BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002D03

Length=574
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_002298520.1|  leucine-rich repeat transmembrane protein ki...    192   3e-54   Populus trichocarpa [western balsam poplar]
ref|XP_011047296.1|  PREDICTED: probable inactive receptor kinase...    192   4e-54   Populus euphratica
ref|XP_002323813.1|  leucine-rich repeat transmembrane protein ki...    192   4e-54   Populus trichocarpa [western balsam poplar]
ref|XP_010091928.1|  putative inactive receptor kinase                  191   1e-53   Morus notabilis
ref|XP_011009041.1|  PREDICTED: probable inactive receptor kinase...    189   4e-53   Populus euphratica
gb|KDP45434.1|  hypothetical protein JCGZ_09683                         189   9e-53   Jatropha curcas
emb|CDP02178.1|  unnamed protein product                                187   2e-52   Coffea canephora [robusta coffee]
ref|XP_004233342.1|  PREDICTED: probable inactive receptor kinase...    187   3e-52   Solanum lycopersicum
ref|XP_010033235.1|  PREDICTED: probable inactive receptor kinase...    186   5e-52   Eucalyptus grandis [rose gum]
gb|EYU34688.1|  hypothetical protein MIMGU_mgv1a026965mg                184   2e-51   Erythranthe guttata [common monkey flower]
ref|XP_006357131.1|  PREDICTED: probable inactive receptor kinase...    184   6e-51   Solanum tuberosum [potatoes]
ref|XP_002517430.1|  BRASSINOSTEROID INSENSITIVE 1-associated rec...    183   7e-51   Ricinus communis
ref|XP_009617928.1|  PREDICTED: probable inactive receptor kinase...    183   8e-51   Nicotiana tomentosiformis
ref|XP_011098550.1|  PREDICTED: probable inactive receptor kinase...    183   1e-50   Sesamum indicum [beniseed]
ref|XP_011085787.1|  PREDICTED: probable inactive receptor kinase...    182   2e-50   Sesamum indicum [beniseed]
gb|KJB40808.1|  hypothetical protein B456_007G077900                    182   2e-50   Gossypium raimondii
gb|KDO72413.1|  hypothetical protein CISIN_1g035917mg                   182   3e-50   Citrus sinensis [apfelsine]
emb|CBI35007.3|  unnamed protein product                                181   3e-50   Vitis vinifera
ref|XP_004232252.1|  PREDICTED: probable inactive receptor kinase...    182   3e-50   Solanum lycopersicum
ref|XP_003633815.1|  PREDICTED: probable inactive receptor kinase...    182   3e-50   Vitis vinifera
ref|XP_006482508.1|  PREDICTED: probable inactive receptor kinase...    182   4e-50   Citrus sinensis [apfelsine]
ref|XP_006431036.1|  hypothetical protein CICLE_v10011313mg             181   5e-50   Citrus clementina [clementine]
gb|KJB11418.1|  hypothetical protein B456_001G257700                    180   9e-50   Gossypium raimondii
gb|KJB33686.1|  hypothetical protein B456_006G026400                    176   2e-49   Gossypium raimondii
ref|XP_007032365.1|  Leucine-rich repeat protein kinase family pr...    177   1e-48   
ref|XP_010528295.1|  PREDICTED: probable inactive receptor kinase...    177   1e-48   Tarenaya hassleriana [spider flower]
ref|XP_006338497.1|  PREDICTED: probable inactive receptor kinase...    177   2e-48   Solanum tuberosum [potatoes]
gb|EPS58697.1|  hypothetical protein M569_16115                         173   2e-48   Genlisea aurea
gb|EYU34129.1|  hypothetical protein MIMGU_mgv1a027001mg                175   7e-48   Erythranthe guttata [common monkey flower]
ref|XP_010272145.1|  PREDICTED: probable inactive receptor kinase...    174   2e-47   Nelumbo nucifera [Indian lotus]
ref|XP_010684872.1|  PREDICTED: probable inactive receptor kinase...    174   2e-47   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004302375.1|  PREDICTED: probable inactive receptor kinase...    173   3e-47   Fragaria vesca subsp. vesca
ref|XP_008389562.1|  PREDICTED: probable inactive receptor kinase...    171   3e-46   Malus domestica [apple tree]
ref|XP_008361793.1|  PREDICTED: probable inactive receptor kinase...    171   3e-46   
ref|NP_189486.1|  leucine-rich repeat protein kinase-like protein       169   1e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009620632.1|  PREDICTED: probable inactive receptor kinase...    169   2e-45   Nicotiana tomentosiformis
ref|XP_009335793.1|  PREDICTED: probable inactive receptor kinase...    169   2e-45   Pyrus x bretschneideri [bai li]
ref|XP_006290709.1|  hypothetical protein CARUB_v10016807mg             168   2e-45   
gb|KFK33740.1|  hypothetical protein AALP_AA5G053600                    168   3e-45   Arabis alpina [alpine rockcress]
ref|XP_008379313.1|  PREDICTED: probable inactive receptor kinase...    168   3e-45   
ref|XP_009360430.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...    168   3e-45   Pyrus x bretschneideri [bai li]
ref|XP_002875454.1|  hypothetical protein ARALYDRAFT_484619             167   3e-45   
gb|KDO82668.1|  hypothetical protein CISIN_1g007423mg                   167   4e-45   Citrus sinensis [apfelsine]
ref|XP_008221489.1|  PREDICTED: probable inactive receptor kinase...    167   7e-45   Prunus mume [ume]
ref|XP_010514548.1|  PREDICTED: probable inactive receptor kinase...    167   7e-45   Camelina sativa [gold-of-pleasure]
ref|XP_008341508.1|  PREDICTED: probable inactive receptor kinase...    167   8e-45   
ref|XP_007222048.1|  hypothetical protein PRUPE_ppa003089mg             167   8e-45   Prunus persica
ref|XP_010425626.1|  PREDICTED: probable inactive receptor kinase...    167   8e-45   Camelina sativa [gold-of-pleasure]
ref|XP_010043841.1|  PREDICTED: probable inactive receptor kinase...    166   1e-44   Eucalyptus grandis [rose gum]
ref|XP_006395364.1|  hypothetical protein EUTSA_v10003844mg             166   1e-44   Eutrema salsugineum [saltwater cress]
ref|XP_010502845.1|  PREDICTED: probable inactive receptor kinase...    166   1e-44   Camelina sativa [gold-of-pleasure]
emb|CDY04020.1|  BnaC02g37350D                                          166   1e-44   
ref|XP_009759220.1|  PREDICTED: probable inactive receptor kinase...    166   2e-44   Nicotiana sylvestris
ref|XP_006438525.1|  hypothetical protein CICLE_v10030999mg             166   2e-44   Citrus clementina [clementine]
ref|XP_002305238.2|  leucine-rich repeat transmembrane protein ki...    166   2e-44   Populus trichocarpa [western balsam poplar]
ref|XP_009115452.1|  PREDICTED: probable inactive receptor kinase...    166   2e-44   Brassica rapa
emb|CDY14686.1|  BnaC05g19430D                                          165   3e-44   Brassica napus [oilseed rape]
emb|CDY16228.1|  BnaA09g29620D                                          164   5e-44   Brassica napus [oilseed rape]
ref|XP_009129373.1|  PREDICTED: probable inactive receptor kinase...    164   8e-44   Brassica rapa
emb|CDY47244.1|  BnaA02g29300D                                          164   8e-44   Brassica napus [oilseed rape]
ref|XP_008353487.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...    164   9e-44   
ref|XP_007151169.1|  hypothetical protein PHAVU_004G023700g             164   9e-44   Phaseolus vulgaris [French bean]
emb|CDX86433.1|  BnaA06g31500D                                          163   1e-43   
gb|KFK44612.1|  hypothetical protein AALP_AA1G281300                    163   1e-43   Arabis alpina [alpine rockcress]
ref|XP_006357223.1|  PREDICTED: probable inactive receptor kinase...    163   2e-43   Solanum tuberosum [potatoes]
ref|XP_009151873.1|  PREDICTED: probable inactive receptor kinase...    163   2e-43   Brassica rapa
ref|XP_010477749.1|  PREDICTED: probable inactive receptor kinase...    162   3e-43   Camelina sativa [gold-of-pleasure]
ref|XP_008230695.1|  PREDICTED: probable inactive receptor kinase...    162   4e-43   Prunus mume [ume]
ref|XP_006303937.1|  hypothetical protein CARUB_v10008631mg             162   5e-43   Capsella rubella
ref|XP_006416011.1|  hypothetical protein EUTSA_v10009684mg             162   5e-43   Eutrema salsugineum [saltwater cress]
ref|XP_004298597.1|  PREDICTED: probable inactive receptor kinase...    161   6e-43   Fragaria vesca subsp. vesca
gb|KDP21268.1|  hypothetical protein JCGZ_21739                         161   6e-43   Jatropha curcas
ref|XP_010498954.1|  PREDICTED: probable inactive receptor kinase...    161   7e-43   Camelina sativa [gold-of-pleasure]
ref|XP_002890616.1|  hypothetical protein ARALYDRAFT_889992             161   7e-43   Arabidopsis lyrata subsp. lyrata
ref|XP_010912844.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...    161   8e-43   
ref|NP_174039.1|  leucine-rich repeat protein kinase family protein     161   8e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010460207.1|  PREDICTED: probable inactive receptor kinase...    160   1e-42   Camelina sativa [gold-of-pleasure]
ref|XP_010683354.1|  PREDICTED: probable inactive receptor kinase...    160   1e-42   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007216971.1|  hypothetical protein PRUPE_ppa003100mg             160   1e-42   Prunus persica
ref|XP_008800372.1|  PREDICTED: probable inactive receptor kinase...    160   1e-42   Phoenix dactylifera
ref|XP_011043889.1|  PREDICTED: probable inactive receptor kinase...    160   2e-42   Populus euphratica
gb|KDO72412.1|  hypothetical protein CISIN_1g040267mg                   159   3e-42   Citrus sinensis [apfelsine]
ref|XP_003580015.1|  PREDICTED: probable inactive receptor kinase...    159   4e-42   Brachypodium distachyon [annual false brome]
ref|XP_006372487.1|  leucine-rich repeat transmembrane protein ki...    159   5e-42   Populus trichocarpa [western balsam poplar]
ref|XP_004148679.1|  PREDICTED: probable inactive receptor kinase...    158   8e-42   Cucumis sativus [cucumbers]
ref|XP_008458707.1|  PREDICTED: probable inactive receptor kinase...    158   1e-41   Cucumis melo [Oriental melon]
ref|XP_009799074.1|  PREDICTED: probable inactive receptor kinase...    158   1e-41   Nicotiana sylvestris
ref|XP_009602624.1|  PREDICTED: probable inactive receptor kinase...    157   1e-41   Nicotiana tomentosiformis
ref|XP_011038318.1|  PREDICTED: probable inactive receptor kinase...    157   3e-41   Populus euphratica
ref|XP_009105677.1|  PREDICTED: probable LRR receptor-like serine...    156   4e-41   Brassica rapa
ref|XP_004238738.1|  PREDICTED: probable inactive receptor kinase...    155   8e-41   Solanum lycopersicum
gb|ABR16721.1|  unknown                                                 155   1e-40   Picea sitchensis
ref|XP_006849112.1|  hypothetical protein AMTR_s00028p00246730          155   1e-40   Amborella trichopoda
gb|KHN34180.1|  Putative inactive receptor kinase                       154   2e-40   Glycine soja [wild soybean]
emb|CDY38780.1|  BnaA07g28520D                                          154   3e-40   Brassica napus [oilseed rape]
ref|XP_002268171.1|  PREDICTED: probable inactive receptor kinase...    153   7e-40   Vitis vinifera
ref|XP_006595242.1|  PREDICTED: probable inactive receptor kinase...    146   8e-40   Glycine max [soybeans]
gb|KFK41423.1|  hypothetical protein AALP_AA2G128900                    152   1e-39   Arabis alpina [alpine rockcress]
ref|NP_177157.1|  putative LRR receptor-like serine/threonine-pro...    152   1e-39   Arabidopsis thaliana [mouse-ear cress]
gb|KHN13260.1|  Putative inactive receptor kinase                       152   2e-39   Glycine soja [wild soybean]
ref|XP_004489358.1|  PREDICTED: probable inactive receptor kinase...    151   3e-39   Cicer arietinum [garbanzo]
ref|NP_001174416.1|  Os05g0399800                                       145   5e-39   
ref|XP_002446698.1|  hypothetical protein SORBIDRAFT_06g020750          150   5e-39   Sorghum bicolor [broomcorn]
gb|EAY97968.1|  hypothetical protein OsI_19886                          144   1e-38   Oryza sativa Indica Group [Indian rice]
ref|XP_006653547.1|  PREDICTED: probable inactive receptor kinase...    149   1e-38   Oryza brachyantha
ref|XP_007044441.1|  Leucine-rich repeat protein kinase family pr...    149   1e-38   
ref|XP_010415671.1|  PREDICTED: probable LRR receptor-like serine...    147   5e-38   Camelina sativa [gold-of-pleasure]
ref|XP_009385796.1|  PREDICTED: probable inactive receptor kinase...    147   5e-38   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010098246.1|  putative inactive receptor kinase                  147   5e-38   
ref|XP_002888749.1|  hypothetical protein ARALYDRAFT_894788             147   7e-38   Arabidopsis lyrata subsp. lyrata
ref|XP_009342387.1|  PREDICTED: probably inactive leucine-rich re...    141   8e-38   Pyrus x bretschneideri [bai li]
ref|XP_003618423.1|  LRR receptor-like serine/threonine-protein k...    147   1e-37   Medicago truncatula
ref|XP_007151168.1|  hypothetical protein PHAVU_004G023600g             142   1e-37   Phaseolus vulgaris [French bean]
gb|AEW22944.1|  leucine-rich repeat receptor-like protein kinase        145   2e-37   Cenchrus ciliaris [African foxtail grass]
ref|XP_010532925.1|  PREDICTED: probable inactive receptor kinase...    145   2e-37   Tarenaya hassleriana [spider flower]
ref|NP_001053144.1|  Os04g0487200                                       145   4e-37   
gb|ABR16056.1|  unknown                                                 144   5e-37   Picea sitchensis
ref|XP_008669246.1|  PREDICTED: probable inactive receptor kinase...    144   8e-37   Zea mays [maize]
gb|AFW58657.1|  putative leucine-rich repeat transmembrane protei...    144   8e-37   
ref|XP_007213020.1|  hypothetical protein PRUPE_ppa023044mg             136   1e-36   
dbj|BAK03355.1|  predicted protein                                      144   1e-36   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009600980.1|  PREDICTED: probably inactive leucine-rich re...    142   3e-36   Nicotiana tomentosiformis
ref|XP_010551471.1|  PREDICTED: probable inactive receptor kinase...    142   3e-36   Tarenaya hassleriana [spider flower]
ref|XP_009406402.1|  PREDICTED: probable inactive receptor kinase...    140   2e-35   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY11627.1|  BnaC06g31120D                                          140   2e-35   Brassica napus [oilseed rape]
gb|AES90509.2|  LRR receptor-like kinase family protein, putative       140   3e-35   Medicago truncatula
ref|XP_003608312.1|  Receptor-like-kinase                               140   3e-35   
dbj|BAI94492.1|  receptor-like kinase                                   139   9e-35   Dianthus caryophyllus [carnation]
gb|KJB31374.1|  hypothetical protein B456_005G188100                    138   1e-34   Gossypium raimondii
ref|XP_010109951.1|  Probably inactive leucine-rich repeat recept...    134   1e-34   
gb|AGI92776.1|  RLP1.801.4                                              134   2e-34   Triticum aestivum [Canadian hard winter wheat]
ref|XP_007028124.1|  BAK1-interacting receptor-like kinase 1 isof...    137   5e-34   Theobroma cacao [chocolate]
ref|XP_010242455.1|  PREDICTED: probably inactive leucine-rich re...    136   6e-34   Nelumbo nucifera [Indian lotus]
gb|AGI92774.1|  RLP1.801.2                                              132   8e-34   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010673854.1|  PREDICTED: probably inactive leucine-rich re...    135   9e-34   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB75784.1|  hypothetical protein B456_012G058000                    135   1e-33   Gossypium raimondii
ref|XP_006584947.1|  PREDICTED: probably inactive leucine-rich re...    135   1e-33   
gb|EYU46077.1|  hypothetical protein MIMGU_mgv1a002955mg                135   2e-33   Erythranthe guttata [common monkey flower]
ref|XP_011089586.1|  PREDICTED: probably inactive leucine-rich re...    135   2e-33   Sesamum indicum [beniseed]
ref|XP_007134301.1|  hypothetical protein PHAVU_010G035800g             135   2e-33   Phaseolus vulgaris [French bean]
ref|XP_010242501.1|  PREDICTED: probably inactive leucine-rich re...    131   2e-33   
ref|XP_004492888.1|  PREDICTED: probably inactive leucine-rich re...    134   3e-33   
gb|KHN22142.1|  Probably inactive leucine-rich repeat receptor-li...    134   3e-33   Glycine soja [wild soybean]
ref|XP_004510191.1|  PREDICTED: probably inactive leucine-rich re...    134   3e-33   Cicer arietinum [garbanzo]
ref|XP_003534491.1|  PREDICTED: probably inactive leucine-rich re...    134   3e-33   Glycine max [soybeans]
ref|XP_006301045.1|  hypothetical protein CARUB_v10021437mg             134   4e-33   Capsella rubella
ref|XP_006390935.1|  hypothetical protein EUTSA_v10018330mg             134   5e-33   Eutrema salsugineum [saltwater cress]
ref|XP_006366814.1|  PREDICTED: probably inactive leucine-rich re...    134   6e-33   Solanum tuberosum [potatoes]
emb|CBI23354.3|  unnamed protein product                                134   7e-33   Vitis vinifera
ref|XP_002267164.2|  PREDICTED: probably inactive leucine-rich re...    133   7e-33   Vitis vinifera
ref|XP_006342429.1|  PREDICTED: probably inactive leucine-rich re...    133   8e-33   Solanum tuberosum [potatoes]
ref|XP_010101366.1|  Probably inactive leucine-rich repeat recept...    136   8e-33   
ref|XP_010512071.1|  PREDICTED: probable LRR receptor-like serine...    133   9e-33   Camelina sativa [gold-of-pleasure]
gb|AGI92775.1|  RLP1.801.3                                              129   9e-33   Triticum aestivum [Canadian hard winter wheat]
gb|AGI92772.1|  RLP1.1                                                  129   9e-33   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002527290.1|  ATP binding protein, putative                      130   1e-32   
gb|AGI92777.1|  RLP1.801.5                                              129   1e-32   Triticum aestivum [Canadian hard winter wheat]
gb|KJB10818.1|  hypothetical protein B456_001G226700                    132   2e-32   Gossypium raimondii
ref|XP_010088605.1|  Probably inactive leucine-rich repeat recept...    132   2e-32   Morus notabilis
ref|XP_010471000.1|  PREDICTED: probable LRR receptor-like serine...    132   2e-32   Camelina sativa [gold-of-pleasure]
emb|CDP03993.1|  unnamed protein product                                132   2e-32   Coffea canephora [robusta coffee]
ref|XP_010547175.1|  PREDICTED: probably inactive leucine-rich re...    132   2e-32   Tarenaya hassleriana [spider flower]
ref|XP_003624238.1|  Probably inactive leucine-rich repeat recept...    132   2e-32   Medicago truncatula
ref|XP_008356285.1|  PREDICTED: probably inactive leucine-rich re...    128   2e-32   
ref|XP_009619663.1|  PREDICTED: probably inactive leucine-rich re...    132   2e-32   Nicotiana tomentosiformis
ref|XP_007139688.1|  hypothetical protein PHAVU_008G050700g             132   2e-32   Phaseolus vulgaris [French bean]
ref|XP_004242451.1|  PREDICTED: probably inactive leucine-rich re...    132   2e-32   Solanum lycopersicum
ref|XP_010053967.1|  PREDICTED: probably inactive leucine-rich re...    127   2e-32   Eucalyptus grandis [rose gum]
gb|KHN40510.1|  Probably inactive leucine-rich repeat receptor-li...    132   2e-32   Glycine soja [wild soybean]
ref|XP_006601824.1|  PREDICTED: probably inactive leucine-rich re...    132   3e-32   Glycine max [soybeans]
gb|KDP45204.1|  hypothetical protein JCGZ_15069                         127   3e-32   Jatropha curcas
ref|XP_010053969.1|  PREDICTED: probably inactive leucine-rich re...    126   3e-32   Eucalyptus grandis [rose gum]
ref|XP_009615340.1|  PREDICTED: probably inactive leucine-rich re...    131   4e-32   
emb|CDY05685.1|  BnaC02g38520D                                          131   4e-32   
gb|EMT19838.1|  Putative LRR receptor-like serine/threonine-prote...    127   4e-32   
ref|XP_009406423.1|  PREDICTED: probably inactive leucine-rich re...    131   4e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006343705.1|  PREDICTED: probably inactive leucine-rich re...    127   4e-32   
ref|XP_010911215.1|  PREDICTED: probably inactive leucine-rich re...    131   4e-32   Elaeis guineensis
ref|XP_006378629.1|  hypothetical protein POPTR_0010s18540g             131   5e-32   
ref|XP_009799665.1|  PREDICTED: probably inactive leucine-rich re...    131   5e-32   Nicotiana sylvestris
ref|XP_009784192.1|  PREDICTED: probably inactive leucine-rich re...    130   6e-32   Nicotiana sylvestris
ref|NP_001143239.1|  uncharacterized protein LOC100275764 precursor     130   6e-32   
ref|XP_010679004.1|  PREDICTED: probably inactive leucine-rich re...    130   7e-32   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009767841.1|  PREDICTED: probably inactive leucine-rich re...    130   7e-32   Nicotiana sylvestris
gb|KEH18041.1|  LRR receptor-like kinase                                130   8e-32   Medicago truncatula
ref|XP_010251401.1|  PREDICTED: probably inactive leucine-rich re...    130   8e-32   Nelumbo nucifera [Indian lotus]
ref|XP_010037082.1|  PREDICTED: probably inactive leucine-rich re...    130   9e-32   Eucalyptus grandis [rose gum]
ref|NP_001239701.1|  probably inactive leucine-rich repeat recept...    130   9e-32   Glycine max [soybeans]
ref|XP_009406422.1|  PREDICTED: probably inactive leucine-rich re...    131   1e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007159203.1|  hypothetical protein PHAVU_002G217900g             130   1e-31   Phaseolus vulgaris [French bean]
gb|KFK25890.1|  hypothetical protein AALP_AA8G175500                    125   1e-31   Arabis alpina [alpine rockcress]
dbj|BAJ86446.1|  predicted protein                                      130   1e-31   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006372666.1|  hypothetical protein POPTR_0017s03660g             129   1e-31   
gb|AGI92778.1|  RLP1.804.1                                              125   2e-31   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006372658.1|  hypothetical protein POPTR_0017s036302g            124   2e-31   
ref|XP_004253035.2|  PREDICTED: probably inactive leucine-rich re...    129   2e-31   
ref|XP_010314784.1|  PREDICTED: probably inactive leucine-rich re...    129   2e-31   
ref|XP_010314786.1|  PREDICTED: probably inactive leucine-rich re...    129   2e-31   
ref|XP_010314785.1|  PREDICTED: probably inactive leucine-rich re...    129   2e-31   
gb|EMS46984.1|  hypothetical protein TRIUR3_06204                       125   2e-31   Triticum urartu
gb|EMT17156.1|  Putative LRR receptor-like serine/threonine-prote...    125   2e-31   
ref|XP_011013756.1|  PREDICTED: probably inactive leucine-rich re...    129   3e-31   Populus euphratica
ref|XP_011004566.1|  PREDICTED: probably inactive leucine-rich re...    129   3e-31   Populus euphratica
ref|XP_004161543.1|  PREDICTED: LOW QUALITY PROTEIN: probably ina...    129   3e-31   
ref|XP_008447262.1|  PREDICTED: probably inactive leucine-rich re...    129   4e-31   Cucumis melo [Oriental melon]
ref|XP_009416988.1|  PREDICTED: probably inactive leucine-rich re...    129   4e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010095584.1|  Probably inactive leucine-rich repeat recept...    128   6e-31   
ref|XP_007049531.1|  Probably inactive leucine-rich repeat recept...    128   6e-31   
ref|NP_001238083.1|  protein kinase precursor                           127   7e-31   Glycine max [soybeans]
emb|CBI23562.3|  unnamed protein product                                128   7e-31   Vitis vinifera
ref|XP_004148962.1|  PREDICTED: probably inactive leucine-rich re...    128   7e-31   Cucumis sativus [cucumbers]
dbj|BAJ87832.1|  predicted protein                                      124   8e-31   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003635622.1|  PREDICTED: probably inactive leucine-rich re...    128   9e-31   Vitis vinifera
ref|XP_006598679.1|  PREDICTED: protein kinase isoform X1               127   9e-31   Glycine max [soybeans]
ref|XP_008788252.1|  PREDICTED: probably inactive leucine-rich re...    127   1e-30   Phoenix dactylifera
ref|XP_011010442.1|  PREDICTED: probably inactive leucine-rich re...    127   1e-30   Populus euphratica
ref|XP_002529807.1|  serine-threonine protein kinase, plant-type,...    127   1e-30   
gb|KDP33138.1|  hypothetical protein JCGZ_13530                         127   1e-30   Jatropha curcas
ref|XP_008359394.1|  PREDICTED: probable inactive receptor kinase...    121   1e-30   Malus domestica [apple tree]
ref|XP_006372665.1|  hypothetical protein POPTR_0017s03660g             126   1e-30   
gb|AGI92779.1|  RLP1.804.2                                              123   1e-30   Triticum aestivum [Canadian hard winter wheat]
gb|EMT26982.1|  Putative inactive receptor kinase                       127   1e-30   
ref|XP_006372662.1|  hypothetical protein POPTR_0017s036502g            124   1e-30   
gb|KJB42638.1|  hypothetical protein B456_007G161400                    127   1e-30   Gossypium raimondii
ref|XP_004161544.1|  PREDICTED: probably inactive leucine-rich re...    122   1e-30   
ref|XP_007200419.1|  hypothetical protein PRUPE_ppa011049mg             122   2e-30   Prunus persica
ref|XP_004148961.1|  PREDICTED: probably inactive leucine-rich re...    122   2e-30   
dbj|BAJ33754.1|  unnamed protein product                                127   2e-30   Eutrema halophilum
emb|CAN63265.1|  hypothetical protein VITISV_037939                     126   2e-30   Vitis vinifera
emb|CDM85413.1|  unnamed protein product                                122   3e-30   Triticum aestivum [Canadian hard winter wheat]
gb|KGN44709.1|  hypothetical protein Csa_7G373520                       121   3e-30   Cucumis sativus [cucumbers]
ref|XP_010908584.1|  PREDICTED: probably inactive leucine-rich re...    126   3e-30   Elaeis guineensis
gb|KDO37775.1|  hypothetical protein CISIN_1g042065mg                   120   3e-30   Citrus sinensis [apfelsine]
ref|XP_006395190.1|  hypothetical protein EUTSA_v10003825mg             126   4e-30   
emb|CDX70708.1|  BnaC03g07920D                                          123   5e-30   
ref|XP_009124570.1|  PREDICTED: probably inactive leucine-rich re...    121   5e-30   Brassica rapa
ref|XP_006828241.1|  hypothetical protein AMTR_s00023p00191140          120   6e-30   Amborella trichopoda
ref|XP_009132248.1|  PREDICTED: probably inactive leucine-rich re...    120   8e-30   Brassica rapa
ref|XP_004250582.1|  PREDICTED: F-box protein At3g07870-like            124   9e-30   
ref|XP_008382758.1|  PREDICTED: probably inactive leucine-rich re...    119   1e-29   
emb|CDY48749.1|  BnaA02g30100D                                          124   1e-29   Brassica napus [oilseed rape]
emb|CDY07991.1|  BnaC03g35320D                                          120   1e-29   Brassica napus [oilseed rape]
ref|XP_008779573.1|  PREDICTED: LOW QUALITY PROTEIN: probably ina...    124   2e-29   
gb|KJB40809.1|  hypothetical protein B456_007G077900                    123   2e-29   Gossypium raimondii
gb|KDO43522.1|  hypothetical protein CISIN_1g006982mg                   124   2e-29   Citrus sinensis [apfelsine]
ref|XP_006447934.1|  hypothetical protein CICLE_v10014610mg             124   2e-29   Citrus clementina [clementine]
ref|XP_006379646.1|  hypothetical protein POPTR_0008s07830g             124   3e-29   
ref|XP_011015307.1|  PREDICTED: probably inactive leucine-rich re...    123   4e-29   Populus euphratica
ref|XP_009151638.1|  PREDICTED: probably inactive leucine-rich re...    123   5e-29   Brassica rapa
ref|XP_008801014.1|  PREDICTED: probably inactive leucine-rich re...    122   6e-29   Phoenix dactylifera
ref|XP_011024726.1|  PREDICTED: probably inactive leucine-rich re...    122   6e-29   Populus euphratica
ref|XP_009342403.1|  PREDICTED: probably inactive leucine-rich re...    119   7e-29   Pyrus x bretschneideri [bai li]
gb|EMT01778.1|  Putative LRR receptor-like serine/threonine-prote...    119   1e-28   
ref|XP_010037095.1|  PREDICTED: probably inactive leucine-rich re...    122   1e-28   Eucalyptus grandis [rose gum]
ref|XP_006386865.1|  hypothetical protein POPTR_0002s24100g             122   1e-28   Populus trichocarpa [western balsam poplar]
ref|XP_008382757.1|  PREDICTED: probably inactive leucine-rich re...    119   1e-28   
ref|XP_011467436.1|  PREDICTED: probably inactive leucine-rich re...    121   1e-28   Fragaria vesca subsp. vesca
ref|XP_011015926.1|  PREDICTED: probably inactive leucine-rich re...    122   1e-28   Populus euphratica
ref|XP_008372669.1|  PREDICTED: probably inactive leucine-rich re...    122   1e-28   
ref|XP_009607588.1|  PREDICTED: probably inactive leucine-rich re...    121   1e-28   Nicotiana tomentosiformis
ref|XP_008356275.1|  PREDICTED: probably inactive leucine-rich re...    122   1e-28   
ref|XP_010456552.1|  PREDICTED: probably inactive leucine-rich re...    118   2e-28   Camelina sativa [gold-of-pleasure]
ref|XP_010424129.1|  PREDICTED: probably inactive leucine-rich re...    117   2e-28   Camelina sativa [gold-of-pleasure]
ref|XP_002450551.1|  hypothetical protein SORBIDRAFT_05g006860          121   2e-28   Sorghum bicolor [broomcorn]
gb|EEC79229.1|  hypothetical protein OsI_19968                          122   2e-28   Oryza sativa Indica Group [Indian rice]
ref|XP_006372679.1|  hypothetical protein POPTR_0017s03800g             120   2e-28   
ref|XP_008235927.1|  PREDICTED: probably inactive leucine-rich re...    117   2e-28   
ref|XP_009342388.1|  PREDICTED: probably inactive leucine-rich re...    121   2e-28   Pyrus x bretschneideri [bai li]
ref|XP_009129721.1|  PREDICTED: LOW QUALITY PROTEIN: probably ina...    121   2e-28   
ref|XP_008235867.1|  PREDICTED: probably inactive leucine-rich re...    116   3e-28   
emb|CDP06295.1|  unnamed protein product                                120   3e-28   Coffea canephora [robusta coffee]
ref|XP_009595674.1|  PREDICTED: probably inactive leucine-rich re...    120   3e-28   Nicotiana tomentosiformis
ref|XP_007200215.1|  hypothetical protein PRUPE_ppa015531mg             116   3e-28   
ref|XP_004290111.1|  PREDICTED: probably inactive leucine-rich re...    120   4e-28   Fragaria vesca subsp. vesca
ref|XP_006400208.1|  hypothetical protein EUTSA_v10015945mg             116   4e-28   
ref|XP_004242658.1|  PREDICTED: probably inactive leucine-rich re...    120   4e-28   
ref|XP_008235929.1|  PREDICTED: probably inactive leucine-rich re...    117   4e-28   
gb|AGI92781.1|  RLP1.804.4                                              116   4e-28   Triticum aestivum [Canadian hard winter wheat]
emb|CDX85334.1|  BnaC07g26450D                                          120   5e-28   
ref|XP_004305754.2|  PREDICTED: probably inactive leucine-rich re...    120   5e-28   
ref|XP_006343707.1|  PREDICTED: probably inactive leucine-rich re...    119   5e-28   
ref|XP_006280968.1|  hypothetical protein CARUB_v10026969mg             116   5e-28   
gb|AGI92780.1|  RLP1.804.3                                              116   6e-28   
ref|XP_009132249.1|  PREDICTED: probably inactive leucine-rich re...    115   6e-28   
emb|CDY38095.1|  BnaC02g06780D                                          116   6e-28   
ref|XP_008382538.1|  PREDICTED: probably inactive leucine-rich re...    120   6e-28   
ref|XP_006356492.1|  PREDICTED: probably inactive leucine-rich re...    119   6e-28   
emb|CDM85411.1|  unnamed protein product                                116   7e-28   
ref|XP_006343706.1|  PREDICTED: probably inactive leucine-rich re...    118   8e-28   
emb|CDY38092.1|  BnaC02g06810D                                          115   1e-27   
ref|XP_006654407.1|  PREDICTED: probably inactive leucine-rich re...    119   1e-27   
ref|XP_002441100.1|  hypothetical protein SORBIDRAFT_09g020410          119   1e-27   
gb|ACN26668.1|  unknown                                                 119   1e-27   
gb|AFW78014.1|  putative leucine-rich repeat transmembrane protei...    119   2e-27   
ref|XP_009358936.1|  PREDICTED: probably inactive leucine-rich re...    118   2e-27   
ref|XP_009126335.1|  PREDICTED: probably inactive leucine-rich re...    114   2e-27   
gb|AGI92782.1|  RLP1.813                                                114   3e-27   
ref|XP_002865632.1|  hypothetical protein ARALYDRAFT_357041             114   3e-27   
gb|AAN60365.1|  unknown                                                 117   4e-27   
gb|AAL32637.1|  receptor-like protein kinase                            117   4e-27   
ref|NP_568696.1|  BAK1-interacting receptor-like kinase BIR1            117   4e-27   
ref|NP_001147794.1|  BRASSINOSTEROID INSENSITIVE 1-associated rec...    117   4e-27   
gb|KDP45203.1|  hypothetical protein JCGZ_15068                         117   5e-27   
ref|NP_001055553.2|  Os05g0414700                                       117   5e-27   
gb|AAT94042.1|  putative protein kinase                                 117   6e-27   
ref|XP_011459718.1|  PREDICTED: probably inactive leucine-rich re...    111   6e-27   
ref|XP_007201733.1|  hypothetical protein PRUPE_ppa002865mg             117   6e-27   
ref|XP_010493653.1|  PREDICTED: probably inactive leucine-rich re...    112   6e-27   
ref|XP_008235928.1|  PREDICTED: probably inactive leucine-rich re...    112   7e-27   
ref|XP_002865631.1|  hypothetical protein ARALYDRAFT_494891             117   8e-27   
ref|XP_008235868.1|  PREDICTED: probably inactive leucine-rich re...    117   9e-27   
ref|XP_007199029.1|  hypothetical protein PRUPE_ppa017910mg             112   1e-26   
gb|AAB61113.1|  Similar to Arabidopsis receptor-like protein kina...    115   1e-26   
gb|ACN31332.1|  unknown                                                 116   1e-26   
ref|XP_003568447.1|  PREDICTED: probably inactive leucine-rich re...    115   2e-26   
ref|XP_006645152.1|  PREDICTED: probably inactive leucine-rich re...    112   2e-26   
gb|KDP33141.1|  hypothetical protein JCGZ_13533                         112   2e-26   
ref|XP_002962193.1|  hypothetical protein SELMODRAFT_77054              116   2e-26   
ref|XP_010495233.1|  PREDICTED: probably inactive leucine-rich re...    110   2e-26   
ref|XP_002965106.1|  hypothetical protein SELMODRAFT_83773              116   2e-26   
ref|XP_006280190.1|  hypothetical protein CARUB_v10026094mg             115   4e-26   
ref|XP_009134974.1|  PREDICTED: probably inactive leucine-rich re...    111   5e-26   
ref|XP_003532578.2|  PREDICTED: probably inactive leucine-rich re...    114   6e-26   
ref|XP_011013757.1|  PREDICTED: probably inactive leucine-rich re...    114   6e-26   
ref|XP_011004567.1|  PREDICTED: probably inactive leucine-rich re...    114   6e-26   
ref|XP_006448523.1|  hypothetical protein CICLE_v10014622mg             114   6e-26   
dbj|BAA96958.1|  receptor-like protein kinase                           114   8e-26   
ref|XP_010525273.1|  PREDICTED: probably inactive leucine-rich re...    110   9e-26   
ref|XP_006372671.1|  hypothetical protein POPTR_0017s03710g             114   1e-25   
ref|XP_004970860.1|  PREDICTED: probably inactive leucine-rich re...    110   1e-25   
emb|CDM85370.1|  unnamed protein product                                110   1e-25   
ref|XP_006468634.1|  PREDICTED: probably inactive leucine-rich re...    113   1e-25   
ref|XP_007200186.1|  hypothetical protein PRUPE_ppa016209mg             111   2e-25   
emb|CAN68144.1|  hypothetical protein VITISV_035661                     112   2e-25   
ref|XP_004962081.1|  PREDICTED: probably inactive leucine-rich re...    112   2e-25   
gb|EMT17153.1|  Putative LRR receptor-like serine/threonine-prote...    107   2e-25   
emb|CDM85405.1|  unnamed protein product                                109   3e-25   
gb|AGI92773.1|  RLP1.738                                                108   4e-25   
ref|NP_001045059.1|  Os01g0892300                                       108   4e-25   
gb|EMT24743.1|  Putative inactive receptor kinase                       107   6e-25   
gb|EMT06892.1|  Putative LRR receptor-like serine/threonine-prote...    108   7e-25   
ref|XP_010442258.1|  PREDICTED: probably inactive leucine-rich re...    108   8e-25   
ref|XP_006858332.1|  hypothetical protein AMTR_s00064p00147190          110   1e-24   
gb|EMT29216.1|  Putative inactive receptor kinase                       110   2e-24   
ref|XP_002980343.1|  hypothetical protein SELMODRAFT_112289             110   2e-24   
ref|XP_001774216.1|  predicted protein                                  109   3e-24   
ref|XP_010493657.1|  PREDICTED: probably inactive leucine-rich re...    109   4e-24   
gb|EAZ17993.1|  hypothetical protein OsJ_33541                          109   5e-24   
gb|AAX95167.1|  receptor-like protein kinase                            108   7e-24   
gb|EMT09681.1|  Putative inactive receptor kinase                       103   7e-24   
gb|EMT18342.1|  Putative LRR receptor-like serine/threonine-prote...    105   8e-24   
ref|XP_002962989.1|  hypothetical protein SELMODRAFT_165616             108   8e-24   
emb|CBI24746.3|  unnamed protein product                                105   1e-23   
ref|XP_002315108.2|  hypothetical protein POPTR_0010s18550g             108   1e-23   
gb|EMT18343.1|  Putative inactive receptor kinase                       106   1e-23   
ref|XP_010482086.1|  PREDICTED: probably inactive leucine-rich re...    107   1e-23   
gb|EMT17157.1|  Putative LRR receptor-like serine/threonine-prote...    103   3e-23   
gb|EMT17152.1|  Putative inactive receptor kinase                       101   3e-23   
ref|NP_001151988.1|  brassinosteroid LRR receptor kinase precursor      106   5e-23   
tpg|DAA41892.1|  TPA: putative leucine-rich repeat transmembrane ...    105   6e-23   
ref|XP_002275677.1|  PREDICTED: probably inactive leucine-rich re...    106   6e-23   
ref|XP_006662858.1|  PREDICTED: probably inactive leucine-rich re...    105   6e-23   
ref|XP_002456769.1|  hypothetical protein SORBIDRAFT_03g042370          102   6e-23   
ref|XP_004978965.1|  PREDICTED: probably inactive leucine-rich re...    105   7e-23   
gb|EAY76795.1|  hypothetical protein OsI_04752                          103   7e-23   
ref|NP_001045056.2|  Os01g0891500                                       102   1e-22   
ref|NP_001045057.1|  Os01g0891700                                       102   1e-22   
ref|XP_002962990.1|  hypothetical protein SELMODRAFT_404473             100   2e-22   
ref|XP_003577638.1|  PREDICTED: probably inactive leucine-rich re...    104   2e-22   
ref|XP_006288478.1|  hypothetical protein CARUB_v10001738mg             100   4e-22   
ref|XP_006387318.1|  hypothetical protein POPTR_1276s002001g          99.0    4e-22   
ref|XP_006372284.1|  hypothetical protein POPTR_0017s00200g             101   6e-22   
ref|XP_008673646.1|  PREDICTED: probably inactive leucine-rich re...  99.4    1e-21   
ref|XP_010482085.1|  PREDICTED: probably inactive leucine-rich re...  97.4    4e-21   
ref|XP_002529809.1|  serine-threonine protein kinase, plant-type,...    100   4e-21   
ref|XP_002960437.1|  hypothetical protein SELMODRAFT_164132             100   8e-21   
emb|CDX69430.1|  BnaA10g17790D                                        96.7    9e-21   
ref|XP_002967283.1|  hypothetical protein SELMODRAFT_87671            99.8    9e-21   
ref|XP_001776665.1|  predicted protein                                99.4    1e-20   
ref|XP_009122865.1|  PREDICTED: probably inactive leucine-rich re...  95.5    2e-20   
dbj|BAF79937.1|  receptor-like kinase                                 98.6    3e-20   
ref|XP_002962585.1|  hypothetical protein SELMODRAFT_26690            93.2    4e-20   
emb|CBI32063.3|  unnamed protein product                              95.5    6e-20   
gb|KCW65553.1|  hypothetical protein EUGRSUZ_G02950                   93.6    9e-20   
ref|XP_011010589.1|  PREDICTED: probably inactive leucine-rich re...  96.7    1e-19   
ref|XP_002980502.1|  hypothetical protein SELMODRAFT_16597            91.7    1e-19   
ref|XP_010493656.1|  PREDICTED: probably inactive leucine-rich re...  90.9    2e-19   
ref|XP_003608311.1|  LRR receptor-like protein kinase                 95.1    3e-19   
ref|XP_010650777.1|  PREDICTED: probably inactive leucine-rich re...  94.0    1e-18   
ref|XP_002883614.1|  hypothetical protein ARALYDRAFT_480045           93.6    1e-18   
gb|EEE55789.1|  hypothetical protein OsJ_04371                        92.4    1e-18   
gb|EEC71938.1|  hypothetical protein OsI_04750                        91.7    2e-18   
ref|XP_001751680.1|  predicted protein                                92.4    3e-18   
ref|XP_006379647.1|  hypothetical protein POPTR_0008s07830g           92.0    4e-18   
ref|XP_009411327.1|  PREDICTED: probable inactive receptor kinase...  89.7    4e-18   
gb|ABK22665.1|  unknown                                               89.0    8e-18   
ref|XP_009394292.1|  PREDICTED: leucine-rich repeat receptor-like...  88.6    9e-18   
ref|XP_004978090.1|  PREDICTED: probable inactive receptor kinase...  90.1    2e-17   
ref|XP_006291633.1|  hypothetical protein CARUB_v10017786mg           87.4    2e-17   
ref|XP_006393981.1|  hypothetical protein EUTSA_v10005320mg           87.4    2e-17   
ref|XP_007148302.1|  hypothetical protein PHAVU_006G197000g           89.7    2e-17   
gb|EMT26063.1|  Putative LRR receptor-like serine/threonine-prote...  85.5    4e-17   
ref|XP_002980342.1|  hypothetical protein SELMODRAFT_112687           85.9    4e-17   
ref|XP_006404105.1|  hypothetical protein EUTSA_v10010947mg           86.3    9e-17   
gb|EMT12771.1|  Mitogen-activated protein kinase 12                   88.6    1e-16   
ref|XP_010515338.1|  PREDICTED: probable inactive receptor kinase...  85.5    1e-16   
ref|XP_010463652.1|  PREDICTED: probable inactive receptor kinase...  85.1    1e-16   
ref|XP_010232678.1|  PREDICTED: probable inactive receptor kinase...  85.5    1e-16   
gb|EYU41369.1|  hypothetical protein MIMGU_mgv1a011773mg              85.1    1e-16   
ref|XP_009339384.1|  PREDICTED: probable inactive receptor kinase...  84.7    2e-16   
emb|CDY05959.1|  BnaC08g21360D                                        84.7    2e-16   
ref|XP_010503642.1|  PREDICTED: probable inactive receptor kinase...  84.7    2e-16   
ref|XP_008393057.1|  PREDICTED: probable LRR receptor-like serine...  84.7    2e-16   
ref|XP_010484431.1|  PREDICTED: probable LRR receptor-like serine...  84.3    3e-16   
gb|KFK34242.1|  hypothetical protein AALP_AA5G119700                  84.3    3e-16   
ref|XP_009601000.1|  PREDICTED: probably inactive leucine-rich re...  86.7    3e-16   
ref|XP_010426501.1|  PREDICTED: probable inactive receptor kinase...  83.6    4e-16   
emb|CDY16992.1|  BnaC09g41190D                                        82.8    4e-16   
ref|XP_010559281.1|  PREDICTED: probable inactive receptor kinase...  83.6    4e-16   
ref|XP_009101260.1|  PREDICTED: probable inactive receptor kinase...  83.6    5e-16   
ref|XP_008788253.1|  PREDICTED: probably inactive leucine-rich re...  85.9    5e-16   
ref|NP_190544.1|  receptor like protein 44                            83.2    5e-16   
ref|XP_001776559.1|  predicted protein                                83.6    6e-16   
ref|XP_006280935.1|  hypothetical protein CARUB_v10026933mg           83.2    6e-16   
ref|XP_002877697.1|  leucine-rich repeat family protein               82.8    9e-16   
gb|EYU44523.1|  hypothetical protein MIMGU_mgv1a022454mg              82.0    1e-15   
ref|XP_004974286.1|  PREDICTED: probably inactive leucine-rich re...  82.4    1e-15   
ref|XP_006466423.1|  PREDICTED: LRR receptor-like serine/threonin...  82.4    1e-15   
gb|KDO78860.1|  hypothetical protein CISIN_1g024203mg                 82.0    1e-15   
gb|KDO78861.1|  hypothetical protein CISIN_1g024203mg                 82.0    1e-15   
gb|EAZ31160.1|  hypothetical protein OsJ_15259                        84.7    1e-15   
ref|XP_006426140.1|  hypothetical protein CICLE_v10026270mg           82.0    1e-15   
ref|XP_010106894.1|  hypothetical protein L484_012987                 81.6    2e-15   
emb|CBI41043.3|  unnamed protein product                              81.6    2e-15   
ref|XP_002265055.1|  PREDICTED: probable inactive receptor kinase...  81.6    2e-15   
ref|XP_007047606.1|  Receptor like protein 44 isoform 1               81.6    2e-15   
gb|KJB48768.1|  hypothetical protein B456_008G086100                  81.3    2e-15   
ref|XP_010068891.1|  PREDICTED: probable inactive receptor kinase...  80.9    3e-15   
gb|AAM62916.1|  unknown                                               81.3    3e-15   
ref|XP_007047607.1|  Receptor like protein 44 isoform 2               81.3    3e-15   
gb|KJB43964.1|  hypothetical protein B456_007G226700                  81.3    3e-15   
ref|XP_004231949.1|  PREDICTED: probable LRR receptor-like serine...  80.9    4e-15   
gb|EAZ43829.1|  hypothetical protein OsJ_28447                        80.9    4e-15   
emb|CDX85197.1|  BnaC07g25080D                                        80.1    5e-15   
gb|KHN19056.1|  Probably inactive leucine-rich repeat receptor-li...  82.4    6e-15   
ref|NP_201384.1|  receptor like protein 57                            80.5    6e-15   
ref|XP_008354731.1|  PREDICTED: probable LRR receptor-like serine...  80.5    6e-15   
ref|XP_002965447.1|  hypothetical protein SELMODRAFT_67606            80.1    6e-15   
ref|XP_002984543.1|  hypothetical protein SELMODRAFT_47607            79.7    8e-15   
ref|XP_008237444.1|  PREDICTED: probable inactive receptor kinase...  80.1    8e-15   
ref|XP_010939348.1|  PREDICTED: probable LRR receptor-like serine...  80.1    8e-15   
ref|XP_006363800.1|  PREDICTED: probable LRR receptor-like serine...  79.3    1e-14   
gb|KDP33139.1|  hypothetical protein JCGZ_13531                       81.3    1e-14   
ref|XP_001758290.1|  predicted protein                                79.3    1e-14   
ref|XP_002520188.1|  conserved hypothetical protein                   80.9    1e-14   
ref|XP_007205703.1|  hypothetical protein PRUPE_ppa009836mg           79.3    1e-14   
ref|XP_009362609.1|  PREDICTED: probable inactive receptor kinase...  79.3    1e-14   
dbj|BAJ94386.1|  predicted protein                                    81.3    2e-14   
ref|NP_001062623.1|  Os09g0131200                                     79.0    2e-14   
ref|XP_011073668.1|  PREDICTED: LOW QUALITY PROTEIN: probably ina...  78.6    2e-14   
ref|XP_008785726.1|  PREDICTED: leucine-rich repeat receptor-like...  78.6    2e-14   
gb|EPS74269.1|  hypothetical protein M569_00488                       78.6    3e-14   
ref|XP_008790267.1|  PREDICTED: probable LRR receptor-like serine...  78.6    3e-14   
ref|XP_004288279.1|  PREDICTED: probable LRR receptor-like serine...  78.2    3e-14   
emb|CAA16677.1|  LRR-like protein                                     79.7    4e-14   
ref|XP_003541771.1|  PREDICTED: probably inactive leucine-rich re...  80.5    4e-14   
gb|EMT19839.1|  Putative NADP-dependent oxidoreductase P1             80.1    4e-14   
emb|CDP02635.1|  unnamed protein product                              77.8    5e-14   
ref|XP_011099414.1|  PREDICTED: probable inactive receptor kinase...  77.4    5e-14   
gb|KFK44613.1|  hypothetical protein AALP_AA1G281400                  79.7    6e-14   
gb|KJB18063.1|  hypothetical protein B456_003G032400                  77.4    6e-14   
ref|XP_004966549.1|  PREDICTED: probable LRR receptor-like serine...  76.3    1e-13   
gb|EMT33046.1|  Putative LRR receptor-like serine/threonine-prote...  76.3    1e-13   
ref|XP_011031327.1|  PREDICTED: probable LRR receptor-like serine...  75.9    2e-13   
ref|XP_009389449.1|  PREDICTED: probably inactive leucine-rich re...  75.9    2e-13   
ref|XP_009112204.1|  PREDICTED: probable inactive receptor kinase...  75.9    2e-13   
ref|XP_002310881.1|  leucine-rich repeat family protein               75.5    3e-13   
ref|XP_010679675.1|  PREDICTED: probable LRR receptor-like serine...  75.5    3e-13   
ref|XP_010999923.1|  PREDICTED: probable inactive receptor kinase...  75.1    4e-13   
ref|XP_002320014.1|  leucine-rich repeat family protein               75.1    4e-13   
gb|KJB10817.1|  hypothetical protein B456_001G226700                  77.0    4e-13   
ref|XP_010936190.1|  PREDICTED: probable inactive receptor kinase...  75.5    4e-13   
ref|XP_003557650.1|  PREDICTED: leucine-rich repeat receptor-like...  77.8    4e-13   
gb|KDP32114.1|  hypothetical protein JCGZ_12575                       74.7    5e-13   
ref|XP_002530612.1|  serine-threonine protein kinase, plant-type,...  73.9    9e-13   
ref|XP_009770457.1|  PREDICTED: probable inactive receptor kinase...  73.6    1e-12   
ref|XP_009402118.1|  PREDICTED: probably inactive leucine-rich re...  73.6    1e-12   
ref|XP_004491533.1|  PREDICTED: probable LRR receptor-like serine...  75.9    2e-12   
ref|XP_009597913.1|  PREDICTED: probable LRR receptor-like serine...  72.8    2e-12   
ref|XP_009387113.1|  PREDICTED: probable LRR receptor-like serine...  72.8    2e-12   
ref|NP_001132115.1|  hypothetical protein precursor                   72.8    2e-12   
ref|XP_002454685.1|  hypothetical protein SORBIDRAFT_04g035580        72.8    3e-12   
ref|XP_010028069.1|  PREDICTED: probable inactive receptor kinase...  72.4    3e-12   
gb|KCW54722.1|  hypothetical protein EUGRSUZ_I00670                   72.4    4e-12   
gb|KFK28457.1|  hypothetical protein AALP_AA8G516800                  72.0    4e-12   
ref|XP_004143410.1|  PREDICTED: receptor-like protein kinase BRI1...  72.0    4e-12   
ref|XP_008670931.1|  PREDICTED: LRR receptor-like serine/threonin...  72.8    5e-12   
gb|AGT16598.1|  hypothetical protein SHCRBa_009_E01_F_290             70.9    7e-12   
ref|XP_010273650.1|  PREDICTED: probable inactive receptor kinase...  71.2    8e-12   
ref|XP_002271860.1|  PREDICTED: probable LRR receptor-like serine...  73.2    1e-11   



>ref|XP_002298520.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEE83325.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=595

 Score =   192 bits (489),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 98/153 (64%), Positives = 118/153 (77%), Gaps = 1/153 (1%)
 Frame = +1

Query  118  RFLKLSILLVLFGVGV-AEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVAC  294
            +F    ++    G  V AEDD +CLQGV+ S  DP+G L  WNF NT+ GFIC FVGV+C
Sbjct  2    KFCTFIVIFAALGATVFAEDDARCLQGVQNSLGDPEGRLATWNFGNTSVGFICNFVGVSC  61

Query  295  WNDNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTL  474
            WND ENR+I LELR++ L G+VP +LQ C SLQNLDLS N LSGTIP+QIC WLPYLVTL
Sbjct  62   WNDRENRIINLELRDMKLSGQVPESLQYCKSLQNLDLSSNSLSGTIPAQICTWLPYLVTL  121

Query  475  DLSSNDLTGPIPPDLGNCTYLNKLILNDNKLTG  573
            DLS+ND +GPIPPDL NC YLN LIL++N+L+G
Sbjct  122  DLSNNDFSGPIPPDLANCIYLNNLILSNNRLSG  154



>ref|XP_011047296.1| PREDICTED: probable inactive receptor kinase At1g27190 [Populus 
euphratica]
Length=593

 Score =   192 bits (488),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 97/153 (63%), Positives = 119/153 (78%), Gaps = 1/153 (1%)
 Frame = +1

Query  118  RFLKLSILLVLFGVGV-AEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVAC  294
            +F    ++   FG  V AEDD +CLQGV+ S  DP+G L  WNF N++ GFIC FVGV+C
Sbjct  2    KFCTFIVIFAAFGAIVFAEDDARCLQGVRKSLGDPEGRLATWNFANSSVGFICNFVGVSC  61

Query  295  WNDNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTL  474
            WND ENR+I LELR++ L G+VP ++Q C SLQNLDLS N LSGTIP+QIC WLPYLVTL
Sbjct  62   WNDRENRIINLELRDMKLSGQVPESIQYCESLQNLDLSSNSLSGTIPTQICTWLPYLVTL  121

Query  475  DLSSNDLTGPIPPDLGNCTYLNKLILNDNKLTG  573
            DLS+ND +GPIPPDL NC YLN LIL++N+L+G
Sbjct  122  DLSNNDFSGPIPPDLANCIYLNNLILSNNRLSG  154



>ref|XP_002323813.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEF03946.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=602

 Score =   192 bits (488),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 97/150 (65%), Positives = 122/150 (81%), Gaps = 4/150 (3%)
 Frame = +1

Query  136  ILLVLFGVGV----AEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWND  303
            I+++L  + V     EDDV+CLQGVK S  +P+G L  WNF N++ GFIC FVGV+CWND
Sbjct  13   IIVILVALSVINVLGEDDVRCLQGVKNSLDNPEGKLTTWNFANSSVGFICNFVGVSCWND  72

Query  304  NENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLS  483
             ENR+I L+LR++ L G+VP +L+ C SLQNLDLS N LSGTIP+QIC W+PYLVTLDLS
Sbjct  73   RENRIINLQLRDMKLSGQVPESLRYCQSLQNLDLSSNSLSGTIPAQICTWVPYLVTLDLS  132

Query  484  SNDLTGPIPPDLGNCTYLNKLILNDNKLTG  573
            +NDL+GPIPPDL NCTYLNKLIL++N+L+G
Sbjct  133  NNDLSGPIPPDLANCTYLNKLILSNNRLSG  162



>ref|XP_010091928.1| putative inactive receptor kinase [Morus notabilis]
 gb|EXB47708.1| putative inactive receptor kinase [Morus notabilis]
Length=597

 Score =   191 bits (485),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 99/161 (61%), Positives = 120/161 (75%), Gaps = 2/161 (1%)
 Frame = +1

Query  97   MVGFGFSRFLKLSILLVLFGV--GVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFI  270
            M G   + F  L +L    G   GVAEDDVKCL+G+K S RDP G L  W+F NT+ G I
Sbjct  1    MKGSATTIFASLLVLFASLGFCSGVAEDDVKCLRGIKQSLRDPQGKLDSWDFSNTSVGVI  60

Query  271  CKFVGVACWNDNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICR  450
            CKFVGV+CWND ENR++ LELR++ L G VP AL+ C SLQ LD +GN LSGTIPSQIC 
Sbjct  61   CKFVGVSCWNDRENRILNLELRDMKLAGSVPQALEYCGSLQKLDFAGNDLSGTIPSQICT  120

Query  451  WLPYLVTLDLSSNDLTGPIPPDLGNCTYLNKLILNDNKLTG  573
            WLP++V LDLSSN  +GPIPP+LGNC YLN L+L+DN+L+G
Sbjct  121  WLPFVVDLDLSSNKFSGPIPPELGNCQYLNNLVLSDNRLSG  161



>ref|XP_011009041.1| PREDICTED: probable inactive receptor kinase At1g27190 [Populus 
euphratica]
Length=602

 Score =   189 bits (481),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 97/150 (65%), Positives = 121/150 (81%), Gaps = 4/150 (3%)
 Frame = +1

Query  136  ILLVLFGVGV----AEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWND  303
            I+++L  + V     EDDV+CLQGVK S  +P G L  WNF N++ GFIC FVGV+CWND
Sbjct  13   IIVILVALSVINVLGEDDVRCLQGVKNSLDNPGGQLTTWNFANSSVGFICNFVGVSCWND  72

Query  304  NENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLS  483
             ENR+I L+LR++ L G+VP +L+ C SLQNLDLS N LSGTIP+QIC W+PYLVTLDLS
Sbjct  73   RENRIINLQLRDMKLSGQVPESLRYCQSLQNLDLSSNYLSGTIPAQICTWVPYLVTLDLS  132

Query  484  SNDLTGPIPPDLGNCTYLNKLILNDNKLTG  573
            +NDL+GPIPPDL NCTYLNKLIL++N+L+G
Sbjct  133  NNDLSGPIPPDLANCTYLNKLILSNNRLSG  162



>gb|KDP45434.1| hypothetical protein JCGZ_09683 [Jatropha curcas]
Length=598

 Score =   189 bits (479),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 97/156 (62%), Positives = 124/156 (79%), Gaps = 2/156 (1%)
 Frame = +1

Query  112  FSRFLKLS--ILLVLFGVGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVG  285
            F+  LK++  I ++LF + + EDDV+CL+GV  S  DP G L  WNF NT+ GF+C FVG
Sbjct  4    FNNLLKIASLITVLLFSLAIGEDDVRCLRGVHSSLSDPQGKLSSWNFANTSNGFLCNFVG  63

Query  286  VACWNDNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYL  465
            V CWND ENR+IGLELR++ L G+ P +L++C SLQNLDLS N LSGTIP+QIC WLP+L
Sbjct  64   VTCWNDQENRIIGLELRDMKLSGQFPESLKECKSLQNLDLSSNALSGTIPTQICTWLPFL  123

Query  466  VTLDLSSNDLTGPIPPDLGNCTYLNKLILNDNKLTG  573
            VTLDLS+N+++G IPPDLGNCT+LN LIL++N LTG
Sbjct  124  VTLDLSNNEISGSIPPDLGNCTFLNNLILSNNSLTG  159



>emb|CDP02178.1| unnamed protein product [Coffea canephora]
Length=602

 Score =   187 bits (476),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 98/137 (72%), Positives = 111/137 (81%), Gaps = 0/137 (0%)
 Frame = +1

Query  163  VAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrel  342
            +AEDDVKCL+GVK S RDPDG   LWNF N++ GFIC FVGV+CWN NENR+IGL LR++
Sbjct  28   IAEDDVKCLRGVKSSLRDPDGRFSLWNFSNSSVGFICDFVGVSCWNPNENRLIGLLLRDM  87

Query  343  nlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLG  522
            NL G VP ALQ CHSLQ LDLSGN LSG IP QIC WLPYLVT+DLS N LTG IP DL 
Sbjct  88   NLSGGVPDALQYCHSLQTLDLSGNDLSGPIPPQICDWLPYLVTVDLSGNALTGTIPEDLV  147

Query  523  NCTYLNKLILNDNKLTG  573
             C+YLN L+L+DNKL+G
Sbjct  148  KCSYLNSLVLDDNKLSG  164



>ref|XP_004233342.1| PREDICTED: probable inactive receptor kinase At1g27190 [Solanum 
lycopersicum]
Length=603

 Score =   187 bits (475),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 103/162 (64%), Positives = 122/162 (75%), Gaps = 1/162 (1%)
 Frame = +1

Query  91   FRMVGFGF-SRFLKLSILLVLFGVGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGF  267
            FR++   F   FL    LL    V VAEDD+KCL+GVK S  DP GNL  WNF N+T GF
Sbjct  4    FRLINLPFIVLFLVFQPLLHCTAVAVAEDDIKCLEGVKNSLTDPKGNLNSWNFANSTVGF  63

Query  268  ICKFVGVACWNDNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQIC  447
            ICKFVG +CWND ENR+I LELR++NLGG V  +L+ C SLQ LDLSGN +SG+IPS IC
Sbjct  64   ICKFVGASCWNDRENRLINLELRDMNLGGNVTDSLKYCRSLQTLDLSGNQISGSIPSDIC  123

Query  448  RWLPYLVTLDLSSNDLTGPIPPDLGNCTYLNKLILNDNKLTG  573
             WLP+LVTLDLS N+ TG IP DL +C+YLNKL+LNDNKL+G
Sbjct  124  TWLPFLVTLDLSYNEFTGSIPSDLVSCSYLNKLMLNDNKLSG  165



>ref|XP_010033235.1| PREDICTED: probable inactive receptor kinase At1g27190 [Eucalyptus 
grandis]
 gb|KCW52822.1| hypothetical protein EUGRSUZ_J02155 [Eucalyptus grandis]
Length=599

 Score =   186 bits (473),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 92/140 (66%), Positives = 111/140 (79%), Gaps = 0/140 (0%)
 Frame = +1

Query  154  GVGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglel  333
             V   EDD++CLQG+K S  DP G L  W F +++ GFICKFVGV+CWND ENR++ LEL
Sbjct  19   AVAAVEDDIQCLQGLKASLGDPQGKLSSWRFASSSVGFICKFVGVSCWNDRENRILSLEL  78

Query  334  relnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPP  513
            R ++  G++P +LQ C SLQ LDLS NGLSGTIP QICRWLPYLVTLDLSSN L+G IPP
Sbjct  79   RGMDFTGQIPESLQYCRSLQTLDLSNNGLSGTIPPQICRWLPYLVTLDLSSNGLSGSIPP  138

Query  514  DLGNCTYLNKLILNDNKLTG  573
            DL NCTYLN L+L++N+LTG
Sbjct  139  DLVNCTYLNNLVLSNNRLTG  158



>gb|EYU34688.1| hypothetical protein MIMGU_mgv1a026965mg, partial [Erythranthe 
guttata]
Length=587

 Score =   184 bits (468),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 97/135 (72%), Positives = 109/135 (81%), Gaps = 0/135 (0%)
 Frame = +1

Query  169  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  348
            EDDV CL+ VK S  D +G L  WNF NTT GFICKFVGV+CWND ENR+IGL LR+L+L
Sbjct  4    EDDVICLREVKNSLTDAEGRLSSWNFSNTTVGFICKFVGVSCWNDRENRLIGLALRDLSL  63

Query  349  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  528
             G VP +LQ CHSLQNLDLSGN LSG+IP QIC WLPYLVTLDLS N LTG IP DL NC
Sbjct  64   AGVVPDSLQFCHSLQNLDLSGNSLSGSIPPQICTWLPYLVTLDLSRNGLTGQIPEDLANC  123

Query  529  TYLNKLILNDNKLTG  573
            +YLN LIL+DN+L+G
Sbjct  124  SYLNTLILDDNQLSG  138



>ref|XP_006357131.1| PREDICTED: probable inactive receptor kinase At1g27190-like [Solanum 
tuberosum]
Length=612

 Score =   184 bits (466),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 96/138 (70%), Positives = 114/138 (83%), Gaps = 0/138 (0%)
 Frame = +1

Query  160  GVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelre  339
             VAEDD+KCL+GVK S  DP GNL  WNF N+T GFICKFVG +CWND ENR+I LELR+
Sbjct  33   AVAEDDIKCLKGVKNSLTDPKGNLNSWNFANSTVGFICKFVGASCWNDRENRLINLELRD  92

Query  340  lnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDL  519
            +NLGG VP +L+ C SLQ LDLSGN +SG+IPS IC WLP+LVTLDLS+N+ TG IP DL
Sbjct  93   MNLGGNVPDSLKYCRSLQTLDLSGNRISGSIPSDICTWLPFLVTLDLSNNEFTGSIPSDL  152

Query  520  GNCTYLNKLILNDNKLTG  573
             +C+YLNKL+LNDNKL+G
Sbjct  153  VSCSYLNKLMLNDNKLSG  170



>ref|XP_002517430.1| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor, 
putative [Ricinus communis]
 gb|EEF44972.1| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor, 
putative [Ricinus communis]
Length=602

 Score =   183 bits (465),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 96/154 (62%), Positives = 120/154 (78%), Gaps = 1/154 (1%)
 Frame = +1

Query  112  FSRFLKLSILLVLFGVGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVA  291
            F+  + +S  L+   V + EDD KCL+GV+ S  DP G L  WNF N+++GF+C FVGV+
Sbjct  10   FATLILVSATLISSSV-IGEDDAKCLEGVRNSLSDPQGKLSSWNFANSSSGFLCNFVGVS  68

Query  292  CWNDNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVT  471
            CWND ENR+I LELR++ L G+VP +L+ C SLQNLDLS N LSGTIPSQIC WLPYLVT
Sbjct  69   CWNDQENRIINLELRDMQLSGQVPESLKYCKSLQNLDLSSNALSGTIPSQICTWLPYLVT  128

Query  472  LDLSSNDLTGPIPPDLGNCTYLNKLILNDNKLTG  573
            LDLS+NDL+G IP DL NCTYLN LIL++N+L+G
Sbjct  129  LDLSNNDLSGSIPHDLVNCTYLNNLILSNNRLSG  162



>ref|XP_009617928.1| PREDICTED: probable inactive receptor kinase At1g27190 [Nicotiana 
tomentosiformis]
Length=605

 Score =   183 bits (465),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 103/159 (65%), Positives = 122/159 (77%), Gaps = 5/159 (3%)
 Frame = +1

Query  112  FSRFLKLSILLVL----FGVGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKF  279
            F  F+ + + LVL        VAEDD+KCLQGVK S  DP GNL  WNF N+T GFICKF
Sbjct  4    FRLFMLILLFLVLQPLPSSTVVAEDDIKCLQGVKNSLTDPKGNLKSWNFANSTVGFICKF  63

Query  280  VGVACWNDNENRVIglelrelnlg-geVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWL  456
            VG +CWND ENR+I LELR+LNLG  ++P +LQ C SLQNLDLSGN LSG+IPS IC WL
Sbjct  64   VGASCWNDRENRLITLELRDLNLGGSKIPDSLQYCKSLQNLDLSGNRLSGSIPSDICTWL  123

Query  457  PYLVTLDLSSNDLTGPIPPDLGNCTYLNKLILNDNKLTG  573
            P+LV LDLS+N+ +G IP DL +C+YLNKLILNDNKL+G
Sbjct  124  PFLVILDLSNNEFSGSIPADLVSCSYLNKLILNDNKLSG  162



>ref|XP_011098550.1| PREDICTED: probable inactive receptor kinase At1g27190 [Sesamum 
indicum]
Length=604

 Score =   183 bits (464),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 94/135 (70%), Positives = 108/135 (80%), Gaps = 0/135 (0%)
 Frame = +1

Query  169  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  348
            EDD +CLQ VK S  DP+G L  W F NTT GFICKFVGV+CWND ENR+IGLELR+ +L
Sbjct  28   EDDTRCLQEVKKSLTDPEGKLNSWVFSNTTVGFICKFVGVSCWNDRENRLIGLELRDFSL  87

Query  349  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  528
             G +P +LQ CHSLQ L+L+GN LSG+IP QIC WLPYLVTLDLS N LTG IP DL NC
Sbjct  88   TGSIPDSLQFCHSLQTLNLAGNSLSGSIPPQICTWLPYLVTLDLSQNSLTGQIPEDLANC  147

Query  529  TYLNKLILNDNKLTG  573
            +YLN LIL+DNKL+G
Sbjct  148  SYLNNLILDDNKLSG  162



>ref|XP_011085787.1| PREDICTED: probable inactive receptor kinase At1g27190 [Sesamum 
indicum]
Length=607

 Score =   182 bits (463),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 98/160 (61%), Positives = 118/160 (74%), Gaps = 0/160 (0%)
 Frame = +1

Query  94   RMVGFGFSRFLKLSILLVLFGVGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFIC  273
            R++    S F  L ++ +      AEDDV+CLQ VK S  D  G L  W F NT+ GFIC
Sbjct  4    RLLLLSRSIFSTLLLIFLFICSSFAEDDVRCLQEVKRSLTDTGGKLNSWVFSNTSVGFIC  63

Query  274  KFVGVACWNDNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRW  453
            +FVGV+CWND ENR+IGLELR+ +L G++P +LQ CHSLQ LDLSGN LSG+IP QIC W
Sbjct  64   RFVGVSCWNDRENRLIGLELRDFSLAGDIPDSLQFCHSLQTLDLSGNSLSGSIPPQICTW  123

Query  454  LPYLVTLDLSSNDLTGPIPPDLGNCTYLNKLILNDNKLTG  573
            LPYLVTLDLS N LTG IP DL NC++LN LIL+DNKL+G
Sbjct  124  LPYLVTLDLSRNSLTGHIPEDLANCSFLNALILDDNKLSG  163



>gb|KJB40808.1| hypothetical protein B456_007G077900 [Gossypium raimondii]
Length=605

 Score =   182 bits (463),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 97/161 (60%), Positives = 119/161 (74%), Gaps = 7/161 (4%)
 Frame = +1

Query  112  FSRFLKL-------SILLVLFGVGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFI  270
            FSR LK+          L L     A+DD+KCL+GVK S +DPDG L  W F+N + GF+
Sbjct  5    FSRRLKILSFVLSWMFSLALVFPATAQDDLKCLEGVKNSLKDPDGRLSSWTFNNNSVGFV  64

Query  271  CKFVGVACWNDNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICR  450
            CKFVGV CWN+ ENR++GLELR++ L GE+P +L+ C SLQ LDLS N LSGTIP QIC 
Sbjct  65   CKFVGVQCWNEQENRLLGLELRDMKLSGELPQSLEYCRSLQTLDLSANKLSGTIPPQICS  124

Query  451  WLPYLVTLDLSSNDLTGPIPPDLGNCTYLNKLILNDNKLTG  573
            WLPYLVTLDLSSNDL G +PP+L NC YLN LIL++N+L+G
Sbjct  125  WLPYLVTLDLSSNDLHGSVPPELSNCAYLNNLILSNNRLSG  165



>gb|KDO72413.1| hypothetical protein CISIN_1g035917mg [Citrus sinensis]
Length=611

 Score =   182 bits (461),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 93/137 (68%), Positives = 111/137 (81%), Gaps = 0/137 (0%)
 Frame = +1

Query  163  VAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrel  342
            VAEDDVKCL+GVK S  DP   L  W+F N+T GFIC+FVGV+CWND ENR++ LELRE+
Sbjct  47   VAEDDVKCLEGVKSSLNDPQRKLSSWSFGNSTIGFICQFVGVSCWNDKENRILNLELREM  106

Query  343  nlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLG  522
             L G++P  L+ C S+Q LDLS N LSG IP+QIC WLPYLV LDLS+NDL+GPIP DLG
Sbjct  107  KLSGKIPEPLKFCKSMQRLDLSANDLSGNIPAQICNWLPYLVLLDLSNNDLSGPIPADLG  166

Query  523  NCTYLNKLILNDNKLTG  573
            NCTYLN LIL++NKL+G
Sbjct  167  NCTYLNTLILSNNKLSG  183



>emb|CBI35007.3| unnamed protein product [Vitis vinifera]
Length=578

 Score =   181 bits (460),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 111/144 (77%), Gaps = 0/144 (0%)
 Frame = +1

Query  142  LVLFGVGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVI  321
            + LF   VAEDDVKCL+GVK S  DP G L  W+F N + G +CKFVGVACWND ENR+ 
Sbjct  36   VALFSAAVAEDDVKCLRGVKESLSDPQGKLSSWSFSNISVGSLCKFVGVACWNDRENRIF  95

Query  322  glelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTG  501
            GLEL ++ L GE+P  L+ C S+Q LDLSGN L G IPSQIC WLPYLVTLDLS+NDL+G
Sbjct  96   GLELPDMKLSGEIPKPLEYCQSMQTLDLSGNRLYGNIPSQICTWLPYLVTLDLSNNDLSG  155

Query  502  PIPPDLGNCTYLNKLILNDNKLTG  573
             IPPDL NC++LN L+L DN+L+G
Sbjct  156  TIPPDLANCSFLNSLLLADNQLSG  179



>ref|XP_004232252.1| PREDICTED: probable inactive receptor kinase At1g27190 [Solanum 
lycopersicum]
Length=601

 Score =   182 bits (461),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 96/139 (69%), Positives = 105/139 (76%), Gaps = 0/139 (0%)
 Frame = +1

Query  157  VGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelr  336
              VAEDD+KCL+G K S  DPDGNL  WNF NTT G ICKFVGV CWNDNENR+  L L 
Sbjct  24   AAVAEDDLKCLEGFKKSLEDPDGNLNSWNFKNTTIGAICKFVGVTCWNDNENRINSLSLP  83

Query  337  elnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPD  516
             +NLGG+V   +Q C SL  LDLSGN  SG IPSQIC WLPYLVTLDLS ND +GPIP D
Sbjct  84   AMNLGGKVTEPVQYCASLTALDLSGNSFSGPIPSQICTWLPYLVTLDLSGNDYSGPIPAD  143

Query  517  LGNCTYLNKLILNDNKLTG  573
            L  CT+LNKL L+DNKLTG
Sbjct  144  LAKCTFLNKLSLSDNKLTG  162



>ref|XP_003633815.1| PREDICTED: probable inactive receptor kinase At1g27190 [Vitis 
vinifera]
Length=613

 Score =   182 bits (461),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 111/144 (77%), Gaps = 0/144 (0%)
 Frame = +1

Query  142  LVLFGVGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVI  321
            + LF   VAEDDVKCL+GVK S  DP G L  W+F N + G +CKFVGVACWND ENR+ 
Sbjct  27   VALFSAAVAEDDVKCLRGVKESLSDPQGKLSSWSFSNISVGSLCKFVGVACWNDRENRIF  86

Query  322  glelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTG  501
            GLEL ++ L GE+P  L+ C S+Q LDLSGN L G IPSQIC WLPYLVTLDLS+NDL+G
Sbjct  87   GLELPDMKLSGEIPKPLEYCQSMQTLDLSGNRLYGNIPSQICTWLPYLVTLDLSNNDLSG  146

Query  502  PIPPDLGNCTYLNKLILNDNKLTG  573
             IPPDL NC++LN L+L DN+L+G
Sbjct  147  TIPPDLANCSFLNSLLLADNQLSG  170



>ref|XP_006482508.1| PREDICTED: probable inactive receptor kinase At1g27190-like [Citrus 
sinensis]
Length=612

 Score =   182 bits (461),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 93/137 (68%), Positives = 111/137 (81%), Gaps = 0/137 (0%)
 Frame = +1

Query  163  VAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrel  342
            VAEDDVKCL+GVK S  DP   L  W+F N+T GFIC+FVGV+CWND ENR++ LELRE+
Sbjct  35   VAEDDVKCLEGVKSSLNDPQRKLSSWSFGNSTIGFICQFVGVSCWNDKENRILNLELREM  94

Query  343  nlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLG  522
             L G++P  L+ C S+Q LDLS N LSG IP+QIC WLPYLV LDLS+NDL+GPIP DLG
Sbjct  95   KLSGKIPEPLKFCKSMQRLDLSANDLSGNIPAQICNWLPYLVLLDLSNNDLSGPIPADLG  154

Query  523  NCTYLNKLILNDNKLTG  573
            NCTYLN LIL++NKL+G
Sbjct  155  NCTYLNTLILSNNKLSG  171



>ref|XP_006431036.1| hypothetical protein CICLE_v10011313mg [Citrus clementina]
 gb|ESR44276.1| hypothetical protein CICLE_v10011313mg [Citrus clementina]
Length=612

 Score =   181 bits (460),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 93/137 (68%), Positives = 111/137 (81%), Gaps = 0/137 (0%)
 Frame = +1

Query  163  VAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrel  342
            VAEDDVKCL+GVK S  DP   L  W+F N+T GFIC+FVGV+CWND ENR++ LELRE+
Sbjct  35   VAEDDVKCLEGVKSSLNDPQRKLSSWSFGNSTIGFICQFVGVSCWNDKENRILNLELREM  94

Query  343  nlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLG  522
             L G++P  L+ C S+Q LDLS N LSG IP+QIC WLPYLV LDLS+NDL+GPIP DLG
Sbjct  95   KLSGQIPEPLKFCKSMQRLDLSANDLSGNIPAQICDWLPYLVLLDLSNNDLSGPIPADLG  154

Query  523  NCTYLNKLILNDNKLTG  573
            NCTYLN LIL++NKL+G
Sbjct  155  NCTYLNTLILSNNKLSG  171



>gb|KJB11418.1| hypothetical protein B456_001G257700 [Gossypium raimondii]
Length=588

 Score =   180 bits (457),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 90/143 (63%), Positives = 113/143 (79%), Gaps = 0/143 (0%)
 Frame = +1

Query  145  VLFGVGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIg  324
            VL    V EDD+KCL+GVK S +DPDG L  W F+N + GFICKFVGV+CWN+ ENR++ 
Sbjct  5    VLVLSAVTEDDMKCLEGVKNSLKDPDGKLSSWTFNNNSVGFICKFVGVSCWNERENRLLS  64

Query  325  lelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGP  504
            L LR++ L G++P +LQ C SLQ+LDLS N LSG+IP+QIC WLPYLVTLDLSSNDL+G 
Sbjct  65   LGLRDMKLSGQLPQSLQYCRSLQSLDLSANKLSGSIPTQICSWLPYLVTLDLSSNDLSGT  124

Query  505  IPPDLGNCTYLNKLILNDNKLTG  573
            IPP+L  C YLN L L++N+L+G
Sbjct  125  IPPELSYCAYLNNLKLSNNRLSG  147



>gb|KJB33686.1| hypothetical protein B456_006G026400 [Gossypium raimondii]
Length=399

 Score =   176 bits (445),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 88/154 (57%), Positives = 117/154 (76%), Gaps = 2/154 (1%)
 Frame = +1

Query  118  RFLKLSILLVLFGVG--VAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVA  291
            RF+ L+ +L    V   V EDD+KCL+G+K S  DPDG L  W+F+N +AGF+C  VGV 
Sbjct  13   RFVLLTRMLFAGHVSSTVTEDDIKCLKGIKNSLNDPDGKLSNWSFNNNSAGFLCNLVGVE  72

Query  292  CWNDNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVT  471
            CW + E+R++ L+LR++ L G++P +LQ C SLQ LDLS N LSGT+P+QIC WLPYLVT
Sbjct  73   CWTEREDRLLSLQLRDMKLSGQLPQSLQYCQSLQTLDLSANRLSGTVPAQICSWLPYLVT  132

Query  472  LDLSSNDLTGPIPPDLGNCTYLNKLILNDNKLTG  573
            LDLSSNDL+G IP +L NC YLN L+L++N+L+G
Sbjct  133  LDLSSNDLSGSIPSELSNCAYLNNLVLSNNRLSG  166



>ref|XP_007032365.1| Leucine-rich repeat protein kinase family protein [Theobroma 
cacao]
 gb|EOY03291.1| Leucine-rich repeat protein kinase family protein [Theobroma 
cacao]
Length=606

 Score =   177 bits (450),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 87/138 (63%), Positives = 108/138 (78%), Gaps = 0/138 (0%)
 Frame = +1

Query  160  GVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelre  339
             V EDD+KCL+GVK S +DPD  L  W F+N + GFICKFVGV CWN+ ENR++ L+LR+
Sbjct  29   AVTEDDMKCLEGVKNSLKDPDRKLSSWTFNNNSVGFICKFVGVTCWNERENRLLSLQLRD  88

Query  340  lnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDL  519
            + L G++P +L+ C SLQ LDLS N LSGTIP QIC WLPYLVTLDLSSNDL+G IPP+L
Sbjct  89   MKLSGQLPESLEYCQSLQTLDLSANKLSGTIPPQICTWLPYLVTLDLSSNDLSGSIPPEL  148

Query  520  GNCTYLNKLILNDNKLTG  573
              C YLN L L++N+L+G
Sbjct  149  SKCAYLNYLTLSNNRLSG  166



>ref|XP_010528295.1| PREDICTED: probable inactive receptor kinase At1g27190 [Tarenaya 
hassleriana]
Length=611

 Score =   177 bits (450),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 95/163 (58%), Positives = 119/163 (73%), Gaps = 5/163 (3%)
 Frame = +1

Query  100  VGFGFSRFLKLSILLVL-----FGVGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAG  264
            +G   S+FL LSI + +       +   EDDV+CLQGVK S  DP G L LWNF N+T G
Sbjct  3    IGSKPSKFLLLSIAVTVVFFCCLVMAADEDDVRCLQGVKNSLSDPQGALKLWNFANSTVG  62

Query  265  FICKFVGVACWNDNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQI  444
            F+C FVGV+CWN+ ENRVI LELR++ L G +P +LQ C SLQ LDLSGN LSG IPSQ 
Sbjct  63   FLCNFVGVSCWNNQENRVINLELRDMGLSGRIPESLQFCGSLQKLDLSGNRLSGNIPSQF  122

Query  445  CRWLPYLVTLDLSSNDLTGPIPPDLGNCTYLNKLILNDNKLTG  573
            C WLP+LV+LDLSSNDL G +PP+L  C++LN L+L+ N+L+G
Sbjct  123  CDWLPFLVSLDLSSNDLGGELPPELAKCSFLNSLVLSSNRLSG  165



>ref|XP_006338497.1| PREDICTED: probable inactive receptor kinase At1g27190-like [Solanum 
tuberosum]
Length=601

 Score =   177 bits (448),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 93/137 (68%), Positives = 103/137 (75%), Gaps = 0/137 (0%)
 Frame = +1

Query  163  VAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrel  342
            V EDD+KCL+G K S  DPDGNL  WNF NTT G ICKF GV CWNDNENR+I L L  +
Sbjct  26   VVEDDLKCLEGFKKSLEDPDGNLNSWNFKNTTVGAICKFTGVNCWNDNENRIISLSLSNI  85

Query  343  nlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLG  522
            NLGG+V   +Q C SL  LDLSGN  SG IPSQIC WLP+LVTLDLS ND +GPIP DL 
Sbjct  86   NLGGKVTEPVQYCASLTTLDLSGNRFSGPIPSQICTWLPFLVTLDLSGNDYSGPIPADLA  145

Query  523  NCTYLNKLILNDNKLTG  573
             C +LNKL L+DNKLTG
Sbjct  146  KCIFLNKLSLSDNKLTG  162



>gb|EPS58697.1| hypothetical protein M569_16115, partial [Genlisea aurea]
Length=400

 Score =   173 bits (439),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 91/137 (66%), Positives = 108/137 (79%), Gaps = 0/137 (0%)
 Frame = +1

Query  163  VAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrel  342
            VA+DDV+CLQ V+ S  DP G+L  WNF N TAGFIC F GV+CWND ENRVIGL L   
Sbjct  2    VAQDDVRCLQQVRNSLADPKGSLSSWNFGNDTAGFICHFDGVSCWNDFENRVIGLSLLNF  61

Query  343  nlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLG  522
            +LGG VP +L+ CH+LQ L+L+GN L G+IP QIC WLPYLVTLDLS+NDLTG IP DL 
Sbjct  62   HLGGTVPDSLRLCHTLQTLNLAGNSLYGSIPLQICSWLPYLVTLDLSNNDLTGQIPEDLA  121

Query  523  NCTYLNKLILNDNKLTG  573
            NC+YLN LIL+ N+L+G
Sbjct  122  NCSYLNALILDGNRLSG  138



>gb|EYU34129.1| hypothetical protein MIMGU_mgv1a027001mg, partial [Erythranthe 
guttata]
Length=603

 Score =   175 bits (444),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 91/135 (67%), Positives = 107/135 (79%), Gaps = 0/135 (0%)
 Frame = +1

Query  169  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  348
            EDDVKCL+ VK S  DPDG L  W F N++ GFICKFVG +CWND ENR+IGLELR+  L
Sbjct  16   EDDVKCLREVKNSLSDPDGKLSSWIFSNSSLGFICKFVGASCWNDQENRLIGLELRDFRL  75

Query  349  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  528
             G +P +LQ CHSLQ L+L+GN LSG+IP +IC WLPYLVTLDLS N LTG IP DL NC
Sbjct  76   AGNIPDSLQFCHSLQVLNLAGNSLSGSIPPEICTWLPYLVTLDLSQNRLTGSIPEDLANC  135

Query  529  TYLNKLILNDNKLTG  573
            +YLN LIL+DN+L+G
Sbjct  136  SYLNNLILDDNQLSG  150



>ref|XP_010272145.1| PREDICTED: probable inactive receptor kinase At1g27190 [Nelumbo 
nucifera]
Length=610

 Score =   174 bits (441),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 89/153 (58%), Positives = 112/153 (73%), Gaps = 0/153 (0%)
 Frame = +1

Query  115  SRFLKLSILLVLFGVGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVAC  294
            S+   L +  ++F     EDDVKCL GVK S  DP G L  W F N + GF+CKFVGV+C
Sbjct  8    SQLFLLLLSAMIFASMAIEDDVKCLTGVKNSLSDPQGKLSSWIFSNNSVGFLCKFVGVSC  67

Query  295  WNDNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTL  474
            WN+ ENR+I L+L  +NL G++P +LQ C SLQ LDLSGN LSG IPSQIC W+PYLVTL
Sbjct  68   WNERENRLIRLDLPTMNLAGQIPDSLQYCQSLQGLDLSGNKLSGQIPSQICTWMPYLVTL  127

Query  475  DLSSNDLTGPIPPDLGNCTYLNKLILNDNKLTG  573
            DLS+ND +GPIPP+L +C +LN L L +N+L+G
Sbjct  128  DLSNNDFSGPIPPELVDCKFLNSLNLANNRLSG  160



>ref|XP_010684872.1| PREDICTED: probable inactive receptor kinase At1g27190 [Beta 
vulgaris subsp. vulgaris]
Length=604

 Score =   174 bits (440),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 89/147 (61%), Positives = 113/147 (77%), Gaps = 3/147 (2%)
 Frame = +1

Query  139  LLVLFGVGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTA--GFICKFVGVACWNDNEN  312
            LL  F + V EDDVKCL+G+K +  DP G L  WNF N++A  GF+C FVG +CWND EN
Sbjct  19   LLTTFSLAV-EDDVKCLEGIKNTLNDPQGKLNSWNFRNSSASVGFVCNFVGASCWNDREN  77

Query  313  RVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSND  492
            R+I L+LR+  L G +P +L+ C S+Q+LDLSGN L+GTIPS+IC WLP+LVTLDLS+N 
Sbjct  78   RLISLQLRDFQLSGHIPDSLEFCSSIQSLDLSGNSLTGTIPSKICSWLPFLVTLDLSNNQ  137

Query  493  LTGPIPPDLGNCTYLNKLILNDNKLTG  573
            L+G IPPDLG C YLN+L L+DN L+G
Sbjct  138  LSGQIPPDLGKCQYLNRLDLSDNHLSG  164



>ref|XP_004302375.1| PREDICTED: probable inactive receptor kinase At1g27190 [Fragaria 
vesca subsp. vesca]
Length=596

 Score =   173 bits (439),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 89/152 (59%), Positives = 113/152 (74%), Gaps = 2/152 (1%)
 Frame = +1

Query  124  LKLSILLVLFGV--GVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACW  297
            L L + L  F     V EDDVKCL+G+K +F DP G L  W+F N++ GF+C FVG++CW
Sbjct  10   LTLVLFLSFFSSYQAVVEDDVKCLKGIKEAFNDPLGKLDSWDFTNSSVGFVCHFVGISCW  69

Query  298  NDNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLD  477
            ND ENR+  LELR+++L G +P +++ C SLQNLDL GN L+G IP  +C WLPYLVTLD
Sbjct  70   NDRENRIYNLELRDMSLSGTIPQSIEYCISLQNLDLGGNDLNGMIPKDLCSWLPYLVTLD  129

Query  478  LSSNDLTGPIPPDLGNCTYLNKLILNDNKLTG  573
            LS N+ TGPIP DL NCT+LN LIL+DNKL+G
Sbjct  130  LSGNEFTGPIPVDLSNCTFLNNLILSDNKLSG  161



>ref|XP_008389562.1| PREDICTED: probable inactive receptor kinase At1g27190 [Malus 
domestica]
Length=607

 Score =   171 bits (433),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 84/135 (62%), Positives = 104/135 (77%), Gaps = 0/135 (0%)
 Frame = +1

Query  169  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  348
            EDDV CL+GVK S  DP+G LG W+  N +   ICK VGV+CWN+ ENR+I L+L  + L
Sbjct  23   EDDVACLEGVKSSLTDPEGRLGQWDLANRSVASICKLVGVSCWNEKENRLISLQLPSMEL  82

Query  349  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  528
             G +P +L+ CHSLQ+LDLSGN LSG+IP QIC WLPYLVTLDLS N L+G IPP++ NC
Sbjct  83   VGMLPESLKFCHSLQSLDLSGNALSGSIPPQICNWLPYLVTLDLSGNALSGSIPPEIVNC  142

Query  529  TYLNKLILNDNKLTG  573
             +LN LILNDN+L+G
Sbjct  143  KFLNTLILNDNRLSG  157



>ref|XP_008361793.1| PREDICTED: probable inactive receptor kinase At1g27190 [Malus 
domestica]
Length=607

 Score =   171 bits (432),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 103/135 (76%), Gaps = 0/135 (0%)
 Frame = +1

Query  169  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  348
            EDDV CL+GVK S  DP+G L  W+  N +   ICK VGV CWN+ ENR+I L+L  + L
Sbjct  23   EDDVACLZGVKSSLTDPEGRLSQWDLANRSVASICKLVGVTCWNEKENRLISLQLPSMEL  82

Query  349  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  528
             G++P +L+ CHSLQ+LDLSGN LSG+IP QIC WLPYLVTLDLS N L+G IPP++ NC
Sbjct  83   AGKLPESLKFCHSLQSLDLSGNSLSGSIPPQICNWLPYLVTLDLSGNSLSGSIPPEIANC  142

Query  529  TYLNKLILNDNKLTG  573
             +LN LILNDN+L+G
Sbjct  143  KFLNTLILNDNRLSG  157



>ref|NP_189486.1| leucine-rich repeat protein kinase-like protein [Arabidopsis 
thaliana]
 dbj|BAB02861.1| receptor-like protein kinase-like protein [Arabidopsis thaliana]
 dbj|BAC42027.1| putative receptor kinase [Arabidopsis thaliana]
 gb|ACN59325.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE77446.1| leucine-rich repeat protein kinase-like protein [Arabidopsis 
thaliana]
Length=605

 Score =   169 bits (428),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 108/135 (80%), Gaps = 0/135 (0%)
 Frame = +1

Query  169  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  348
            EDD++CL+G+K S  DP   L  WNFDNTT GF+C FVGV+CWN+ ENRVI LELR++ L
Sbjct  31   EDDIRCLRGLKASLTDPQNALKSWNFDNTTLGFLCNFVGVSCWNNQENRVINLELRDMGL  90

Query  349  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  528
             G++P +LQ C SLQ LDLS N LSG IP+++C WLP+LV+LDLS+N+L G IPPDL  C
Sbjct  91   SGKIPDSLQYCASLQKLDLSSNRLSGNIPTELCNWLPFLVSLDLSNNELNGEIPPDLAKC  150

Query  529  TYLNKLILNDNKLTG  573
            +++N L+L+DN+L+G
Sbjct  151  SFVNSLVLSDNRLSG  165



>ref|XP_009620632.1| PREDICTED: probable inactive receptor kinase At1g27190 [Nicotiana 
tomentosiformis]
Length=602

 Score =   169 bits (427),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 91/159 (57%), Positives = 109/159 (69%), Gaps = 0/159 (0%)
 Frame = +1

Query  97   MVGFGFSRFLKLSILLVLFGVGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICK  276
            M  F F   L   +L   +   V EDD+KCL+G K S  DP GNL  W+F N+T   ICK
Sbjct  1    MTRFRFQLILLFVVLPQFYDAAVVEDDLKCLEGFKKSLEDPSGNLISWDFTNSTVSAICK  60

Query  277  FVGVACWNDNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWL  456
            F GV CWN+ ENR+ GL L+ +NLGG+V  +L+ C SL  LDLSGN  SG IPS+IC WL
Sbjct  61   FTGVNCWNERENRINGLALQTMNLGGKVTESLEYCASLTTLDLSGNRFSGPIPSKICTWL  120

Query  457  PYLVTLDLSSNDLTGPIPPDLGNCTYLNKLILNDNKLTG  573
            P+L TLDLSSND +G IP DL  C YLNKL+LNDNKL+G
Sbjct  121  PFLTTLDLSSNDFSGSIPADLVKCAYLNKLMLNDNKLSG  159



>ref|XP_009335793.1| PREDICTED: probable inactive receptor kinase At1g27190 [Pyrus 
x bretschneideri]
Length=601

 Score =   169 bits (427),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 92/162 (57%), Positives = 112/162 (69%), Gaps = 9/162 (6%)
 Frame = +1

Query  115  SRFLKLSILLVLFG---------VGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGF  267
            SR  ++ I ++L+G           V EDDV+CLQG+K S  DP GNL  W+F N T GF
Sbjct  3    SRIARIWIPVLLWGCMSTHFGSYAAVVEDDVRCLQGLKQSLNDPLGNLASWDFKNHTVGF  62

Query  268  ICKFVGVACWNDNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQIC  447
            IC FVGV CWND ENR+  LELR++ + GEVP  ++ C SL  LDL GN +SG IP  IC
Sbjct  63   ICDFVGVTCWNDRENRIFSLELRDMEITGEVPRDIEYCASLTKLDLGGNEISGPIPPNIC  122

Query  448  RWLPYLVTLDLSSNDLTGPIPPDLGNCTYLNKLILNDNKLTG  573
             WLP+LVTLDLS ND +G IPPDL +C YLN LIL+DNKL+G
Sbjct  123  DWLPFLVTLDLSGNDFSGAIPPDLQHCEYLNILILSDNKLSG  164



>ref|XP_006290709.1| hypothetical protein CARUB_v10016807mg, partial [Capsella rubella]
 gb|EOA23607.1| hypothetical protein CARUB_v10016807mg, partial [Capsella rubella]
Length=654

 Score =   168 bits (426),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 82/139 (59%), Positives = 108/139 (78%), Gaps = 0/139 (0%)
 Frame = +1

Query  157  VGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelr  336
            +   EDD++CL+G++ S  DP G L  WNF NTT GF+CKFVGV+CWND ENRVI LELR
Sbjct  76   MAADEDDIRCLRGIQSSLTDPQGILKSWNFANTTVGFLCKFVGVSCWNDQENRVINLELR  135

Query  337  elnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPD  516
            ++ L G+VP +LQ C SLQ LDLS N LSG IP ++C WLP+LV+LDLS+N+L G I PD
Sbjct  136  DMGLSGKVPESLQYCGSLQKLDLSSNRLSGNIPRELCSWLPFLVSLDLSNNELNGEISPD  195

Query  517  LGNCTYLNKLILNDNKLTG  573
            L  C+++N ++L+DN+L+G
Sbjct  196  LAKCSFVNSMVLSDNRLSG  214



>gb|KFK33740.1| hypothetical protein AALP_AA5G053600 [Arabis alpina]
Length=604

 Score =   168 bits (425),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 107/135 (79%), Gaps = 0/135 (0%)
 Frame = +1

Query  169  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  348
            EDD++CLQG+K S  DP G L  WNF NTT GF+C FVGV+CWN+ ENRVI LELR++ L
Sbjct  29   EDDIRCLQGIKTSLTDPQGALKSWNFGNTTLGFLCNFVGVSCWNNQENRVINLELRDMGL  88

Query  349  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  528
             G++P +LQ C SLQ LDLS N LSG IP+Q+C WLP+LV++D S+N+L G IP DL NC
Sbjct  89   SGKIPESLQYCKSLQKLDLSSNRLSGNIPTQLCNWLPFLVSIDFSNNELNGEIPVDLANC  148

Query  529  TYLNKLILNDNKLTG  573
            +++N L+L+DN+L+G
Sbjct  149  SFVNSLVLSDNRLSG  163



>ref|XP_008379313.1| PREDICTED: probable inactive receptor kinase At1g27190 [Malus 
domestica]
Length=600

 Score =   168 bits (425),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 86/138 (62%), Positives = 102/138 (74%), Gaps = 0/138 (0%)
 Frame = +1

Query  160  GVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelre  339
             V EDD++CL+G+K S  DP   L  W+F NTTAG ICKFVG+ CWND ENR++ LELRE
Sbjct  26   AVVEDDLRCLRGLKQSLHDPLEKLASWDFGNTTAGVICKFVGITCWNDKENRIVKLELRE  85

Query  340  lnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDL  519
            + L G VP  ++ C SL NLDL  N +SG IP  IC WLP+LVTLDLS ND +GPIPP L
Sbjct  86   MELTGAVPKEIEYCGSLTNLDLGSNAISGPIPPDICDWLPFLVTLDLSGNDFSGPIPPGL  145

Query  520  GNCTYLNKLILNDNKLTG  573
             +C YLN LIL+DNKLTG
Sbjct  146  QHCKYLNSLILSDNKLTG  163



>ref|XP_009360430.1| PREDICTED: LOW QUALITY PROTEIN: probable inactive receptor kinase 
At1g27190 [Pyrus x bretschneideri]
Length=607

 Score =   168 bits (425),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 103/135 (76%), Gaps = 0/135 (0%)
 Frame = +1

Query  169  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  348
            EDDV CL+GVK S  DP+G LG W+  N +   ICK VGV+CWN+ ENR+I L+L  + L
Sbjct  23   EDDVACLEGVKSSLTDPEGRLGQWDLANRSVASICKLVGVSCWNEKENRLISLQLPSMEL  82

Query  349  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  528
             G++P +L+ CHSLQ+LDLS N LSG+IP QIC WLPYLVTLDLS N L+G IPP++ NC
Sbjct  83   AGKLPESLKFCHSLQSLDLSSNALSGSIPRQICNWLPYLVTLDLSGNALSGSIPPEIVNC  142

Query  529  TYLNKLILNDNKLTG  573
             +LN L LNDN+L+G
Sbjct  143  KFLNTLFLNDNRLSG  157



>ref|XP_002875454.1| hypothetical protein ARALYDRAFT_484619 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51713.1| hypothetical protein ARALYDRAFT_484619 [Arabidopsis lyrata subsp. 
lyrata]
Length=579

 Score =   167 bits (424),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 107/135 (79%), Gaps = 0/135 (0%)
 Frame = +1

Query  169  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  348
            EDD++CL+G+K S  DP   L  WNFDNTT GF+C FVGV+CWN+ ENRVI LELR++ L
Sbjct  5    EDDIRCLRGLKTSLTDPQNALKSWNFDNTTLGFLCNFVGVSCWNNQENRVINLELRDMGL  64

Query  349  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  528
             G++P +LQ C SLQ LDLS N LSG IP ++C WLP+LV+LDLS+N+L G IPPDL  C
Sbjct  65   SGKIPDSLQYCASLQKLDLSSNRLSGNIPKELCNWLPFLVSLDLSNNELNGEIPPDLAKC  124

Query  529  TYLNKLILNDNKLTG  573
            +++N L+L+DN+L+G
Sbjct  125  SFVNSLVLSDNRLSG  139



>gb|KDO82668.1| hypothetical protein CISIN_1g007423mg [Citrus sinensis]
Length=604

 Score =   167 bits (424),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 105/135 (78%), Gaps = 1/135 (1%)
 Frame = +1

Query  169  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  348
            EDDVKCL+G++ S +DPDG L  W+F NTT G IC+  GVACWN+ ENR+I L L  + L
Sbjct  23   EDDVKCLEGIQNSIKDPDGRLS-WSFTNTTVGAICRLTGVACWNEKENRIISLTLSSMQL  81

Query  349  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  528
             G++P +L  CHSLQ+LDLS N LSG+IP  +C+WLPY+V LDLS+N L+GPIPP +  C
Sbjct  82   SGQLPESLHLCHSLQSLDLSDNSLSGSIPVDLCKWLPYVVQLDLSNNHLSGPIPPQIVEC  141

Query  529  TYLNKLILNDNKLTG  573
             +LNKLIL++NKL+G
Sbjct  142  KFLNKLILSNNKLSG  156



>ref|XP_008221489.1| PREDICTED: probable inactive receptor kinase At1g27190 [Prunus 
mume]
Length=605

 Score =   167 bits (422),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 104/135 (77%), Gaps = 0/135 (0%)
 Frame = +1

Query  169  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  348
            EDD+ CL+GVK S  DP G L  W+  N +   ICK VGV+CWN+ ENR+I L+L  + L
Sbjct  22   EDDLTCLEGVKTSLTDPQGRLSQWDLGNRSVASICKLVGVSCWNEKENRLISLQLPSMEL  81

Query  349  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  528
             GE+P +L+ CHSLQ+LDLSGN LSG+IP QIC WLPYLVTLDLS+N L+G IPP++ NC
Sbjct  82   AGELPESLKFCHSLQSLDLSGNALSGSIPPQICNWLPYLVTLDLSNNHLSGSIPPEIVNC  141

Query  529  TYLNKLILNDNKLTG  573
             +LN LILNDN+L+G
Sbjct  142  KFLNTLILNDNRLSG  156



>ref|XP_010514548.1| PREDICTED: probable inactive receptor kinase At1g27190 [Camelina 
sativa]
Length=607

 Score =   167 bits (422),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 86/156 (55%), Positives = 115/156 (74%), Gaps = 4/156 (3%)
 Frame = +1

Query  118  RFLKLSILLVLF----GVGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVG  285
            + L LSI++ L      +   EDD++CL+GV+ S  DP G L  WNF NTT GF+C FVG
Sbjct  10   KLLPLSIIIFLCFCYPSMAADEDDIRCLRGVQSSLTDPQGALKSWNFGNTTVGFLCNFVG  69

Query  286  VACWNDNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYL  465
            V+CWN+ ENRVI LELR++ L G++P +LQ C SLQ LDLS N LSG IP ++C WLP+L
Sbjct  70   VSCWNNQENRVINLELRDMGLSGKIPESLQYCGSLQKLDLSSNQLSGNIPRELCTWLPFL  129

Query  466  VTLDLSSNDLTGPIPPDLGNCTYLNKLILNDNKLTG  573
            V+LDLS+N+L G I PDL  C+++N L+L+DN+L+G
Sbjct  130  VSLDLSNNELNGEISPDLAKCSFVNSLVLSDNRLSG  165



>ref|XP_008341508.1| PREDICTED: probable inactive receptor kinase At1g27190 [Malus 
domestica]
Length=601

 Score =   167 bits (422),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 91/162 (56%), Positives = 111/162 (69%), Gaps = 9/162 (6%)
 Frame = +1

Query  115  SRFLKLSILLVLFG---------VGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGF  267
            SR  ++ I ++L+G           V EDDV+CLQG+K S  DP G L  W+F N T GF
Sbjct  3    SRIARIWIPVLLWGCMSTHFCSYAAVVEDDVRCLQGLKQSLNDPLGKLASWDFRNHTVGF  62

Query  268  ICKFVGVACWNDNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQIC  447
            IC FVGV CWND ENR+  LELR++ + GEVP  ++ C SL  LDL GN +SG IP  IC
Sbjct  63   ICDFVGVTCWNDRENRIFSLELRDMEITGEVPKDIEYCASLTKLDLGGNEISGPIPPDIC  122

Query  448  RWLPYLVTLDLSSNDLTGPIPPDLGNCTYLNKLILNDNKLTG  573
             WLP+LVTLDLS ND +G IPPDL +C YLN LIL+DNKL+G
Sbjct  123  DWLPFLVTLDLSGNDFSGAIPPDLQHCEYLNILILSDNKLSG  164



>ref|XP_007222048.1| hypothetical protein PRUPE_ppa003089mg [Prunus persica]
 gb|EMJ23247.1| hypothetical protein PRUPE_ppa003089mg [Prunus persica]
Length=605

 Score =   167 bits (422),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 104/135 (77%), Gaps = 0/135 (0%)
 Frame = +1

Query  169  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  348
            EDD+ CL+GVK S  DP G L  W+  N +   ICK VGV+CWN+ ENR+I L+L  + L
Sbjct  22   EDDLTCLEGVKTSLTDPQGRLSQWDLGNRSVASICKLVGVSCWNEKENRLISLQLPSMEL  81

Query  349  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  528
             GE+P +L+ CHSLQ+LDLSGN LSG+IP QIC WLPYLVTLDLS+N L+G IPP++ NC
Sbjct  82   AGELPESLKFCHSLQSLDLSGNALSGSIPPQICTWLPYLVTLDLSNNHLSGSIPPEIVNC  141

Query  529  TYLNKLILNDNKLTG  573
             +LN LILNDN+L+G
Sbjct  142  KFLNTLILNDNRLSG  156



>ref|XP_010425626.1| PREDICTED: probable inactive receptor kinase At1g27190 [Camelina 
sativa]
Length=606

 Score =   167 bits (422),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 86/156 (55%), Positives = 115/156 (74%), Gaps = 4/156 (3%)
 Frame = +1

Query  118  RFLKLSILLVLF----GVGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVG  285
            + L LSI++ L      +   EDD++CL+GV+ S  DP G L  WNF NTT GF+C FVG
Sbjct  10   KLLPLSIIIFLCFCYPSMAADEDDIRCLRGVQSSLTDPQGALKSWNFGNTTVGFLCNFVG  69

Query  286  VACWNDNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYL  465
            V+CWN+ ENRVI LELR++ L G++P +LQ C SLQ LDLS N LSG IP ++C WLP+L
Sbjct  70   VSCWNNQENRVINLELRDMGLSGKIPESLQYCGSLQKLDLSSNQLSGNIPRELCTWLPFL  129

Query  466  VTLDLSSNDLTGPIPPDLGNCTYLNKLILNDNKLTG  573
            V+LDLS+N+L G I PDL  C+++N L+L+DN+L+G
Sbjct  130  VSLDLSNNELNGEISPDLAKCSFVNSLVLSDNRLSG  165



>ref|XP_010043841.1| PREDICTED: probable inactive receptor kinase At1g27190 [Eucalyptus 
grandis]
 gb|KCW85840.1| hypothetical protein EUGRSUZ_B02576 [Eucalyptus grandis]
Length=616

 Score =   166 bits (421),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 85/135 (63%), Positives = 98/135 (73%), Gaps = 0/135 (0%)
 Frame = +1

Query  169  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  348
            EDDV CL+GVK S  DP G+L  W F NT+A  IC   GVACWN NENR+I L L    +
Sbjct  34   EDDVLCLEGVKRSLGDPQGSLADWTFANTSASHICNLNGVACWNLNENRIISLSLTGFGV  93

Query  349  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  528
             G +P +L++CHSLQ LDLS N L G IP+QIC WLPYLV LDLSSN L GPIP  +G+C
Sbjct  94   SGGLPESLKNCHSLQTLDLSQNKLDGPIPAQICEWLPYLVKLDLSSNSLAGPIPSQIGDC  153

Query  529  TYLNKLILNDNKLTG  573
             +LN LILNDNKLTG
Sbjct  154  KFLNNLILNDNKLTG  168



>ref|XP_006395364.1| hypothetical protein EUTSA_v10003844mg [Eutrema salsugineum]
 gb|ESQ32650.1| hypothetical protein EUTSA_v10003844mg [Eutrema salsugineum]
Length=609

 Score =   166 bits (421),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 83/156 (53%), Positives = 113/156 (72%), Gaps = 5/156 (3%)
 Frame = +1

Query  121  FLKLSILLVLF-----GVGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVG  285
             L ++ + V F      +   EDD++CLQG+K S  DP   L  WNF N+T GF+C FVG
Sbjct  13   LLIITTVFVFFLCYSPAMAADEDDIRCLQGLKSSLTDPQNALKSWNFANSTIGFLCNFVG  72

Query  286  VACWNDNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYL  465
            V+CWN+ ENRVI LELR++ L G +P +LQ C SLQ LDLS N +SG IP+Q+C WLP+L
Sbjct  73   VSCWNNQENRVINLELRDMGLSGRIPESLQFCGSLQKLDLSSNRISGNIPTQLCSWLPFL  132

Query  466  VTLDLSSNDLTGPIPPDLGNCTYLNKLILNDNKLTG  573
            V+LDLS+N+L G IPPDL  C+++N ++L+DN+L+G
Sbjct  133  VSLDLSNNELNGEIPPDLAKCSFVNSIVLSDNRLSG  168



>ref|XP_010502845.1| PREDICTED: probable inactive receptor kinase At1g27190 [Camelina 
sativa]
Length=606

 Score =   166 bits (420),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 115/156 (74%), Gaps = 4/156 (3%)
 Frame = +1

Query  118  RFLKLSILLVLF----GVGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVG  285
            + + LSI++ L      +   EDD++CL+GV+ S  DP G L  WNF NTT GF+C FVG
Sbjct  10   KLIPLSIIIFLCFCYPSMAADEDDIRCLRGVQSSLTDPQGALKSWNFGNTTVGFLCNFVG  69

Query  286  VACWNDNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYL  465
            V+CWN+ ENRVI LELR++ L G++P +LQ C SLQ LDLS N LSG IP ++C WLP+L
Sbjct  70   VSCWNNQENRVINLELRDMGLSGKIPESLQYCGSLQKLDLSSNQLSGNIPRELCTWLPFL  129

Query  466  VTLDLSSNDLTGPIPPDLGNCTYLNKLILNDNKLTG  573
            V+LDLS+N+L G I PDL  C+++N L+L+DN+L+G
Sbjct  130  VSLDLSNNELNGEISPDLAKCSFVNSLVLSDNRLSG  165



>emb|CDY04020.1| BnaC02g37350D [Brassica napus]
Length=602

 Score =   166 bits (420),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 86/158 (54%), Positives = 112/158 (71%), Gaps = 6/158 (4%)
 Frame = +1

Query  118  RFLKLSILLVLF------GVGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKF  279
            + L LSI ++L        +   EDD+KCL+G++ S  DP G L  WNF NTT GF+C F
Sbjct  10   KLLPLSIFIILLLCFSPPAMAADEDDIKCLKGIQTSLTDPQGILKSWNFANTTLGFLCNF  69

Query  280  VGVACWNDNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLP  459
            VGV+CWN+ ENRVI LELR++ L G +P +LQ C SLQ LDLS N LSG IP ++C WLP
Sbjct  70   VGVSCWNNQENRVINLELRDMGLSGRIPESLQYCGSLQKLDLSTNRLSGNIPRELCTWLP  129

Query  460  YLVTLDLSSNDLTGPIPPDLGNCTYLNKLILNDNKLTG  573
            +LV+LDLS+N L G IPP L  C ++N L+L++N+LTG
Sbjct  130  FLVSLDLSNNQLNGEIPPSLAECRFVNSLVLSENRLTG  167



>ref|XP_009759220.1| PREDICTED: probable inactive receptor kinase At1g27190 [Nicotiana 
sylvestris]
Length=602

 Score =   166 bits (420),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 87/142 (61%), Positives = 104/142 (73%), Gaps = 0/142 (0%)
 Frame = +1

Query  148  LFGVGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIgl  327
             +   V EDD+KCL+G K S  DP GNL  W+F N+T G ICKF GV CWN+ ENR+ GL
Sbjct  18   FYDTAVVEDDLKCLEGFKKSLEDPSGNLNSWDFTNSTVGAICKFAGVNCWNERENRINGL  77

Query  328  elrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPI  507
             L+ +NLGG+V  +L+ C SL  LDLSGN  SG IPS+IC WLP+L TLDLSSND +G I
Sbjct  78   ALQTMNLGGKVTESLEYCASLTTLDLSGNRFSGPIPSKICTWLPFLTTLDLSSNDFSGSI  137

Query  508  PPDLGNCTYLNKLILNDNKLTG  573
            P DL  C YLNKL+LNDNKL+G
Sbjct  138  PADLVKCAYLNKLMLNDNKLSG  159



>ref|XP_006438525.1| hypothetical protein CICLE_v10030999mg [Citrus clementina]
 ref|XP_006483300.1| PREDICTED: probable inactive receptor kinase At1g27190-like [Citrus 
sinensis]
 gb|ESR51765.1| hypothetical protein CICLE_v10030999mg [Citrus clementina]
Length=604

 Score =   166 bits (420),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 104/135 (77%), Gaps = 1/135 (1%)
 Frame = +1

Query  169  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  348
            EDDVKCL+G++ S +DPDG L  W+F NTT G IC+  GV+CWN+ ENR+I L L  + L
Sbjct  23   EDDVKCLEGIQNSIKDPDGRLS-WSFTNTTVGAICRLTGVSCWNEKENRIISLTLSSMQL  81

Query  349  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  528
             G++P +L  CHSLQ LDLS N LSG+IP  +C+WLPY+V LDLS+N L+GPIPP +  C
Sbjct  82   SGQLPESLHLCHSLQTLDLSDNSLSGSIPVDLCKWLPYVVQLDLSNNHLSGPIPPQIVEC  141

Query  529  TYLNKLILNDNKLTG  573
             +LNKLIL++NKL+G
Sbjct  142  KFLNKLILSNNKLSG  156



>ref|XP_002305238.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEE85749.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=609

 Score =   166 bits (419),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 107/151 (71%), Gaps = 1/151 (1%)
 Frame = +1

Query  124  LKLSILLVLFGVGVA-EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWN  300
            +  S+L  LF    A EDDV CL+GVK SF DP G L  W+F+N +  +ICK  GV+CWN
Sbjct  8    ISFSLLFSLFAFSFAIEDDVTCLEGVKNSFTDPLGRLTSWDFNNNSVAYICKLNGVSCWN  67

Query  301  DNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDL  480
            + ENR+I L+L    L G++P +L+ CHSL  LDLS N LSG IP +IC WLPY+VTLDL
Sbjct  68   EKENRIISLQLPLFQLSGKLPESLKYCHSLTTLDLSNNDLSGPIPPEICNWLPYVVTLDL  127

Query  481  SSNDLTGPIPPDLGNCTYLNKLILNDNKLTG  573
            S N  +GPIPP++ NC +LN LIL+ NKLTG
Sbjct  128  SGNKFSGPIPPEIVNCKFLNSLILSGNKLTG  158



>ref|XP_009115452.1| PREDICTED: probable inactive receptor kinase At1g27190 [Brassica 
rapa]
Length=598

 Score =   166 bits (419),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 109/151 (72%), Gaps = 0/151 (0%)
 Frame = +1

Query  121  FLKLSILLVLFGVGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWN  300
             L L  +++ F    AEDDV CLQG+K S  DP   L  W+F N++A  ICK  GV+CWN
Sbjct  4    LLPLLFIIISFLSPNAEDDVLCLQGLKNSLTDPSSRLTSWSFPNSSASSICKLTGVSCWN  63

Query  301  DNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDL  480
            + ENR+I L+L+ + L G++P +L+ C SLQ+LDLSGN LSG IPSQIC WLPYLVTLDL
Sbjct  64   EKENRIISLQLQSMQLAGQIPESLKLCRSLQSLDLSGNDLSGAIPSQICSWLPYLVTLDL  123

Query  481  SSNDLTGPIPPDLGNCTYLNKLILNDNKLTG  573
            S N L+GPIP  +  C +LN L+L+DNKL+G
Sbjct  124  SGNKLSGPIPTQIVECKFLNALVLSDNKLSG  154



>emb|CDY14686.1| BnaC05g19430D [Brassica napus]
Length=597

 Score =   165 bits (418),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 83/141 (59%), Positives = 104/141 (74%), Gaps = 0/141 (0%)
 Frame = +1

Query  151  FGVGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIgle  330
            F    AEDDV CLQG+K S  DP   L  W+F N++A  ICK  GV+CWN+ ENR+I L+
Sbjct  13   FLSSFAEDDVLCLQGLKKSLTDPSSRLTSWSFPNSSASSICKLTGVSCWNEKENRIISLQ  72

Query  331  lrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIP  510
            L+ + L G++P +L+ C SLQ+LDLSGN LSG IPSQIC WLPYLVTLDLS N L+GPIP
Sbjct  73   LQSMQLAGQIPESLKLCRSLQSLDLSGNDLSGAIPSQICSWLPYLVTLDLSGNKLSGPIP  132

Query  511  PDLGNCTYLNKLILNDNKLTG  573
              +  C +LN L+L+DNKL+G
Sbjct  133  TQIVECKFLNALVLSDNKLSG  153



>emb|CDY16228.1| BnaA09g29620D [Brassica napus]
Length=599

 Score =   164 bits (416),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 82/136 (60%), Positives = 103/136 (76%), Gaps = 0/136 (0%)
 Frame = +1

Query  166  AEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelreln  345
            AEDDV CLQG+K S  DP   L  W+F N++A  ICK  GV+CWN+ ENR+I L+L+ + 
Sbjct  20   AEDDVLCLQGLKNSLTDPSSRLTSWSFPNSSASSICKLTGVSCWNEKENRIISLQLQSMQ  79

Query  346  lggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGN  525
            L G++P +L+ C SLQ+LDLSGN LSG IPSQIC WLPYLVTLDLS N L+GPIP  +  
Sbjct  80   LAGQIPESLKLCRSLQSLDLSGNDLSGAIPSQICSWLPYLVTLDLSGNKLSGPIPTQIVE  139

Query  526  CTYLNKLILNDNKLTG  573
            C +LN L+L+DNKL+G
Sbjct  140  CKFLNALVLSDNKLSG  155



>ref|XP_009129373.1| PREDICTED: probable inactive receptor kinase At1g27190 [Brassica 
rapa]
Length=600

 Score =   164 bits (415),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 81/140 (58%), Positives = 104/140 (74%), Gaps = 0/140 (0%)
 Frame = +1

Query  154  GVGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglel  333
             +   EDD++CL+G++ S  DP G L  WNF NTT GF+C FVGV+CWN+ ENRVI LEL
Sbjct  26   AMAADEDDIRCLKGIQTSLTDPQGALRSWNFANTTLGFLCNFVGVSCWNNQENRVINLEL  85

Query  334  relnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPP  513
            R++ L G +P +LQ C SLQ LDLS N LSG IP Q+C WLP+LV+LDLS+NDL G +PP
Sbjct  86   RDMGLSGRIPESLQYCGSLQKLDLSTNRLSGNIPPQLCTWLPFLVSLDLSNNDLNGEVPP  145

Query  514  DLGNCTYLNKLILNDNKLTG  573
             L  C ++N L+L+ N+LTG
Sbjct  146  SLAECRFVNSLVLSKNRLTG  165



>emb|CDY47244.1| BnaA02g29300D [Brassica napus]
Length=601

 Score =   164 bits (415),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 81/140 (58%), Positives = 104/140 (74%), Gaps = 0/140 (0%)
 Frame = +1

Query  154  GVGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglel  333
             +   EDD++CL+G++ S  DP G L  WNF NTT GF+C FVGV+CWN+ ENRVI LEL
Sbjct  26   AMAADEDDIRCLKGIQTSLTDPQGALRSWNFANTTLGFLCNFVGVSCWNNQENRVINLEL  85

Query  334  relnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPP  513
            R++ L G +P +LQ C SLQ LDLS N LSG IP Q+C WLP+LV+LDLS+NDL G +PP
Sbjct  86   RDMGLSGRIPESLQYCGSLQKLDLSTNRLSGNIPPQLCTWLPFLVSLDLSNNDLNGEVPP  145

Query  514  DLGNCTYLNKLILNDNKLTG  573
             L  C ++N L+L+ N+LTG
Sbjct  146  SLAECRFVNSLVLSKNRLTG  165



>ref|XP_008353487.1| PREDICTED: LOW QUALITY PROTEIN: probable inactive receptor kinase 
At1g27190 [Malus domestica]
Length=601

 Score =   164 bits (414),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 90/162 (56%), Positives = 110/162 (68%), Gaps = 9/162 (6%)
 Frame = +1

Query  115  SRFLKLSILLVLFG---------VGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGF  267
            SR  ++ I ++L+G           V EDDV+CLQG+K S  DP G L  W+F N T G 
Sbjct  3    SRIARIWIPVLLWGCMSTHFCSYAAVVEDDVRCLQGLKQSLNDPLGKLASWDFRNHTVGX  62

Query  268  ICKFVGVACWNDNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQIC  447
            IC FVGV CWND ENR+  LELR++ + GEVP  ++ C SL  LDL GN +SG IP  IC
Sbjct  63   ICDFVGVTCWNDRENRIFSLELRDMEITGEVPKDIEYCASLTKLDLGGNEISGPIPPDIC  122

Query  448  RWLPYLVTLDLSSNDLTGPIPPDLGNCTYLNKLILNDNKLTG  573
             WLP+LVTLDLS ND +G IPPDL +C YLN LIL+DNKL+G
Sbjct  123  DWLPFLVTLDLSGNDFSGAIPPDLQHCEYLNILILSDNKLSG  164



>ref|XP_007151169.1| hypothetical protein PHAVU_004G023700g [Phaseolus vulgaris]
 gb|ESW23163.1| hypothetical protein PHAVU_004G023700g [Phaseolus vulgaris]
Length=606

 Score =   164 bits (414),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 84/157 (54%), Positives = 112/157 (71%), Gaps = 4/157 (3%)
 Frame = +1

Query  115  SRFLKLSIL---LVLFGVGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVG  285
            S FL L++L   + L    V EDDVKCL+G+K +  DP G+L LW F+NTT GFIC FVG
Sbjct  9    SSFLILTLLGFHVFLGSSQVEEDDVKCLRGIKEALSDPQGHLDLWRFENTTVGFICDFVG  68

Query  286  VACWNDNENRVIglelrelnlggeVPGALQDC-HSLQNLDLSGNGLSGTIPSQICRWLPY  462
            V CWN  ENRV+ L+ ++  L G +P A++ C  SLQ L+L+ N  S  IP +IC W+P+
Sbjct  69   VTCWNQRENRVLSLDFQDFKLSGRIPEAMKYCGKSLQRLNLASNSFSFEIPHEICTWMPF  128

Query  463  LVTLDLSSNDLTGPIPPDLGNCTYLNKLILNDNKLTG  573
            LV+LDLS N L+G IPP L NC+YLN+L+L+DN+L+G
Sbjct  129  LVSLDLSGNQLSGSIPPTLANCSYLNELMLSDNQLSG  165



>emb|CDX86433.1| BnaA06g31500D [Brassica napus]
Length=560

 Score =   163 bits (413),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 79/140 (56%), Positives = 108/140 (77%), Gaps = 0/140 (0%)
 Frame = +1

Query  154  GVGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglel  333
             +   EDD++CL+G+  S  DP+G L  WNF NTT GF+C FVGV+CWN+ ENRV+ LEL
Sbjct  24   ALAADEDDIRCLRGIHTSLTDPNGLLKSWNFANTTVGFLCNFVGVSCWNNQENRVLNLEL  83

Query  334  relnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPP  513
            R+++L G++P +L+ C SLQ LDLS N L+GTIP Q+C WLP+LV+LDLS+N L G IPP
Sbjct  84   RDMSLSGQIPDSLRFCGSLQKLDLSNNRLTGTIPRQLCSWLPFLVSLDLSNNQLNGEIPP  143

Query  514  DLGNCTYLNKLILNDNKLTG  573
            +L  C ++N L+L+DN+L+G
Sbjct  144  ELAECRFVNSLVLSDNRLSG  163



>gb|KFK44612.1| hypothetical protein AALP_AA1G281300 [Arabis alpina]
Length=598

 Score =   163 bits (413),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 83/151 (55%), Positives = 108/151 (72%), Gaps = 0/151 (0%)
 Frame = +1

Query  121  FLKLSILLVLFGVGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWN  300
            F+ L  +L    +   EDDV CLQG+K S  DP   L  W+F N ++  ICK  GV+CWN
Sbjct  5    FIALLCILFTTSLSSGEDDVLCLQGLKNSLTDPSSRLTSWSFPNASSSSICKLTGVSCWN  64

Query  301  DNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDL  480
            + ENR+I L+L+ + L G++P +L+ CHSLQ+LDLSGN LSG+IPSQIC WLPYLVTLDL
Sbjct  65   EKENRIISLQLQLMQLKGQIPESLKLCHSLQSLDLSGNDLSGSIPSQICSWLPYLVTLDL  124

Query  481  SSNDLTGPIPPDLGNCTYLNKLILNDNKLTG  573
            S N L+G IP  +  C +LN L+L+DNKL+G
Sbjct  125  SGNKLSGSIPSQIVECKFLNTLVLSDNKLSG  155



>ref|XP_006357223.1| PREDICTED: probable inactive receptor kinase At1g27190-like [Solanum 
tuberosum]
Length=615

 Score =   163 bits (412),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 100/135 (74%), Gaps = 0/135 (0%)
 Frame = +1

Query  169  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  348
            E+DVKCL+G+K +  DP   L  W+F NT+   ICK VGV+CWN+ ENR++ L+L  ++L
Sbjct  28   ENDVKCLEGIKSALSDPLNKLSSWSFSNTSVASICKLVGVSCWNEKENRLLSLQLPSMSL  87

Query  349  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  528
             G +P ALQ C SLQ+LDLSGN  SG IP QIC WLPYLV LDLSSN  +G IPP+  NC
Sbjct  88   SGSLPPALQFCTSLQSLDLSGNSFSGPIPVQICSWLPYLVNLDLSSNSFSGSIPPEFINC  147

Query  529  TYLNKLILNDNKLTG  573
             +LN L+LNDNKLTG
Sbjct  148  KFLNTLVLNDNKLTG  162



>ref|XP_009151873.1| PREDICTED: probable inactive receptor kinase At1g27190 [Brassica 
rapa]
Length=594

 Score =   163 bits (412),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 79/140 (56%), Positives = 108/140 (77%), Gaps = 0/140 (0%)
 Frame = +1

Query  154  GVGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglel  333
             +   EDD++CL+G+  S  DP+G L  WNF NTT GF+C FVGV+CWN+ ENRV+ LEL
Sbjct  24   ALAADEDDIRCLRGIHTSLTDPNGLLKSWNFANTTVGFLCNFVGVSCWNNQENRVLNLEL  83

Query  334  relnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPP  513
            R+++L G++P +L+ C SLQ LDLS N L+GTIP Q+C WLP+LV+LDLS+N L G IPP
Sbjct  84   RDMSLSGQIPDSLRFCGSLQKLDLSNNRLTGTIPRQLCSWLPFLVSLDLSNNQLNGEIPP  143

Query  514  DLGNCTYLNKLILNDNKLTG  573
            +L  C ++N L+L+DN+L+G
Sbjct  144  ELAECRFVNSLVLSDNRLSG  163



>ref|XP_010477749.1| PREDICTED: probable inactive receptor kinase At1g27190 [Camelina 
sativa]
Length=600

 Score =   162 bits (410),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 82/136 (60%), Positives = 103/136 (76%), Gaps = 0/136 (0%)
 Frame = +1

Query  166  AEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelreln  345
            AEDDV CLQG+K S +DP   L  W+F N++A  ICK  GV+CWN+ ENR+I L+L+ + 
Sbjct  22   AEDDVLCLQGLKDSLKDPSSRLTSWSFPNSSASSICKLTGVSCWNEKENRIISLQLQSMQ  81

Query  346  lggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGN  525
            L GE+P +L+ C SLQ+LDLSGN LSG+IPSQIC WLPYLVTLDLS N L G IP  +  
Sbjct  82   LAGEIPESLKLCRSLQSLDLSGNDLSGSIPSQICSWLPYLVTLDLSGNKLGGSIPTQIVE  141

Query  526  CTYLNKLILNDNKLTG  573
            C +LN L+L+DNKL+G
Sbjct  142  CKFLNALVLSDNKLSG  157



>ref|XP_008230695.1| PREDICTED: probable inactive receptor kinase At1g27190 [Prunus 
mume]
Length=604

 Score =   162 bits (409),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 83/138 (60%), Positives = 102/138 (74%), Gaps = 0/138 (0%)
 Frame = +1

Query  160  GVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelre  339
             V EDDVKCLQ +K S +DP G L  W+F NT+   +CKFVGV CWND ENR++ LELR+
Sbjct  29   AVVEDDVKCLQSLKQSLKDPLGKLASWDFRNTSVVSMCKFVGVTCWNDRENRILNLELRD  88

Query  340  lnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDL  519
            + L G +   ++ C SLQNLDL GN LSG+IP  IC WLP+LVTLD S+ND +G IP DL
Sbjct  89   MELSGAIAKDIEYCSSLQNLDLGGNKLSGSIPPDICTWLPFLVTLDFSNNDFSGSIPTDL  148

Query  520  GNCTYLNKLILNDNKLTG  573
             +C YLN LIL+DNKL+G
Sbjct  149  QHCKYLNNLILSDNKLSG  166



>ref|XP_006303937.1| hypothetical protein CARUB_v10008631mg [Capsella rubella]
 gb|EOA36835.1| hypothetical protein CARUB_v10008631mg [Capsella rubella]
Length=601

 Score =   162 bits (409),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 102/136 (75%), Gaps = 0/136 (0%)
 Frame = +1

Query  166  AEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelreln  345
            AEDDV CLQG+K S  DP   L  W+F N++A  ICK  GV+CWN+ ENR+I L+L+ + 
Sbjct  24   AEDDVLCLQGLKNSLTDPSSRLSTWSFPNSSASSICKLSGVSCWNEKENRIISLQLQSMQ  83

Query  346  lggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGN  525
            L GE+P +L+ C SLQ+LDLSGN LSG+IPSQIC WLPYLVTLDLS N L G IP  +  
Sbjct  84   LAGEIPESLKLCRSLQSLDLSGNDLSGSIPSQICSWLPYLVTLDLSGNKLGGSIPTQIVE  143

Query  526  CTYLNKLILNDNKLTG  573
            C +LN LIL+DNKL+G
Sbjct  144  CKFLNALILSDNKLSG  159



>ref|XP_006416011.1| hypothetical protein EUTSA_v10009684mg [Eutrema salsugineum]
 gb|ESQ34364.1| hypothetical protein EUTSA_v10009684mg [Eutrema salsugineum]
Length=601

 Score =   162 bits (409),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 80/136 (59%), Positives = 102/136 (75%), Gaps = 0/136 (0%)
 Frame = +1

Query  166  AEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelreln  345
            AEDDV CLQG+K S  DP   L  W+F N +A  ICK  GV+CWN+ ENR+I L+L+ + 
Sbjct  24   AEDDVLCLQGLKNSLTDPSSRLTTWSFPNASASSICKLTGVSCWNEKENRIISLQLQSMQ  83

Query  346  lggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGN  525
            L G++P +L+ C SLQ+LDLSGN LSG+IP QIC WLPYLVTLDLS N L+G IP  + +
Sbjct  84   LAGQIPESLKLCRSLQSLDLSGNDLSGSIPPQICSWLPYLVTLDLSGNKLSGSIPTQIAD  143

Query  526  CTYLNKLILNDNKLTG  573
            C +LN L+L+DNKL+G
Sbjct  144  CKFLNALVLSDNKLSG  159



>ref|XP_004298597.1| PREDICTED: probable inactive receptor kinase At1g27190 [Fragaria 
vesca subsp. vesca]
Length=605

 Score =   161 bits (408),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 101/135 (75%), Gaps = 0/135 (0%)
 Frame = +1

Query  169  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  348
            EDD+ CL GVK S  DP G L  WN  N +   ICK VGV+CWN+ ENR++ L+L  ++L
Sbjct  24   EDDLACLAGVKSSLADPGGRLSQWNLANNSVASICKLVGVSCWNEKENRLLSLQLPSMSL  83

Query  349  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  528
             GE+P +L+ CHSLQ LDLSGN LSG++P QIC WLPYLVTLDLS+N L+G IPP++ NC
Sbjct  84   AGELPESLKYCHSLQTLDLSGNALSGSVPPQICDWLPYLVTLDLSNNRLSGSIPPEIVNC  143

Query  529  TYLNKLILNDNKLTG  573
             +LN L+LNDN  +G
Sbjct  144  KFLNTLLLNDNGFSG  158



>gb|KDP21268.1| hypothetical protein JCGZ_21739 [Jatropha curcas]
Length=601

 Score =   161 bits (408),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 104/151 (69%), Gaps = 3/151 (2%)
 Frame = +1

Query  121  FLKLSILLVLFGVGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWN  300
            FL L  L V+F +   EDDV CL+G+K SF DP   L  W+  N +   ICK  GVACWN
Sbjct  6    FLFLFTLPVVFAI---EDDVTCLEGLKNSFTDPLSRLASWDLTNNSVASICKLNGVACWN  62

Query  301  DNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDL  480
            + ENR+I L L    L G++P +L+ C SLQ LDLS N LSG+IP QIC WLPY+VTLDL
Sbjct  63   EKENRIISLNLPASELSGQLPDSLKYCRSLQTLDLSNNALSGSIPPQICTWLPYIVTLDL  122

Query  481  SSNDLTGPIPPDLGNCTYLNKLILNDNKLTG  573
            S N  +G IPP++ NC +LN LILNDNKL+G
Sbjct  123  SGNSFSGAIPPEIVNCKFLNNLILNDNKLSG  153



>ref|XP_010498954.1| PREDICTED: probable inactive receptor kinase At1g27190 [Camelina 
sativa]
Length=598

 Score =   161 bits (408),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 82/136 (60%), Positives = 103/136 (76%), Gaps = 0/136 (0%)
 Frame = +1

Query  166  AEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelreln  345
            AEDDV CLQG+K S  DP   L  W+F N++A  ICK  GV+CWN+ ENR+I L+L+ + 
Sbjct  21   AEDDVLCLQGLKNSLTDPSSRLTSWSFPNSSASSICKLTGVSCWNEKENRIISLQLQSMQ  80

Query  346  lggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGN  525
            L GE+P +L+ C SLQ+LDLSGN LSG+IPSQIC WLPYLVTLDLS N+L G IP  +  
Sbjct  81   LAGEIPESLKLCRSLQSLDLSGNDLSGSIPSQICSWLPYLVTLDLSGNNLGGSIPTQIVE  140

Query  526  CTYLNKLILNDNKLTG  573
            C +LN L+L+DNKL+G
Sbjct  141  CKFLNALVLSDNKLSG  156



>ref|XP_002890616.1| hypothetical protein ARALYDRAFT_889992 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66875.1| hypothetical protein ARALYDRAFT_889992 [Arabidopsis lyrata subsp. 
lyrata]
Length=601

 Score =   161 bits (408),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 102/136 (75%), Gaps = 0/136 (0%)
 Frame = +1

Query  166  AEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelreln  345
            AEDDV CLQG+K S  DP   L  W+F N++A  ICK  GV+CWN+ ENR+I L+L+ + 
Sbjct  24   AEDDVLCLQGLKNSLIDPSSRLSSWSFPNSSASSICKLTGVSCWNEKENRIISLQLQSMQ  83

Query  346  lggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGN  525
            L GE+P +L+ C SLQ+LDLSGN LSG+IPSQIC WLPYLVTLDLS N L G IP  +  
Sbjct  84   LAGEIPESLKLCRSLQSLDLSGNDLSGSIPSQICSWLPYLVTLDLSGNKLGGSIPTQIVE  143

Query  526  CTYLNKLILNDNKLTG  573
            C +LN LIL+DNKL+G
Sbjct  144  CKFLNALILSDNKLSG  159



>ref|XP_010912844.1| PREDICTED: LOW QUALITY PROTEIN: probable inactive receptor kinase 
At1g27190 [Elaeis guineensis]
Length=614

 Score =   161 bits (407),  Expect = 8e-43, Method: Composition-based stats.
 Identities = 80/135 (59%), Positives = 98/135 (73%), Gaps = 2/135 (1%)
 Frame = +1

Query  169  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  348
            E+DV CL+GV+ S  DP+G+L  WNF NTT GF+C FVGV+CWN  ENRVI L L  ++L
Sbjct  27   ENDVNCLRGVQESL-DPNGSLN-WNFANTTVGFVCNFVGVSCWNPQENRVIALSLPSMSL  84

Query  349  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  528
             G +P ALQ C +   LDLS N LSG IPS +C WLPYLVTLDLSSN L+G IPP+L  C
Sbjct  85   AGSIPSALQYCRTATTLDLSSNSLSGPIPSSLCDWLPYLVTLDLSSNSLSGLIPPELSKC  144

Query  529  TYLNKLILNDNKLTG  573
             +LN L+L+ N  +G
Sbjct  145  RFLNTLLLSSNSFSG  159



>ref|NP_174039.1| leucine-rich repeat protein kinase family protein [Arabidopsis 
thaliana]
 sp|O04567.1|Y1719_ARATH RecName: Full=Probable inactive receptor kinase At1g27190; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAF79872.1|AC000348_25 T7N9.25 [Arabidopsis thaliana]
 gb|AAU94364.1| At1g27190 [Arabidopsis thaliana]
 gb|ACN59234.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE30792.1| leucine-rich repeat protein kinase family protein [Arabidopsis 
thaliana]
Length=601

 Score =   161 bits (407),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 102/136 (75%), Gaps = 0/136 (0%)
 Frame = +1

Query  166  AEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelreln  345
            AEDDV CLQG+K S  DP   L  W+F N++A  ICK  GV+CWN+ ENR+I L+L+ + 
Sbjct  24   AEDDVLCLQGLKNSLIDPSSRLSSWSFPNSSASSICKLTGVSCWNEKENRIISLQLQSMQ  83

Query  346  lggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGN  525
            L GE+P +L+ C SLQ+LDLSGN LSG+IPSQIC WLPYLVTLDLS N L G IP  +  
Sbjct  84   LAGEIPESLKLCRSLQSLDLSGNDLSGSIPSQICSWLPYLVTLDLSGNKLGGSIPTQIVE  143

Query  526  CTYLNKLILNDNKLTG  573
            C +LN LIL+DNKL+G
Sbjct  144  CKFLNALILSDNKLSG  159



>ref|XP_010460207.1| PREDICTED: probable inactive receptor kinase At1g27190 [Camelina 
sativa]
Length=598

 Score =   160 bits (406),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 85/148 (57%), Positives = 107/148 (72%), Gaps = 0/148 (0%)
 Frame = +1

Query  130  LSILLVLFGVGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNE  309
            L I  +L     AEDDV CLQG+K S  DP   L  W+F N++A  ICK  GV+CWN+ E
Sbjct  9    LFITTLLCSSSSAEDDVLCLQGLKNSLTDPSSRLTSWSFPNSSASSICKLSGVSCWNEKE  68

Query  310  NRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSN  489
            NR+I L+L+ + L GE+P +L+ C SLQ+LDLSGN LSG+IPSQIC WLPYLVTLDLS N
Sbjct  69   NRIISLQLQSMQLAGEIPESLKLCRSLQSLDLSGNDLSGSIPSQICSWLPYLVTLDLSGN  128

Query  490  DLTGPIPPDLGNCTYLNKLILNDNKLTG  573
            +L G IP  +  C +LN L+L+DNKL+G
Sbjct  129  NLGGSIPTQIVECKFLNALVLSDNKLSG  156



>ref|XP_010683354.1| PREDICTED: probable inactive receptor kinase At1g27190 [Beta 
vulgaris subsp. vulgaris]
Length=597

 Score =   160 bits (406),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 101/135 (75%), Gaps = 0/135 (0%)
 Frame = +1

Query  169  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  348
            +DDVKCLQGVK S  DP   L  W+FDNT+   ICKF GV+CWN+ E+R++ L+L  + L
Sbjct  20   DDDVKCLQGVKSSISDPQNRLSNWHFDNTSVDSICKFTGVSCWNEKEDRLLSLQLPAMFL  79

Query  349  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  528
             G++P +LQ C SLQ LD SGN +SG IP QIC WLPYLVTLDLS N+L+G IP  + NC
Sbjct  80   AGKLPSSLQFCRSLQTLDFSGNQISGEIPPQICDWLPYLVTLDLSGNELSGSIPTQIENC  139

Query  529  TYLNKLILNDNKLTG  573
             +LN LIL++NKL+G
Sbjct  140  KFLNSLILSNNKLSG  154



>ref|XP_007216971.1| hypothetical protein PRUPE_ppa003100mg [Prunus persica]
 gb|EMJ18170.1| hypothetical protein PRUPE_ppa003100mg [Prunus persica]
Length=604

 Score =   160 bits (406),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 83/138 (60%), Positives = 102/138 (74%), Gaps = 0/138 (0%)
 Frame = +1

Query  160  GVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelre  339
             V EDDVKCLQ +K S +DP G L  W+F NT+   +CKFVGV CWND ENR++ LELR+
Sbjct  29   AVVEDDVKCLQSLKQSLKDPLGKLVSWDFRNTSVVSMCKFVGVTCWNDRENRILNLELRD  88

Query  340  lnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDL  519
            + L G +   ++ C SLQNLDL GN LSG+IP  IC WLP+LVTLD S+ND +G IP DL
Sbjct  89   MELSGAIAKDIEYCSSLQNLDLGGNKLSGSIPPDICTWLPFLVTLDFSNNDFSGSIPTDL  148

Query  520  GNCTYLNKLILNDNKLTG  573
             +C YLN LIL+DNKL+G
Sbjct  149  QHCKYLNNLILSDNKLSG  166



>ref|XP_008800372.1| PREDICTED: probable inactive receptor kinase At1g27190 [Phoenix 
dactylifera]
Length=618

 Score =   160 bits (406),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 79/139 (57%), Positives = 98/139 (71%), Gaps = 1/139 (1%)
 Frame = +1

Query  157  VGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelr  336
            V   EDDV+CL+GV+ +   PDG L  WNF N T GF+C FVGV+CWN  ENRVI L L 
Sbjct  25   VATDEDDVRCLRGVQQALSAPDGGLN-WNFSNKTVGFVCNFVGVSCWNPQENRVIALSLP  83

Query  337  elnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPD  516
             ++L G +P ALQ C +   LDLS N LSG IPS +C WLP+LVTLDLSSN L+GP+PP+
Sbjct  84   SMSLSGTIPSALQYCRAATTLDLSSNSLSGLIPSDLCDWLPFLVTLDLSSNSLSGPVPPE  143

Query  517  LGNCTYLNKLILNDNKLTG  573
            L  C +LN L+L+ N  +G
Sbjct  144  LSKCRFLNALLLSSNSFSG  162



>ref|XP_011043889.1| PREDICTED: probable inactive receptor kinase At1g27190 [Populus 
euphratica]
Length=609

 Score =   160 bits (404),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 99/135 (73%), Gaps = 0/135 (0%)
 Frame = +1

Query  169  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  348
            EDDV CL+GVK SF DP G L  W F+N +  +ICK  GV+CWN+ ENR+I L+L    L
Sbjct  24   EDDVTCLEGVKNSFTDPLGRLTSWAFNNNSVAYICKLNGVSCWNEKENRIISLQLPLFQL  83

Query  349  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  528
             G++P +L+ CHSL  LDLS N LSG IP +IC WLPY+VTLDLS N  +GPIPP++ NC
Sbjct  84   SGKLPESLKYCHSLTTLDLSNNDLSGPIPPEICNWLPYVVTLDLSGNKFSGPIPPEIVNC  143

Query  529  TYLNKLILNDNKLTG  573
             +LN LIL+ NKLTG
Sbjct  144  KFLNTLILSGNKLTG  158



>gb|KDO72412.1| hypothetical protein CISIN_1g040267mg [Citrus sinensis]
Length=538

 Score =   159 bits (402),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 83/139 (60%), Positives = 105/139 (76%), Gaps = 1/139 (1%)
 Frame = +1

Query  157  VGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelr  336
               AEDDVKCL G+K SF DP G L  W+  N++ GFIC+F GV+CWN  ENR++ LEL 
Sbjct  6    TATAEDDVKCLAGIK-SFNDPQGKLSSWSLTNSSVGFICRFNGVSCWNGLENRILSLELE  64

Query  337  elnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPD  516
            E+NL G+VP +LQ C SLQ L+LS N L G IP+Q+C+W PYLV+LDLS+NDL+G IP +
Sbjct  65   EMNLSGQVPESLQSCKSLQVLNLSTNNLFGKIPTQLCKWFPYLVSLDLSNNDLSGTIPHE  124

Query  517  LGNCTYLNKLILNDNKLTG  573
            LGNC YLN L L+ N+L+G
Sbjct  125  LGNCVYLNTLYLSYNRLSG  143



>ref|XP_003580015.1| PREDICTED: probable inactive receptor kinase At1g27190 [Brachypodium 
distachyon]
Length=630

 Score =   159 bits (403),  Expect = 4e-42, Method: Composition-based stats.
 Identities = 74/135 (55%), Positives = 93/135 (69%), Gaps = 0/135 (0%)
 Frame = +1

Query  169  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  348
            EDD++CL+GVK   +DPDG L  WNF NT+AG +C + GV CWN  E+RVI L L    L
Sbjct  35   EDDLRCLRGVKDGLQDPDGRLASWNFRNTSAGALCDYSGVTCWNPQESRVITLSLSGFGL  94

Query  349  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  528
             G VP +LQ C S    DLSGNGL G IP  +C W+P++V+LDLS N L+GP+P +L NC
Sbjct  95   RGHVPSSLQYCGSANTFDLSGNGLDGPIPPALCDWIPFVVSLDLSGNKLSGPLPAELANC  154

Query  529  TYLNKLILNDNKLTG  573
             +LN L L+DN  TG
Sbjct  155  RFLNSLKLSDNAFTG  169



>ref|XP_006372487.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|ERP50284.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=606

 Score =   159 bits (402),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 77/135 (57%), Positives = 99/135 (73%), Gaps = 0/135 (0%)
 Frame = +1

Query  169  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  348
            EDD+ CL+GVK SF DP G L  W F+N +  F+CK  GV+CWN+ ENR+I L+L    L
Sbjct  23   EDDITCLEGVKKSFTDPLGRLTSWTFNNNSVAFVCKLNGVSCWNEKENRIISLQLSSFQL  82

Query  349  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  528
             G++P +L+ CHSL  LDLS N LSG IP +IC WLPY+V+LDLS N  +GPIPP++ NC
Sbjct  83   SGKLPESLKYCHSLTTLDLSSNDLSGPIPPEICNWLPYIVSLDLSGNKFSGPIPPEIVNC  142

Query  529  TYLNKLILNDNKLTG  573
             +LN LIL+ N+LTG
Sbjct  143  KFLNNLILSGNQLTG  157



>ref|XP_004148679.1| PREDICTED: probable inactive receptor kinase At1g27190-like [Cucumis 
sativus]
 ref|XP_004168438.1| PREDICTED: probable inactive receptor kinase At1g27190-like [Cucumis 
sativus]
 gb|KGN52424.1| hypothetical protein Csa_5G633220 [Cucumis sativus]
Length=604

 Score =   158 bits (400),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 80/138 (58%), Positives = 102/138 (74%), Gaps = 1/138 (1%)
 Frame = +1

Query  163  VAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFIC-KFVGVACWNDNENRVIglelre  339
            V EDD++CL+GVK +  DP G L  W+F NT+ G +C KFVG++CWND ENR++ LEL++
Sbjct  28   VPEDDIRCLRGVKNALVDPIGRLSSWDFKNTSVGHLCDKFVGLSCWNDRENRILSLELKD  87

Query  340  lnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDL  519
            + L G +   LQ C SLQ LDLSGN  SG IP  IC WLPYLV++DLS+N  TG IP DL
Sbjct  88   MKLSGSISEDLQYCVSLQKLDLSGNSFSGEIPPHICEWLPYLVSMDLSNNQFTGSIPADL  147

Query  520  GNCTYLNKLILNDNKLTG  573
              C+YLN LIL+DN+L+G
Sbjct  148  ARCSYLNSLILSDNELSG  165



>ref|XP_008458707.1| PREDICTED: probable inactive receptor kinase At1g27190 [Cucumis 
melo]
Length=604

 Score =   158 bits (399),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 80/138 (58%), Positives = 102/138 (74%), Gaps = 1/138 (1%)
 Frame = +1

Query  163  VAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFIC-KFVGVACWNDNENRVIglelre  339
            V EDD++CL+GVK +  DP G L  W+F NT+ G +C KFVG++CWND ENR++ LEL++
Sbjct  28   VPEDDIRCLRGVKNALVDPLGRLSSWDFKNTSVGHLCNKFVGLSCWNDRENRILSLELKD  87

Query  340  lnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDL  519
            + L G +   LQ C SLQ LDLSGN  SG IP  IC WLPYLV++DLS+N  TG IP DL
Sbjct  88   MKLSGSISEDLQYCVSLQKLDLSGNSFSGEIPPHICEWLPYLVSMDLSNNQFTGSIPADL  147

Query  520  GNCTYLNKLILNDNKLTG  573
              C+YLN LIL+DN+L+G
Sbjct  148  ARCSYLNSLILSDNELSG  165



>ref|XP_009799074.1| PREDICTED: probable inactive receptor kinase At1g27190 [Nicotiana 
sylvestris]
Length=617

 Score =   158 bits (399),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 79/136 (58%), Positives = 102/136 (75%), Gaps = 1/136 (1%)
 Frame = +1

Query  169  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTT-AGFICKFVGVACWNDNENRVIglelreln  345
            E+D+KCL+G+K +  DP   L  W+F NT+ A  ICK VGV+CWN+ ENR+I L+L  ++
Sbjct  28   ENDIKCLEGIKSALSDPLNKLSSWSFSNTSIAASICKLVGVSCWNEKENRLISLQLPSMS  87

Query  346  lggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGN  525
            L G +P +LQ C SLQ+LDLSGN LSG++P Q+C WLPYLV LDLS N  +G IPP+  N
Sbjct  88   LSGSLPPSLQYCTSLQSLDLSGNSLSGSLPVQLCSWLPYLVNLDLSGNSFSGSIPPEFIN  147

Query  526  CTYLNKLILNDNKLTG  573
            C +LN L+LNDNKLTG
Sbjct  148  CKFLNTLLLNDNKLTG  163



>ref|XP_009602624.1| PREDICTED: probable inactive receptor kinase At1g27190 [Nicotiana 
tomentosiformis]
Length=617

 Score =   157 bits (398),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 79/136 (58%), Positives = 102/136 (75%), Gaps = 1/136 (1%)
 Frame = +1

Query  169  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTT-AGFICKFVGVACWNDNENRVIglelreln  345
            E+D+KCL+G+K +  DP   L  W+F NT+ A  ICK VGV+CWN+ ENR+I L+L  ++
Sbjct  28   ENDIKCLEGIKSALSDPLNKLSSWSFSNTSVAASICKLVGVSCWNEKENRLISLQLPSMS  87

Query  346  lggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGN  525
            L G +P +LQ C SLQ+LDLSGN LSG++P Q+C WLPYLV LDLS N  +G IPP+  N
Sbjct  88   LSGSLPPSLQYCTSLQSLDLSGNSLSGSLPVQLCSWLPYLVNLDLSGNSFSGSIPPEFIN  147

Query  526  CTYLNKLILNDNKLTG  573
            C +LN L+LNDNKLTG
Sbjct  148  CKFLNTLLLNDNKLTG  163



>ref|XP_011038318.1| PREDICTED: probable inactive receptor kinase At1g27190 [Populus 
euphratica]
Length=607

 Score =   157 bits (396),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 76/135 (56%), Positives = 97/135 (72%), Gaps = 0/135 (0%)
 Frame = +1

Query  169  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  348
            EDD+ CL+GVK SF DP   L  W F+N +  F+CK  GV+CWN+ ENR+I L+L    L
Sbjct  23   EDDITCLEGVKKSFTDPLSRLSSWTFNNNSVAFVCKLNGVSCWNEKENRIISLQLSSFEL  82

Query  349  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  528
             G++P +L+ CHSL  LDLS N LSG IP +IC WLPY+V LDLS N  +GPIPP++ NC
Sbjct  83   SGKLPESLKYCHSLTTLDLSSNDLSGPIPPEICNWLPYIVNLDLSGNKFSGPIPPEIVNC  142

Query  529  TYLNKLILNDNKLTG  573
             +LN LIL+ N+LTG
Sbjct  143  KFLNNLILSRNQLTG  157



>ref|XP_009105677.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g69990 [Brassica rapa]
Length=596

 Score =   156 bits (395),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 104/146 (71%), Gaps = 0/146 (0%)
 Frame = +1

Query  136  ILLVLFGVGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENR  315
            I+L+      AEDDV CL+G+K S  DP G L  W+F N+++  ICK  GV+CWN  ENR
Sbjct  14   IILISSSSSYAEDDVLCLKGLKNSLTDPSGRLSTWSFPNSSSSSICKLTGVSCWNAKENR  73

Query  316  VIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDL  495
            ++ L L  + L G++P +L+ C SLQ+LDLSGN +SG IP +IC WLPYLVTLDLS N L
Sbjct  74   ILSLHLPSMQLAGKIPESLKLCRSLQSLDLSGNDISGEIPPEICSWLPYLVTLDLSGNKL  133

Query  496  TGPIPPDLGNCTYLNKLILNDNKLTG  573
            +G IP ++ NC +LN L LN+NKLTG
Sbjct  134  SGEIPSEIVNCKFLNGLALNENKLTG  159



>ref|XP_004238738.1| PREDICTED: probable inactive receptor kinase At1g27190 [Solanum 
lycopersicum]
Length=610

 Score =   155 bits (393),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 101/135 (75%), Gaps = 0/135 (0%)
 Frame = +1

Query  169  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  348
            E+DVKCL+G+K +F DP   L  W+F NT+   ICK VGV+CWN+ ENR++ L+L  ++L
Sbjct  28   ENDVKCLEGIKSAFSDPLNKLSSWSFSNTSVASICKLVGVSCWNEKENRLLSLQLPSMSL  87

Query  349  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  528
             G +P +LQ C SLQ+LDLSGN  SG IP QIC WLPYLV LDLSSN  +G IPP+  NC
Sbjct  88   SGSLPSSLQFCSSLQSLDLSGNSFSGPIPVQICSWLPYLVNLDLSSNYFSGSIPPEFINC  147

Query  529  TYLNKLILNDNKLTG  573
             +LN L+LNDNKLTG
Sbjct  148  KFLNTLLLNDNKLTG  162



>gb|ABR16721.1| unknown [Picea sitchensis]
Length=613

 Score =   155 bits (392),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 75/137 (55%), Positives = 103/137 (75%), Gaps = 0/137 (0%)
 Frame = +1

Query  163  VAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrel  342
            VAE+D++CLQ  K   +DP  NL  WNFDN+T GFIC F+G+ CW++++N+V+ + L+E+
Sbjct  29   VAENDIQCLQSTKNHLKDPQDNLYTWNFDNSTKGFICNFLGITCWHNDDNKVLSISLQEM  88

Query  343  nlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLG  522
             L GE P  ++ C S+ +L LS N L+GTIP ++C+WLPYLVT+DLS N+ TG IP +L 
Sbjct  89   GLQGEFPPGVKYCGSMTSLTLSQNSLTGTIPKELCQWLPYLVTIDLSQNEFTGSIPAELH  148

Query  523  NCTYLNKLILNDNKLTG  573
            NCTYLN L LN N+LTG
Sbjct  149  NCTYLNILRLNGNQLTG  165



>ref|XP_006849112.1| hypothetical protein AMTR_s00028p00246730 [Amborella trichopoda]
 gb|ERN10693.1| hypothetical protein AMTR_s00028p00246730 [Amborella trichopoda]
Length=620

 Score =   155 bits (391),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 79/137 (58%), Positives = 101/137 (74%), Gaps = 0/137 (0%)
 Frame = +1

Query  163  VAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrel  342
            VAEDDV+CL+  K    DP GNL  WNF NT+AGFIC F GV CW++NEN+V+ L L  L
Sbjct  40   VAEDDVQCLRATKSELLDPQGNLVSWNFGNTSAGFICAFGGVTCWHENENKVLDLRLSSL  99

Query  343  nlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLG  522
            +L G VP +L+ C S+ +LD+S N +SG IP+ +C WLP+LVTLDLS N L+G IPP+L 
Sbjct  100  SLSGPVPSSLRLCSSMTSLDISKNSISGPIPANLCDWLPFLVTLDLSHNQLSGHIPPELV  159

Query  523  NCTYLNKLILNDNKLTG  573
            NC +LN L L+ NKL+G
Sbjct  160  NCRFLNTLRLDSNKLSG  176



>gb|KHN34180.1| Putative inactive receptor kinase [Glycine soja]
Length=610

 Score =   154 bits (390),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/136 (57%), Positives = 103/136 (76%), Gaps = 1/136 (1%)
 Frame = +1

Query  169  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  348
            EDDV CL+G+K +  DP   L  W FDNTT GFIC FVGV+CWN  ENRVIGL+L++  L
Sbjct  29   EDDVTCLKGIKETLSDPLNRLSNWRFDNTTVGFICDFVGVSCWNQRENRVIGLDLQDFKL  88

Query  349  ggeVPGALQDC-HSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGN  525
             G++P AL+ C  S+Q LDL+ N  S  IP +IC W+P+LV++DLSSN L+G IPP + N
Sbjct  89   SGKIPEALKYCGKSIQRLDLASNSFSSEIPHEICTWMPFLVSIDLSSNQLSGVIPPTIDN  148

Query  526  CTYLNKLILNDNKLTG  573
            C+YLN+L+L++N+L+G
Sbjct  149  CSYLNELVLSNNQLSG  164



>emb|CDY38780.1| BnaA07g28520D [Brassica napus]
Length=600

 Score =   154 bits (389),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 100/136 (74%), Gaps = 0/136 (0%)
 Frame = +1

Query  166  AEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelreln  345
            AEDDV CL+G+K S  DP G L  W+F N+++  ICK  GV+CWN  ENR++ L L  + 
Sbjct  28   AEDDVLCLKGLKNSLTDPSGRLSTWSFPNSSSSSICKLTGVSCWNAKENRILSLHLPSMQ  87

Query  346  lggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGN  525
            L G++P +L+ C SLQ+LDLSGN +SG IP +IC WLPYLVTLDLS N L+G IP ++ N
Sbjct  88   LAGKIPESLKLCRSLQSLDLSGNDISGEIPPEICSWLPYLVTLDLSGNKLSGEIPSEIVN  147

Query  526  CTYLNKLILNDNKLTG  573
            C +LN L LN+NKLTG
Sbjct  148  CKFLNGLALNENKLTG  163



>ref|XP_002268171.1| PREDICTED: probable inactive receptor kinase At1g27190 [Vitis 
vinifera]
Length=611

 Score =   153 bits (386),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 78/128 (61%), Positives = 96/128 (75%), Gaps = 1/128 (1%)
 Frame = +1

Query  154  GVGVA-EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIgle  330
             V VA EDDV CLQG+K S  DPD  +  W F NT+A FIC  VGV+CWN  E+R+I L+
Sbjct  24   AVAVAIEDDVVCLQGLKDSLTDPDDKISTWRFTNTSASFICNLVGVSCWNAQESRIISLQ  83

Query  331  lrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIP  510
            L ++NL G +P +LQ C SLQ+L LSGN +SG+IP QIC WLPY+VTLDLS NDLTGPIP
Sbjct  84   LPDMNLIGTLPDSLQHCRSLQSLGLSGNRISGSIPDQICTWLPYVVTLDLSHNDLTGPIP  143

Query  511  PDLGNCTY  534
            P++ NC +
Sbjct  144  PEMVNCKF  151



>ref|XP_006595242.1| PREDICTED: probable inactive receptor kinase At1g27190-like [Glycine 
max]
Length=234

 Score =   146 bits (369),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 75/153 (49%), Positives = 107/153 (70%), Gaps = 2/153 (1%)
 Frame = +1

Query  121  FLKLSILLVLFGVGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWN  300
            F+ L  L V F     ED V+CL+G++ +  DP   L  W FDNTT+GFIC F GV+CW 
Sbjct  14   FITLLGLHVYFASSQVEDYVRCLRGIEDTVSDPQARLATWRFDNTTSGFICDFEGVSCWG  73

Query  301  DNENRVIglelrelnlg-geVPGALQDC-HSLQNLDLSGNGLSGTIPSQICRWLPYLVTL  474
              ENRV+GL+LR+  L   ++P AL+ C  S+Q LDL+ +  +  IP +IC W+P+LV++
Sbjct  74   RRENRVLGLDLRDTKLSGNKIPEALKYCGKSIQRLDLASDSFTSKIPREICTWMPFLVSI  133

Query  475  DLSSNDLTGPIPPDLGNCTYLNKLILNDNKLTG  573
            DLSSN L+G IPP + NC+YLN+L+L++N+L+G
Sbjct  134  DLSSNKLSGHIPPTIVNCSYLNELVLSNNQLSG  166



>gb|KFK41423.1| hypothetical protein AALP_AA2G128900 [Arabis alpina]
Length=595

 Score =   152 bits (384),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 81/146 (55%), Positives = 101/146 (69%), Gaps = 2/146 (1%)
 Frame = +1

Query  136  ILLVLFGVGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENR  315
            +L +L     AEDDV CL+G+K S  DP   L  W F NT++  ICK  GV+CWN  ENR
Sbjct  8    LLTILISSSNAEDDVLCLKGLKSSLTDPSNRLNTWVFSNTSS--ICKLTGVSCWNAKENR  65

Query  316  VIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDL  495
            +I L+L+ + L G++P +L+ C SLQ+LDLS N  SG+IPS+IC WLPYLVTLDLS N L
Sbjct  66   IISLQLQSMQLAGQIPESLKLCRSLQSLDLSNNDFSGSIPSEICSWLPYLVTLDLSGNKL  125

Query  496  TGPIPPDLGNCTYLNKLILNDNKLTG  573
             G IP  +  C +LN L LNDNKLTG
Sbjct  126  GGSIPSRIVECKFLNSLALNDNKLTG  151



>ref|NP_177157.1| putative LRR receptor-like serine/threonine-protein kinase [Arabidopsis 
thaliana]
 sp|C0LGI5.1|Y1699_ARATH RecName: Full=Probable LRR receptor-like serine/threonine-protein 
kinase At1g69990; Flags: Precursor [Arabidopsis thaliana]
 gb|ACN59270.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE35006.1| putative LRR receptor-like serine/threonine-protein kinase [Arabidopsis 
thaliana]
Length=591

 Score =   152 bits (383),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 78/152 (51%), Positives = 105/152 (69%), Gaps = 1/152 (1%)
 Frame = +1

Query  118  RFLKLSILLVLFGVGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACW  297
            + + +  +++L     AEDDV CL+G K S +DP   L  W+F N+++  ICK  GV+CW
Sbjct  2    KTISIFFVIILMSSSHAEDDVLCLKGFKSSLKDPSNQLNTWSFPNSSSS-ICKLTGVSCW  60

Query  298  NDNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLD  477
            N  ENR++ L+L+ + L G++P +L+ C SLQ+LDLS N  SG IPSQIC WLPYLVTLD
Sbjct  61   NAKENRILSLQLQSMQLSGQIPESLKLCRSLQSLDLSFNDFSGLIPSQICSWLPYLVTLD  120

Query  478  LSSNDLTGPIPPDLGNCTYLNKLILNDNKLTG  573
            LS N L+G IP  + +C +LN L LN NKLTG
Sbjct  121  LSGNKLSGSIPSQIVDCKFLNSLALNQNKLTG  152



>gb|KHN13260.1| Putative inactive receptor kinase [Glycine soja]
Length=608

 Score =   152 bits (383),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 77/144 (53%), Positives = 102/144 (71%), Gaps = 1/144 (1%)
 Frame = +1

Query  145  VLFGVGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIg  324
            V F     E DV+CL+G+K +  DP   L  W FDNTT GFICKF GV+CWND ENRV+ 
Sbjct  23   VFFVSSQVEGDVRCLKGIKETLSDPLNRLSDWRFDNTTIGFICKFAGVSCWNDRENRVLS  82

Query  325  lelrelnlggeVPGALQDC-HSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTG  501
            L LR+  L G++P AL+ C  ++Q LDL+ N  S  IP  IC W+P+LV+LDLSSN L+G
Sbjct  83   LTLRDFKLSGKIPEALKYCGKNIQKLDLASNSFSLEIPRNICSWMPFLVSLDLSSNQLSG  142

Query  502  PIPPDLGNCTYLNKLILNDNKLTG  573
             IPP +  C+YLN+L+L++N+L+G
Sbjct  143  FIPPTIDKCSYLNELVLSNNQLSG  166



>ref|XP_004489358.1| PREDICTED: probable inactive receptor kinase At1g27190-like [Cicer 
arietinum]
Length=601

 Score =   151 bits (381),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 78/138 (57%), Positives = 99/138 (72%), Gaps = 1/138 (1%)
 Frame = +1

Query  163  VAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrel  342
            V ED+V+CL+G+K +  D +  L  W FDNTT GFIC FVGV CWN  ENRV+GLEL+ +
Sbjct  24   VEEDNVRCLKGIKQTLVDSENRLSTWRFDNTTVGFICDFVGVTCWNLRENRVLGLELQGM  83

Query  343  nlggeVPGALQDC-HSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDL  519
             L G +P AL+ C  SLQ LDL  N LS  IP+QIC W+P+LVT+DLS N+L G IP  +
Sbjct  84   KLSGMIPEALKYCGQSLQKLDLGSNSLSSVIPTQICSWMPFLVTMDLSDNNLEGSIPSTI  143

Query  520  GNCTYLNKLILNDNKLTG  573
             NC+YLN+L+L+DN   G
Sbjct  144  VNCSYLNELMLSDNNFVG  161



>ref|NP_001174416.1| Os05g0399800 [Oryza sativa Japonica Group]
 dbj|BAH01231.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE63653.1| hypothetical protein OsJ_18470 [Oryza sativa Japonica Group]
 dbj|BAH93144.1| Os05g0399800 [Oryza sativa Japonica Group]
Length=255

 Score =   145 bits (366),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 71/135 (53%), Positives = 92/135 (68%), Gaps = 0/135 (0%)
 Frame = +1

Query  169  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  348
            EDDV+CL+G+K S  DPDG L  W F NT+AG IC+  GV+CWN +E+R+I L L    L
Sbjct  29   EDDVRCLEGLKTSLGDPDGRLASWTFSNTSAGAICELSGVSCWNPDESRIIALSLSGFGL  88

Query  349  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  528
             G +P  LQ C ++  LDLS N L G IP  +C WLP++V LDLS N L+GPIP +L NC
Sbjct  89   TGAIPSELQFCSAITTLDLSSNRLGGQIPPALCDWLPFVVNLDLSGNQLSGPIPAELANC  148

Query  529  TYLNKLILNDNKLTG  573
             ++N L L+ N L+G
Sbjct  149  KFINSLKLSANSLSG  163



>ref|XP_002446698.1| hypothetical protein SORBIDRAFT_06g020750 [Sorghum bicolor]
 gb|EES11026.1| hypothetical protein SORBIDRAFT_06g020750 [Sorghum bicolor]
Length=627

 Score =   150 bits (380),  Expect = 5e-39, Method: Composition-based stats.
 Identities = 71/135 (53%), Positives = 93/135 (69%), Gaps = 0/135 (0%)
 Frame = +1

Query  169  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  348
            EDD++CL+GVK    DP+G L  W+F NT+ G +C + G+ CWN  E+RV+ L L    L
Sbjct  35   EDDLRCLKGVKHDLSDPNGRLDDWDFKNTSGGAVCNYNGIGCWNMQESRVLSLSLSGFGL  94

Query  349  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  528
             G +P +LQ C +   LDLS N L+GTI   +C WLP+LVTLDLSSN LTGPIP +L NC
Sbjct  95   VGSIPSSLQYCRAATTLDLSSNALAGTILPALCDWLPFLVTLDLSSNQLTGPIPAELANC  154

Query  529  TYLNKLILNDNKLTG  573
             +LN L L+ N+L+G
Sbjct  155  RFLNTLRLSGNQLSG  169



>gb|EAY97968.1| hypothetical protein OsI_19886 [Oryza sativa Indica Group]
Length=255

 Score =   144 bits (363),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 71/135 (53%), Positives = 92/135 (68%), Gaps = 0/135 (0%)
 Frame = +1

Query  169  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  348
            EDDV+CLQG+K S  DPDG L  W F NT+ G IC+  GV+CW+ +E+R+IGL L    L
Sbjct  29   EDDVRCLQGIKTSLSDPDGRLASWTFSNTSTGAICELSGVSCWSPDESRIIGLSLSGFGL  88

Query  349  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  528
             G +P  LQ C ++  LDLS N L G IP  +C WLP++V LDLS N L+GPIP +L NC
Sbjct  89   TGAIPSELQFCSAITALDLSSNRLGGQIPPALCDWLPFVVNLDLSGNQLSGPIPAELANC  148

Query  529  TYLNKLILNDNKLTG  573
             ++N L L+ N L+G
Sbjct  149  KFINSLKLSANSLSG  163



>ref|XP_006653547.1| PREDICTED: probable inactive receptor kinase At1g27190-like [Oryza 
brachyantha]
Length=602

 Score =   149 bits (377),  Expect = 1e-38, Method: Composition-based stats.
 Identities = 69/135 (51%), Positives = 88/135 (65%), Gaps = 0/135 (0%)
 Frame = +1

Query  169  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  348
            EDDV+CL+GVK S RDPDG L  W FDN ++  +C + GV CWN  E R+I L L    L
Sbjct  11   EDDVRCLRGVKKSLRDPDGRLSSWTFDNLSSSAVCSYSGVTCWNPQELRIIQLSLAGFGL  70

Query  349  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  528
             G +P  LQ C     LDLSGN L G IPS +C W+P++V LDLS N L+GP+P +L NC
Sbjct  71   QGSIPSDLQFCSGATTLDLSGNALEGQIPSTLCDWIPFVVNLDLSGNQLSGPLPSELANC  130

Query  529  TYLNKLILNDNKLTG  573
             ++N L L+ N  +G
Sbjct  131  RFVNSLKLSGNSFSG  145



>ref|XP_007044441.1| Leucine-rich repeat protein kinase family protein [Theobroma 
cacao]
 gb|EOY00273.1| Leucine-rich repeat protein kinase family protein [Theobroma 
cacao]
Length=612

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 96/135 (71%), Gaps = 0/135 (0%)
 Frame = +1

Query  169  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  348
            EDD+ CL+G+K S  DPD  L  W F+N ++ F+C   GV+CWN+ ENR+I L L  + L
Sbjct  24   EDDITCLEGLKSSLTDPDSPLATWTFNNRSSTFVCNLTGVSCWNEKENRIISLLLSSMKL  83

Query  349  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  528
             G++P +L+ C SLQ LDLS N LSG IP+ IC WLPYLV LDLS N L+G IP  + NC
Sbjct  84   SGQLPDSLKYCRSLQILDLSNNSLSGPIPNDICSWLPYLVRLDLSGNRLSGSIPTQIANC  143

Query  529  TYLNKLILNDNKLTG  573
             +LN L+L++NKL+G
Sbjct  144  KFLNDLVLDNNKLSG  158



>ref|XP_010415671.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g69990 [Camelina sativa]
Length=594

 Score =   147 bits (372),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 78/148 (53%), Positives = 103/148 (70%), Gaps = 2/148 (1%)
 Frame = +1

Query  136  ILLVLFGVGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGF--ICKFVGVACWNDNE  309
             +++L     AED+V CL+G+K S +DP   L  W+F N+++    ICK  GV+CWN  E
Sbjct  9    FVIILIPSSYAEDEVLCLKGLKASLKDPSNQLSTWSFPNSSSSSSSICKLTGVSCWNAKE  68

Query  310  NRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSN  489
            NR+I L+L+ + L G++P +L+ C SLQ+LDLS NG SG IPSQIC WLPYLVTL+LS N
Sbjct  69   NRIISLQLQSMQLSGQIPESLKLCRSLQSLDLSDNGFSGLIPSQICSWLPYLVTLNLSRN  128

Query  490  DLTGPIPPDLGNCTYLNKLILNDNKLTG  573
             L G IP  + +C +LN L LN NKLTG
Sbjct  129  KLGGSIPSQVVDCKFLNTLALNKNKLTG  156



>ref|XP_009385796.1| PREDICTED: probable inactive receptor kinase At1g27190 [Musa 
acuminata subsp. malaccensis]
Length=611

 Score =   147 bits (372),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 80/138 (58%), Positives = 96/138 (70%), Gaps = 2/138 (1%)
 Frame = +1

Query  160  GVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelre  339
            G AEDDV+CL GVK S  D    LG WNF N T GF+C FVGV+CWN  ENRV+ L L+ 
Sbjct  26   GAAEDDVRCLTGVKTSL-DRGHTLG-WNFSNATVGFVCSFVGVSCWNLQENRVLALNLKS  83

Query  340  lnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDL  519
            ++L G VP  LQ C +   LDLS N +SG IP+++C WLPYLVTLDLS+N  TG IPP L
Sbjct  84   MSLAGSVPSDLQYCSAANVLDLSSNTISGPIPNELCSWLPYLVTLDLSNNQFTGGIPPTL  143

Query  520  GNCTYLNKLILNDNKLTG  573
             NC +LN L+L  N+L G
Sbjct  144  SNCRFLNTLVLAGNQLQG  161



>ref|XP_010098246.1| putative inactive receptor kinase [Morus notabilis]
 gb|EXB74731.1| putative inactive receptor kinase [Morus notabilis]
Length=586

 Score =   147 bits (372),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 97/135 (72%), Gaps = 0/135 (0%)
 Frame = +1

Query  169  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  348
            EDD+ CL+GV+ S  DP G L  W F N +   ICK  GV+CWN+ ENR+I ++L+ ++L
Sbjct  2    EDDMMCLEGVRKSLSDPLGKLRSWTFTNDSVASICKLAGVSCWNEKENRLISIQLQYMDL  61

Query  349  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  528
             G +P +L+ C SLQ LD S N LSG IP QIC WLPYLVTLDLS+N L+G I P++ NC
Sbjct  62   SGGLPESLKFCRSLQTLDFSNNHLSGPIPPQICTWLPYLVTLDLSNNRLSGSIAPEIVNC  121

Query  529  TYLNKLILNDNKLTG  573
             +LN LIL+ N+L+G
Sbjct  122  KFLNTLILDGNRLSG  136



>ref|XP_002888749.1| hypothetical protein ARALYDRAFT_894788 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65008.1| hypothetical protein ARALYDRAFT_894788 [Arabidopsis lyrata subsp. 
lyrata]
Length=598

 Score =   147 bits (371),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 75/137 (55%), Positives = 101/137 (74%), Gaps = 1/137 (1%)
 Frame = +1

Query  166  AEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGF-ICKFVGVACWNDNENRVIglelrel  342
            +EDD+ CL+G+K S +DP   L  W+F N+++   ICK  GV+CWN  ENR++ L+L+ +
Sbjct  18   SEDDILCLKGLKSSLKDPSNQLNTWSFPNSSSSSPICKLTGVSCWNAKENRILSLQLQSM  77

Query  343  nlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLG  522
             L G++P +L+ C SLQ+LDLS N  SG IPSQIC WLPYLV+LDLS N L+G IP  + 
Sbjct  78   QLSGQIPESLKLCRSLQSLDLSDNDFSGLIPSQICSWLPYLVSLDLSGNKLSGSIPSQIV  137

Query  523  NCTYLNKLILNDNKLTG  573
            +C +LN L+LNDNKLTG
Sbjct  138  DCKFLNSLVLNDNKLTG  154



>ref|XP_009342387.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Pyrus x bretschneideri]
 ref|XP_009342390.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Pyrus x bretschneideri]
Length=226

 Score =   141 bits (355),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 76/147 (52%), Positives = 100/147 (68%), Gaps = 2/147 (1%)
 Frame = +1

Query  136  ILLVLFGVGVAEDDVKCLQGVKGSFRDPDGNLGL-WNFDNTTAGFICKFVGVACWNDNEN  312
            +L   F +GV E D+ CL+ +K S  DP G L L W+F NTT GFICKF+G+ CW+ NEN
Sbjct  26   LLTCSFSLGV-ESDISCLKSIKASLEDPSGYLSLSWDFSNTTEGFICKFLGIECWHPNEN  84

Query  313  RVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSND  492
            +V+ ++L +L L G+ P  L +C SL  LDLSGN LSG +P  I R L ++ TLDLSSN 
Sbjct  85   KVLNIKLSDLGLKGQFPRGLSNCSSLTGLDLSGNKLSGPLPEDIGRILAFITTLDLSSNS  144

Query  493  LTGPIPPDLGNCTYLNKLILNDNKLTG  573
             +G IPP L NC+YLN L L +N+ +G
Sbjct  145  FSGKIPPSLSNCSYLNVLKLENNEFSG  171



>ref|XP_003618423.1| LRR receptor-like serine/threonine-protein kinase FEI [Medicago 
truncatula]
 gb|AES74641.1| LRR receptor-like kinase [Medicago truncatula]
Length=602

 Score =   147 bits (370),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 106/152 (70%), Gaps = 1/152 (1%)
 Frame = +1

Query  121  FLKLSILLVLFGVGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWN  300
            F+  +  + L    V ED+V+CLQG++ +  + D  +  W F+N T GFIC FVGV CWN
Sbjct  10   FIVFAFWVTLSSSQVEEDNVRCLQGIQQNLGNSDSPISNWKFNNRTVGFICDFVGVTCWN  69

Query  301  DNENRVIglelrelnlggeVPGALQDC-HSLQNLDLSGNGLSGTIPSQICRWLPYLVTLD  477
              ENRV+GLEL+ + L G++P +L+ C  SLQ LDL  N LS  IP+QIC W+P+LVT+D
Sbjct  70   VRENRVLGLELKGMKLSGKIPESLKYCGQSLQRLDLGSNSLSSVIPTQICEWMPFLVTMD  129

Query  478  LSSNDLTGPIPPDLGNCTYLNKLILNDNKLTG  573
            LS N+L G IP  + NC+YLN+L+L++N LTG
Sbjct  130  LSGNNLNGEIPHTIVNCSYLNELMLDNNHLTG  161



>ref|XP_007151168.1| hypothetical protein PHAVU_004G023600g [Phaseolus vulgaris]
 gb|ESW23162.1| hypothetical protein PHAVU_004G023600g [Phaseolus vulgaris]
Length=265

 Score =   142 bits (357),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 76/146 (52%), Positives = 99/146 (68%), Gaps = 1/146 (1%)
 Frame = +1

Query  139  LLVLFGVGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRV  318
             L  F      DDV+CL+G+K +  DP+ +L  W F NTT GFIC F GV CWN +ENRV
Sbjct  19   FLSFFASSQVADDVECLRGIKATLSDPEASLATWRFGNTTPGFICNFEGVTCWNSSENRV  78

Query  319  IglelrelnlggeVPGALQDC-HSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDL  495
            + LEL+   L G +P +L+ C  SLQ L LS N LS  IP +IC WLP+LV++D S N L
Sbjct  79   LDLELQSFKLSGRIPESLKYCGKSLQRLSLSNNSLSSEIPIEICTWLPFLVSVDFSRNRL  138

Query  496  TGPIPPDLGNCTYLNKLILNDNKLTG  573
            +G IPP   NC+YLN+L+L+DN+L+G
Sbjct  139  SGAIPPSFSNCSYLNELVLSDNELSG  164



>gb|AEW22944.1| leucine-rich repeat receptor-like protein kinase, partial [Cenchrus 
ciliaris]
Length=597

 Score =   145 bits (367),  Expect = 2e-37, Method: Composition-based stats.
 Identities = 68/135 (50%), Positives = 90/135 (67%), Gaps = 1/135 (1%)
 Frame = +1

Query  169  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  348
            EDD++CL+GVK    DPD  L  W+F NT+A  +C F G+ CWN  E+RV+ L      L
Sbjct  4    EDDLRCLRGVKKELADPDDRLA-WDFSNTSAAAVCNFNGITCWNPQESRVMSLSFSGFGL  62

Query  349  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  528
             G +P +LQ C +   LDLS N L G+IP  +C W+P+LV LDLSSN LTGP+P +L NC
Sbjct  63   QGSLPSSLQYCRAATTLDLSQNALDGSIPPALCDWVPFLVNLDLSSNKLTGPLPAELANC  122

Query  529  TYLNKLILNDNKLTG  573
             +LN L L+ N+L+G
Sbjct  123  RFLNSLKLSGNQLSG  137


 Score = 52.0 bits (123),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 28/55 (51%), Positives = 34/55 (62%), Gaps = 1/55 (2%)
 Frame = +1

Query  358  VPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLG  522
            +P  L +C  L +L LSGN LSG IP+ + R L  L +LDLS N L G IP  LG
Sbjct  115  LPAELANCRFLNSLKLSGNQLSGQIPASLAR-LDRLKSLDLSGNKLEGQIPSQLG  168



>ref|XP_010532925.1| PREDICTED: probable inactive receptor kinase At1g27190 [Tarenaya 
hassleriana]
Length=612

 Score =   145 bits (367),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 106/148 (72%), Gaps = 2/148 (1%)
 Frame = +1

Query  136  ILLVLFGVGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGF--ICKFVGVACWNDNE  309
            +L+  F     EDDV CL+G+K S +DP G LG W+F N+++    ICK  GV+CWN+ E
Sbjct  14   LLVCPFLCSSVEDDVLCLEGLKNSLQDPSGRLGGWSFSNSSSSAVSICKLTGVSCWNEKE  73

Query  310  NRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSN  489
            NR+I L+L+ + L G++P +L+ C SLQ LDLS NGLSG IPSQIC WLPYLVTLDLS N
Sbjct  74   NRIISLQLQSMQLAGQIPESLKFCRSLQYLDLSDNGLSGPIPSQICSWLPYLVTLDLSGN  133

Query  490  DLTGPIPPDLGNCTYLNKLILNDNKLTG  573
             L G IP  +  C +LN LIL++NKL+G
Sbjct  134  KLGGSIPSQIVECKFLNSLILDENKLSG  161



>ref|NP_001053144.1| Os04g0487200 [Oryza sativa Japonica Group]
 emb|CAD41324.2| OJ991113_30.7 [Oryza sativa Japonica Group]
 dbj|BAF15058.1| Os04g0487200 [Oryza sativa Japonica Group]
 gb|EAY94615.1| hypothetical protein OsI_16392 [Oryza sativa Indica Group]
Length=622

 Score =   145 bits (366),  Expect = 4e-37, Method: Composition-based stats.
 Identities = 69/135 (51%), Positives = 89/135 (66%), Gaps = 0/135 (0%)
 Frame = +1

Query  169  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  348
            EDDV+CL+ VK   RDPDG L  W+F NT+AG +C   GV+CWN  E+R+IGL L    L
Sbjct  30   EDDVRCLKEVKAELRDPDGRLSAWSFGNTSAGALCLLSGVSCWNPQESRIIGLSLSGFGL  89

Query  349  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  528
             G +P ALQ C +   LDLS N L G IP  +C W+P++V LDLS N L+G +P +L NC
Sbjct  90   QGGIPSALQFCSAATTLDLSNNALVGVIPPALCDWIPFVVNLDLSGNQLSGQLPSELANC  149

Query  529  TYLNKLILNDNKLTG  573
             +LN L L+ N  +G
Sbjct  150  RFLNSLKLSGNSFSG  164



>gb|ABR16056.1| unknown [Picea sitchensis]
Length=564

 Score =   144 bits (364),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 69/138 (50%), Positives = 95/138 (69%), Gaps = 0/138 (0%)
 Frame = +1

Query  160  GVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelre  339
             V EDD++CLQ +K + +DP G L  WNF+N T GFIC F+G+ CW+ NENRV+ ++L  
Sbjct  44   SVPEDDIRCLQTIKRTVKDPHGYLYTWNFNNKTDGFICSFLGIDCWHPNENRVLNIKLPG  103

Query  340  lnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDL  519
            ++L G  P   + C  +  LDLS N LSGTIP  + +WLPYL +LDLS N+  G IP ++
Sbjct  104  MSLQGSFPTGFEYCGRMTGLDLSDNNLSGTIPVNLSKWLPYLTSLDLSQNNFHGSIPAEI  163

Query  520  GNCTYLNKLILNDNKLTG  573
             NCTYLN + L +N+L+G
Sbjct  164  ANCTYLNIIHLQENQLSG  181



>ref|XP_008669246.1| PREDICTED: probable inactive receptor kinase At1g27190 [Zea mays]
 tpg|DAA37241.1| TPA: putative leucine-rich repeat transmembrane protein kinase 
family protein [Zea mays]
Length=626

 Score =   144 bits (364),  Expect = 8e-37, Method: Composition-based stats.
 Identities = 69/135 (51%), Positives = 90/135 (67%), Gaps = 0/135 (0%)
 Frame = +1

Query  169  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  348
            EDD++CL+GVK    DP+  L  W+F NT+ G +C + G+ CWN  E+RV+ L L    L
Sbjct  34   EDDLRCLRGVKHDLADPNERLADWDFKNTSGGAVCNYNGIGCWNLQESRVLSLSLSGFGL  93

Query  349  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  528
             G +P +LQ C +   LDLS N L GTI   +C WLP+LVTLDLSSN L GPIP +L NC
Sbjct  94   VGSIPSSLQYCRAATTLDLSSNALVGTILPALCDWLPFLVTLDLSSNQLNGPIPAELANC  153

Query  529  TYLNKLILNDNKLTG  573
             +LN L L+ N+L+G
Sbjct  154  RFLNSLRLSGNQLSG  168



>gb|AFW58657.1| putative leucine-rich repeat transmembrane protein kinase family 
protein [Zea mays]
Length=632

 Score =   144 bits (364),  Expect = 8e-37, Method: Composition-based stats.
 Identities = 68/135 (50%), Positives = 90/135 (67%), Gaps = 0/135 (0%)
 Frame = +1

Query  169  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  348
            +D ++CL+GVK    DP+G L  W+F NT+ G +C + G+ CWN  E+RV+ L L    L
Sbjct  34   QDGLRCLRGVKHDLADPNGRLADWDFKNTSGGAVCSYSGIGCWNLQESRVLSLSLSGFGL  93

Query  349  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  528
             G +P +LQ C +   LDLS N L GTI   +C WLP+LVTLDLSSN LTG IP +L NC
Sbjct  94   VGSIPSSLQYCSAATTLDLSSNALVGTILPALCDWLPFLVTLDLSSNQLTGAIPAELANC  153

Query  529  TYLNKLILNDNKLTG  573
             +LN L L+ N+L+G
Sbjct  154  RFLNSLTLSGNQLSG  168



>ref|XP_007213020.1| hypothetical protein PRUPE_ppa023044mg, partial [Prunus persica]
 gb|EMJ14219.1| hypothetical protein PRUPE_ppa023044mg, partial [Prunus persica]
Length=147

 Score =   136 bits (342),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 71/120 (59%), Positives = 87/120 (73%), Gaps = 0/120 (0%)
 Frame = +1

Query  160  GVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelre  339
             V EDDVKCLQ +K S +DP G L  W+F NT+   +CKFVGV CWND ENR++ LELR+
Sbjct  25   AVVEDDVKCLQSLKQSLKDPLGKLVSWDFRNTSVVSMCKFVGVTCWNDRENRILNLELRD  84

Query  340  lnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDL  519
            + L G +   ++ C SLQNLDL GN LSG+IP  IC WLP+LVTLD S+ND +G IP DL
Sbjct  85   MELSGAIAKDIEYCSSLQNLDLGGNKLSGSIPPDICTWLPFLVTLDFSNNDFSGSIPTDL  144



>dbj|BAK03355.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=624

 Score =   144 bits (363),  Expect = 1e-36, Method: Composition-based stats.
 Identities = 65/135 (48%), Positives = 89/135 (66%), Gaps = 1/135 (1%)
 Frame = +1

Query  169  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  348
            EDD +CL+GVK   RDP+G L  W   N +AG +C F G++CWN  E+R++ + L    L
Sbjct  34   EDDARCLKGVKAELRDPEGRLSSWT-TNASAGAVCDFSGISCWNPQESRILAVSLSGFGL  92

Query  349  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  528
             G++P  LQ C +   LDLS N L G IP  +C WLP++VTLDLS N L+GP+P +L +C
Sbjct  93   QGKIPPDLQYCRAATTLDLSSNALEGPIPPALCDWLPFVVTLDLSGNRLSGPLPSELASC  152

Query  529  TYLNKLILNDNKLTG  573
             +LN L L+DN  +G
Sbjct  153  RFLNSLKLSDNAFSG  167



>ref|XP_009600980.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Nicotiana tomentosiformis]
 ref|XP_009600987.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Nicotiana tomentosiformis]
 ref|XP_009600992.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Nicotiana tomentosiformis]
Length=584

 Score =   142 bits (359),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 81/166 (49%), Positives = 106/166 (64%), Gaps = 3/166 (2%)
 Frame = +1

Query  85   ADFRMVGFGFSRFLKLSILLVLFGVGV---AEDDVKCLQGVKGSFRDPDGNLGLWNFDNT  255
             +FR   F F       +L++L  + V   AE+D  CL+ +K S +DP  NLG W+F+N 
Sbjct  4    TNFRTRSFFFICTFLGFLLILLSKISVCSAAENDFYCLKSIKDSLQDPFNNLGSWDFNNV  63

Query  256  TAGFICKFVGVACWNDNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIP  435
            T GFIC+F G+ CW+DNEN+V+ + L    L GE P  +++C SL NLDLSGN L G IP
Sbjct  64   TEGFICRFSGINCWHDNENKVLSITLSNYGLIGEFPRGVRNCTSLTNLDLSGNKLYGNIP  123

Query  436  SQICRWLPYLVTLDLSSNDLTGPIPPDLGNCTYLNKLILNDNKLTG  573
            S I   L Y+V LDLS N  +G IPPD+ NCTYLN L L++N L G
Sbjct  124  SDISVILDYVVILDLSYNTFSGNIPPDIANCTYLNFLGLDNNNLEG  169



>ref|XP_010551471.1| PREDICTED: probable inactive receptor kinase At1g27190 [Tarenaya 
hassleriana]
Length=604

 Score =   142 bits (359),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 84/156 (54%), Positives = 108/156 (69%), Gaps = 2/156 (1%)
 Frame = +1

Query  112  FSRFLKLSILLVLFGVGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGF--ICKFVG  285
            F  F  L IL+  F     EDDV CL+G+K S +DP G L  W+F N+++    +CK  G
Sbjct  6    FFTFFCLLILVSPFPCSSLEDDVLCLEGLKNSLKDPSGRLSGWSFSNSSSSAVSVCKLTG  65

Query  286  VACWNDNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYL  465
            V+CWN+ ENR+I L+L+ + L G++P +L+ C SLQ+LDLS N LSG IPSQIC WLPYL
Sbjct  66   VSCWNEKENRIISLQLQSMQLAGQIPESLKFCRSLQSLDLSDNDLSGPIPSQICSWLPYL  125

Query  466  VTLDLSSNDLTGPIPPDLGNCTYLNKLILNDNKLTG  573
            VTLDLS N L G IP  + +C +LN L LNDNKL+G
Sbjct  126  VTLDLSGNKLGGSIPAQIVDCKFLNSLALNDNKLSG  161



>ref|XP_009406402.1| PREDICTED: probable inactive receptor kinase At1g27190 [Musa 
acuminata subsp. malaccensis]
Length=599

 Score =   140 bits (354),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 77/135 (57%), Positives = 94/135 (70%), Gaps = 2/135 (1%)
 Frame = +1

Query  169  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  348
            EDDV+CL+GVK +  D DG L  WN  N T GF+C FVGV+CWN  ENRV+GL LR+++L
Sbjct  27   EDDVRCLRGVKATL-DRDGRLS-WNLSNGTVGFVCSFVGVSCWNPQENRVLGLNLRDMSL  84

Query  349  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  528
             G +   LQ C +   LDLS N +SG IP  +C WLPYLVTLDLS+N LTG IPP L  C
Sbjct  85   SGSIASDLQYCAAANVLDLSSNAISGAIPPDLCSWLPYLVTLDLSNNQLTGAIPPGLSGC  144

Query  529  TYLNKLILNDNKLTG  573
             +LN L+L  N+L G
Sbjct  145  RFLNTLVLAGNRLEG  159



>emb|CDY11627.1| BnaC06g31120D [Brassica napus]
Length=595

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 76/136 (56%), Positives = 98/136 (72%), Gaps = 0/136 (0%)
 Frame = +1

Query  166  AEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelreln  345
            AEDDV CL+G+K S  DP G L  W+F N+++  ICK  GV+CWN  ENR++ L L  + 
Sbjct  23   AEDDVLCLKGLKNSLTDPSGRLSNWSFPNSSSSSICKLTGVSCWNAKENRILSLHLPSMQ  82

Query  346  lggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGN  525
            L G++P +L+ C SLQ+LDLSGN +S  IP +IC WLPYLVTLDLS N L+G IP  + +
Sbjct  83   LAGKIPESLKLCRSLQSLDLSGNDISSEIPPEICSWLPYLVTLDLSGNKLSGSIPSQIAD  142

Query  526  CTYLNKLILNDNKLTG  573
            C +LN L LN+NKLTG
Sbjct  143  CKFLNGLALNENKLTG  158



>gb|AES90509.2| LRR receptor-like kinase family protein, putative [Medicago truncatula]
Length=594

 Score =   140 bits (352),  Expect = 3e-35, Method: Composition-based stats.
 Identities = 71/135 (53%), Positives = 92/135 (68%), Gaps = 0/135 (0%)
 Frame = +1

Query  169  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  348
            E D+ CL+ +K S  DP+G L  W+F+N T GFICKF GV CW+ +ENRV+ L+L  + L
Sbjct  9    ETDIFCLKSIKNSLEDPNGYLQNWDFNNRTEGFICKFTGVECWHPDENRVLNLKLSNMGL  68

Query  349  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  528
             G+ P  L++C SL  LDLS N LSG+IPS I   L ++ + DLSSN+ TG IP  L NC
Sbjct  69   KGQFPRGLENCSSLTGLDLSVNDLSGSIPSDISTMLTFVTSFDLSSNEFTGEIPTALANC  128

Query  529  TYLNKLILNDNKLTG  573
            TYLN L L+ N L+G
Sbjct  129  TYLNTLKLSQNMLSG  143



>ref|XP_003608312.1| Receptor-like-kinase [Medicago truncatula]
Length=592

 Score =   140 bits (352),  Expect = 3e-35, Method: Composition-based stats.
 Identities = 71/135 (53%), Positives = 92/135 (68%), Gaps = 0/135 (0%)
 Frame = +1

Query  169  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  348
            E D+ CL+ +K S  DP+G L  W+F+N T GFICKF GV CW+ +ENRV+ L+L  + L
Sbjct  7    ETDIFCLKSIKNSLEDPNGYLQNWDFNNRTEGFICKFTGVECWHPDENRVLNLKLSNMGL  66

Query  349  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  528
             G+ P  L++C SL  LDLS N LSG+IPS I   L ++ + DLSSN+ TG IP  L NC
Sbjct  67   KGQFPRGLENCSSLTGLDLSVNDLSGSIPSDISTMLTFVTSFDLSSNEFTGEIPTALANC  126

Query  529  TYLNKLILNDNKLTG  573
            TYLN L L+ N L+G
Sbjct  127  TYLNTLKLSQNMLSG  141



>dbj|BAI94492.1| receptor-like kinase [Dianthus caryophyllus]
Length=619

 Score =   139 bits (349),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 75/154 (49%), Positives = 104/154 (68%), Gaps = 2/154 (1%)
 Frame = +1

Query  118  RFLKLSI-LLVLFGVGVAEDDVKCLQGVKGSFRDPDGNL-GLWNFDNTTAGFICKFVGVA  291
            RFL +   LL+L  +   E+D++CL+ +K S  DP+  L   WNF+N T GF+C F G+ 
Sbjct  10   RFLVICTGLLLLSKLSYGENDIQCLKSIKQSLEDPNNILNSTWNFNNNTKGFVCSFNGID  69

Query  292  CWNDNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVT  471
            CWN +ENRV+ + L ++ L G+ P  +  C  LQ LDLS N LSG IPS I   LPY+ +
Sbjct  70   CWNPSENRVLNIRLSDMGLKGKFPLGISMCSELQLLDLSSNNLSGVIPSNISAILPYITS  129

Query  472  LDLSSNDLTGPIPPDLGNCTYLNKLILNDNKLTG  573
            LDLSSN  +G IP +L NCT+LNKL+L++N+L+G
Sbjct  130  LDLSSNSFSGHIPDNLANCTFLNKLVLDNNQLSG  163



>gb|KJB31374.1| hypothetical protein B456_005G188100 [Gossypium raimondii]
Length=611

 Score =   138 bits (348),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 93/135 (69%), Gaps = 0/135 (0%)
 Frame = +1

Query  169  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  348
            EDD+ CL+G+K S    D  L  W+F N ++  +C+  GV+CWN+ ENR+I L L  + L
Sbjct  25   EDDIACLEGLKNSLTGADSPLSTWSFSNRSSTSVCQLTGVSCWNEKENRIISLHLPSMKL  84

Query  349  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  528
             G++P +L+ C SLQ LDLS N LSG IPS IC WLPYLV LDLS N  +G IP  + +C
Sbjct  85   SGQLPDSLKYCRSLQILDLSNNSLSGPIPSDICSWLPYLVHLDLSGNLFSGSIPLQIVDC  144

Query  529  TYLNKLILNDNKLTG  573
             +LN L+L+DNKL+G
Sbjct  145  KFLNDLVLSDNKLSG  159



>ref|XP_010109951.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Morus notabilis]
 gb|EXC24927.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Morus notabilis]
Length=280

 Score =   134 bits (337),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 94/134 (70%), Gaps = 0/134 (0%)
 Frame = +1

Query  172  DDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnlg  351
            +D+ CL+ +K SF DP G L  W+F+N T GFICKF+GV CW+ +EN+V+ + L ++ L 
Sbjct  26   NDIYCLKTIKKSFNDPYGYLASWDFNNNTEGFICKFIGVDCWHPDENKVLNIRLSDMGLR  85

Query  352  geVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNCT  531
            GE P  +++C SL  LDLS N LSG IP  I + L Y+ +LDLSSN+ +G IP  L NCT
Sbjct  86   GEFPRGIENCTSLTGLDLSNNILSGPIPFDISKRLQYVTSLDLSSNNFSGEIPLSLANCT  145

Query  532  YLNKLILNDNKLTG  573
            YLN L L +NKLTG
Sbjct  146  YLNVLKLENNKLTG  159



>gb|AGI92776.1| RLP1.801.4 [Triticum aestivum]
Length=266

 Score =   134 bits (336),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/136 (51%), Positives = 90/136 (66%), Gaps = 0/136 (0%)
 Frame = +1

Query  166  AEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelreln  345
             E D++CL  V+GS  DP G L  WNF+N T G+IC+F GV CW+ +EN+++ L L  L 
Sbjct  23   TEQDIRCLMSVQGSLADPGGVLRSWNFENETNGYICRFTGVECWHPDENKILSLRLGNLG  82

Query  346  lggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGN  525
            L G+ P ALQ+C SL  LDLS N  SG IP  I R +PYL +LDLS N  +G IP ++ N
Sbjct  83   LQGQFPVALQNCSSLTGLDLSNNNFSGPIPQDISRRMPYLTSLDLSYNSFSGLIPQNISN  142

Query  526  CTYLNKLILNDNKLTG  573
             TYLN L L  N+L+G
Sbjct  143  MTYLNLLNLQHNQLSG  158



>ref|XP_007028124.1| BAK1-interacting receptor-like kinase 1 isoform 1 [Theobroma 
cacao]
 ref|XP_007028125.1| BAK1-interacting receptor-like kinase 1 isoform 1 [Theobroma 
cacao]
 gb|EOY08626.1| BAK1-interacting receptor-like kinase 1 isoform 1 [Theobroma 
cacao]
 gb|EOY08627.1| BAK1-interacting receptor-like kinase 1 isoform 1 [Theobroma 
cacao]
Length=623

 Score =   137 bits (344),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 90/134 (67%), Gaps = 0/134 (0%)
 Frame = +1

Query  172  DDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnlg  351
            +D++CL+ VK S  DP   L  WNF+N T GFICKF GV CW+ +EN+V+ + L +L L 
Sbjct  39   NDIECLKSVKASLEDPYSYLSSWNFNNGTEGFICKFTGVDCWHPDENKVLNIRLSDLGLK  98

Query  352  geVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNCT  531
            G  P  +  C SL  LDLS N LSG IPS I   L Y+ TLDLS N+ +GPIPP L NC+
Sbjct  99   GRFPQGIGKCESLTGLDLSSNKLSGLIPSDISEKLKYVTTLDLSDNNFSGPIPPSLANCS  158

Query  532  YLNKLILNDNKLTG  573
            +LN L L +N+LTG
Sbjct  159  FLNVLKLGNNRLTG  172



>ref|XP_010242455.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Nelumbo nucifera]
Length=630

 Score =   136 bits (343),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 71/137 (52%), Positives = 95/137 (69%), Gaps = 1/137 (1%)
 Frame = +1

Query  166  AEDDVKCLQGVKGSFRDPDGNLGL-WNFDNTTAGFICKFVGVACWNDNENRVIglelrel  342
             E D+ CL+ +K S +DP G L   WNF N T GFICKF G+ CW+ +E++V+ + L ++
Sbjct  34   TETDIYCLKTLKDSLKDPFGYLNTSWNFANKTEGFICKFTGIDCWHPDESKVLNIRLSDM  93

Query  343  nlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLG  522
             L G+ P  +++C SL  LDLS N LSG IP  I + LP++ TLDLSSND +GPIP  L 
Sbjct  94   GLKGQFPKGIENCTSLTGLDLSSNNLSGPIPLDISKRLPFVTTLDLSSNDFSGPIPVSLA  153

Query  523  NCTYLNKLILNDNKLTG  573
            NCTYLN L L++N+LTG
Sbjct  154  NCTYLNSLKLDNNQLTG  170



>gb|AGI92774.1| RLP1.801.2 [Triticum aestivum]
Length=266

 Score =   132 bits (331),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 69/136 (51%), Positives = 90/136 (66%), Gaps = 0/136 (0%)
 Frame = +1

Query  166  AEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelreln  345
             E D++CL  V+GS  DP G L  WNF+N T G+IC+F GV CW+ +EN+++ L L  L 
Sbjct  23   TEQDIRCLMSVQGSLADPGGVLRSWNFENETNGYICRFTGVECWHPDENKILSLRLGNLG  82

Query  346  lggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGN  525
            L G+ P ALQ+C SL  LDLS N  SG IP  I + +PYL +LDLS N  +G IP ++ N
Sbjct  83   LQGQFPVALQNCSSLTGLDLSNNNFSGPIPQDISQVMPYLTSLDLSYNSFSGSIPQNISN  142

Query  526  CTYLNKLILNDNKLTG  573
             TYLN L L  N+L+G
Sbjct  143  MTYLNILNLQHNQLSG  158



>ref|XP_010673854.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Beta vulgaris subsp. vulgaris]
Length=615

 Score =   135 bits (341),  Expect = 9e-34, Method: Composition-based stats.
 Identities = 71/159 (45%), Positives = 106/159 (67%), Gaps = 4/159 (3%)
 Frame = +1

Query  100  VGFGFSRFLKLSILLVLFGVGVAEDDVKCLQGVKGSFRDPDGNLGL-WNFDNTTAGFICK  276
            V FG  RFL   I L  +G+     DV CL+ +  S +DP+G L + WNF+N T G ICK
Sbjct  11   VVFGL-RFLL--IFLSSYGIYGTVTDVSCLRKIYRSLKDPNGYLNVTWNFNNGTEGAICK  67

Query  277  FVGVACWNDNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWL  456
            F+G+ CW+ +ENRV+ ++L ++ L G+ P  ++DC SL  LDLS N L+G++PS + R++
Sbjct  68   FIGIECWHPDENRVLNIKLADMGLEGQFPVGIEDCTSLTGLDLSNNKLNGSLPSNMSRFI  127

Query  457  PYLVTLDLSSNDLTGPIPPDLGNCTYLNKLILNDNKLTG  573
            P++  LDLS+ND +G IP  L NC+YLN +  + N+ +G
Sbjct  128  PFVTELDLSNNDFSGVIPETLANCSYLNGVNFDQNRFSG  166



>gb|KJB75784.1| hypothetical protein B456_012G058000 [Gossypium raimondii]
Length=564

 Score =   135 bits (340),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 76/162 (47%), Positives = 95/162 (59%), Gaps = 38/162 (23%)
 Frame = +1

Query  88   DFRMVGFGFSRFLKLSILLVLFGVGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGF  267
            +F ++G+ F  +L LS         V EDD+KCL+GVK S +DPDG L  W FDN + G 
Sbjct  7    NFVVLGWMFLPWLVLS--------AVTEDDMKCLEGVKNSLKDPDGKLSGWRFDNNSVG-  57

Query  268  ICKFVGVACWNDNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQIC  447
                                         ++P +L+ C SLQ LDLS N LSG IPSQIC
Sbjct  58   -----------------------------QLPQSLEYCQSLQTLDLSANKLSGNIPSQIC  88

Query  448  RWLPYLVTLDLSSNDLTGPIPPDLGNCTYLNKLILNDNKLTG  573
             WLPYLVTLDLSSN L+GPIP +L  C YLN LIL++N+L+G
Sbjct  89   SWLPYLVTLDLSSNYLSGPIPSELSKCAYLNNLILSNNRLSG  130



>ref|XP_006584947.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380-like [Glycine max]
Length=613

 Score =   135 bits (340),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 77/163 (47%), Positives = 100/163 (61%), Gaps = 4/163 (2%)
 Frame = +1

Query  88   DFRMVGFGFSRFLKLSILLVLFGVGVAEDDVKCLQGVKGSFRDPDGNLGLW-NFDNTTAG  264
            D  M  F  S  L   +++V  GV   E D+ CL+ +K +  DP   L  W NF+N T G
Sbjct  8    DILMHAFWCSSLLSFYMVVVAHGV---ESDISCLKSIKNTLEDPHNKLSSWKNFNNKTNG  64

Query  265  FICKFVGVACWNDNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQI  444
            FIC FVGV CW+  EN+V+ L L  + L GE P  L+DC SL +L+LS N L+G IPS I
Sbjct  65   FICDFVGVECWHPGENKVLHLNLTNMGLKGEFPRDLRDCPSLTSLNLSHNELTGPIPSDI  124

Query  445  CRWLPYLVTLDLSSNDLTGPIPPDLGNCTYLNKLILNDNKLTG  573
               LPY  ++DLS+N   G IPP LGNC+YL  L L++N L+G
Sbjct  125  STLLPYATSIDLSNNKFNGEIPPSLGNCSYLTSLRLDNNMLSG  167



>gb|EYU46077.1| hypothetical protein MIMGU_mgv1a002955mg [Erythranthe guttata]
Length=622

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 74/155 (48%), Positives = 107/155 (69%), Gaps = 5/155 (3%)
 Frame = +1

Query  121  FLKLSILLVLFG---VGVAEDDVKCLQGVKGSFRDPDGNLG-LWNFDNTTAGFICKFVGV  288
            FL  +++L L        A+ DV CL+ +K +  DP   L  LWNF+N+T G+ICKF GV
Sbjct  17   FLVTALILFLLTEPLSQAAQSDVDCLRAIKDTL-DPLNKLASLWNFNNSTEGYICKFTGV  75

Query  289  ACWNDNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLV  468
             CW++NEN+V+ + L ++ L GE P A+  C S+  LDLS N ++GTIP+ I + LP++ 
Sbjct  76   ECWHENENKVLNIRLPDIGLKGEFPQAISGCSSMTGLDLSSNNINGTIPTNISKLLPFVT  135

Query  469  TLDLSSNDLTGPIPPDLGNCTYLNKLILNDNKLTG  573
            +LDLSSN+L+G IP DL NC++LN L L++N+LTG
Sbjct  136  SLDLSSNELSGEIPVDLANCSFLNILRLDNNQLTG  170



>ref|XP_011089586.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Sesamum indicum]
 ref|XP_011089587.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Sesamum indicum]
Length=620

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 73/146 (50%), Positives = 96/146 (66%), Gaps = 1/146 (1%)
 Frame = +1

Query  139  LLVLFGVG-VAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENR  315
            LLV+   G  A+ D+ CL+ +K S  DP   L  WNFDNTT G+ICKF GV CW+ NEN+
Sbjct  25   LLVIESFGHAAQTDIDCLRAIKISLEDPFNYLSSWNFDNTTEGYICKFTGVECWHPNENK  84

Query  316  VIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDL  495
            VI + L ++ L GE P  +  C SL   DLS N + G IPS I + + ++ +LDLSSN  
Sbjct  85   VINIRLGDMGLRGEFPLGVSSCSSLTGFDLSSNSIRGNIPSNISKLIGFVTSLDLSSNRF  144

Query  496  TGPIPPDLGNCTYLNKLILNDNKLTG  573
            +G IP DL NC+YLN L L++N+LTG
Sbjct  145  SGEIPVDLANCSYLNILKLDNNQLTG  170



>ref|XP_007134301.1| hypothetical protein PHAVU_010G035800g [Phaseolus vulgaris]
 ref|XP_007134302.1| hypothetical protein PHAVU_010G035800g [Phaseolus vulgaris]
 gb|ESW06295.1| hypothetical protein PHAVU_010G035800g [Phaseolus vulgaris]
 gb|ESW06296.1| hypothetical protein PHAVU_010G035800g [Phaseolus vulgaris]
Length=609

 Score =   135 bits (339),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 71/137 (52%), Positives = 93/137 (68%), Gaps = 1/137 (1%)
 Frame = +1

Query  166  AEDDVKCLQGVKGSFRDPDGNLGL-WNFDNTTAGFICKFVGVACWNDNENRVIglelrel  342
             E D+ CL+ +K +  DP   L   W+F+N T GFICKF+GV CW+ +ENRV+ L+L  +
Sbjct  27   TETDIFCLRSIKEALEDPSNYLKFSWDFNNRTEGFICKFIGVECWHPDENRVLNLKLSNM  86

Query  343  nlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLG  522
             L G+ P A+Q+C SL  LDLS N LSGTIP  I   +P++ +LDLSSND +G IP  L 
Sbjct  87   GLKGQFPRAIQNCSSLTGLDLSINKLSGTIPEDISTLVPFVTSLDLSSNDFSGAIPVTLS  146

Query  523  NCTYLNKLILNDNKLTG  573
            NCT+LN L L+ N LTG
Sbjct  147  NCTFLNSLKLDQNGLTG  163



>ref|XP_010242501.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380, partial [Nelumbo nucifera]
Length=303

 Score =   131 bits (330),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 67/136 (49%), Positives = 93/136 (68%), Gaps = 1/136 (1%)
 Frame = +1

Query  169  EDDVKCLQGVKGSFRDPDGNLGL-WNFDNTTAGFICKFVGVACWNDNENRVIglelreln  345
            E D+ CL+ +K S  DP G L   WNF N T GFICKF G+ CW+ +E++V+ + L ++ 
Sbjct  29   ETDIYCLRTLKASLEDPFGYLNTSWNFANKTEGFICKFTGIDCWHPDESKVLNIRLSDMG  88

Query  346  lggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGN  525
            L G+ P  +++C SL  LDLS N LSG +P  I + LP++ TLDLSSND +GPIP  L N
Sbjct  89   LKGQFPKGIENCTSLTGLDLSSNNLSGPVPLDISKRLPFVTTLDLSSNDFSGPIPASLAN  148

Query  526  CTYLNKLILNDNKLTG  573
            C+YL  + L++N+LTG
Sbjct  149  CSYLASVKLDNNQLTG  164



>ref|XP_004492888.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380-like isoform X1 [Cicer arietinum]
 ref|XP_004492889.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380-like isoform X2 [Cicer arietinum]
Length=614

 Score =   134 bits (338),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 73/143 (51%), Positives = 92/143 (64%), Gaps = 3/143 (2%)
 Frame = +1

Query  145  VLFGVGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIg  324
            ++FG    E D+ CL+ VK S  DP   L  WNF+N T GFICKF GV CW+  ENRV+ 
Sbjct  24   MIFGT---ESDIFCLKSVKSSLNDPYNYLQSWNFNNKTEGFICKFSGVECWHPEENRVLN  80

Query  325  lelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGP  504
            L+L  + L G+ P  +Q+C SL  LDLS N  S +IP  I   + ++ +LDLSSND TG 
Sbjct  81   LKLSNMGLKGQFPRGIQNCSSLTGLDLSSNSFSESIPEDISTLVFFMTSLDLSSNDFTGA  140

Query  505  IPPDLGNCTYLNKLILNDNKLTG  573
            IP  L NCTYLN L L+ N+LTG
Sbjct  141  IPVSLSNCTYLNILKLDQNQLTG  163



>gb|KHN22142.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Glycine soja]
Length=617

 Score =   134 bits (338),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 75/147 (51%), Positives = 96/147 (65%), Gaps = 1/147 (1%)
 Frame = +1

Query  136  ILLVLFG-VGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNEN  312
             LL+L G V   E D+ CL+ VK +  DP   L  WNF+N T G+ICKF+GV CW+ +EN
Sbjct  20   FLLILCGMVCGTESDLFCLKSVKSALEDPYNYLQSWNFNNNTEGYICKFIGVECWHPDEN  79

Query  313  RVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSND  492
            +V+ L+L  + L G  P  +Q+C S+  LD S N LS TIP+ I   L ++ TLDLSSND
Sbjct  80   KVLNLKLSNMGLKGPFPRGIQNCTSMTGLDFSLNRLSKTIPADISTLLTFVTTLDLSSND  139

Query  493  LTGPIPPDLGNCTYLNKLILNDNKLTG  573
             TG IP  L NCTYLN L L+ N+LTG
Sbjct  140  FTGEIPASLSNCTYLNTLRLDQNQLTG  166



>ref|XP_004510191.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380-like isoform X1 [Cicer arietinum]
 ref|XP_004510192.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380-like isoform X2 [Cicer arietinum]
 ref|XP_004510193.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380-like isoform X3 [Cicer arietinum]
 ref|XP_004510194.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380-like isoform X4 [Cicer arietinum]
Length=618

 Score =   134 bits (338),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 75/158 (47%), Positives = 102/158 (65%), Gaps = 2/158 (1%)
 Frame = +1

Query  106  FGFSRFLKLSILLVLFGVGV-AEDDVKCLQGVKGSFRDPDGNLGL-WNFDNTTAGFICKF  279
            F    F+   +L++ +G+    E D+ CL+ +K S +DP+G L   W+F+N T GFIC+F
Sbjct  9    FNSHVFVNFLLLIISWGITYGTETDILCLKSIKESLKDPNGYLKTSWDFNNKTEGFICRF  68

Query  280  VGVACWNDNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLP  459
             GV CW+ +ENRV+ L+L  + L G  P  + +C SL  LDLS N LSGTIP  I   L 
Sbjct  69   TGVECWHPDENRVLNLKLSNMGLKGPFPRGIINCSSLTGLDLSINYLSGTIPGDISSLLT  128

Query  460  YLVTLDLSSNDLTGPIPPDLGNCTYLNKLILNDNKLTG  573
            ++ +LDLSSN+ +G IP  L NCTYLN L LN N+LTG
Sbjct  129  FVTSLDLSSNEFSGEIPDSLANCTYLNTLKLNQNQLTG  166



>ref|XP_003534491.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380-like isoform X1 [Glycine max]
 ref|XP_006587796.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380-like isoform X2 [Glycine max]
Length=617

 Score =   134 bits (338),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 75/147 (51%), Positives = 96/147 (65%), Gaps = 1/147 (1%)
 Frame = +1

Query  136  ILLVLFG-VGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNEN  312
             LL+L G V   E D+ CL+ VK +  DP   L  WNF+N T G+ICKF+GV CW+ +EN
Sbjct  20   FLLILCGMVCGTESDLFCLKSVKSALEDPYNYLQSWNFNNNTEGYICKFIGVECWHPDEN  79

Query  313  RVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSND  492
            +V+ L+L  + L G  P  +Q+C S+  LD S N LS TIP+ I   L ++ TLDLSSND
Sbjct  80   KVLNLKLSNMGLKGPFPRGIQNCTSMTGLDFSLNRLSKTIPADISTLLTFVTTLDLSSND  139

Query  493  LTGPIPPDLGNCTYLNKLILNDNKLTG  573
             TG IP  L NCTYLN L L+ N+LTG
Sbjct  140  FTGEIPASLSNCTYLNTLRLDQNQLTG  166



>ref|XP_006301045.1| hypothetical protein CARUB_v10021437mg [Capsella rubella]
 gb|EOA33943.1| hypothetical protein CARUB_v10021437mg [Capsella rubella]
Length=596

 Score =   134 bits (336),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 74/136 (54%), Positives = 92/136 (68%), Gaps = 1/136 (1%)
 Frame = +1

Query  166  AEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelreln  345
            AEDDV CL+G+K S  DP   L        ++  ICK  GV+CWN  ENR+I L+L+ + 
Sbjct  18   AEDDVLCLKGLKASLTDPSNQLSS-WSFPNSSSSICKLAGVSCWNAKENRIISLQLQSMQ  76

Query  346  lggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGN  525
            L G++P +L+ C SLQ+LDLS N  SG IPSQIC WLPYLV LDLS N L G IP  + +
Sbjct  77   LSGQIPESLKLCRSLQSLDLSDNDFSGLIPSQICSWLPYLVNLDLSGNKLGGSIPSQIVD  136

Query  526  CTYLNKLILNDNKLTG  573
            C +LN L LN+NKLTG
Sbjct  137  CKFLNTLALNENKLTG  152



>ref|XP_006390935.1| hypothetical protein EUTSA_v10018330mg [Eutrema salsugineum]
 gb|ESQ28221.1| hypothetical protein EUTSA_v10018330mg [Eutrema salsugineum]
Length=582

 Score =   134 bits (336),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 76/151 (50%), Positives = 105/151 (70%), Gaps = 3/151 (2%)
 Frame = +1

Query  130  LSILLVLFGVGVA---EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWN  300
            +SI L +F +  +   EDDV CL+G+K S  D  G L  W+F N+++  IC  +GV+CWN
Sbjct  5    ISITLFIFLISSSSYGEDDVLCLKGLKNSLTDSSGRLRSWSFPNSSSSSICNLIGVSCWN  64

Query  301  DNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDL  480
              E+R+I L+L+ + L G++P +L+ C SLQ+LDLS N  SG+IPS+IC WLPYLV LDL
Sbjct  65   AKESRIISLQLQSMQLSGQIPESLKLCRSLQSLDLSDNDFSGSIPSEICSWLPYLVALDL  124

Query  481  SSNDLTGPIPPDLGNCTYLNKLILNDNKLTG  573
            S N L G IP  + +C +LN + L+DNKLTG
Sbjct  125  SGNKLAGSIPSQIVDCKFLNSVALSDNKLTG  155



>ref|XP_006366814.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380-like [Solanum tuberosum]
Length=620

 Score =   134 bits (336),  Expect = 6e-33, Method: Composition-based stats.
 Identities = 65/136 (48%), Positives = 95/136 (70%), Gaps = 1/136 (1%)
 Frame = +1

Query  169  EDDVKCLQGVKGSFRDPDGNLGL-WNFDNTTAGFICKFVGVACWNDNENRVIglelreln  345
            + D+ CL+ +K SF DP   L   W FDN T GFICKF G+ CW+ +E RV+ + L ++ 
Sbjct  36   QSDIDCLKSIKDSFEDPLKFLNTTWKFDNQTEGFICKFAGIQCWHPDETRVLSISLPDMG  95

Query  346  lggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGN  525
            L G+ P  L++C S+ +LDLS N L G+IP+ I + + ++VTLDLSSN+L+G IP +L N
Sbjct  96   LKGKFPRGLKNCTSITSLDLSSNKLHGSIPNDISKIIGFMVTLDLSSNNLSGDIPVNLAN  155

Query  526  CTYLNKLILNDNKLTG  573
            C++LN L L++N+ TG
Sbjct  156  CSFLNSLRLDNNQFTG  171



>emb|CBI23354.3| unnamed protein product [Vitis vinifera]
Length=625

 Score =   134 bits (336),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 68/138 (49%), Positives = 94/138 (68%), Gaps = 1/138 (1%)
 Frame = +1

Query  163  VAEDDVKCLQGVKGSFRDPDGNLGL-WNFDNTTAGFICKFVGVACWNDNENRVIglelre  339
              E D+ CL+ +K S +DP+  L   WNF+N T GFICKF G+ CW+ +ENRV+ + L +
Sbjct  29   ATETDIYCLKTIKNSLQDPNNYLNFSWNFNNNTEGFICKFAGIDCWHPDENRVLNIRLSD  88

Query  340  lnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDL  519
            + L G+ P  +++C SL  LDLS N LSG+IPS I   L ++ TL+LSSN   G IPP L
Sbjct  89   MGLKGQFPRGIRNCSSLTGLDLSNNKLSGSIPSDISELLKFVTTLELSSNSFAGDIPPSL  148

Query  520  GNCTYLNKLILNDNKLTG  573
             NC++LN L L++N+LTG
Sbjct  149  ANCSFLNVLKLDNNRLTG  166



>ref|XP_002267164.2| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Vitis vinifera]
Length=621

 Score =   133 bits (335),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 68/138 (49%), Positives = 94/138 (68%), Gaps = 1/138 (1%)
 Frame = +1

Query  163  VAEDDVKCLQGVKGSFRDPDGNLGL-WNFDNTTAGFICKFVGVACWNDNENRVIglelre  339
              E D+ CL+ +K S +DP+  L   WNF+N T GFICKF G+ CW+ +ENRV+ + L +
Sbjct  29   ATETDIYCLKTIKNSLQDPNNYLNFSWNFNNNTEGFICKFAGIDCWHPDENRVLNIRLSD  88

Query  340  lnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDL  519
            + L G+ P  +++C SL  LDLS N LSG+IPS I   L ++ TL+LSSN   G IPP L
Sbjct  89   MGLKGQFPRGIRNCSSLTGLDLSNNKLSGSIPSDISELLKFVTTLELSSNSFAGDIPPSL  148

Query  520  GNCTYLNKLILNDNKLTG  573
             NC++LN L L++N+LTG
Sbjct  149  ANCSFLNVLKLDNNRLTG  166



>ref|XP_006342429.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380-like [Solanum tuberosum]
Length=588

 Score =   133 bits (334),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 90/137 (66%), Gaps = 0/137 (0%)
 Frame = +1

Query  163  VAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrel  342
             +E DV CL+ +K S  DP  +LG W+F N T GFICKF  V CW+ +EN+V+ L L   
Sbjct  26   ASESDVYCLKSIKDSLHDPFNSLGFWDFSNATEGFICKFSEVLCWHPDENKVLSLSLSGY  85

Query  343  nlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLG  522
             L GE P  +Q+C SL +LDLSGN L GTIPS I   + ++  LDLS+N  +G IPPD+ 
Sbjct  86   GLIGEFPRGIQNCTSLTSLDLSGNSLYGTIPSDISAIVEHVTILDLSNNTFSGDIPPDIA  145

Query  523  NCTYLNKLILNDNKLTG  573
            NC YLN L L++N L G
Sbjct  146  NCQYLNGLKLDNNYLEG  162



>ref|XP_010101366.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Morus notabilis]
 gb|EXB88313.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Morus notabilis]
Length=2189

 Score =   136 bits (342),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 72/142 (51%), Positives = 92/142 (65%), Gaps = 1/142 (1%)
 Frame = +1

Query  151  FGVGVA-EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIgl  327
            FG   A  DD+ CL+ +K S  DP G L  W+F+N T GFICKF+GV CW+ +EN+V+ +
Sbjct  23   FGASRALVDDIHCLKAIKASLEDPYGYLASWDFNNNTEGFICKFIGVDCWHPDENKVLNI  82

Query  328  elrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPI  507
             + ++ L G  P  L  C SL  LDLS N L G IPS I   LP + +LDLSSN+ +G I
Sbjct  83   RITDMGLKGTFPRGLGRCRSLTGLDLSNNKLHGPIPSDIGTLLPSVTSLDLSSNNFSGEI  142

Query  508  PPDLGNCTYLNKLILNDNKLTG  573
            P  L NCTYLN L L+ N+LTG
Sbjct  143  PKSLANCTYLNVLKLDHNRLTG  164



>ref|XP_010512071.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g69990 [Camelina sativa]
Length=594

 Score =   133 bits (334),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 77/138 (56%), Positives = 98/138 (71%), Gaps = 2/138 (1%)
 Frame = +1

Query  166  AEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGF--ICKFVGVACWNDNENRVIglelre  339
            AEDDV CL+G+K S +DP   L  W+F N+++    ICK  GV+CWN  ENR+I L+L+ 
Sbjct  18   AEDDVLCLKGLKASLKDPSNQLSSWSFPNSSSSSSSICKLTGVSCWNAKENRIISLQLQS  77

Query  340  lnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDL  519
            + L G++P +L+ C SLQ+LDLS N  SG IPSQIC WLPYLVTL+LS N L G IP  +
Sbjct  78   MQLSGQIPESLKLCRSLQSLDLSDNDFSGLIPSQICSWLPYLVTLNLSGNKLGGSIPSQI  137

Query  520  GNCTYLNKLILNDNKLTG  573
             +C +LN L LN NKLTG
Sbjct  138  VDCKFLNTLALNKNKLTG  155



>gb|AGI92775.1| RLP1.801.3 [Triticum aestivum]
Length=266

 Score =   129 bits (324),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 68/136 (50%), Positives = 90/136 (66%), Gaps = 0/136 (0%)
 Frame = +1

Query  166  AEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelreln  345
             E D++CL+ V+ S  DP G L  W+F+N T G+IC+F GV CW+ +EN+++ L L  L 
Sbjct  23   TEQDIRCLKSVQRSLADPGGVLRSWDFENDTDGYICRFTGVECWHPDENKILSLRLGNLG  82

Query  346  lggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGN  525
            L G+ P ALQ+C SL  LDLS N  SG IP  I R +PYL +LDLS N  +G IP ++ N
Sbjct  83   LQGQFPVALQNCSSLTGLDLSNNNFSGPIPQDISRRMPYLTSLDLSYNSFSGLIPQNISN  142

Query  526  CTYLNKLILNDNKLTG  573
             TYLN L L  N+L+G
Sbjct  143  MTYLNLLNLQHNQLSG  158



>gb|AGI92772.1| RLP1.1 [Triticum aestivum]
Length=266

 Score =   129 bits (324),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 68/136 (50%), Positives = 90/136 (66%), Gaps = 0/136 (0%)
 Frame = +1

Query  166  AEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelreln  345
             E D++CL+ V+ S  DP G L  W+F+N T G+IC+F GV CW+ +EN+++ L L  L 
Sbjct  23   TEQDIRCLKSVQRSLADPGGVLRSWDFENDTDGYICRFTGVECWHPDENKILSLRLGNLG  82

Query  346  lggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGN  525
            L G+ P ALQ+C SL  LDLS N  SG IP  I R +PYL +LDLS N  +G IP ++ N
Sbjct  83   LQGQFPVALQNCSSLTGLDLSNNNFSGPIPQDISRRMPYLTSLDLSYNSFSGLIPQNISN  142

Query  526  CTYLNKLILNDNKLTG  573
             TYLN L L  N+L+G
Sbjct  143  MTYLNLLNLQHNQLSG  158



>ref|XP_002527290.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF35134.1| ATP binding protein, putative [Ricinus communis]
Length=302

 Score =   130 bits (326),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 67/138 (49%), Positives = 92/138 (67%), Gaps = 1/138 (1%)
 Frame = +1

Query  163  VAEDDVKCLQGVKGSFRDPDGNL-GLWNFDNTTAGFICKFVGVACWNDNENRVIglelre  339
              E D+ CL+ +K S  DP  NL   W+F+N T G+ICKFVGV CW+ +EN+V+ L L  
Sbjct  33   ATETDIACLKSIKASLEDPLNNLNSSWDFNNKTEGYICKFVGVECWHPDENKVLNLRLSG  92

Query  340  lnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDL  519
            + L G  P  LQ+C S+  +DLS N LSG+IP+ I   + Y+ +L+LSSN+ +G IP  L
Sbjct  93   MGLKGRFPIGLQNCTSITGVDLSSNELSGSIPADISHIIKYVTSLELSSNNFSGEIPVAL  152

Query  520  GNCTYLNKLILNDNKLTG  573
             NC+YLN L L+ N+LTG
Sbjct  153  ANCSYLNVLKLDHNRLTG  170



>gb|AGI92777.1| RLP1.801.5 [Triticum aestivum]
Length=266

 Score =   129 bits (323),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 68/136 (50%), Positives = 90/136 (66%), Gaps = 0/136 (0%)
 Frame = +1

Query  166  AEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelreln  345
             E D++CL+ V+ S  DP G L  W+F+N T G+IC+F GV CW+ +EN+++ L L  L 
Sbjct  23   TEQDIRCLKSVQRSLADPGGVLRSWDFENDTDGYICRFTGVECWHPDENKILSLRLGNLG  82

Query  346  lggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGN  525
            L G+ P ALQ+C SL  LDLS N  SG IP  I R +PYL +LDLS N  +G IP ++ N
Sbjct  83   LQGQFPVALQNCSSLTGLDLSNNNFSGPIPQDISRRMPYLTSLDLSYNSFSGLIPQNISN  142

Query  526  CTYLNKLILNDNKLTG  573
             TYLN L L  N+L+G
Sbjct  143  MTYLNLLNLQHNQLSG  158



>gb|KJB10818.1| hypothetical protein B456_001G226700 [Gossypium raimondii]
 gb|KJB10819.1| hypothetical protein B456_001G226700 [Gossypium raimondii]
Length=614

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 67/138 (49%), Positives = 94/138 (68%), Gaps = 1/138 (1%)
 Frame = +1

Query  163  VAEDDVKCLQGVKGSFRDPDGNL-GLWNFDNTTAGFICKFVGVACWNDNENRVIglelre  339
              +DD++CL+ +K SF+D  G L   WNF+N T GFIC+F G+ CW+ +ENRV+ + L +
Sbjct  29   ATKDDIECLKSIKASFQDSFGYLNSSWNFNNDTEGFICRFTGIDCWHPDENRVLNIRLSD  88

Query  340  lnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDL  519
            + L G  P  +  C S+  LDLS N L G IPS I + +PY+ +LDLSSN+ +G IP +L
Sbjct  89   MGLKGVFPRDIIKCKSMTGLDLSSNKLYGKIPSDIAKLIPYVTSLDLSSNNFSGEIPKNL  148

Query  520  GNCTYLNKLILNDNKLTG  573
             NC++LN L L+ NKLTG
Sbjct  149  ANCSFLNILNLDHNKLTG  166



>ref|XP_010088605.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Morus notabilis]
 gb|EXB36746.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Morus notabilis]
Length=618

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 74/155 (48%), Positives = 100/155 (65%), Gaps = 8/155 (5%)
 Frame = +1

Query  130  LSILLVLFGVGVAE------DDVKCLQGVKGSFRDPDGNLGL-WNFDNTTAGFICKFVGV  288
            L + LVLF +G  +      DD+ CL+ +K SF DP G+L   W F+N T G IC+F GV
Sbjct  12   LHLFLVLF-IGSVDASLALGDDIPCLKAIKASFEDPFGHLSYSWKFNNQTEGSICRFKGV  70

Query  289  ACWNDNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLV  468
             CW+ +EN+V+ + L  + L G  P  ++ C SL  L+LS N L+GTIPS I   LP++ 
Sbjct  71   ECWHPDENKVLNINLSGMGLKGTFPRGIRYCTSLMGLNLSNNALAGTIPSDISMLLPFVT  130

Query  469  TLDLSSNDLTGPIPPDLGNCTYLNKLILNDNKLTG  573
            +LDLSSN  +G IP +L NCTYLN L L+ N+LTG
Sbjct  131  SLDLSSNSCSGEIPKNLANCTYLNVLRLDHNRLTG  165



>ref|XP_010471000.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g69990 [Camelina sativa]
Length=616

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 97/137 (71%), Gaps = 1/137 (1%)
 Frame = +1

Query  166  AEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGF-ICKFVGVACWNDNENRVIglelrel  342
            AEDDV CL+G+K S +DP   L  W+F N+++   ICK  GV CWN  ENR+I L+L+ +
Sbjct  42   AEDDVLCLKGLKASLKDPSNQLSSWSFPNSSSSSSICKLTGVFCWNAKENRIISLQLQSM  101

Query  343  nlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLG  522
             L G++P +L+ C SLQ+LDLS N  SG IPSQIC WLPYLVTL+LS N L G IP  + 
Sbjct  102  QLSGQIPESLKLCRSLQSLDLSDNDFSGLIPSQICSWLPYLVTLNLSGNKLGGSIPSQIV  161

Query  523  NCTYLNKLILNDNKLTG  573
            +C +LN L LN NKLTG
Sbjct  162  DCKFLNTLALNKNKLTG  178



>emb|CDP03993.1| unnamed protein product [Coffea canephora]
Length=617

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 90/133 (68%), Gaps = 0/133 (0%)
 Frame = +1

Query  175  DVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnlgg  354
            DV CL+ VK +  DP  +L  WNFDN T GFICKF G+ CW+ +EN+V+ + L  + L G
Sbjct  31   DVDCLRAVKQTLEDPLNSLSTWNFDNATEGFICKFTGIECWHPDENKVLNVRLSSMGLKG  90

Query  355  eVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNCTY  534
            + P  L +C +L  LDLS N +SG IPS I   + ++ TLDLSSN L+G IP  L NC++
Sbjct  91   QFPRDLANCSALTGLDLSSNNISGNIPSDISSIIKFVTTLDLSSNHLSGQIPEGLANCSF  150

Query  535  LNKLILNDNKLTG  573
            LN L L++N+LTG
Sbjct  151  LNSLKLDNNQLTG  163



>ref|XP_010547175.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Tarenaya hassleriana]
Length=615

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 71/148 (48%), Positives = 101/148 (68%), Gaps = 3/148 (2%)
 Frame = +1

Query  139  LLVLFGVGVA---EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNE  309
            LL+LF  G++   E D+ CL+ +K  F+DP+G L  W F N+T G+ICKF GV+CW+D+E
Sbjct  16   LLLLFCSGLSNASEADIACLKTLKEQFKDPNGYLSNWVFGNSTPGYICKFSGVSCWHDDE  75

Query  310  NRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSN  489
            NRV+ ++L    +GGE P  +++C SL  LDLS N LSGT+P+ I  ++    TLDLS N
Sbjct  76   NRVLSIKLPGYGVGGEFPRGVKECTSLTALDLSKNNLSGTLPTDISSFIGLATTLDLSYN  135

Query  490  DLTGPIPPDLGNCTYLNKLILNDNKLTG  573
              +G IP  + N ++LN L+LNDN+ TG
Sbjct  136  GFSGEIPVSVSNISFLNTLMLNDNRFTG  163



>ref|XP_003624238.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Medicago truncatula]
 gb|ABN08998.1| Protein kinase [Medicago truncatula]
 gb|AES80456.1| LRR receptor-like kinase [Medicago truncatula]
Length=615

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 101/157 (64%), Gaps = 3/157 (2%)
 Frame = +1

Query  112  FSRFLKLSILLVLFGVGVA---EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFV  282
            FS  + +S  L++   G+    E D+ CL+ VK S +DP+  L  W+F+N T G ICKF 
Sbjct  8    FSTPIIVSFSLLVISCGITYGTETDILCLKRVKESLKDPNNYLQNWDFNNKTEGSICKFT  67

Query  283  GVACWNDNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPY  462
            GV CW+ +ENRV+ L+L  + L GE P  +Q+C SL  LD S N LS +IP+ +   + +
Sbjct  68   GVECWHPDENRVLNLKLSNMGLKGEFPRGIQNCSSLTGLDFSLNSLSKSIPADVSTLIGF  127

Query  463  LVTLDLSSNDLTGPIPPDLGNCTYLNKLILNDNKLTG  573
            + TLDLSSND TG IP  L NCTYLN + L+ N+LTG
Sbjct  128  VTTLDLSSNDFTGEIPVSLANCTYLNSIKLDQNQLTG  164



>ref|XP_008356285.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Malus domestica]
Length=281

 Score =   128 bits (322),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 67/138 (49%), Positives = 95/138 (69%), Gaps = 1/138 (1%)
 Frame = +1

Query  163  VAEDDVKCLQGVKGSFRDPDGNL-GLWNFDNTTAGFICKFVGVACWNDNENRVIglelre  339
              E D+ CL+G+K S  DP G L   W+F N T GFIC F+G+ CW+ +E++V+ ++L +
Sbjct  34   AVESDINCLKGIKDSLNDPLGYLNSSWDFXNXTEGFICNFLGIECWHPHESKVLNIKLSD  93

Query  340  lnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDL  519
            L L G+ P  + +C SL  LDLS N L+G +P+ I R+LP+L  LDLSSN  +G IP +L
Sbjct  94   LGLKGQFPXGVANCTSLTGLDLSSNMLNGPLPTDIGRFLPFLTYLDLSSNSFSGSIPANL  153

Query  520  GNCTYLNKLILNDNKLTG  573
             NCTY+N L+L++NK TG
Sbjct  154  SNCTYMNVLMLDNNKFTG  171



>ref|XP_009619663.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Nicotiana tomentosiformis]
 ref|XP_009619664.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Nicotiana tomentosiformis]
Length=622

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 67/138 (49%), Positives = 97/138 (70%), Gaps = 1/138 (1%)
 Frame = +1

Query  163  VAEDDVKCLQGVKGSFRDPDGNLG-LWNFDNTTAGFICKFVGVACWNDNENRVIglelre  339
              + D+ CL+ VK S  DP   LG  WNFDN T GFICKF G+ CW+ +E++V+ + L +
Sbjct  34   AVQSDIDCLKSVKESLEDPLNYLGSTWNFDNQTEGFICKFTGIQCWHPDESKVLSITLPD  93

Query  340  lnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDL  519
            + L G  P  +Q+C S+ +LDLS N L+G+IPS I + + ++V LDLSSN+L+G IP DL
Sbjct  94   MGLKGRFPRGIQNCTSMTSLDLSSNELNGSIPSDISKIIGFVVILDLSSNNLSGQIPVDL  153

Query  520  GNCTYLNKLILNDNKLTG  573
             NC++LN + L++N+LTG
Sbjct  154  ANCSFLNDIKLDNNQLTG  171



>ref|XP_007139688.1| hypothetical protein PHAVU_008G050700g [Phaseolus vulgaris]
 gb|ESW11682.1| hypothetical protein PHAVU_008G050700g [Phaseolus vulgaris]
Length=614

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 72/147 (49%), Positives = 97/147 (66%), Gaps = 1/147 (1%)
 Frame = +1

Query  136  ILLVLFGVGVAED-DVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNEN  312
             LLVL G+    D D+ CL+ VK + +DP   L  W+F+N T G+ICKF GV CW+ +EN
Sbjct  17   FLLVLCGMVCGTDNDISCLRSVKAALQDPYNYLQSWDFNNKTEGYICKFTGVECWHPDEN  76

Query  313  RVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSND  492
            RV+ L+L  + L GE P  +++C S+  LD S N LS TIP+ I   L ++ ++DLSSND
Sbjct  77   RVLNLKLSNMGLKGEFPRGVENCSSMTGLDFSLNRLSKTIPADISTLLTFVTSIDLSSND  136

Query  493  LTGPIPPDLGNCTYLNKLILNDNKLTG  573
             TG IP  L NCTYLN L L+ N+L+G
Sbjct  137  FTGEIPASLSNCTYLNTLRLDQNQLSG  163



>ref|XP_004242451.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Solanum lycopersicum]
 ref|XP_004242452.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Solanum lycopersicum]
 ref|XP_010323106.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Solanum lycopersicum]
Length=620

 Score =   132 bits (332),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 69/158 (44%), Positives = 100/158 (63%), Gaps = 3/158 (2%)
 Frame = +1

Query  109  GFSRFLKLSILLVLFGV--GVAEDDVKCLQGVKGSFRDPDGNLGL-WNFDNTTAGFICKF  279
              + F  + I LVL        + D+ CL+ +K SF DP   L   W FDN T GFICKF
Sbjct  14   ALTTFAAILIYLVLSCAVCSAVQSDIDCLKSIKDSFEDPLNFLNTTWKFDNQTEGFICKF  73

Query  280  VGVACWNDNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLP  459
             G+ CW+ +E RV+ + L ++ L G+ P  L++C S+ +LDLS N L G+IP+ I + + 
Sbjct  74   AGIQCWHPDETRVLSISLPDMRLKGKFPRGLKNCTSITSLDLSSNELHGSIPNDISKIIG  133

Query  460  YLVTLDLSSNDLTGPIPPDLGNCTYLNKLILNDNKLTG  573
            ++V LDLSSN+ +G IP +L NC++LN L L+DN+ TG
Sbjct  134  FVVMLDLSSNNFSGEIPVNLANCSFLNSLRLDDNQFTG  171



>ref|XP_010053967.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Eucalyptus grandis]
 gb|KCW78348.1| hypothetical protein EUGRSUZ_D02521 [Eucalyptus grandis]
Length=220

 Score =   127 bits (318),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 73/161 (45%), Positives = 99/161 (61%), Gaps = 3/161 (2%)
 Frame = +1

Query  94   RMVGFGFSRFLKLSILLVLFGVGVAEDDVKCLQGVKGSFRDPDGNLGL-WNFDNTTAGFI  270
            R+   G + FL    LL    +   E D+ CL+ +K S +DP   L   WNFDN T GFI
Sbjct  6    RVSSLGAAGFLW--ALLSCCVIHCLETDINCLKTIKASVQDPLNYLNYTWNFDNDTEGFI  63

Query  271  CKFVGVACWNDNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICR  450
            C+F GV CW+ +ENRV+ L+L ++ L G+ P  ++ C SL  LDLS N  SG IP  I  
Sbjct  64   CRFTGVECWHPDENRVLNLKLSDMGLKGQFPRGIEQCKSLTGLDLSSNEFSGPIPENISS  123

Query  451  WLPYLVTLDLSSNDLTGPIPPDLGNCTYLNKLILNDNKLTG  573
             +PY  +LDLSSN+ +G IP ++ NC YLN L L+ N+L+G
Sbjct  124  IIPYATSLDLSSNNFSGQIPVNISNCRYLNSLRLDHNQLSG  164



>gb|KHN40510.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Glycine soja]
Length=616

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 98/157 (62%), Gaps = 1/157 (1%)
 Frame = +1

Query  106  FGFSRFLKLSILLVLFGVGVAED-DVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFV  282
            FG    +    LL+L G+    D D+ CL+ VK +  DP   L  WNF+N T G+ICKF 
Sbjct  8    FGAGVIIVSFFLLILCGMVCGTDSDIFCLKSVKRTLDDPYNYLQSWNFNNNTEGYICKFT  67

Query  283  GVACWNDNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPY  462
            GV CW+ +EN+V+ L+L  + L G  P  +Q+C S+  LD S N LS TIP+ I   L +
Sbjct  68   GVECWHPDENKVLNLKLSNMGLKGPFPRGIQNCSSMTGLDFSLNRLSKTIPADISTLLTF  127

Query  463  LVTLDLSSNDLTGPIPPDLGNCTYLNKLILNDNKLTG  573
            + TLDLSSND TG IP  L NCTYLN + L+ N+LTG
Sbjct  128  VTTLDLSSNDFTGEIPASLSNCTYLNTIRLDQNQLTG  164



>ref|XP_006601824.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380-like isoform X1 [Glycine max]
Length=618

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 98/157 (62%), Gaps = 1/157 (1%)
 Frame = +1

Query  106  FGFSRFLKLSILLVLFGVGVAED-DVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFV  282
            FG    +    LL+L G+    D D+ CL+ VK +  DP   L  WNF+N T G+ICKF 
Sbjct  10   FGAGVIIVSFFLLILCGMVCGTDSDIFCLKSVKRTLDDPYNYLQSWNFNNNTEGYICKFT  69

Query  283  GVACWNDNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPY  462
            GV CW+ +EN+V+ L+L  + L G  P  +Q+C S+  LD S N LS TIP+ I   L +
Sbjct  70   GVECWHPDENKVLNLKLSNMGLKGPFPRGIQNCSSMTGLDFSLNRLSKTIPADISTLLTF  129

Query  463  LVTLDLSSNDLTGPIPPDLGNCTYLNKLILNDNKLTG  573
            + TLDLSSND TG IP  L NCTYLN + L+ N+LTG
Sbjct  130  VTTLDLSSNDFTGEIPASLSNCTYLNTIRLDQNQLTG  166



>gb|KDP45204.1| hypothetical protein JCGZ_15069 [Jatropha curcas]
Length=225

 Score =   127 bits (318),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 68/137 (50%), Positives = 91/137 (66%), Gaps = 1/137 (1%)
 Frame = +1

Query  166  AEDDVKCLQGVKGSFRDPDGNL-GLWNFDNTTAGFICKFVGVACWNDNENRVIglelrel  342
             E D+ CL+ +K S  DP G L   WNF+N T GFIC+F GV CW+ +EN+V+ L L ++
Sbjct  27   TETDIACLKSIKASLEDPFGYLKSSWNFNNNTEGFICRFTGVDCWHPDENKVLNLRLSDM  86

Query  343  nlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLG  522
             L G+ P  L++C S+  +DLS N L GTIP+ I    P+L +LDLSSN  +G IP DL 
Sbjct  87   ELKGQFPLGLRNCTSITGVDLSNNDLVGTIPTNISNITPFLTSLDLSSNSFSGTIPADLV  146

Query  523  NCTYLNKLILNDNKLTG  573
            NC+YLN L L+ N+ TG
Sbjct  147  NCSYLNVLKLDRNRFTG  163



>ref|XP_010053969.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Eucalyptus grandis]
 gb|KCW78346.1| hypothetical protein EUGRSUZ_D02519 [Eucalyptus grandis]
Length=220

 Score =   126 bits (317),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 74/161 (46%), Positives = 98/161 (61%), Gaps = 3/161 (2%)
 Frame = +1

Query  94   RMVGFGFSRFLKLSILLVLFGVGVAEDDVKCLQGVKGSFRDPDGNLGL-WNFDNTTAGFI  270
            R+ G G + FL    LL    +   E D+ CL+ +K S +DP   L   WNFDN T GFI
Sbjct  6    RVSGLGAAGFLW--ALLSCCVIHCLETDINCLKTIKASVQDPLNYLNYTWNFDNDTEGFI  63

Query  271  CKFVGVACWNDNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICR  450
            C+F GV CW+ +ENRV+ L+L ++ L G+ P  ++ C SL  LDLS N  SG IP  I  
Sbjct  64   CRFTGVECWHPDENRVLNLKLSDMGLKGQFPRGIEQCKSLTGLDLSSNKFSGPIPENISS  123

Query  451  WLPYLVTLDLSSNDLTGPIPPDLGNCTYLNKLILNDNKLTG  573
             + Y  +LDLSSN  +G IP +L NC YLN L L+ N+L+G
Sbjct  124  IIQYATSLDLSSNSFSGQIPVNLSNCRYLNSLRLDHNQLSG  164



>ref|XP_009615340.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Nicotiana tomentosiformis]
Length=576

 Score =   131 bits (329),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 73/158 (46%), Positives = 102/158 (65%), Gaps = 5/158 (3%)
 Frame = +1

Query  115  SRFLKLSIL-LVLFG----VGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKF  279
            S FL  +IL  +LFG        E D+ CL+ +K S +DP  +L  W+F N+T GFIC+F
Sbjct  10   SFFLVSNILGFLLFGRIYLCSATETDIHCLKSIKDSLQDPFNSLDSWDFSNSTEGFICRF  69

Query  280  VGVACWNDNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLP  459
            +G+ CW+ +EN+V+ + L ++ L GE P  +Q+C SL  L++S N L GTIPS I   L 
Sbjct  70   IGIECWHPDENKVLNIMLSKMGLIGEFPRGIQNCTSLTGLNISNNNLYGTIPSDISVILE  129

Query  460  YLVTLDLSSNDLTGPIPPDLGNCTYLNKLILNDNKLTG  573
            ++ TLDLS+N  +G IPPD+ NC YLN L L +N L G
Sbjct  130  HVTTLDLSNNTFSGNIPPDIANCAYLNILKLENNNLEG  167



>emb|CDY05685.1| BnaC02g38520D [Brassica napus]
Length=625

 Score =   131 bits (330),  Expect = 4e-32, Method: Composition-based stats.
 Identities = 63/135 (47%), Positives = 87/135 (64%), Gaps = 0/135 (0%)
 Frame = +1

Query  169  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  348
            E +V CL+ +    +DP+G L  W F N TAG+ICKF GV CW+D+ENRV+ ++L    L
Sbjct  31   EANVNCLRTIYKQVKDPNGYLTSWVFGNQTAGYICKFAGVTCWHDDENRVLSIKLGGYGL  90

Query  349  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  528
             GE P  +++C  L  LDLS N  SG +PS +  ++P +  LDLS N  +GPIPP + N 
Sbjct  91   EGEFPLGIKNCTDLTALDLSKNNFSGPLPSNVTSFIPLVTILDLSYNQFSGPIPPSISNI  150

Query  529  TYLNKLILNDNKLTG  573
            T+LN L+L  N+ TG
Sbjct  151  TFLNSLMLQHNQFTG  165



>gb|EMT19838.1| Putative LRR receptor-like serine/threonine-protein kinase [Aegilops 
tauschii]
Length=266

 Score =   127 bits (319),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 70/141 (50%), Positives = 92/141 (65%), Gaps = 3/141 (2%)
 Frame = +1

Query  151  FGVGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIgle  330
            FG+   E D++CL+ V+GS  DP G L  W+F+N T GFIC+F GV CW+ +EN+++ L 
Sbjct  21   FGI---EQDIRCLKSVQGSLADPGGVLRSWDFENETNGFICRFTGVECWHPDENKILSLR  77

Query  331  lrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIP  510
            L  L L G+ P ALQ+C SL  LDLS N   G IP  I   +PYL +LDLS N  +G IP
Sbjct  78   LGNLGLEGQFPVALQNCSSLTGLDLSNNNFLGPIPQDISWVMPYLTSLDLSYNSFSGSIP  137

Query  511  PDLGNCTYLNKLILNDNKLTG  573
             ++ N TYLN L L  N+L+G
Sbjct  138  HNISNMTYLNVLNLQHNQLSG  158



>ref|XP_009406423.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 isoform X2 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009406424.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=613

 Score =   131 bits (330),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 92/134 (69%), Gaps = 1/134 (1%)
 Frame = +1

Query  175  DVKCLQGVKGSFRDPDGNLGL-WNFDNTTAGFICKFVGVACWNDNENRVIglelrelnlg  351
            D++CL+ VK S +DP+ NL   W FDNT+ G ICKF GV CW+ +EN+V+ L L  + L 
Sbjct  32   DIECLRLVKLSLKDPENNLFYSWTFDNTSEGSICKFNGVECWHPDENKVLNLRLSNMGLQ  91

Query  352  geVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNCT  531
            G+ P  L++C SL  LDLS N LSGTIP  I + +PY+ +LDLS ND +G IP +L +CT
Sbjct  92   GQFPSGLENCTSLTGLDLSNNNLSGTIPVNIAKKIPYVTSLDLSFNDFSGQIPVNLSDCT  151

Query  532  YLNKLILNDNKLTG  573
            YLN L L  N LTG
Sbjct  152  YLNSLKLQHNNLTG  165



>ref|XP_006343705.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380-like [Solanum tuberosum]
Length=256

 Score =   127 bits (318),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 70/156 (45%), Positives = 98/156 (63%), Gaps = 5/156 (3%)
 Frame = +1

Query  121  FLKLSILLVLFGVGV----AEDDVKCLQGVKGSFRDPDGNLGL-WNFDNTTAGFICKFVG  285
            +L L   +VL    +     + D+ CL  +K SF DP   L   W FDN T GFICKF G
Sbjct  8    YLVLPFFVVLCSFSLRCNAVQSDIDCLISIKDSFEDPLNFLNTTWKFDNQTEGFICKFAG  67

Query  286  VACWNDNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYL  465
            + CW+ +E RV+ + L ++ L GE P  +++C S+ +LDLS N L GTIPS I + + + 
Sbjct  68   IQCWHPDETRVLSISLPDMGLKGEFPRGIENCTSITSLDLSSNELYGTIPSDISKLIRFT  127

Query  466  VTLDLSSNDLTGPIPPDLGNCTYLNKLILNDNKLTG  573
            +TLDLSSN  +G IP D+ NC++LN L L++NKL G
Sbjct  128  ITLDLSSNQFSGAIPSDIANCSFLNSLRLDNNKLQG  163



>ref|XP_010911215.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Elaeis guineensis]
Length=611

 Score =   131 bits (330),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 69/136 (51%), Positives = 92/136 (68%), Gaps = 1/136 (1%)
 Frame = +1

Query  169  EDDVKCLQGVKGSFRDPDGNLGL-WNFDNTTAGFICKFVGVACWNDNENRVIglelreln  345
            + D++CL+ ++ S RDP  +L   WNF N T G ICKF GV CW+ +ENRV+ L L  + 
Sbjct  30   QTDIECLRKIQLSLRDPLDSLKYSWNFSNKTEGAICKFNGVECWHPDENRVLNLHLSNMG  89

Query  346  lggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGN  525
            L G  P  L++C SL  LDLS N LSG+IP+ I R +PY+ +LDLS N+ TG IP +L N
Sbjct  90   LEGPFPSGLENCTSLTGLDLSSNNLSGSIPADISRKIPYITSLDLSFNNFTGEIPANLSN  149

Query  526  CTYLNKLILNDNKLTG  573
            C+YLN L L  N+L+G
Sbjct  150  CSYLNVLSLQHNRLSG  165



>ref|XP_006378629.1| hypothetical protein POPTR_0010s18540g [Populus trichocarpa]
 gb|ERP56426.1| hypothetical protein POPTR_0010s18540g [Populus trichocarpa]
Length=621

 Score =   131 bits (329),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 69/154 (45%), Positives = 104/154 (68%), Gaps = 6/154 (4%)
 Frame = +1

Query  130  LSILLVLFGVGVA-----EDDVKCLQGVKGSFRDPDGNLGL-WNFDNTTAGFICKFVGVA  291
            + ++LVL    ++     E D+ CL+ +K S  DP+  L   WNFDN T GFIC+F+G+ 
Sbjct  16   IGMVLVLLSSRISVSNATETDLACLKSIKASLVDPNNYLNTTWNFDNNTEGFICRFMGID  75

Query  292  CWNDNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVT  471
            CW+ +ENRV+ + L +L L G+ P  +Q+C SL  L+LS N LSG+IP+ I +++PY+  
Sbjct  76   CWHPDENRVLNIRLSDLGLEGQFPPGIQNCTSLTGLNLSQNQLSGSIPANIAKFIPYITN  135

Query  472  LDLSSNDLTGPIPPDLGNCTYLNKLILNDNKLTG  573
            LDLS N+ +G IP +L NC++LN L L++N+LT 
Sbjct  136  LDLSFNNFSGEIPQNLANCSFLNDLKLDNNRLTS  169



>ref|XP_009799665.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Nicotiana sylvestris]
 ref|XP_009799666.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Nicotiana sylvestris]
Length=625

 Score =   131 bits (329),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 66/135 (49%), Positives = 95/135 (70%), Gaps = 0/135 (0%)
 Frame = +1

Query  169  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  348
            + D+ CL+ +K +  D   +L  WNF+N T GFICKF G+ CW+ +ENRV+ + L ++ L
Sbjct  36   QSDIDCLKSIKSALEDTSNSLASWNFNNQTEGFICKFTGIECWHPDENRVLSIRLPDMGL  95

Query  349  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  528
             GE P  +Q+C SL +LDLS N L+G+IPS I + + ++V LDLSSN L+G IP +L NC
Sbjct  96   KGEFPRGIQNCSSLTSLDLSNNKLNGSIPSNISKVIGFVVKLDLSSNLLSGEIPVNLANC  155

Query  529  TYLNKLILNDNKLTG  573
            +YLN L L++N+L G
Sbjct  156  SYLNDLNLDNNRLRG  170



>ref|XP_009784192.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Nicotiana sylvestris]
Length=599

 Score =   130 bits (328),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 76/166 (46%), Positives = 99/166 (60%), Gaps = 3/166 (2%)
 Frame = +1

Query  85   ADFRMVGFGFSRFLKLSILLVLFGVGV---AEDDVKCLQGVKGSFRDPDGNLGLWNFDNT  255
             +FR   F F       +L+ L  + V    E D  CL+ +K S +DP  NL  W+F N 
Sbjct  4    TNFRTRSFFFICTFLGFLLMSLSRISVCCAVESDFYCLKSIKDSLQDPFNNLDTWDFSNA  63

Query  256  TAGFICKFVGVACWNDNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIP  435
            T G IC+F G+ CW+ NEN+V+ + L    L GE P  +++C SL  LDLSGN L G IP
Sbjct  64   TEGSICRFSGINCWHANENKVLSITLSNYGLIGEFPRGVRNCTSLTGLDLSGNKLYGNIP  123

Query  436  SQICRWLPYLVTLDLSSNDLTGPIPPDLGNCTYLNKLILNDNKLTG  573
            S I   L Y+ TLDLS+N  +G IPPD+ NCTYLN L L++N L G
Sbjct  124  SDISVILDYVTTLDLSNNTFSGNIPPDIANCTYLNVLRLDNNNLEG  169



>ref|NP_001143239.1| uncharacterized protein LOC100275764 precursor [Zea mays]
 gb|ACG30073.1| hypothetical protein [Zea mays]
Length=467

 Score =   130 bits (326),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 65/135 (48%), Positives = 86/135 (64%), Gaps = 0/135 (0%)
 Frame = +1

Query  169  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  348
            +D ++CL+GVK    DP+G L  W+F NT+ G +  + G+ CWN  E+RV+ L L    L
Sbjct  34   QDGLRCLRGVKHDLADPNGRLADWDFKNTSGGAVYSYSGIGCWNLQESRVLSLSLSGFGL  93

Query  349  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  528
             G +P +LQ C +   LDLS N L GTI   +C WLP+LVTLDLSSN LTG IP +L NC
Sbjct  94   VGSIPSSLQYCSAATTLDLSSNALVGTILPALCDWLPFLVTLDLSSNQLTGAIPAELANC  153

Query  529  TYLNKLILNDNKLTG  573
             +LN L L+ +   G
Sbjct  154  RFLNSLTLSGSSRAG  168



>ref|XP_010679004.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Beta vulgaris subsp. vulgaris]
 ref|XP_010679005.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Beta vulgaris subsp. vulgaris]
Length=619

 Score =   130 bits (328),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 70/148 (47%), Positives = 93/148 (63%), Gaps = 2/148 (1%)
 Frame = +1

Query  136  ILLVLFGVGV-AEDDVKCLQGVKGSFRDPDGNL-GLWNFDNTTAGFICKFVGVACWNDNE  309
            +LLV  G+   +E+DV CL+ +K S  DP+  L   WNF N T GFIC F G+ CW  NE
Sbjct  23   VLLVFSGLSYGSENDVSCLRSIKESLHDPNNILNSTWNFSNATQGFICSFTGIDCWAPNE  82

Query  310  NRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSN  489
             RV+ + L  + L G  P  + +C SLQ+LDLS N L G IP+ I   +PY+  LDLSSN
Sbjct  83   YRVLNIRLSNMGLRGRFPLGISNCSSLQHLDLSSNDLDGAIPANISFIIPYVTVLDLSSN  142

Query  490  DLTGPIPPDLGNCTYLNKLILNDNKLTG  573
              +G IP +L NC+YLN L L+ N+ +G
Sbjct  143  RFSGEIPVNLANCSYLNSLQLDHNRFSG  170



>ref|XP_009767841.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Nicotiana sylvestris]
 ref|XP_009767850.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Nicotiana sylvestris]
 ref|XP_009767856.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Nicotiana sylvestris]
Length=622

 Score =   130 bits (328),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 66/138 (48%), Positives = 96/138 (70%), Gaps = 1/138 (1%)
 Frame = +1

Query  163  VAEDDVKCLQGVKGSFRDPDGNLG-LWNFDNTTAGFICKFVGVACWNDNENRVIglelre  339
              + D+ CL+ VK S  DP   LG  WNFDN T GFICKF G+ CW+ +E++V+ + L +
Sbjct  34   AVQSDIDCLKSVKESLEDPLNYLGSTWNFDNQTEGFICKFTGIQCWHPDESKVLSITLPD  93

Query  340  lnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDL  519
            + L G  P  +Q+C S+ +LDLS N L+G+IP  I + + ++V LDLSSN+L+G IP DL
Sbjct  94   MGLKGRFPRGIQNCTSMTSLDLSSNELNGSIPRDISKIIGFVVILDLSSNNLSGEIPVDL  153

Query  520  GNCTYLNKLILNDNKLTG  573
             NC++LN + L++N+LTG
Sbjct  154  ANCSFLNDIKLDNNQLTG  171



>gb|KEH18041.1| LRR receptor-like kinase [Medicago truncatula]
Length=618

 Score =   130 bits (328),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 72/148 (49%), Positives = 99/148 (67%), Gaps = 2/148 (1%)
 Frame = +1

Query  136  ILLVLFGVGV-AEDDVKCLQGVKGSFRDPDGNL-GLWNFDNTTAGFICKFVGVACWNDNE  309
            +LL+ FG+    E D+ CL+ +K S +DP+  L   WNF+N T GFIC+F GV CW+ +E
Sbjct  19   LLLISFGITYGTETDIFCLKSIKNSIQDPNNYLTSSWNFNNKTEGFICRFNGVECWHPDE  78

Query  310  NRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSN  489
            N+V+ L+L  + L G+ P  + +C S+  LDLS N LSGTIP  I   L ++ +LDLSSN
Sbjct  79   NKVLNLKLSNMGLKGQFPRGIVNCSSMTGLDLSVNDLSGTIPGDISTLLKFVTSLDLSSN  138

Query  490  DLTGPIPPDLGNCTYLNKLILNDNKLTG  573
            + +G IP  L NCTYLN L L+ N+LTG
Sbjct  139  EFSGEIPVSLANCTYLNVLKLSQNQLTG  166



>ref|XP_010251401.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Nelumbo nucifera]
 ref|XP_010251402.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Nelumbo nucifera]
 ref|XP_010251403.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Nelumbo nucifera]
Length=617

 Score =   130 bits (328),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 67/136 (49%), Positives = 90/136 (66%), Gaps = 0/136 (0%)
 Frame = +1

Query  166  AEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelreln  345
            ++ D+ CL+ +K S  DP   L  WNF+N T GFICKF G+ CW+ +ENRVI + L ++ 
Sbjct  29   SDADINCLKSLKSSLEDPFNYLSSWNFNNKTEGFICKFTGIDCWHPDENRVINIRLSDMG  88

Query  346  lggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGN  525
            L G+ P  +++C +L  LDLS N LSG IP  + + + Y  TLDLSSN  +G IP  L N
Sbjct  89   LKGQFPKGVENCTTLTGLDLSNNNLSGPIPLDVSKMIIYATTLDLSSNRFSGQIPVSLSN  148

Query  526  CTYLNKLILNDNKLTG  573
            CTYLN L L +N+LTG
Sbjct  149  CTYLNTLKLENNQLTG  164



>ref|XP_010037082.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Eucalyptus grandis]
 gb|KCW48706.1| hypothetical protein EUGRSUZ_K02357 [Eucalyptus grandis]
Length=618

 Score =   130 bits (328),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 72/157 (46%), Positives = 96/157 (61%), Gaps = 4/157 (3%)
 Frame = +1

Query  115  SRFLKLSILLVLFGVGVA---EDDVKCLQGVKGSFRDPDGNLGL-WNFDNTTAGFICKFV  282
            SR +   IL  L G  V    E D+ CL+ +K S +DP   L   WNFDN+T GFIC+F 
Sbjct  8    SRLVAAGILWALLGCCVIDCLETDINCLKTIKASVQDPLNYLNYTWNFDNSTEGFICRFT  67

Query  283  GVACWNDNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPY  462
            GV CW+ +ENRV+ L+L ++ L G+ P  ++ C SL  LDLS N  SG IP  I   +P+
Sbjct  68   GVECWHPDENRVLNLKLSDMGLKGQFPRGIEQCKSLTGLDLSSNEFSGPIPENISHIIPF  127

Query  463  LVTLDLSSNDLTGPIPPDLGNCTYLNKLILNDNKLTG  573
              +LDLSSN  +G IP +L  C YLN L L+ N+ +G
Sbjct  128  ATSLDLSSNSFSGQIPANLSECKYLNSLRLDHNQFSG  164



>ref|NP_001239701.1| probably inactive leucine-rich repeat receptor-like protein kinase 
At5g48380-like [Glycine max]
 gb|ACM89483.1| leucine-rich repeat family protein [Glycine max]
Length=592

 Score =   130 bits (327),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 68/135 (50%), Positives = 89/135 (66%), Gaps = 0/135 (0%)
 Frame = +1

Query  169  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  348
            + D+ CL+ VK +  DP   L  WNF+N T G+ICKF GV CW+ +EN+V+ L+L  + L
Sbjct  6    DSDIFCLKSVKRTLDDPYNYLQSWNFNNNTEGYICKFTGVECWHPDENKVLNLKLSNMGL  65

Query  349  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  528
             G  P  +Q+C S+  LD S N LS TIP+ I   L ++ TLDLSSND TG IP  L NC
Sbjct  66   KGPFPRGIQNCSSMTGLDFSLNRLSKTIPADISTLLTFVTTLDLSSNDFTGEIPASLSNC  125

Query  529  TYLNKLILNDNKLTG  573
            TYLN + L+ N+LTG
Sbjct  126  TYLNTIRLDQNQLTG  140



>ref|XP_009406422.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=672

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 92/134 (69%), Gaps = 1/134 (1%)
 Frame = +1

Query  175  DVKCLQGVKGSFRDPDGNLGL-WNFDNTTAGFICKFVGVACWNDNENRVIglelrelnlg  351
            D++CL+ VK S +DP+ NL   W FDNT+ G ICKF GV CW+ +EN+V+ L L  + L 
Sbjct  91   DIECLRLVKLSLKDPENNLFYSWTFDNTSEGSICKFNGVECWHPDENKVLNLRLSNMGLQ  150

Query  352  geVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNCT  531
            G+ P  L++C SL  LDLS N LSGTIP  I + +PY+ +LDLS ND +G IP +L +CT
Sbjct  151  GQFPSGLENCTSLTGLDLSNNNLSGTIPVNIAKKIPYVTSLDLSFNDFSGQIPVNLSDCT  210

Query  532  YLNKLILNDNKLTG  573
            YLN L L  N LTG
Sbjct  211  YLNSLKLQHNNLTG  224



>ref|XP_007159203.1| hypothetical protein PHAVU_002G217900g [Phaseolus vulgaris]
 gb|ESW31197.1| hypothetical protein PHAVU_002G217900g [Phaseolus vulgaris]
Length=611

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 72/148 (49%), Positives = 97/148 (66%), Gaps = 3/148 (2%)
 Frame = +1

Query  130  LSILLVLFGVGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNE  309
            LS L+V  G GVA  D+ CL+ +K S  DP   L  W+FDN T GF+C FVGV+CW+  E
Sbjct  19   LSSLMV--GNGVA-SDISCLKSIKDSLEDPFSYLSSWSFDNQTEGFLCSFVGVSCWHPGE  75

Query  310  NRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSN  489
            N+V+ + L  + L GE P  +++C SL  L+LS N L+G IPS IC  +P+  ++DLS N
Sbjct  76   NKVLSISLENMGLKGEFPLGIRNCLSLTALNLSNNHLTGPIPSDICTLIPFATSIDLSHN  135

Query  490  DLTGPIPPDLGNCTYLNKLILNDNKLTG  573
               G IPP L +CTYLN L L++N L+G
Sbjct  136  RFNGNIPPTLAHCTYLNSLRLDNNNLSG  163



>gb|KFK25890.1| hypothetical protein AALP_AA8G175500 [Arabis alpina]
Length=254

 Score =   125 bits (315),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 68/146 (47%), Positives = 88/146 (60%), Gaps = 0/146 (0%)
 Frame = +1

Query  136  ILLVLFGVGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENR  315
             LLV    G  + ++ CLQ +K    DP+  L  W F NTT GFICKF GV+CW+D+E+R
Sbjct  13   FLLVSNFTGANQLNINCLQSIKSQVEDPNDYLSSWVFSNTTQGFICKFSGVSCWHDDESR  72

Query  316  VIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDL  495
            V+ ++L    L GE P  ++DC  L  LDLS N  SG +PS +   +P L  LDLS N  
Sbjct  73   VLSIKLSGYGLIGEFPQGIKDCSDLVGLDLSRNNFSGALPSNMTDLVPLLTILDLSYNQF  132

Query  496  TGPIPPDLGNCTYLNKLILNDNKLTG  573
            +  IPP L N TYLN L+L  N+ TG
Sbjct  133  SDEIPPSLSNITYLNTLMLQHNQFTG  158



>dbj|BAJ86446.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=604

 Score =   130 bits (326),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 70/142 (49%), Positives = 91/142 (64%), Gaps = 1/142 (1%)
 Frame = +1

Query  151  FGVGVAEDDVKCLQGVKGSFRDPDGNL-GLWNFDNTTAGFICKFVGVACWNDNENRVIgl  327
            F    +E D++CL+ V+ S  DP+G L   WNF+N T GFIC+F GV CW+ +E+RV+ L
Sbjct  18   FTCFASEADIQCLKSVQQSVNDPNGVLKSSWNFENVTVGFICRFTGVECWHPDEDRVLSL  77

Query  328  elrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPI  507
             L  L L G  P  LQ+C S+  LDLS N  SG IP  I R +PYL +LDLS N  +G I
Sbjct  78   RLGNLGLQGPFPRGLQNCSSMTGLDLSNNNFSGLIPQDISREIPYLTSLDLSYNSFSGAI  137

Query  508  PPDLGNCTYLNKLILNDNKLTG  573
            P ++ N TYLN L L  N+L+G
Sbjct  138  PQNISNMTYLNLLNLQHNQLSG  159



>ref|XP_006372666.1| hypothetical protein POPTR_0017s03660g [Populus trichocarpa]
 gb|ERP50463.1| hypothetical protein POPTR_0017s03660g [Populus trichocarpa]
Length=600

 Score =   129 bits (325),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 68/147 (46%), Positives = 90/147 (61%), Gaps = 1/147 (1%)
 Frame = +1

Query  136  ILLVLFGVGVA-EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNEN  312
            +L  LF V  A E D+ CL+ +K S  DP  +   W+F N T GFICKF GV CW   E+
Sbjct  15   VLFCLFSVSSATEPDIYCLKSIKDSLEDPYNHFSSWDFANHTEGFICKFAGVDCWKPEES  74

Query  313  RVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSND  492
            RV+ L L  + L G+ P  +++C SL  LDLS N L G IPS I + LPY+  LDLS N+
Sbjct  75   RVLNLALSNMELKGQFPPGIENCTSLTGLDLSRNELQGPIPSDISKRLPYITNLDLSFNN  134

Query  493  LTGPIPPDLGNCTYLNKLILNDNKLTG  573
             +G IP  + N ++LN L L+ N+L G
Sbjct  135  FSGEIPSSIANLSFLNVLQLDHNQLIG  161



>gb|AGI92778.1| RLP1.804.1 [Triticum aestivum]
Length=267

 Score =   125 bits (315),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 69/137 (50%), Positives = 89/137 (65%), Gaps = 1/137 (1%)
 Frame = +1

Query  166  AEDDVKCLQGVKGSFRDPDGNL-GLWNFDNTTAGFICKFVGVACWNDNENRVIglelrel  342
            +E D++CL+ V  S  DP+G L   WNF++ T GFIC+F GV CW+ ++N V+ L L  L
Sbjct  23   SEQDIQCLKSVYQSVIDPNGVLKSSWNFEDGTVGFICRFTGVECWHPDKNMVLSLRLGNL  82

Query  343  nlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLG  522
             L G  P  LQDC S+  LDLS N  SG IP  I R +PYL +LDLS N  +G IP ++ 
Sbjct  83   GLQGTFPQGLQDCASMTGLDLSNNKFSGPIPQDISRQVPYLTSLDLSYNSFSGSIPQNIS  142

Query  523  NCTYLNKLILNDNKLTG  573
            N TYLN LIL  N+L+G
Sbjct  143  NMTYLNVLILQHNQLSG  159



>ref|XP_006372658.1| hypothetical protein POPTR_0017s036302g, partial [Populus trichocarpa]
 gb|ERP50455.1| hypothetical protein POPTR_0017s036302g, partial [Populus trichocarpa]
Length=211

 Score =   124 bits (311),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 69/164 (42%), Positives = 94/164 (57%), Gaps = 1/164 (1%)
 Frame = +1

Query  85   ADFRMVGFGFSRFLKLSILLVLFGVGVAEDDVKCLQGVKGSFRDPDGNLGL-WNFDNTTA  261
            +  +M    F      S+L         E D+ CL+ ++ S  DP   L   WNFDN T 
Sbjct  3    SQIQMANLFFIYSFMFSLLATFTVTSATETDLSCLKSIRASMIDPYNYLNTTWNFDNKTE  62

Query  262  GFICKFVGVACWNDNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQ  441
            GFIC+F+G+ CW+ +ENRV+ + L  + L G+    LQ+C SL  LDLS N L G IPS 
Sbjct  63   GFICRFMGLDCWHPDENRVLNIRLSGMGLKGQFHLGLQNCTSLTGLDLSHNELQGPIPSD  122

Query  442  ICRWLPYLVTLDLSSNDLTGPIPPDLGNCTYLNKLILNDNKLTG  573
            I R LPY+  LDLS N+ +G IP  + N ++LN L L++N L G
Sbjct  123  ISRRLPYITNLDLSFNNFSGEIPSSIANLSFLNDLKLDNNNLAG  166



>ref|XP_004253035.2| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 isoform X4 [Solanum lycopersicum]
Length=591

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 67/137 (49%), Positives = 91/137 (66%), Gaps = 0/137 (0%)
 Frame = +1

Query  163  VAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrel  342
             +E DV CL+ +K S  DP  +LG W F + T GFIC FVG++CW+ +EN+V+ ++L   
Sbjct  26   ASESDVYCLKSIKDSLHDPFNSLGSWEFSDATEGFICHFVGISCWHVDENKVLSIQLPGF  85

Query  343  nlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLG  522
             L GE P  +Q+C SL +LDLSGN L GTIPS I   + ++  LDLS+N  +G IP D+ 
Sbjct  86   GLIGEFPRGIQNCTSLTSLDLSGNSLYGTIPSDISAIVEHVTILDLSNNTFSGYIPSDIA  145

Query  523  NCTYLNKLILNDNKLTG  573
            NC YLN L L++N L G
Sbjct  146  NCQYLNGLKLDNNYLEG  162



>ref|XP_010314784.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 isoform X1 [Solanum lycopersicum]
Length=611

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 67/137 (49%), Positives = 91/137 (66%), Gaps = 0/137 (0%)
 Frame = +1

Query  163  VAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrel  342
             +E DV CL+ +K S  DP  +LG W F + T GFIC FVG++CW+ +EN+V+ ++L   
Sbjct  26   ASESDVYCLKSIKDSLHDPFNSLGSWEFSDATEGFICHFVGISCWHVDENKVLSIQLPGF  85

Query  343  nlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLG  522
             L GE P  +Q+C SL +LDLSGN L GTIPS I   + ++  LDLS+N  +G IP D+ 
Sbjct  86   GLIGEFPRGIQNCTSLTSLDLSGNSLYGTIPSDISAIVEHVTILDLSNNTFSGYIPSDIA  145

Query  523  NCTYLNKLILNDNKLTG  573
            NC YLN L L++N L G
Sbjct  146  NCQYLNGLKLDNNYLEG  162



>ref|XP_010314786.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 isoform X3 [Solanum lycopersicum]
Length=600

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 67/137 (49%), Positives = 91/137 (66%), Gaps = 0/137 (0%)
 Frame = +1

Query  163  VAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrel  342
             +E DV CL+ +K S  DP  +LG W F + T GFIC FVG++CW+ +EN+V+ ++L   
Sbjct  26   ASESDVYCLKSIKDSLHDPFNSLGSWEFSDATEGFICHFVGISCWHVDENKVLSIQLPGF  85

Query  343  nlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLG  522
             L GE P  +Q+C SL +LDLSGN L GTIPS I   + ++  LDLS+N  +G IP D+ 
Sbjct  86   GLIGEFPRGIQNCTSLTSLDLSGNSLYGTIPSDISAIVEHVTILDLSNNTFSGYIPSDIA  145

Query  523  NCTYLNKLILNDNKLTG  573
            NC YLN L L++N L G
Sbjct  146  NCQYLNGLKLDNNYLEG  162



>ref|XP_010314785.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 isoform X2 [Solanum lycopersicum]
Length=608

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 67/137 (49%), Positives = 91/137 (66%), Gaps = 0/137 (0%)
 Frame = +1

Query  163  VAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrel  342
             +E DV CL+ +K S  DP  +LG W F + T GFIC FVG++CW+ +EN+V+ ++L   
Sbjct  26   ASESDVYCLKSIKDSLHDPFNSLGSWEFSDATEGFICHFVGISCWHVDENKVLSIQLPGF  85

Query  343  nlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLG  522
             L GE P  +Q+C SL +LDLSGN L GTIPS I   + ++  LDLS+N  +G IP D+ 
Sbjct  86   GLIGEFPRGIQNCTSLTSLDLSGNSLYGTIPSDISAIVEHVTILDLSNNTFSGYIPSDIA  145

Query  523  NCTYLNKLILNDNKLTG  573
            NC YLN L L++N L G
Sbjct  146  NCQYLNGLKLDNNYLEG  162



>gb|EMS46984.1| hypothetical protein TRIUR3_06204 [Triticum urartu]
Length=269

 Score =   125 bits (314),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 69/139 (50%), Positives = 91/139 (65%), Gaps = 3/139 (2%)
 Frame = +1

Query  166  AEDDVKCLQGVKGSFRDPDGNL-GLWNFDNT--TAGFICKFVGVACWNDNENRVIglelr  336
            +E D++CL+ V+ S  DP+G L   WNF+N   T G+IC+F GV CW+ +ENRV+ L L 
Sbjct  23   SEADIQCLKSVQQSVIDPNGVLKSTWNFENPNPTDGYICRFTGVECWHPDENRVLSLRLG  82

Query  337  elnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPD  516
             L L    P  LQ+C S+  LDLS N  SG IPS+I R +PYL +LDL  N  +G IP +
Sbjct  83   NLGLESTFPQGLQNCSSMIGLDLSNNNFSGPIPSEIAREVPYLTSLDLLYNSFSGSIPQN  142

Query  517  LGNCTYLNKLILNDNKLTG  573
            + N TYLN LIL  N+L+G
Sbjct  143  ISNMTYLNILILQHNQLSG  161



>gb|EMT17156.1| Putative LRR receptor-like serine/threonine-protein kinase [Aegilops 
tauschii]
Length=268

 Score =   125 bits (314),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 67/137 (49%), Positives = 86/137 (63%), Gaps = 1/137 (1%)
 Frame = +1

Query  166  AEDDVKCLQGVKGSFRDPDGNL-GLWNFDNTTAGFICKFVGVACWNDNENRVIglelrel  342
             E D++CL+ V+ S  DP+G L   WNF+N T  FIC+F GV CW+ +E+RV+ L L  L
Sbjct  23   TEQDIQCLKSVQQSVTDPNGVLKSSWNFENNTVAFICRFTGVECWHPDEDRVLSLRLGNL  82

Query  343  nlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLG  522
             L G  P  LQ C S+ NLDLS N   G IP+ I R +PYL +LDLS N  +G IP ++ 
Sbjct  83   GLEGPFPRGLQYCTSMMNLDLSNNNFEGPIPANISREVPYLTSLDLSYNSFSGSIPQNIS  142

Query  523  NCTYLNKLILNDNKLTG  573
            N TYLN L L  N+  G
Sbjct  143  NMTYLNVLSLQHNQFIG  159



>ref|XP_011013756.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 isoform X1 [Populus euphratica]
Length=623

 Score =   129 bits (324),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 74/147 (50%), Positives = 96/147 (65%), Gaps = 2/147 (1%)
 Frame = +1

Query  139  LLVLFGVGVAED-DVKCLQGVKGSFRDPDGNLGL-WNFDNTTAGFICKFVGVACWNDNEN  312
            LL  F V  A D DV CL+ +K S  DP G L   W+F+N T GFIC+F+GV CW+ +EN
Sbjct  20   LLATFTVTSATDTDVYCLKSIKDSMIDPHGYLNTTWDFNNYTEGFICRFLGVDCWHPDEN  79

Query  313  RVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSND  492
            RV+ L L +L L G+ P  L++C SL  L+LS N L G IPS I + LPY+  LDLS N 
Sbjct  80   RVLNLILFDLGLKGQFPHGLKNCTSLSGLNLSHNELQGPIPSDISKRLPYITNLDLSFNK  139

Query  493  LTGPIPPDLGNCTYLNKLILNDNKLTG  573
             +G IP ++ N ++LN L L+ NKLTG
Sbjct  140  FSGEIPINIANLSFLNVLKLDKNKLTG  166



>ref|XP_011004566.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 isoform X1 [Populus euphratica]
Length=622

 Score =   129 bits (324),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 74/147 (50%), Positives = 96/147 (65%), Gaps = 2/147 (1%)
 Frame = +1

Query  139  LLVLFGVGVAED-DVKCLQGVKGSFRDPDGNLGL-WNFDNTTAGFICKFVGVACWNDNEN  312
            LL  F V  A D DV CL+ +K S  DP G L   W+F+N T GFIC+F+GV CW+ +EN
Sbjct  20   LLATFTVTSATDTDVYCLKSIKDSMIDPHGYLNTTWDFNNYTEGFICRFLGVDCWHPDEN  79

Query  313  RVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSND  492
            RV+ L L +L L G  P  +Q+C SL  LDLS N L G IPS I + L ++  LDLS N+
Sbjct  80   RVLNLRLSDLGLEGRFPPGIQNCTSLSGLDLSHNELQGPIPSDIFKRLLFITNLDLSYNN  139

Query  493  LTGPIPPDLGNCTYLNKLILNDNKLTG  573
            L+G IP  + N ++LN L L++NKLTG
Sbjct  140  LSGEIPSSIANLSFLNVLKLDNNKLTG  166



>ref|XP_004161543.1| PREDICTED: LOW QUALITY PROTEIN: probably inactive leucine-rich 
repeat receptor-like protein kinase At5g48380-like [Cucumis 
sativus]
Length=614

 Score =   129 bits (324),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 63/135 (47%), Positives = 90/135 (67%), Gaps = 0/135 (0%)
 Frame = +1

Query  169  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  348
            E D+ CL+ +K SF+DP+  L  W+F N + G IC+F G+ CW+ +ENRV+ + L  + L
Sbjct  29   ESDLFCLRSIKNSFQDPNEYLTSWDFSNRSEGVICRFAGIMCWHPDENRVLSITLSNMGL  88

Query  349  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  528
             G+ P  +++C SL  LDLS N +SG IP+ I   + Y  TLDLSSND TGPIP  + + 
Sbjct  89   KGQFPTGIKNCTSLTGLDLSFNQMSGEIPTDIGSIVKYAATLDLSSNDFTGPIPKSIADI  148

Query  529  TYLNKLILNDNKLTG  573
            +YLN L L+ N+L+G
Sbjct  149  SYLNILKLDHNQLSG  163



>ref|XP_008447262.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Cucumis melo]
Length=614

 Score =   129 bits (323),  Expect = 4e-31, Method: Composition-based stats.
 Identities = 63/135 (47%), Positives = 90/135 (67%), Gaps = 0/135 (0%)
 Frame = +1

Query  169  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  348
            E D+ CL+ +K SF+DP+  L  W+F N + G ICKF G+ CW+ +EN+V+ + L  + L
Sbjct  29   ESDLSCLRSIKKSFQDPNEYLTSWDFSNRSEGVICKFAGIMCWHPDENKVLSITLSNMGL  88

Query  349  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  528
             G+ P  +++C SL  LDLS N +SG IP+ I   + +  TLDLSSND TGPIP  + + 
Sbjct  89   KGQFPIGIKNCSSLTGLDLSFNQISGEIPTDIGSIVSFATTLDLSSNDFTGPIPESIADI  148

Query  529  TYLNKLILNDNKLTG  573
            TYLN L L+ N+L+G
Sbjct  149  TYLNVLKLDHNQLSG  163



>ref|XP_009416988.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Musa acuminata subsp. malaccensis]
 ref|XP_009416990.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Musa acuminata subsp. malaccensis]
Length=617

 Score =   129 bits (323),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 90/134 (67%), Gaps = 1/134 (1%)
 Frame = +1

Query  175  DVKCLQGVKGSFRDPDGNLGL-WNFDNTTAGFICKFVGVACWNDNENRVIglelrelnlg  351
            D++CL+ +  S +DP+ +L   WNFDN + G IC+F GV CW+ +ENRV+ L L  + L 
Sbjct  32   DIQCLELIHKSLKDPENSLTYSWNFDNKSEGAICRFAGVECWHPDENRVLNLRLSNMGLQ  91

Query  352  geVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNCT  531
            GE P  L++C SL  LDLS N LSG IP+ I R +P++  LDLS N  +G IP +L +C+
Sbjct  92   GEFPSGLENCTSLTGLDLSSNSLSGPIPADISRKIPFVTALDLSFNGFSGEIPVNLSDCS  151

Query  532  YLNKLILNDNKLTG  573
            YLN L L  NKLTG
Sbjct  152  YLNSLKLQHNKLTG  165



>ref|XP_010095584.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Morus notabilis]
 gb|EXB61157.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Morus notabilis]
Length=602

 Score =   128 bits (321),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 74/160 (46%), Positives = 103/160 (64%), Gaps = 7/160 (4%)
 Frame = +1

Query  115  SRFLKLS-----ILLVLFGVGVAE-DDVKCLQGVKGSFRDPDGNL-GLWNFDNTTAGFIC  273
            SRFL +S      LL+   + +A  +D+ CL+ ++ S  DP G L   WNF+N T G+IC
Sbjct  12   SRFLDISGGILLWLLIHSSLSLASVNDINCLKSIQESLEDPYGYLNSSWNFNNNTEGYIC  71

Query  274  KFVGVACWNDNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRW  453
            KF+GV CW+ +EN+V+ + L ++ L G  P  + +C SL  LDLS N L G IP+ I R 
Sbjct  72   KFIGVECWHPDENKVLNIRLSDMGLKGLFPQGIVNCSSLTGLDLSNNKLFGPIPTNISRI  131

Query  454  LPYLVTLDLSSNDLTGPIPPDLGNCTYLNKLILNDNKLTG  573
            + Y+ +LDLSSN+ +G IP  L NCTYLN L L+ N+LTG
Sbjct  132  MNYVTSLDLSSNNFSGSIPTLLSNCTYLNVLKLDHNRLTG  171



>ref|XP_007049531.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Theobroma cacao]
 gb|EOX93688.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Theobroma cacao]
Length=619

 Score =   128 bits (322),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 66/134 (49%), Positives = 93/134 (69%), Gaps = 1/134 (1%)
 Frame = +1

Query  172  DDVKCLQGVKGSFRDPDGNL-GLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  348
            +D+ CL+ ++ SF DP   L   WNF+N T GFIC+F GV CW+ +EN+V+ + L ++ L
Sbjct  32   EDINCLKSIRDSFEDPFNYLNSSWNFNNDTEGFICRFTGVECWHPDENKVLNIRLSDMGL  91

Query  349  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  528
             GE P  +++C SL  LDLS N L G+IP+ I  +LPY+ +LDLSSN+ +G IP  L NC
Sbjct  92   KGEFPRGIKNCKSLTGLDLSSNKLYGSIPTNISGFLPYVTSLDLSSNNFSGNIPKSLANC  151

Query  529  TYLNKLILNDNKLT  570
            ++LN L L+ NKLT
Sbjct  152  SFLNILKLDHNKLT  165



>ref|NP_001238083.1| protein kinase precursor [Glycine max]
 gb|ACJ37414.1| protein kinase [Glycine max]
Length=572

 Score =   127 bits (320),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 69/149 (46%), Positives = 97/149 (65%), Gaps = 4/149 (3%)
 Frame = +1

Query  139  LLVLFGVGVA---EDDVKCLQGVKGSFRDPDGNLGL-WNFDNTTAGFICKFVGVACWNDN  306
             L+L G G+    + D+ CL+ +K S  DP   L   W+F+N T G+IC+F GV CW+ +
Sbjct  16   FLLLLGCGITYGTDTDIFCLKSIKESLEDPYNYLKFSWDFNNKTEGYICRFNGVECWHPD  75

Query  307  ENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSS  486
            ENRV+ L+L  + L G+ P  +Q+C SL  LDLS N LSGTIP  I   +P+  ++DLS+
Sbjct  76   ENRVLNLKLSNMGLKGQFPRGIQNCSSLTGLDLSINKLSGTIPGDISTLIPFATSIDLST  135

Query  487  NDLTGPIPPDLGNCTYLNKLILNDNKLTG  573
            N+ +G IP  L NCT+LN L L+ N+LTG
Sbjct  136  NEFSGAIPVSLANCTFLNTLKLDQNRLTG  164



>emb|CBI23562.3| unnamed protein product [Vitis vinifera]
Length=619

 Score =   128 bits (321),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 67/138 (49%), Positives = 96/138 (70%), Gaps = 1/138 (1%)
 Frame = +1

Query  163  VAEDDVKCLQGVKGSFRDPDGNL-GLWNFDNTTAGFICKFVGVACWNDNENRVIglelre  339
              E D+ CL+G+K S  DP   L   W+F+N T GFIC+F G+ CW+ +ENRV+ ++L +
Sbjct  27   ATESDLYCLKGIKNSLDDPYRYLNSSWDFNNKTEGFICRFTGIECWHPDENRVLNIKLAD  86

Query  340  lnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDL  519
            + L G+ P A+++C SL  LDLS N L G+IPS I   + ++ TLDLSSN+ +GPIP  L
Sbjct  87   MGLKGQFPRAIKNCTSLTGLDLSSNDLYGSIPSDINDIIKFMTTLDLSSNNFSGPIPLGL  146

Query  520  GNCTYLNKLILNDNKLTG  573
             NC+YLN L L++N+L+G
Sbjct  147  SNCSYLNVLKLDNNQLSG  164



>ref|XP_004148962.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380-like [Cucumis sativus]
 gb|KGN44710.1| hypothetical protein Csa_7G373530 [Cucumis sativus]
Length=614

 Score =   128 bits (321),  Expect = 7e-31, Method: Composition-based stats.
 Identities = 63/135 (47%), Positives = 89/135 (66%), Gaps = 0/135 (0%)
 Frame = +1

Query  169  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  348
            E D+ CL+ +K SF+DP+  L  W+F N + G IC+F G+ CW+ +ENRV+ + L  + L
Sbjct  29   ESDLFCLRSIKNSFQDPNEYLTSWDFSNRSEGVICRFTGIMCWHPDENRVLSITLSNMGL  88

Query  349  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  528
             G+ P  +++C SL  LDLS N +SG IP  I   + Y  TLDLSSND TGPIP  + + 
Sbjct  89   KGQFPTGIKNCTSLTGLDLSFNQMSGEIPMDIGSIVKYAATLDLSSNDFTGPIPKSIADI  148

Query  529  TYLNKLILNDNKLTG  573
            +YLN L L+ N+L+G
Sbjct  149  SYLNILKLDHNQLSG  163



>dbj|BAJ87832.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=259

 Score =   124 bits (310),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 68/137 (50%), Positives = 88/137 (64%), Gaps = 1/137 (1%)
 Frame = +1

Query  166  AEDDVKCLQGVKGSFRDPDGNL-GLWNFDNTTAGFICKFVGVACWNDNENRVIglelrel  342
            +E D++CL+ V+ S  DP G L   WNF+N +AGFIC+F GV CW+ +ENRV  L L  L
Sbjct  23   SEFDIQCLKSVQQSVIDPFGVLKSSWNFENDSAGFICRFTGVECWHPDENRVSSLRLGNL  82

Query  343  nlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLG  522
             L G     LQ+C S+  LDLS N  SG IP++I R +PYL +LDLS N  +G IP  + 
Sbjct  83   GLEGPFLQGLQNCTSMSGLDLSNNYFSGPIPAEISRQMPYLTSLDLSYNSFSGSIPQSIS  142

Query  523  NCTYLNKLILNDNKLTG  573
              TYLN LI   N+L+G
Sbjct  143  QMTYLNALIFQHNQLSG  159



>ref|XP_003635622.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Vitis vinifera]
Length=625

 Score =   128 bits (321),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 67/138 (49%), Positives = 96/138 (70%), Gaps = 1/138 (1%)
 Frame = +1

Query  163  VAEDDVKCLQGVKGSFRDPDGNL-GLWNFDNTTAGFICKFVGVACWNDNENRVIglelre  339
              E D+ CL+G+K S  DP   L   W+F+N T GFIC+F G+ CW+ +ENRV+ ++L +
Sbjct  33   ATESDLYCLKGIKNSLDDPYRYLNSSWDFNNKTEGFICRFTGIECWHPDENRVLNIKLAD  92

Query  340  lnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDL  519
            + L G+ P A+++C SL  LDLS N L G+IPS I   + ++ TLDLSSN+ +GPIP  L
Sbjct  93   MGLKGQFPRAIKNCTSLTGLDLSSNDLYGSIPSDINDIIKFMTTLDLSSNNFSGPIPLGL  152

Query  520  GNCTYLNKLILNDNKLTG  573
             NC+YLN L L++N+L+G
Sbjct  153  SNCSYLNVLKLDNNQLSG  170



>ref|XP_006598679.1| PREDICTED: protein kinase isoform X1 [Glycine max]
 gb|KHN16981.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Glycine soja]
Length=614

 Score =   127 bits (320),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 69/149 (46%), Positives = 97/149 (65%), Gaps = 4/149 (3%)
 Frame = +1

Query  139  LLVLFGVGVA---EDDVKCLQGVKGSFRDPDGNLGL-WNFDNTTAGFICKFVGVACWNDN  306
             L+L G G+    + D+ CL+ +K S  DP   L   W+F+N T G+IC+F GV CW+ +
Sbjct  16   FLLLLGCGITYGTDTDIFCLKSIKESLEDPYNYLKFSWDFNNKTEGYICRFNGVECWHPD  75

Query  307  ENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSS  486
            ENRV+ L+L  + L G+ P  +Q+C SL  LDLS N LSGTIP  I   +P+  ++DLS+
Sbjct  76   ENRVLNLKLSNMGLKGQFPRGIQNCSSLTGLDLSINKLSGTIPGDISTLIPFATSIDLST  135

Query  487  NDLTGPIPPDLGNCTYLNKLILNDNKLTG  573
            N+ +G IP  L NCT+LN L L+ N+LTG
Sbjct  136  NEFSGAIPVSLANCTFLNTLKLDQNRLTG  164



>ref|XP_008788252.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 isoform X1 [Phoenix dactylifera]
Length=610

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 68/137 (50%), Positives = 90/137 (66%), Gaps = 1/137 (1%)
 Frame = +1

Query  166  AEDDVKCLQGVKGSFRDPDGNLGL-WNFDNTTAGFICKFVGVACWNDNENRVIglelrel  342
             E D+KCL+ ++ S +DP+  L   W FDN T GF+CKF GV CW+ +E+RV+ L L  +
Sbjct  27   TETDIKCLKTLQQSLKDPNNMLTYSWKFDNLTEGFMCKFNGVDCWHPDESRVLNLHLSNM  86

Query  343  nlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLG  522
             L G+ P  L+ C SL  LDLS N  SG IP+ I + LPY+ +LDLS N  +G IP +L 
Sbjct  87   GLQGQFPSGLEYCTSLTGLDLSSNNFSGPIPADISKKLPYVTSLDLSYNSFSGEIPVNLS  146

Query  523  NCTYLNKLILNDNKLTG  573
            NCTYLN L L  N+L+G
Sbjct  147  NCTYLNILNLQHNRLSG  163



>ref|XP_011010442.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 isoform X1 [Populus euphratica]
 ref|XP_011010516.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 isoform X1 [Populus euphratica]
Length=623

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 67/140 (48%), Positives = 96/140 (69%), Gaps = 1/140 (1%)
 Frame = +1

Query  157  VGVAEDDVKCLQGVKGSFRDPDGNLGL-WNFDNTTAGFICKFVGVACWNDNENRVIglel  333
            +     D++CL+ +K S  DP   L   W+F+N T GF+C+F+GV CW+ +ENRV+ + L
Sbjct  30   IDATATDIECLKSIKDSLVDPYNYLNTTWDFNNNTEGFLCRFMGVECWHPDENRVLNIRL  89

Query  334  relnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPP  513
             +L+L G+ P  +Q C SL  LDLS N L G+IP+ I + LPY+ TLDLS N+ +G IP 
Sbjct  90   SDLSLKGQFPLGIQKCTSLTGLDLSRNKLFGSIPANISKLLPYVTTLDLSFNNFSGGIPL  149

Query  514  DLGNCTYLNKLILNDNKLTG  573
            DL NC++LN L L++N+LTG
Sbjct  150  DLANCSFLNDLKLDNNRLTG  169



>ref|XP_002529807.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
 gb|EEF32556.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
Length=598

 Score =   127 bits (319),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 66/138 (48%), Positives = 90/138 (65%), Gaps = 2/138 (1%)
 Frame = +1

Query  157  VGVAEDDVKCLQGVKGSFRDP-DGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglel  333
            +G A D V CL+ +K S  DP D     W+F N T GFICKF GV CW+ +EN+V+ L +
Sbjct  27   IGTATDIV-CLKSIKHSLEDPFDYFKSSWDFSNYTEGFICKFTGVECWHPDENKVLNLRM  85

Query  334  relnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPP  513
              + L G+ P  +++C SL  LDLS N L G IP  I + LPY+ +LDLSSN+ +G IP 
Sbjct  86   SGMGLKGQFPSGIENCTSLTGLDLSNNELQGPIPFNISKLLPYITSLDLSSNNFSGEIPT  145

Query  514  DLGNCTYLNKLILNDNKL  567
            D+ NC++LN L L+ N+L
Sbjct  146  DIANCSHLNVLKLDHNRL  163



>gb|KDP33138.1| hypothetical protein JCGZ_13530 [Jatropha curcas]
Length=616

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 72/149 (48%), Positives = 91/149 (61%), Gaps = 1/149 (1%)
 Frame = +1

Query  130  LSILLVLFGVGVAEDDVKCLQGVKGSFRDPDGNL-GLWNFDNTTAGFICKFVGVACWNDN  306
             S L         E D+ CL+ VK S  DP G L   WNF+N T GFIC+F GV CW+ +
Sbjct  18   FSFLATFTATISTETDIACLKSVKASLEDPFGYLNSSWNFNNNTEGFICRFTGVDCWHFD  77

Query  307  ENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSS  486
            EN+V+ L L ++ L G+ P  LQ+C SL  LDLS N L G IP  I + LPY+  LDLSS
Sbjct  78   ENKVLNLRLSDMGLKGQFPRGLQNCTSLTGLDLSNNDLYGQIPFDIQKLLPYVTVLDLSS  137

Query  487  NDLTGPIPPDLGNCTYLNKLILNDNKLTG  573
            N+ +G IP  + NC+ LN L L+ N LTG
Sbjct  138  NNFSGEIPLSIANCSNLNVLRLDQNSLTG  166



>ref|XP_008359394.1| PREDICTED: probable inactive receptor kinase At1g27190 [Malus 
domestica]
Length=196

 Score =   121 bits (304),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 84/128 (66%), Gaps = 6/128 (5%)
 Frame = +1

Query  160  GVAEDDVKCLQGV------KGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVI  321
            GV+  D    Q V        S  DP+G LG W+  N +   ICK VGV+CWN+  N +I
Sbjct  69   GVSSSDDSRTQNVVDEFFQPSSLTDPEGRLGQWDLANRSVASICKLVGVSCWNEKGNCLI  128

Query  322  glelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTG  501
             L+L  + L G +P +L+ CHSLQ+LDLSGN LSG+IP QIC WLPYLVTLDLS N L+G
Sbjct  129  SLQLPSMELVGMLPESLKFCHSLQSLDLSGNALSGSIPPQICTWLPYLVTLDLSGNALSG  188

Query  502  PIPPDLGN  525
             IPP++ N
Sbjct  189  SIPPEIVN  196



>ref|XP_006372665.1| hypothetical protein POPTR_0017s03660g [Populus trichocarpa]
 gb|ERP50462.1| hypothetical protein POPTR_0017s03660g [Populus trichocarpa]
Length=556

 Score =   126 bits (317),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 68/147 (46%), Positives = 90/147 (61%), Gaps = 1/147 (1%)
 Frame = +1

Query  136  ILLVLFGVGVA-EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNEN  312
            +L  LF V  A E D+ CL+ +K S  DP  +   W+F N T GFICKF GV CW   E+
Sbjct  15   VLFCLFSVSSATEPDIYCLKSIKDSLEDPYNHFSSWDFANHTEGFICKFAGVDCWKPEES  74

Query  313  RVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSND  492
            RV+ L L  + L G+ P  +++C SL  LDLS N L G IPS I + LPY+  LDLS N+
Sbjct  75   RVLNLALSNMELKGQFPPGIENCTSLTGLDLSRNELQGPIPSDISKRLPYITNLDLSFNN  134

Query  493  LTGPIPPDLGNCTYLNKLILNDNKLTG  573
             +G IP  + N ++LN L L+ N+L G
Sbjct  135  FSGEIPSSIANLSFLNVLQLDHNQLIG  161



>gb|AGI92779.1| RLP1.804.2 [Triticum aestivum]
Length=267

 Score =   123 bits (309),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 67/137 (49%), Positives = 88/137 (64%), Gaps = 1/137 (1%)
 Frame = +1

Query  166  AEDDVKCLQGVKGSFRDPDGNL-GLWNFDNTTAGFICKFVGVACWNDNENRVIglelrel  342
            +E D++CL+ V+ S  DP+G L   W F+N T G+IC F GV CW+ +ENR+  L L  L
Sbjct  23   SEADIQCLKSVQQSVNDPNGVLKSSWIFENATEGYICLFTGVECWHPDENRIFSLRLGNL  82

Query  343  nlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLG  522
             L G  P  LQ+C S+  +DLS N LSG IP +I R +PYL  LDLS N  +G IP ++ 
Sbjct  83   GLQGSFPRGLQNCSSVTGMDLSNNNLSGPIPQEISREMPYLTFLDLSYNSFSGSIPQNIS  142

Query  523  NCTYLNKLILNDNKLTG  573
            N TYLN L L  N+L+G
Sbjct  143  NMTYLNLLNLQHNQLSG  159



>gb|EMT26982.1| Putative inactive receptor kinase [Aegilops tauschii]
Length=604

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 70/142 (49%), Positives = 91/142 (64%), Gaps = 2/142 (1%)
 Frame = +1

Query  151  FGVGVAEDDVKCLQGVKGSFRDPDGNL-GLWNFDNTTAGFICKFVGVACWNDNENRVIgl  327
            F    +E D++CL+ V+ S  DP+G L   WNF+N TAGF C+F GV CW+ +E+RV+ L
Sbjct  18   FTCFASEADIQCLKSVQQSV-DPNGVLKSSWNFENDTAGFTCRFTGVECWHPDEDRVLSL  76

Query  328  elrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPI  507
             L  L L G  P  LQ+C S+  LDLS N  SG IP  I R +PYL +LDLS N  +G I
Sbjct  77   RLGNLGLQGSFPHGLQNCSSMTGLDLSNNNFSGPIPQDISREIPYLTSLDLSYNGFSGTI  136

Query  508  PPDLGNCTYLNKLILNDNKLTG  573
            PP++ N TYLN L L  N+ +G
Sbjct  137  PPNISNMTYLNVLNLQHNQFSG  158



>ref|XP_006372662.1| hypothetical protein POPTR_0017s036502g, partial [Populus trichocarpa]
 gb|ERP50459.1| hypothetical protein POPTR_0017s036502g, partial [Populus trichocarpa]
Length=343

 Score =   124 bits (312),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 70/147 (48%), Positives = 93/147 (63%), Gaps = 2/147 (1%)
 Frame = +1

Query  139  LLVLFGVGVAED-DVKCLQGVKGSFRDPDGNLGL-WNFDNTTAGFICKFVGVACWNDNEN  312
            LL  F V  A D D+ CL+ ++ S  DP+  L   WNF N T GFIC+F+GV CW+ +E+
Sbjct  4    LLATFTVTSATDTDIYCLKSIRDSMIDPNNYLSTTWNFTNKTEGFICRFMGVDCWHPDES  63

Query  313  RVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSND  492
            RV+ + L  + L G+ P  LQ+C SL  LDLS N L G IPS I R LPY+  LDLS N+
Sbjct  64   RVVNIRLSGMGLKGQFPLGLQNCTSLTGLDLSHNELQGPIPSHISRRLPYITNLDLSFNN  123

Query  493  LTGPIPPDLGNCTYLNKLILNDNKLTG  573
             +G IP  + N ++LN L L++N L G
Sbjct  124  FSGEIPSGIANLSFLNDLKLDNNNLAG  150



>gb|KJB42638.1| hypothetical protein B456_007G161400 [Gossypium raimondii]
 gb|KJB42639.1| hypothetical protein B456_007G161400 [Gossypium raimondii]
 gb|KJB42640.1| hypothetical protein B456_007G161400 [Gossypium raimondii]
 gb|KJB42641.1| hypothetical protein B456_007G161400 [Gossypium raimondii]
Length=621

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 66/138 (48%), Positives = 91/138 (66%), Gaps = 1/138 (1%)
 Frame = +1

Query  163  VAEDDVKCLQGVKGSFRDPDGNL-GLWNFDNTTAGFICKFVGVACWNDNENRVIglelre  339
             +++D+ CL+ +K S  D  G L   WNFDNTT GFIC+F G+ CW+ +ENRV+ + L +
Sbjct  29   ASQEDIDCLRSIKDSLEDSLGYLNSSWNFDNTTEGFICRFTGIDCWHPDENRVLNIRLAD  88

Query  340  lnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDL  519
            + L G  P  +  C S+  LDLS N L G IPS I + + Y+ +LDLSSN+ +G IPP L
Sbjct  89   MGLKGVFPQGIVKCKSITGLDLSSNKLYGPIPSNISQIIHYVTSLDLSSNNFSGEIPPAL  148

Query  520  GNCTYLNKLILNDNKLTG  573
             NC++LN L L+ N LTG
Sbjct  149  ANCSFLNILKLDYNSLTG  166



>ref|XP_004161544.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380-like [Cucumis sativus]
Length=225

 Score =   122 bits (306),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/137 (44%), Positives = 90/137 (66%), Gaps = 0/137 (0%)
 Frame = +1

Query  163  VAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrel  342
             AE D+ CL+ +K SF+DP+  L  W+F + + G IC+F+G+ CW+ +EN V+ + L  +
Sbjct  27   AAESDLSCLRSIKKSFQDPNKYLTSWDFSSRSEGAICRFIGIICWHPDENSVLSITLSNM  86

Query  343  nlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLG  522
             L G+ P  +++C SL  LDLS N +SG IP+ +   +P+  TLDLSSN  TG IP  + 
Sbjct  87   GLKGQFPTGIKNCTSLTGLDLSFNQISGEIPTNVGSLVPFATTLDLSSNKFTGRIPKSIA  146

Query  523  NCTYLNKLILNDNKLTG  573
            N +YLN L L+ N+L+G
Sbjct  147  NISYLNVLKLDHNQLSG  163



>ref|XP_007200419.1| hypothetical protein PRUPE_ppa011049mg [Prunus persica]
 gb|EMJ01618.1| hypothetical protein PRUPE_ppa011049mg [Prunus persica]
Length=225

 Score =   122 bits (306),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 67/150 (45%), Positives = 97/150 (65%), Gaps = 3/150 (2%)
 Frame = +1

Query  133  SILLVLFGVGVA---EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWND  303
            S+L +L   G +   E D+ CL+ +K S  D  G L  W+F+N T GFIC F+GV CW+ 
Sbjct  20   SVLWLLLSCGFSFGVESDINCLKSIKASLEDTLGYLNSWDFNNNTEGFICNFLGVECWHP  79

Query  304  NENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLS  483
            +E+RV+ ++L +L L G  P  + +C SL  LDLS N L+G +P+ I + + ++ +LDLS
Sbjct  80   HESRVLNIKLSDLGLKGSFPQGVANCTSLTGLDLSSNQLNGPLPTDIDKIITFITSLDLS  139

Query  484  SNDLTGPIPPDLGNCTYLNKLILNDNKLTG  573
            SN  TG IP  L NC+YLN L L++NK +G
Sbjct  140  SNSFTGQIPMKLSNCSYLNVLKLDNNKFSG  169



>ref|XP_004148961.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380-like [Cucumis sativus]
Length=225

 Score =   122 bits (305),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/137 (44%), Positives = 90/137 (66%), Gaps = 0/137 (0%)
 Frame = +1

Query  163  VAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrel  342
             AE D+ CL+ +K SF+DP+  L  W+F + + G IC+F+G+ CW+ +EN V+ + L  +
Sbjct  27   AAESDLSCLRSIKKSFQDPNKYLTSWDFSSRSEGAICRFIGIICWHPDENSVLSITLSNM  86

Query  343  nlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLG  522
             L G+ P  +++C SL  LDLS N +SG IP+ +   +P+  TLDLSSN  TG IP  + 
Sbjct  87   GLKGQFPTGIKNCTSLTGLDLSFNQISGEIPTNVGSIVPFATTLDLSSNKFTGRIPKSIA  146

Query  523  NCTYLNKLILNDNKLTG  573
            N +YLN L L+ N+L+G
Sbjct  147  NISYLNVLKLDHNQLSG  163



>dbj|BAJ33754.1| unnamed protein product [Thellungiella halophila]
Length=622

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 85/135 (63%), Gaps = 0/135 (0%)
 Frame = +1

Query  169  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  348
            E +V CL+ +    +DP+G L  W F N T GFICKF+GV CW+D+ENRV+ + L    L
Sbjct  29   EANVNCLRSILSQVKDPNGYLSSWVFRNQTVGFICKFIGVTCWHDDENRVLSINLSGYGL  88

Query  349  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  528
             GE P  ++ C  L  LDLS N  SGT+P+ I   +P + TLDLS N  +G IPP + N 
Sbjct  89   TGEFPLGIKQCSDLTGLDLSRNNFSGTLPTNISSLIPLVTTLDLSGNRFSGEIPPLISNI  148

Query  529  TYLNKLILNDNKLTG  573
            T+LN L+L  N+ TG
Sbjct  149  TFLNTLMLQQNQFTG  163



>emb|CAN63265.1| hypothetical protein VITISV_037939 [Vitis vinifera]
Length=619

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/138 (48%), Positives = 95/138 (69%), Gaps = 1/138 (1%)
 Frame = +1

Query  163  VAEDDVKCLQGVKGSFRDPDGNL-GLWNFDNTTAGFICKFVGVACWNDNENRVIglelre  339
              E D+ CL+ +K S  DP   L   W+F+N T GFIC+F G+ CW+ +ENRV+ ++L +
Sbjct  27   ATESDLYCLKAIKKSLDDPYRYLNSSWDFNNKTEGFICRFTGIECWHPDENRVLNIKLAD  86

Query  340  lnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDL  519
            + L G+ P A+++C SL  LDLS N L G+IPS I   + ++ TLDLSSN+ +GPIP  L
Sbjct  87   MGLKGQFPRAIKNCTSLTGLDLSSNDLYGSIPSDINDIIKFMTTLDLSSNNFSGPIPLXL  146

Query  520  GNCTYLNKLILNDNKLTG  573
             NC+YLN L L++N+L+G
Sbjct  147  SNCSYLNVLKLDNNQLSG  164



>emb|CDM85413.1| unnamed protein product [Triticum aestivum]
Length=270

 Score =   122 bits (307),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 67/137 (49%), Positives = 87/137 (64%), Gaps = 1/137 (1%)
 Frame = +1

Query  166  AEDDVKCLQGVKGSFRDPDGNL-GLWNFDNTTAGFICKFVGVACWNDNENRVIglelrel  342
            +E D++CL+ V+ S  DP+G L   W F N T G+IC F GV CW+ +ENR+  L L  L
Sbjct  26   SEADIQCLKSVQQSVNDPNGVLKSSWIFKNATEGYICLFTGVECWHPDENRIFSLRLGNL  85

Query  343  nlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLG  522
             L G  P  LQ+C S+  +DLS N LSG IP +I R +PYL  LDLS N  +G IP ++ 
Sbjct  86   GLQGSFPRGLQNCSSVTGMDLSNNNLSGPIPQEISREMPYLTFLDLSYNSFSGSIPQNIS  145

Query  523  NCTYLNKLILNDNKLTG  573
            N TYLN L L  N+L+G
Sbjct  146  NMTYLNLLNLQHNQLSG  162



>gb|KGN44709.1| hypothetical protein Csa_7G373520 [Cucumis sativus]
Length=225

 Score =   121 bits (304),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 60/137 (44%), Positives = 90/137 (66%), Gaps = 0/137 (0%)
 Frame = +1

Query  163  VAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrel  342
             AE D+ CL+ +K SF+DP+  L  W+F + + G IC+F+G+ CW+ +EN V+ + L  +
Sbjct  27   AAESDLSCLRSIKKSFQDPNKYLTSWDFSSRSEGAICRFIGIICWHPDENSVLSINLSNM  86

Query  343  nlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLG  522
             L G+ P  +++C SL  LDLS N +SG IP+ +   +P+  TLDLSSN  TG IP  + 
Sbjct  87   GLKGQFPTGIKNCTSLTGLDLSFNQISGEIPTNVGSIVPFATTLDLSSNKFTGRIPKSIA  146

Query  523  NCTYLNKLILNDNKLTG  573
            N +YLN L L+ N+L+G
Sbjct  147  NISYLNVLKLDHNQLSG  163



>ref|XP_010908584.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Elaeis guineensis]
 ref|XP_010908592.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Elaeis guineensis]
 ref|XP_010908599.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Elaeis guineensis]
Length=610

 Score =   126 bits (316),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 69/137 (50%), Positives = 88/137 (64%), Gaps = 1/137 (1%)
 Frame = +1

Query  166  AEDDVKCLQGVKGSFRDPDGNLGL-WNFDNTTAGFICKFVGVACWNDNENRVIglelrel  342
             + D+KCL+ ++ S  DP+  L   W FDN T GF+CKF GV CW+ +E+RV+ L L  +
Sbjct  27   TQTDIKCLRTLQRSLNDPNNMLTYSWKFDNLTEGFMCKFNGVDCWHPDESRVLNLRLSNM  86

Query  343  nlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLG  522
             L G+ P  L+ C SL  LDLS N  SGTIP  I + LPY+ +LDLS N  +G IP  L 
Sbjct  87   GLQGQFPSGLEYCTSLTGLDLSNNNFSGTIPPDISKKLPYVTSLDLSFNSFSGEIPVSLS  146

Query  523  NCTYLNKLILNDNKLTG  573
            NCTYLN L L  N+LTG
Sbjct  147  NCTYLNVLNLQHNRLTG  163



>gb|KDO37775.1| hypothetical protein CISIN_1g042065mg, partial [Citrus sinensis]
Length=179

 Score =   120 bits (300),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 62/137 (45%), Positives = 91/137 (66%), Gaps = 1/137 (1%)
 Frame = +1

Query  166  AEDDVKCLQGVKGSFRDPDGNL-GLWNFDNTTAGFICKFVGVACWNDNENRVIglelrel  342
             ++D+ CL+ +K S  DP   L   WNF+N T GFICKF GV CW+ +EN+V+ L L ++
Sbjct  22   TKEDIACLKSIKDSLEDPFNYLNSSWNFNNDTEGFICKFTGVECWHPDENKVLNLRLTDM  81

Query  343  nlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLG  522
             L G+ P  +++C S+  LDLS N L G++P  I + + +L  LDLSSN+ +G IP +L 
Sbjct  82   GLKGQFPRGIRNCSSMTGLDLSSNKLYGSLPDDISKLVGFLTGLDLSSNNFSGSIPTNLA  141

Query  523  NCTYLNKLILNDNKLTG  573
            NC+YLN L L+ N+ +G
Sbjct  142  NCSYLNSLKLDHNRFSG  158



>ref|XP_006395190.1| hypothetical protein EUTSA_v10003825mg [Eutrema salsugineum]
 gb|ESQ32476.1| hypothetical protein EUTSA_v10003825mg [Eutrema salsugineum]
Length=622

 Score =   126 bits (316),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 85/135 (63%), Gaps = 0/135 (0%)
 Frame = +1

Query  169  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  348
            E +V CL+ +    +DP+G L  W F N T GFICKF GV CW+D+ENRV+ ++L    L
Sbjct  29   EANVNCLRSILSQVKDPNGYLSSWVFRNQTVGFICKFTGVTCWHDDENRVLSIKLSGFGL  88

Query  349  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  528
             GE P  ++ C  L  LDLS N  SGT+P+ I   +P + TLDLS N  +G IPP + N 
Sbjct  89   TGEFPLGIKQCSDLTGLDLSRNNFSGTLPTNISSLIPLVTTLDLSGNRFSGEIPPLISNI  148

Query  529  TYLNKLILNDNKLTG  573
            T+LN L+L  N+ TG
Sbjct  149  TFLNTLMLQQNQFTG  163



>emb|CDX70708.1| BnaC03g07920D [Brassica napus]
Length=358

 Score =   123 bits (309),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 65/135 (48%), Positives = 85/135 (63%), Gaps = 0/135 (0%)
 Frame = +1

Query  169  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  348
            E DVKCL+ +    +DP+G L  W F N TAG+ICKF GV CW+D+ENRV+ ++L    L
Sbjct  133  EADVKCLRTIHSQVKDPNGYLTSWVFGNKTAGYICKFSGVTCWHDDENRVLSIKLGGYGL  192

Query  349  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  528
             GE P  +++C  L  LDLS N  SG +PS I   +P +  LDLS N  +G IP  L N 
Sbjct  193  EGEFPQGIKNCTDLTALDLSRNNFSGVLPSDIASLVPTVTFLDLSYNQFSGEIPASLPNT  252

Query  529  TYLNKLILNDNKLTG  573
            T+LN L+L  N+ TG
Sbjct  253  TFLNTLMLQHNQFTG  267


 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 29/52 (56%), Gaps = 0/52 (0%)
 Frame = +1

Query  130  LSILLVLFGVGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVG  285
            L  LLV    G  ED+V CL+ +K    DP+G L  W F N T G ICKF G
Sbjct  11   LCFLLVSTFTGADEDNVNCLRSIKSQVEDPNGYLSSWVFRNVTEGSICKFSG  62



>ref|XP_009124570.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Brassica rapa]
Length=235

 Score =   121 bits (303),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 61/135 (45%), Positives = 83/135 (61%), Gaps = 0/135 (0%)
 Frame = +1

Query  169  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  348
            E D+ CL+ +K   +DP  +L  W F N + G+ICKF GV CW   +NRV+ + L    L
Sbjct  28   ETDINCLKSLKSQLQDPKAHLSNWIFGNYSEGYICKFFGVECWGSEQNRVLSINLGGYGL  87

Query  349  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  528
             GE P  +  C S+++L+L+GN L GTIPS+   ++PYLVTLDLS N+    IP  L N 
Sbjct  88   KGEFPSGVTLCTSMESLNLTGNNLYGTIPSEFFSFIPYLVTLDLSHNNFASNIPASLSNM  147

Query  529  TYLNKLILNDNKLTG  573
             YL  L+L+ N  TG
Sbjct  148  YYLKTLLLDHNWFTG  162



>ref|XP_006828241.1| hypothetical protein AMTR_s00023p00191140 [Amborella trichopoda]
 gb|ERM95657.1| hypothetical protein AMTR_s00023p00191140 [Amborella trichopoda]
Length=217

 Score =   120 bits (301),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 66/161 (41%), Positives = 100/161 (62%), Gaps = 3/161 (2%)
 Frame = +1

Query  97   MVGFGFSRFLKLSILLV--LFGVGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFI  270
            ++    S ++ L ++L   +F  G  E D++CL  +K S RDP   L  WNF+N +   I
Sbjct  2    LISVAPSMYIFLGVILQTWVFSHG-GETDIQCLLALKASLRDPFHYLSSWNFNNNSHVSI  60

Query  271  CKFVGVACWNDNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICR  450
            C F+GV CW+ +EN+V+ + L  L L G+ P  L++C S+  LDLS N LSG +PS I +
Sbjct  61   CSFLGVECWHPDENKVLNIRLSGLGLQGQFPQGLENCTSMTGLDLSNNDLSGNLPSDISQ  120

Query  451  WLPYLVTLDLSSNDLTGPIPPDLGNCTYLNKLILNDNKLTG  573
             +P + ++D SSN  +G IP  L NCTYLN + L++N+ +G
Sbjct  121  KIPMVTSVDFSSNKFSGQIPASLANCTYLNIIKLSENQFSG  161



>ref|XP_009132248.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Brassica rapa]
Length=248

 Score =   120 bits (302),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 83/135 (61%), Gaps = 0/135 (0%)
 Frame = +1

Query  169  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  348
            E +V CL+ +    +DP+G L  W F N TAGFICKF GV CW+D+ENRV+ ++L    L
Sbjct  24   EANVNCLRNIYSGVKDPNGYLASWVFGNQTAGFICKFTGVTCWHDDENRVLSIKLGGYGL  83

Query  349  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  528
             GE P  ++ C  L  LDLS N  SG +PS I   +P +  LDLS N  +G IP  L N 
Sbjct  84   EGEFPLGIKQCWDLTGLDLSRNNFSGVLPSNIASLIPSVTILDLSYNKFSGKIPAGLSNI  143

Query  529  TYLNKLILNDNKLTG  573
            T+LN L+L  N+ TG
Sbjct  144  TFLNTLMLQHNQFTG  158



>ref|XP_004250582.1| PREDICTED: F-box protein At3g07870-like [Solanum lycopersicum]
Length=523

 Score =   124 bits (311),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 75/162 (46%), Positives = 102/162 (63%), Gaps = 2/162 (1%)
 Frame = +1

Query  88   DFRMVGFGFSRFLKLSILLVLFGVGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGF  267
            DF  +     + LK   +L+L  V  A +D+KCLQG+K SF+DP+ N   WNF N + GF
Sbjct  336  DFLFLHHPVKKTLKKLDVLLLHNV-TASNDIKCLQGLKDSFKDPNVNFNSWNFSNYSMGF  394

Query  268  ICKFVGVACWNDNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQIC  447
            ICKFVGV  WN+ ENR+I L L  +NL  ++P A + C SL  L LSGN  SG+IP+++ 
Sbjct  395  ICKFVGVIYWNNLENRMISLSLPNMNLSVQLPDAFKCCSSLATLHLSGNSFSGSIPAEL-  453

Query  448  RWLPYLVTLDLSSNDLTGPIPPDLGNCTYLNKLILNDNKLTG  573
            R   YL  L L++N L+G IPP++   T L  L L +N L+G
Sbjct  454  RNCTYLNKLILNNNKLSGNIPPEISQLTRLKVLSLANNNLSG  495



>ref|XP_008382758.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Malus domestica]
Length=197

 Score =   119 bits (298),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 62/138 (45%), Positives = 91/138 (66%), Gaps = 1/138 (1%)
 Frame = +1

Query  163  VAEDDVKCLQGVKGSFRDPDGNL-GLWNFDNTTAGFICKFVGVACWNDNENRVIglelre  339
              E D+ CL+ +K + +DP G L   W+F+N T GFIC F+G+ CW+ +E++V+ ++L +
Sbjct  33   AVESDINCLKSLKATLQDPLGYLNSSWDFNNNTEGFICNFLGIECWHPHESKVLNIKLSD  92

Query  340  lnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDL  519
            L L G  P  + +C SL  LDLS N LSG +P  I R + ++ TLDLSSN  +G IP ++
Sbjct  93   LGLKGPFPHGIANCTSLTGLDLSSNKLSGPLPEDIGRIISFITTLDLSSNSFSGQIPTNI  152

Query  520  GNCTYLNKLILNDNKLTG  573
             NC+YLN L L+ N+ TG
Sbjct  153  TNCSYLNVLKLDSNQFTG  170



>emb|CDY48749.1| BnaA02g30100D [Brassica napus]
Length=623

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 63/135 (47%), Positives = 85/135 (63%), Gaps = 0/135 (0%)
 Frame = +1

Query  169  EDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelrelnl  348
            E +V CL+ +    +DP+G L  W F N TAG+ICKF GV CW+D+ENRV+ ++L    L
Sbjct  29   EANVNCLRTIYNQVKDPNGYLTSWVFGNQTAGYICKFTGVTCWHDDENRVLSIKLGGYGL  88

Query  349  ggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGNC  528
             G  P  +++C  L  LDLS N  SG +PS I   +P +  LDLS N  +GPIPP + N 
Sbjct  89   TGGFPLGIKNCTDLTALDLSRNNFSGPLPSNITDSIPLVTILDLSYNQFSGPIPPSISNI  148

Query  529  TYLNKLILNDNKLTG  573
            T+LN L+L  N+ TG
Sbjct  149  TFLNSLMLQHNQFTG  163



>emb|CDY07991.1| BnaC03g35320D [Brassica napus]
Length=259

 Score =   120 bits (301),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 65/153 (42%), Positives = 94/153 (61%), Gaps = 2/153 (1%)
 Frame = +1

Query  121  FLKLSILLVLFGV--GVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVAC  294
            F++  I L+L  +     E D+ CL+ +K   +DP   L  W F N + G+IC F GV C
Sbjct  12   FIRSCIWLLLLPILTRAMESDITCLRSLKSQLKDPHAYLSNWIFGNYSDGYICSFFGVYC  71

Query  295  WNDNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTL  474
            W    N+V+ + L    L GE P  ++ C  +++L+L+GN L+GT+PS     LPYLVTL
Sbjct  72   WRSKHNKVLSINLGGSGLEGEFPSGVKLCSFMESLNLTGNNLTGTLPSDTFSSLPYLVTL  131

Query  475  DLSSNDLTGPIPPDLGNCTYLNKLILNDNKLTG  573
            DLS+N+L G IP +L N +YLN L+L+ N+ TG
Sbjct  132  DLSNNNLAGEIPANLPNMSYLNTLLLDHNRFTG  164



>ref|XP_008779573.1| PREDICTED: LOW QUALITY PROTEIN: probably inactive leucine-rich 
repeat receptor-like protein kinase At5g48380 [Phoenix dactylifera]
Length=612

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/137 (48%), Positives = 90/137 (66%), Gaps = 1/137 (1%)
 Frame = +1

Query  166  AEDDVKCLQGVKGSFRDPDGNLGL-WNFDNTTAGFICKFVGVACWNDNENRVIglelrel  342
             + D++CL+ ++ S  DP   L   WNF N T GFICKF GV CW+ +ENRV+ L L  +
Sbjct  29   TKTDIECLRRIQDSLHDPFDYLKYSWNFTNKTEGFICKFNGVECWHPDENRVLFLRLSNM  88

Query  343  nlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLG  522
             L G+ P  +++C SL  LDLS N LSG IP+ I R +P++ +LDLS N  +G IP +L 
Sbjct  89   GLEGQFPLGIENCTSLAGLDLSSNNLSGPIPADIARRIPFVTSLDLSFNTFSGEIPANLS  148

Query  523  NCTYLNKLILNDNKLTG  573
            NC+YLN L L  N+L+G
Sbjct  149  NCSYLNILNLQHNQLSG  165



>gb|KJB40809.1| hypothetical protein B456_007G077900 [Gossypium raimondii]
Length=556

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 73/145 (50%), Positives = 95/145 (66%), Gaps = 8/145 (6%)
 Frame = +1

Query  112  FSRFLKL-------SILLVLFGVGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFI  270
            FSR LK+          L L     A+DD+KCL+GVK S +DPDG L  W F+N + GF+
Sbjct  5    FSRRLKILSFVLSWMFSLALVFPATAQDDLKCLEGVKNSLKDPDGRLSSWTFNNNSVGFV  64

Query  271  CKFVGVACWNDNENRVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICR  450
            CKFVGV CWN+ ENR++GLELR++ L GE+P +L+ C SLQ LDLS N LSG+IP Q+  
Sbjct  65   CKFVGVQCWNEQENRLLGLELRDMKLSGELPQSLEYCRSLQTLDLSANKLSGSIPYQLSG  124

Query  451  WLPYLVTLDLSSNDLTGPIPPDLGN  525
             L  L    +++NDL+G IP    N
Sbjct  125  -LDRLKRFSVANNDLSGAIPSSFEN  148



>gb|KDO43522.1| hypothetical protein CISIN_1g006982mg [Citrus sinensis]
Length=623

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 67/147 (46%), Positives = 96/147 (65%), Gaps = 2/147 (1%)
 Frame = +1

Query  139  LLVLFGVGV-AEDDVKCLQGVKGSFRDPDGNL-GLWNFDNTTAGFICKFVGVACWNDNEN  312
            LL+ F +    ++D+ CL+ +K S  DP   L   WNF+N T GFICKF GV CW+ +EN
Sbjct  21   LLLCFSLSYGTKEDLACLKSIKDSLEDPFNYLNSSWNFNNDTEGFICKFTGVECWHPDEN  80

Query  313  RVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSND  492
            RV+ L L ++ L G+ P  +++C S+  LDLS N L G +P  I + + +L +LDLSSN+
Sbjct  81   RVLNLRLTDMGLKGQFPRGIRNCSSMTGLDLSSNKLYGPLPDDISKLVGFLTSLDLSSNN  140

Query  493  LTGPIPPDLGNCTYLNKLILNDNKLTG  573
             +G IP +L NCTYLN L L+ N+ +G
Sbjct  141  FSGSIPSNLANCTYLNSLKLDHNRFSG  167



>ref|XP_006447934.1| hypothetical protein CICLE_v10014610mg [Citrus clementina]
 ref|XP_006469354.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380-like [Citrus sinensis]
 gb|ESR61174.1| hypothetical protein CICLE_v10014610mg [Citrus clementina]
Length=623

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 67/147 (46%), Positives = 96/147 (65%), Gaps = 2/147 (1%)
 Frame = +1

Query  139  LLVLFGVGV-AEDDVKCLQGVKGSFRDPDGNL-GLWNFDNTTAGFICKFVGVACWNDNEN  312
            LL+ F +    ++D+ CL+ +K S  DP   L   WNF+N T GFICKF GV CW+ +EN
Sbjct  21   LLLCFSLSYGTKEDLACLKSIKDSLEDPFNYLNSSWNFNNDTEGFICKFTGVECWHPDEN  80

Query  313  RVIglelrelnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSND  492
            RV+ L L ++ L G+ P  +++C S+  LDLS N L G +P  I + + +L +LDLSSN+
Sbjct  81   RVLNLRLTDMGLKGQFPRGIRNCSSMTGLDLSSNKLYGPLPDDISKLVGFLTSLDLSSNN  140

Query  493  LTGPIPPDLGNCTYLNKLILNDNKLTG  573
             +G IP +L NCTYLN L L+ N+ +G
Sbjct  141  FSGSIPSNLANCTYLNSLKLDHNRFSG  167



>ref|XP_006379646.1| hypothetical protein POPTR_0008s07830g [Populus trichocarpa]
 ref|XP_002312207.2| hypothetical protein POPTR_0008s07830g [Populus trichocarpa]
 gb|ERP57443.1| hypothetical protein POPTR_0008s07830g [Populus trichocarpa]
 gb|EEE89574.2| hypothetical protein POPTR_0008s07830g [Populus trichocarpa]
Length=630

 Score =   124 bits (310),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 95/140 (68%), Gaps = 1/140 (1%)
 Frame = +1

Query  157  VGVAEDDVKCLQGVKGSFRDPDGNLGL-WNFDNTTAGFICKFVGVACWNDNENRVIglel  333
            +     D++CL+ +K S  DP   L   W+F+N T GF+C+F+GV CW+ +ENRV+ + L
Sbjct  30   IDATATDIECLKSIKDSLVDPYNYLNTTWDFNNNTEGFLCRFMGVECWHPDENRVLNIRL  89

Query  334  relnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPP  513
             +L+L G+ P  +Q C SL  LDLS N L G+IP+ I + LPY+  LDLS N+ +G IP 
Sbjct  90   SDLSLKGQFPLGIQKCTSLTGLDLSRNKLFGSIPANISKLLPYVTNLDLSFNNFSGGIPL  149

Query  514  DLGNCTYLNKLILNDNKLTG  573
            +L NC++LN L L++N+LTG
Sbjct  150  NLANCSFLNDLKLDNNRLTG  169



>ref|XP_011015307.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Populus euphratica]
 ref|XP_011015308.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Populus euphratica]
 ref|XP_011015309.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Populus euphratica]
Length=621

 Score =   123 bits (308),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 64/136 (47%), Positives = 87/136 (64%), Gaps = 1/136 (1%)
 Frame = +1

Query  169  EDDVKCLQGVKGSFRDPDGNL-GLWNFDNTTAGFICKFVGVACWNDNENRVIglelreln  345
            E D+ CL+ +K S  D    L   WNF+N T GFIC F+GV CW+ NENRV+ + L ++ 
Sbjct  28   ETDIACLKSIKDSLIDTRNYLNSSWNFENATEGFICTFLGVECWHPNENRVLNIRLPDMG  87

Query  346  lggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLGN  525
            L G  P  L +C S+  +DLS N L G+IP  I + + +  +LDLSSN+ +G IP  L N
Sbjct  88   LKGRFPLGLTNCTSMTGIDLSSNELFGSIPQNISQIVGFATSLDLSSNNFSGEIPSGLAN  147

Query  526  CTYLNKLILNDNKLTG  573
            C++LN L L+ NKLTG
Sbjct  148  CSFLNVLKLDHNKLTG  163



>ref|XP_009151638.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Brassica rapa]
 ref|XP_009151639.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Brassica rapa]
Length=622

 Score =   123 bits (308),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 64/139 (46%), Positives = 89/139 (64%), Gaps = 0/139 (0%)
 Frame = +1

Query  157  VGVAEDDVKCLQGVKGSFRDPDGNLGLWNFDNTTAGFICKFVGVACWNDNENRVIglelr  336
            +  +E DV CL+ +K    DP+  L  W F N +AGFICKF GV+CW+D+ENRV+ ++L 
Sbjct  25   IDASEADVNCLRNIKSQLTDPNEYLSSWVFSNESAGFICKFSGVSCWHDDENRVLSIKLS  84

Query  337  elnlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPD  516
               LGGE P A+++C  L  L+LS N  SG +P+ I   +P + TLDLS N  +G IP  
Sbjct  85   GFGLGGEFPVAIKNCTDLTGLELSRNNFSGPLPTDISSLIPSVTTLDLSENSFSGVIPVS  144

Query  517  LGNCTYLNKLILNDNKLTG  573
            + N T+LN L+L  N+ TG
Sbjct  145  VSNITFLNALMLQGNQFTG  163



>ref|XP_008801014.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Phoenix dactylifera]
Length=611

 Score =   122 bits (307),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 66/137 (48%), Positives = 89/137 (65%), Gaps = 1/137 (1%)
 Frame = +1

Query  166  AEDDVKCLQGVKGSFRDPDGNLGL-WNFDNTTAGFICKFVGVACWNDNENRVIglelrel  342
             + D++CL+ ++ S  DP  NL   WN  N T G ICKF GV CW+ +ENRV+ L L  +
Sbjct  29   TKTDIQCLRNIQDSLHDPFDNLKYSWNLTNQTEGVICKFNGVECWHPDENRVLFLRLSNM  88

Query  343  nlggeVPGALQDCHSLQNLDLSGNGLSGTIPSQICRWLPYLVTLDLSSNDLTGPIPPDLG  522
             L G+ P  +++C SL  LDLS N LSG IP  I R +P++ TLDLS N+ +G IP +L 
Sbjct  89   GLEGQFPLGIENCTSLTGLDLSSNNLSGHIPDDIARRIPFVTTLDLSFNNFSGEIPANLS  148

Query  523  NCTYLNKLILNDNKLTG  573
            NC+YLN L L  N+L+G
Sbjct  149  NCSYLNILNLQHNQLSG  165



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 682974011750