BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002C24

Length=566
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004237268.1|  PREDICTED: uncharacterized protein LOC101265533    164   8e-44   Solanum lycopersicum
ref|XP_006363752.1|  PREDICTED: uncharacterized protein LOC102588763    163   1e-43   Solanum tuberosum [potatoes]
ref|XP_009786299.1|  PREDICTED: uncharacterized protein LOC104234435    157   2e-41   Nicotiana sylvestris
ref|XP_009608458.1|  PREDICTED: membralin                               157   2e-41   Nicotiana tomentosiformis
ref|XP_004163890.1|  PREDICTED: uncharacterized protein LOC101226676    153   2e-41   
emb|CBI23782.3|  unnamed protein product                                155   7e-41   Vitis vinifera
ref|XP_008361707.1|  PREDICTED: uncharacterized protein LOC103425410    149   1e-40   
emb|CAN83928.1|  hypothetical protein VITISV_036910                     155   1e-40   Vitis vinifera
gb|AAQ09996.1|  S3 self-incompatibility locus-linked pollen 3.15 ...    154   2e-40   Petunia integrifolia subsp. inflata
emb|CDP12573.1|  unnamed protein product                                154   2e-40   Coffea canephora [robusta coffee]
ref|XP_003593019.1|  Membralin                                          153   7e-40   Medicago truncatula
ref|XP_004146263.1|  PREDICTED: uncharacterized protein LOC101205453    152   1e-39   Cucumis sativus [cucumbers]
ref|XP_008456073.1|  PREDICTED: uncharacterized protein LOC103496115    152   1e-39   Cucumis melo [Oriental melon]
ref|XP_007227344.1|  hypothetical protein PRUPE_ppa002726mg             152   2e-39   Prunus persica
ref|XP_008347906.1|  PREDICTED: uncharacterized protein LOC103411037    145   5e-39   
ref|XP_003531591.1|  PREDICTED: uncharacterized protein LOC100810...    150   6e-39   Glycine max [soybeans]
ref|XP_011083231.1|  PREDICTED: uncharacterized protein LOC105165794    150   8e-39   Sesamum indicum [beniseed]
ref|XP_006585484.1|  PREDICTED: uncharacterized protein LOC100810...    150   9e-39   Glycine max [soybeans]
ref|XP_007148516.1|  hypothetical protein PHAVU_006G215300g             150   1e-38   Phaseolus vulgaris [French bean]
ref|XP_008224597.1|  PREDICTED: uncharacterized protein LOC103324328    149   1e-38   Prunus mume [ume]
ref|XP_003547536.1|  PREDICTED: uncharacterized protein LOC100812436    150   1e-38   Glycine max [soybeans]
gb|KHN33454.1|  Membralin                                               150   1e-38   Glycine soja [wild soybean]
ref|XP_011016110.1|  PREDICTED: uncharacterized protein LOC105119643    145   2e-38   Populus euphratica
gb|EYU31215.1|  hypothetical protein MIMGU_mgv1a002444mg                148   6e-38   Erythranthe guttata [common monkey flower]
gb|KDO53495.1|  hypothetical protein CISIN_1g005878mg                   145   1e-37   Citrus sinensis [apfelsine]
ref|XP_006431848.1|  hypothetical protein CICLE_v10000505mg             145   1e-37   
gb|KDO53494.1|  hypothetical protein CISIN_1g005878mg                   145   1e-37   Citrus sinensis [apfelsine]
ref|XP_004485491.1|  PREDICTED: uncharacterized protein LOC101514383    147   2e-37   Cicer arietinum [garbanzo]
gb|KDO53491.1|  hypothetical protein CISIN_1g005878mg                   145   3e-37   Citrus sinensis [apfelsine]
gb|KDO53489.1|  hypothetical protein CISIN_1g005878mg                   146   3e-37   Citrus sinensis [apfelsine]
ref|XP_006431850.1|  hypothetical protein CICLE_v10000505mg             145   3e-37   Citrus clementina [clementine]
gb|KDO53490.1|  hypothetical protein CISIN_1g005878mg                   145   3e-37   Citrus sinensis [apfelsine]
ref|XP_008378986.1|  PREDICTED: uncharacterized protein LOC103442021    143   4e-37   
ref|XP_006431851.1|  hypothetical protein CICLE_v10000505mg             145   4e-37   Citrus clementina [clementine]
ref|XP_006369359.1|  hypothetical protein POPTR_0001s21920g             144   5e-37   
gb|KDP38854.1|  hypothetical protein JCGZ_05011                         145   6e-37   Jatropha curcas
ref|XP_002529547.1|  Membralin, putative                                144   1e-36   Ricinus communis
ref|XP_002298169.2|  Nuf2 family protein                                144   1e-36   
ref|XP_009355233.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    144   1e-36   Pyrus x bretschneideri [bai li]
ref|XP_011005215.1|  PREDICTED: uncharacterized protein LOC105111532    144   1e-36   Populus euphratica
gb|KHG02113.1|  Membralin                                               144   1e-36   Gossypium arboreum [tree cotton]
gb|KHG02112.1|  Membralin                                               144   1e-36   Gossypium arboreum [tree cotton]
ref|XP_006471106.1|  PREDICTED: uncharacterized protein LOC102618...    144   2e-36   Citrus sinensis [apfelsine]
ref|XP_010101164.1|  hypothetical protein L484_016729                   143   2e-36   
ref|XP_006471107.1|  PREDICTED: uncharacterized protein LOC102618...    143   2e-36   
ref|XP_006471105.1|  PREDICTED: uncharacterized protein LOC102618...    144   2e-36   Citrus sinensis [apfelsine]
gb|KHG12184.1|  Membralin                                               142   4e-36   Gossypium arboreum [tree cotton]
ref|XP_006392070.1|  hypothetical protein EUTSA_v10023347mg             142   5e-36   Eutrema salsugineum [saltwater cress]
ref|XP_010030118.1|  PREDICTED: uncharacterized protein LOC104419970    142   6e-36   Eucalyptus grandis [rose gum]
ref|XP_004299931.1|  PREDICTED: uncharacterized protein LOC101308680    142   6e-36   Fragaria vesca subsp. vesca
gb|KJB77702.1|  hypothetical protein B456_012G151900                    142   6e-36   Gossypium raimondii
gb|KJB12208.1|  hypothetical protein B456_002G006000                    142   7e-36   Gossypium raimondii
gb|KJB12209.1|  hypothetical protein B456_002G006000                    142   9e-36   Gossypium raimondii
ref|XP_010674302.1|  PREDICTED: uncharacterized protein LOC104890...    142   9e-36   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB77701.1|  hypothetical protein B456_012G151900                    142   9e-36   Gossypium raimondii
gb|KJB12206.1|  hypothetical protein B456_002G006000                    142   9e-36   Gossypium raimondii
ref|XP_010674303.1|  PREDICTED: uncharacterized protein LOC104890...    142   9e-36   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007042243.1|  S3 self-incompatibility locus-linked pollen ...    141   2e-35   
gb|KFK40737.1|  hypothetical protein AALP_AA2G034600                    140   2e-35   Arabis alpina [alpine rockcress]
ref|XP_007042242.1|  S3 self-incompatibility locus-linked pollen ...    141   2e-35   
ref|XP_010274109.1|  PREDICTED: uncharacterized protein LOC104609475    141   2e-35   Nelumbo nucifera [Indian lotus]
ref|XP_010430092.1|  PREDICTED: membralin-like                          140   2e-35   Camelina sativa [gold-of-pleasure]
ref|XP_002886570.1|  hypothetical protein ARALYDRAFT_475227             140   2e-35   
ref|NP_001077749.1|  uncharacterized protein                            140   2e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010418050.1|  PREDICTED: membralin-like                          140   3e-35   Camelina sativa [gold-of-pleasure]
ref|XP_010533962.1|  PREDICTED: membralin                               139   7e-35   Tarenaya hassleriana [spider flower]
emb|CDY52486.1|  BnaA01g36030D                                          137   9e-35   Brassica napus [oilseed rape]
ref|XP_010473303.1|  PREDICTED: uncharacterized protein LOC104752769    139   9e-35   Camelina sativa [gold-of-pleasure]
ref|XP_006301185.1|  hypothetical protein CARUB_v10021584mg             138   1e-34   Capsella rubella
emb|CDY03777.1|  BnaC01g28940D                                          138   2e-34   
ref|XP_009104283.1|  PREDICTED: membralin                               138   2e-34   Brassica rapa
emb|CDY61338.1|  BnaCnng37740D                                          136   5e-34   Brassica napus [oilseed rape]
gb|EPS72367.1|  hypothetical protein M569_02391                         134   2e-33   Genlisea aurea
gb|KDO53488.1|  hypothetical protein CISIN_1g005878mg                   135   2e-33   Citrus sinensis [apfelsine]
gb|KDO53492.1|  hypothetical protein CISIN_1g005878mg                   127   1e-30   Citrus sinensis [apfelsine]
ref|XP_006471108.1|  PREDICTED: uncharacterized protein LOC102618...    127   1e-30   Citrus sinensis [apfelsine]
gb|KDO53493.1|  hypothetical protein CISIN_1g005878mg                   127   1e-30   Citrus sinensis [apfelsine]
ref|XP_006471109.1|  PREDICTED: uncharacterized protein LOC102618...    127   2e-30   Citrus sinensis [apfelsine]
gb|KJB12207.1|  hypothetical protein B456_002G006000                    119   6e-28   Gossypium raimondii
gb|AFW68066.1|  hypothetical protein ZEAMMB73_082522                    114   7e-28   
ref|XP_010923767.1|  PREDICTED: uncharacterized protein LOC105046...    116   7e-28   
gb|AAG51636.1|AC018908_2  unknown protein; 69131-60853                  120   1e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010923766.1|  PREDICTED: uncharacterized protein LOC105046...    116   1e-27   
ref|XP_010923765.1|  PREDICTED: uncharacterized protein LOC105046...    116   2e-27   
ref|XP_010923758.1|  PREDICTED: uncharacterized protein LOC105046...    116   3e-27   Elaeis guineensis
ref|XP_010923763.1|  PREDICTED: uncharacterized protein LOC105046...    115   3e-27   
ref|XP_010923762.1|  PREDICTED: uncharacterized protein LOC105046...    116   3e-27   
ref|XP_010923759.1|  PREDICTED: uncharacterized protein LOC105046...    115   5e-27   
ref|XP_010923760.1|  PREDICTED: uncharacterized protein LOC105046...    115   5e-27   Elaeis guineensis
ref|XP_010923761.1|  PREDICTED: uncharacterized protein LOC105046...    115   6e-27   
ref|XP_010923756.1|  PREDICTED: uncharacterized protein LOC105046...    116   6e-27   
ref|XP_010923757.1|  PREDICTED: uncharacterized protein LOC105046...    115   7e-27   Elaeis guineensis
ref|XP_010923755.1|  PREDICTED: uncharacterized protein LOC105046...    115   8e-27   
ref|XP_010923754.1|  PREDICTED: uncharacterized protein LOC105046...    116   8e-27   
ref|XP_008787340.1|  PREDICTED: uncharacterized protein LOC103705...    116   2e-26   Phoenix dactylifera
dbj|BAK02995.1|  predicted protein                                      113   2e-26   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008787339.1|  PREDICTED: uncharacterized protein LOC103705...    116   2e-26   Phoenix dactylifera
ref|XP_010942375.1|  PREDICTED: uncharacterized protein LOC105060393    113   2e-25   Elaeis guineensis
gb|EEE59630.1|  hypothetical protein OsJ_11978                          113   3e-25   Oryza sativa Japonica Group [Japonica rice]
gb|EEC75863.1|  hypothetical protein OsI_12877                          112   3e-25   Oryza sativa Indica Group [Indian rice]
ref|XP_006650375.1|  PREDICTED: uncharacterized protein LOC102702737    112   3e-25   Oryza brachyantha
ref|NP_001050822.1|  Os03g0659900                                       112   3e-25   
ref|XP_004982244.1|  PREDICTED: uncharacterized protein LOC101752...    112   3e-25   Setaria italica
ref|XP_010231807.1|  PREDICTED: uncharacterized protein LOC100825...    112   3e-25   Brachypodium distachyon [annual false brome]
ref|XP_003561560.1|  PREDICTED: uncharacterized protein LOC100825...    112   4e-25   Brachypodium distachyon [annual false brome]
ref|XP_004982243.1|  PREDICTED: uncharacterized protein LOC101752...    112   4e-25   Setaria italica
ref|XP_002464124.1|  hypothetical protein SORBIDRAFT_01g012790          112   4e-25   Sorghum bicolor [broomcorn]
ref|XP_008782691.1|  PREDICTED: uncharacterized protein LOC103702156    112   4e-25   Phoenix dactylifera
ref|XP_010231815.1|  PREDICTED: uncharacterized protein LOC100825...    111   5e-25   Brachypodium distachyon [annual false brome]
gb|EMT20955.1|  hypothetical protein F775_05632                         112   6e-25   
gb|EMS54971.1|  hypothetical protein TRIUR3_11843                       112   6e-25   Triticum urartu
ref|XP_009387979.1|  PREDICTED: uncharacterized protein LOC103974813    109   4e-24   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFW68067.1|  hypothetical protein ZEAMMB73_082522                    100   8e-24   
gb|ACN39930.1|  unknown                                                 105   2e-22   Picea sitchensis
ref|XP_006853401.1|  hypothetical protein AMTR_s00032p00148750        95.5    2e-19   
gb|AAQ09998.1|  S2 self-incompatibility locus-linked pollen 3.15 ...  82.8    6e-15   Petunia integrifolia subsp. inflata
gb|AAQ09997.1|  S1 self-incompatibility locus-linked pollen 3.15 ...  79.0    1e-13   Petunia integrifolia subsp. inflata
ref|XP_002970045.1|  hypothetical protein SELMODRAFT_440969           78.2    3e-13   
ref|XP_002985235.1|  hypothetical protein SELMODRAFT_446163           77.8    3e-13   
gb|KEH36424.1|  S3 self-incompatibility locus-linked pollen 3.15 ...  61.2    8e-08   Medicago truncatula
gb|ABK24891.1|  unknown                                               58.2    3e-07   Picea sitchensis
gb|ABK23338.1|  unknown                                               57.8    5e-07   Picea sitchensis
gb|ACN41062.1|  unknown                                               58.2    5e-07   Picea sitchensis



>ref|XP_004237268.1| PREDICTED: uncharacterized protein LOC101265533 [Solanum lycopersicum]
Length=658

 Score =   164 bits (415),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = +3

Query  285  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  464
            MDPEQTFIRVQERF+QML+PRIRATLEY  LF+AVTLFCILVVMHANYVQQPGCSSELS+
Sbjct  1    MDPEQTFIRVQERFAQMLTPRIRATLEYLYLFMAVTLFCILVVMHANYVQQPGCSSELSR  60

Query  465  VDISDVQIIQIKITSAGLWFQNETEYNEVDVSS  563
            V+ISD Q+IQIKITSAGLW QN+T Y+ V+V++
Sbjct  61   VNISDAQLIQIKITSAGLWSQNQTNYDVVNVAN  93



>ref|XP_006363752.1| PREDICTED: uncharacterized protein LOC102588763 [Solanum tuberosum]
Length=658

 Score =   163 bits (413),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/91 (84%), Positives = 85/91 (93%), Gaps = 0/91 (0%)
 Frame = +3

Query  285  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  464
            MDPEQTFIRVQERF+QML+PRIRATLEY  LF+AVTLFCILVVMHANYVQQPGCSSELS+
Sbjct  1    MDPEQTFIRVQERFAQMLTPRIRATLEYLYLFMAVTLFCILVVMHANYVQQPGCSSELSR  60

Query  465  VDISDVQIIQIKITSAGLWFQNETEYNEVDV  557
            V+ISD Q+IQIKITSAGLW QN+T Y+ V+V
Sbjct  61   VNISDAQLIQIKITSAGLWSQNQTNYDVVNV  91



>ref|XP_009786299.1| PREDICTED: uncharacterized protein LOC104234435 [Nicotiana sylvestris]
Length=661

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 85/93 (91%), Gaps = 0/93 (0%)
 Frame = +3

Query  285  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  464
            MDPEQTFIRVQERF+QML PR+RATLEY  LF+AVTLF ILVVMHANYVQQPGCSSELS+
Sbjct  1    MDPEQTFIRVQERFAQMLRPRVRATLEYLYLFIAVTLFSILVVMHANYVQQPGCSSELSR  60

Query  465  VDISDVQIIQIKITSAGLWFQNETEYNEVDVSS  563
            V+IS+ Q+IQIKITSAGLW QN+T Y+ V+V++
Sbjct  61   VNISEAQLIQIKITSAGLWSQNQTNYDVVNVAN  93



>ref|XP_009608458.1| PREDICTED: membralin [Nicotiana tomentosiformis]
Length=661

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 85/93 (91%), Gaps = 0/93 (0%)
 Frame = +3

Query  285  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  464
            MDPEQTFIRVQERF+QML PR+RATLEY  LF+AVTLF ILVVMHANYVQQPGCSSELS+
Sbjct  1    MDPEQTFIRVQERFAQMLRPRVRATLEYLYLFIAVTLFSILVVMHANYVQQPGCSSELSR  60

Query  465  VDISDVQIIQIKITSAGLWFQNETEYNEVDVSS  563
            V+IS+ Q+IQIKITSAGLW QN+T Y+ V+V++
Sbjct  61   VNISEAQLIQIKITSAGLWSQNQTNYDVVNVAN  93



>ref|XP_004163890.1| PREDICTED: uncharacterized protein LOC101226676 [Cucumis sativus]
Length=327

 Score =   153 bits (387),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 71/94 (76%), Positives = 82/94 (87%), Gaps = 0/94 (0%)
 Frame = +3

Query  285  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  464
            MDPEQTFIRVQERFSQML+P++RATLEY  L +A+TLFCILVVMHANYVQQPGCSSELS 
Sbjct  1    MDPEQTFIRVQERFSQMLTPKVRATLEYMNLCIAITLFCILVVMHANYVQQPGCSSELSG  60

Query  465  VDISDVQIIQIKITSAGLWFQNETEYNEVDVSSG  566
            V+ ++ Q+IQIKIT+AGLW QNE+E N  DV  G
Sbjct  61   VETTEAQLIQIKITTAGLWSQNESELNIQDVPGG  94



>emb|CBI23782.3| unnamed protein product [Vitis vinifera]
Length=516

 Score =   155 bits (391),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 70/91 (77%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = +3

Query  285  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  464
            MDPEQTFIRVQERFSQML+PR+RA+LEY  LFVA+TLFCILVVMHANYVQQPGCSSE S 
Sbjct  1    MDPEQTFIRVQERFSQMLTPRVRASLEYIYLFVAITLFCILVVMHANYVQQPGCSSEFSG  60

Query  465  VDISDVQIIQIKITSAGLWFQNETEYNEVDV  557
            V+ ++ Q+IQIKITSAGLW +NE+EY  ++V
Sbjct  61   VETTEAQLIQIKITSAGLWSRNESEYKAINV  91



>ref|XP_008361707.1| PREDICTED: uncharacterized protein LOC103425410 [Malus domestica]
Length=267

 Score =   149 bits (377),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 79/89 (89%), Gaps = 0/89 (0%)
 Frame = +3

Query  285  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  464
            MD EQTFIRVQERFSQ+L+P++RA LEY  LF+A+TLFCILVVMHANYVQQPGCSSELS 
Sbjct  1    MDAEQTFIRVQERFSQILTPKVRAALEYIYLFIAITLFCILVVMHANYVQQPGCSSELSG  60

Query  465  VDISDVQIIQIKITSAGLWFQNETEYNEV  551
            V+ ++ QIIQIKITSAGLW QNE+E+  V
Sbjct  61   VETTZAQIIQIKITSAGLWSQNESEFTNV  89



>emb|CAN83928.1| hypothetical protein VITISV_036910 [Vitis vinifera]
Length=673

 Score =   155 bits (392),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 70/91 (77%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = +3

Query  285  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  464
            MDPEQTFIRVQERFSQML+PR+RA+LEY  LFVA+TLFCILVVMHANYVQQPGCSSE S 
Sbjct  1    MDPEQTFIRVQERFSQMLTPRVRASLEYIYLFVAITLFCILVVMHANYVQQPGCSSEFSG  60

Query  465  VDISDVQIIQIKITSAGLWFQNETEYNEVDV  557
            V+ ++ Q+IQIKITSAGLW +NE+EY  ++V
Sbjct  61   VETTEAQLIQIKITSAGLWSRNESEYKAINV  91



>gb|AAQ09996.1| S3 self-incompatibility locus-linked pollen 3.15 protein [Petunia 
integrifolia subsp. inflata]
Length=660

 Score =   154 bits (390),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = +3

Query  285  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  464
            MDPEQTFIRVQERF+QML+PRIR TLEY  LF+AVTLF ILVVMHANYVQQPGCSSELS+
Sbjct  1    MDPEQTFIRVQERFAQMLTPRIRVTLEYLYLFIAVTLFSILVVMHANYVQQPGCSSELSR  60

Query  465  VDISDVQIIQIKITSAGLWFQNETEYNEVDVSS  563
            V+I + Q+IQIKITSAGLW QN+  Y+ VDV++
Sbjct  61   VNIMEAQLIQIKITSAGLWSQNQPNYDVVDVAN  93



>emb|CDP12573.1| unnamed protein product [Coffea canephora]
Length=671

 Score =   154 bits (390),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 71/94 (76%), Positives = 82/94 (87%), Gaps = 0/94 (0%)
 Frame = +3

Query  285  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  464
            MDPEQTFIRVQERFS+ML+P+IR  LEY  LF+AVTLFCILVVMHANYVQQPGCSSEL K
Sbjct  1    MDPEQTFIRVQERFSEMLTPKIRDFLEYLYLFIAVTLFCILVVMHANYVQQPGCSSELPK  60

Query  465  VDISDVQIIQIKITSAGLWFQNETEYNEVDVSSG  566
            V++S+ Q+IQIKITS GLW  NE+EYNE++   G
Sbjct  61   VNVSEAQLIQIKITSDGLWTWNESEYNEINGLEG  94



>ref|XP_003593019.1| Membralin [Medicago truncatula]
 gb|AES63270.1| S3 self-incompatibility locus-linked pollen 3.15 protein [Medicago 
truncatula]
Length=675

 Score =   153 bits (387),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 70/90 (78%), Positives = 79/90 (88%), Gaps = 0/90 (0%)
 Frame = +3

Query  285  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  464
            MDPEQTFIRVQERFSQML+P++R TLEY  LFVA+T FCILVVMHANYVQQPGCSSELS 
Sbjct  1    MDPEQTFIRVQERFSQMLTPKVRVTLEYLYLFVAITFFCILVVMHANYVQQPGCSSELSG  60

Query  465  VDISDVQIIQIKITSAGLWFQNETEYNEVD  554
            V  SD Q+IQIKITSAGLW+ N++E N +D
Sbjct  61   VLTSDAQLIQIKITSAGLWYHNDSEPNIID  90



>ref|XP_004146263.1| PREDICTED: uncharacterized protein LOC101205453 [Cucumis sativus]
 gb|KGN57586.1| hypothetical protein Csa_3G219210 [Cucumis sativus]
Length=669

 Score =   152 bits (385),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 71/94 (76%), Positives = 82/94 (87%), Gaps = 0/94 (0%)
 Frame = +3

Query  285  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  464
            MDPEQTFIRVQERFSQML+P++RATLEY  L +A+TLFCILVVMHANYVQQPGCSSELS 
Sbjct  1    MDPEQTFIRVQERFSQMLTPKVRATLEYMNLCIAITLFCILVVMHANYVQQPGCSSELSG  60

Query  465  VDISDVQIIQIKITSAGLWFQNETEYNEVDVSSG  566
            V+ ++ Q+IQIKIT+AGLW QNE+E N  DV  G
Sbjct  61   VETTEAQLIQIKITTAGLWSQNESELNIQDVPGG  94



>ref|XP_008456073.1| PREDICTED: uncharacterized protein LOC103496115 [Cucumis melo]
Length=668

 Score =   152 bits (385),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 71/94 (76%), Positives = 82/94 (87%), Gaps = 0/94 (0%)
 Frame = +3

Query  285  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  464
            MDPEQTFIRVQERFSQML+P++RATLEY  L +A+TLFCILVVMHANYVQQPGCSSELS 
Sbjct  1    MDPEQTFIRVQERFSQMLTPKVRATLEYMNLCIAITLFCILVVMHANYVQQPGCSSELSG  60

Query  465  VDISDVQIIQIKITSAGLWFQNETEYNEVDVSSG  566
            V+ ++ Q+IQIKIT+AGLW QNE+E N  DV  G
Sbjct  61   VETTEAQLIQIKITTAGLWSQNESELNIQDVPGG  94



>ref|XP_007227344.1| hypothetical protein PRUPE_ppa002726mg [Prunus persica]
 gb|EMJ28543.1| hypothetical protein PRUPE_ppa002726mg [Prunus persica]
Length=639

 Score =   152 bits (383),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 80/89 (90%), Gaps = 0/89 (0%)
 Frame = +3

Query  285  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  464
            MDPEQTFIRVQERFSQ+L+P++RA LEY  LF+A+TLFCILVVMHANYVQQPGCSSELS 
Sbjct  1    MDPEQTFIRVQERFSQILTPKVRAALEYIYLFIAITLFCILVVMHANYVQQPGCSSELSG  60

Query  465  VDISDVQIIQIKITSAGLWFQNETEYNEV  551
            V+ ++ QIIQIKITSAGLW QNE+E+  V
Sbjct  61   VETTEAQIIQIKITSAGLWSQNESEFTNV  89



>ref|XP_008347906.1| PREDICTED: uncharacterized protein LOC103411037 [Malus domestica]
Length=267

 Score =   145 bits (366),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 67/89 (75%), Positives = 78/89 (88%), Gaps = 0/89 (0%)
 Frame = +3

Query  285  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  464
            MD EQTFIRVQERFSQ+L+P++RA LEY  LF+A+TLF ILVVMHANYVQQPGCSSELS 
Sbjct  1    MDAEQTFIRVQERFSQILTPKVRAALEYMYLFIAITLFFILVVMHANYVQQPGCSSELSG  60

Query  465  VDISDVQIIQIKITSAGLWFQNETEYNEV  551
            V+ ++ QIIQIKITSAGLW QNE+E+  V
Sbjct  61   VETTEAQIIQIKITSAGLWSQNESEFTNV  89



>ref|XP_003531591.1| PREDICTED: uncharacterized protein LOC100810658 isoform X1 [Glycine 
max]
Length=616

 Score =   150 bits (379),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 68/90 (76%), Positives = 78/90 (87%), Gaps = 0/90 (0%)
 Frame = +3

Query  285  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  464
            MDPEQTFIRVQERFSQML+P++R  LEY  LF+A+TLFCILVVMHANYVQQPGCSSELS 
Sbjct  1    MDPEQTFIRVQERFSQMLTPKVRVALEYLYLFIAITLFCILVVMHANYVQQPGCSSELSG  60

Query  465  VDISDVQIIQIKITSAGLWFQNETEYNEVD  554
            V  S+ Q+IQIKITSAGLW  N++E N +D
Sbjct  61   VVTSEAQLIQIKITSAGLWSHNDSESNRID  90



>ref|XP_011083231.1| PREDICTED: uncharacterized protein LOC105165794 [Sesamum indicum]
Length=671

 Score =   150 bits (379),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 70/91 (77%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = +3

Query  285  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  464
            MDPEQTFIRVQERFS+ML+PRIRA LEYF LF+A+TLFCILVVMHANYVQQPGCSSE S 
Sbjct  1    MDPEQTFIRVQERFSEMLTPRIRAKLEYFFLFLAITLFCILVVMHANYVQQPGCSSEFSS  60

Query  465  VDISDVQIIQIKITSAGLWFQNETEYNEVDV  557
            V  SD Q+IQI ITSAGLW  NE   + +DV
Sbjct  61   VQTSDAQLIQITITSAGLWSHNEAVNDVIDV  91



>ref|XP_006585484.1| PREDICTED: uncharacterized protein LOC100810658 isoform X2 [Glycine 
max]
 gb|KHN11233.1| Membralin [Glycine soja]
Length=677

 Score =   150 bits (379),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 68/90 (76%), Positives = 78/90 (87%), Gaps = 0/90 (0%)
 Frame = +3

Query  285  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  464
            MDPEQTFIRVQERFSQML+P++R  LEY  LF+A+TLFCILVVMHANYVQQPGCSSELS 
Sbjct  1    MDPEQTFIRVQERFSQMLTPKVRVALEYLYLFIAITLFCILVVMHANYVQQPGCSSELSG  60

Query  465  VDISDVQIIQIKITSAGLWFQNETEYNEVD  554
            V  S+ Q+IQIKITSAGLW  N++E N +D
Sbjct  61   VVTSEAQLIQIKITSAGLWSHNDSESNRID  90



>ref|XP_007148516.1| hypothetical protein PHAVU_006G215300g [Phaseolus vulgaris]
 gb|ESW20510.1| hypothetical protein PHAVU_006G215300g [Phaseolus vulgaris]
Length=676

 Score =   150 bits (378),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 68/90 (76%), Positives = 78/90 (87%), Gaps = 0/90 (0%)
 Frame = +3

Query  285  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  464
            MDPEQTFIRVQERFSQML+P++R  LEY  LF+A+TLFCILVVMHANYVQQPGCSSELS 
Sbjct  1    MDPEQTFIRVQERFSQMLTPKVRVALEYLYLFIAITLFCILVVMHANYVQQPGCSSELSG  60

Query  465  VDISDVQIIQIKITSAGLWFQNETEYNEVD  554
            V  S+ Q+IQIKITSAGLW  N++E N +D
Sbjct  61   VVTSEAQLIQIKITSAGLWSHNDSESNRID  90



>ref|XP_008224597.1| PREDICTED: uncharacterized protein LOC103324328 [Prunus mume]
Length=639

 Score =   149 bits (377),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 79/89 (89%), Gaps = 0/89 (0%)
 Frame = +3

Query  285  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  464
            MDPEQTFIRVQER SQ+L+P++RA LEY  LF+A+TLFCILVVMHANYVQQPGCSSELS 
Sbjct  1    MDPEQTFIRVQERLSQILTPKVRAALEYIYLFIAITLFCILVVMHANYVQQPGCSSELSG  60

Query  465  VDISDVQIIQIKITSAGLWFQNETEYNEV  551
            V+ ++ QIIQIKITSAGLW QNE+E+  V
Sbjct  61   VETTEAQIIQIKITSAGLWSQNESEFTNV  89



>ref|XP_003547536.1| PREDICTED: uncharacterized protein LOC100812436 [Glycine max]
Length=680

 Score =   150 bits (378),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 68/90 (76%), Positives = 78/90 (87%), Gaps = 0/90 (0%)
 Frame = +3

Query  285  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  464
            MDPEQTFIRVQERFSQML+P++R  LEY  LF+A+TLFCILVVMHANYVQQPGCSSELS 
Sbjct  1    MDPEQTFIRVQERFSQMLTPKVRVALEYLYLFIAITLFCILVVMHANYVQQPGCSSELSG  60

Query  465  VDISDVQIIQIKITSAGLWFQNETEYNEVD  554
            V  S+ Q+IQIKITSAGLW  N++E N +D
Sbjct  61   VVTSEAQLIQIKITSAGLWSHNDSESNRID  90



>gb|KHN33454.1| Membralin [Glycine soja]
Length=678

 Score =   150 bits (378),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 68/90 (76%), Positives = 78/90 (87%), Gaps = 0/90 (0%)
 Frame = +3

Query  285  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  464
            MDPEQTFIRVQERFSQML+P++R  LEY  LF+A+TLFCILVVMHANYVQQPGCSSELS 
Sbjct  1    MDPEQTFIRVQERFSQMLTPKVRVALEYLYLFIAITLFCILVVMHANYVQQPGCSSELSG  60

Query  465  VDISDVQIIQIKITSAGLWFQNETEYNEVD  554
            V  S+ Q+IQIKITSAGLW  N++E N +D
Sbjct  61   VVTSEAQLIQIKITSAGLWSHNDSESNRID  90



>ref|XP_011016110.1| PREDICTED: uncharacterized protein LOC105119643 [Populus euphratica]
Length=341

 Score =   145 bits (366),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = +3

Query  285  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  464
            MD EQTFIRVQERFSQML+P++RA  EY  LF+A+TLFCILVVMHANYVQQPGCSS+LS 
Sbjct  1    MDTEQTFIRVQERFSQMLTPKVRAAFEYMYLFIAITLFCILVVMHANYVQQPGCSSQLSG  60

Query  465  VDISDVQIIQIKITSAGLWFQNETEYN  545
            V+  + Q+IQIKITSAGLW QNE+E N
Sbjct  61   VETREAQLIQIKITSAGLWSQNESESN  87



>gb|EYU31215.1| hypothetical protein MIMGU_mgv1a002444mg [Erythranthe guttata]
Length=674

 Score =   148 bits (373),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 69/91 (76%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = +3

Query  285  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  464
            MDPEQTFIRVQERFS+ML+ +IRA LEYF LF+A+TLFCILVVMHANYVQQPGCSSE S 
Sbjct  1    MDPEQTFIRVQERFSEMLTQKIRAKLEYFFLFLAITLFCILVVMHANYVQQPGCSSEFSS  60

Query  465  VDISDVQIIQIKITSAGLWFQNETEYNEVDV  557
              +SD Q+IQIKITSAGLW QNE+  + VD 
Sbjct  61   GQMSDAQLIQIKITSAGLWSQNESVVDAVDA  91



>gb|KDO53495.1| hypothetical protein CISIN_1g005878mg [Citrus sinensis]
Length=447

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +3

Query  285  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  464
            MDPE TFIRVQERFS++L+PR+RA LEY  LF+A+TLFC+LVVMHANYVQQPGCSSE + 
Sbjct  1    MDPEHTFIRVQERFSRVLTPRVRAYLEYIYLFIAITLFCVLVVMHANYVQQPGCSSEFAG  60

Query  465  VDISDVQIIQIKITSAGLWFQNETEYNEVDVSS  563
            + +++ Q+IQIKI+SAGLW QN+++ N VDV+S
Sbjct  61   IRMTEAQLIQIKISSAGLWSQNDSDSNVVDVTS  93



>ref|XP_006431848.1| hypothetical protein CICLE_v10000505mg [Citrus clementina]
 ref|XP_006431849.1| hypothetical protein CICLE_v10000505mg [Citrus clementina]
 ref|XP_006431852.1| hypothetical protein CICLE_v10000505mg [Citrus clementina]
 gb|ESR45088.1| hypothetical protein CICLE_v10000505mg [Citrus clementina]
 gb|ESR45089.1| hypothetical protein CICLE_v10000505mg [Citrus clementina]
 gb|ESR45092.1| hypothetical protein CICLE_v10000505mg [Citrus clementina]
Length=472

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +3

Query  285  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  464
            MDPE TFIRVQERFS++L+PR+RA LEY  LF+A+TLFC+LVVMHANYVQQPGCSSE + 
Sbjct  1    MDPEHTFIRVQERFSRVLTPRVRAYLEYIYLFIAITLFCVLVVMHANYVQQPGCSSEFAG  60

Query  465  VDISDVQIIQIKITSAGLWFQNETEYNEVDVSS  563
            + +++ Q+IQIKI+SAGLW QN+++ N VDV+S
Sbjct  61   IRMTEAQLIQIKISSAGLWSQNDSDSNVVDVTS  93



>gb|KDO53494.1| hypothetical protein CISIN_1g005878mg [Citrus sinensis]
Length=454

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +3

Query  285  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  464
            MDPE TFIRVQERFS++L+PR+RA LEY  LF+A+TLFC+LVVMHANYVQQPGCSSE + 
Sbjct  1    MDPEHTFIRVQERFSRVLTPRVRAYLEYIYLFIAITLFCVLVVMHANYVQQPGCSSEFAG  60

Query  465  VDISDVQIIQIKITSAGLWFQNETEYNEVDVSS  563
            + +++ Q+IQIKI+SAGLW QN+++ N VDV+S
Sbjct  61   IRMTEAQLIQIKISSAGLWSQNDSDSNVVDVTS  93



>ref|XP_004485491.1| PREDICTED: uncharacterized protein LOC101514383 [Cicer arietinum]
Length=675

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/92 (74%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +3

Query  285  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  464
            MDPEQTFIRVQERFSQML+P++R TLEY  LF+A+T FCILVVMHANYVQQPGCS ELS 
Sbjct  1    MDPEQTFIRVQERFSQMLTPKVRVTLEYLYLFMAITFFCILVVMHANYVQQPGCSGELSG  60

Query  465  VDISDVQIIQIKITSAGLWFQNETEYNEVDVS  560
            V  S+ Q+IQIKITSAGLW  N+ E N +D S
Sbjct  61   VLTSEAQLIQIKITSAGLWSHNDPESNIIDSS  92



>gb|KDO53491.1| hypothetical protein CISIN_1g005878mg [Citrus sinensis]
Length=647

 Score =   145 bits (367),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +3

Query  285  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  464
            MDPE TFIRVQERFS++L+PR+RA LEY  LF+A+TLFC+LVVMHANYVQQPGCSSE + 
Sbjct  1    MDPEHTFIRVQERFSRVLTPRVRAYLEYIYLFIAITLFCVLVVMHANYVQQPGCSSEFAG  60

Query  465  VDISDVQIIQIKITSAGLWFQNETEYNEVDVSS  563
            + +++ Q+IQIKI+SAGLW QN+++ N VDV+S
Sbjct  61   IRMTEAQLIQIKISSAGLWSQNDSDSNVVDVTS  93



>gb|KDO53489.1| hypothetical protein CISIN_1g005878mg [Citrus sinensis]
Length=672

 Score =   146 bits (368),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +3

Query  285  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  464
            MDPE TFIRVQERFS++L+PR+RA LEY  LF+A+TLFC+LVVMHANYVQQPGCSSE + 
Sbjct  1    MDPEHTFIRVQERFSRVLTPRVRAYLEYIYLFIAITLFCVLVVMHANYVQQPGCSSEFAG  60

Query  465  VDISDVQIIQIKITSAGLWFQNETEYNEVDVSS  563
            + +++ Q+IQIKI+SAGLW QN+++ N VDV+S
Sbjct  61   IRMTEAQLIQIKISSAGLWSQNDSDSNVVDVTS  93



>ref|XP_006431850.1| hypothetical protein CICLE_v10000505mg [Citrus clementina]
 gb|ESR45090.1| hypothetical protein CICLE_v10000505mg [Citrus clementina]
Length=672

 Score =   145 bits (367),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +3

Query  285  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  464
            MDPE TFIRVQERFS++L+PR+RA LEY  LF+A+TLFC+LVVMHANYVQQPGCSSE + 
Sbjct  1    MDPEHTFIRVQERFSRVLTPRVRAYLEYIYLFIAITLFCVLVVMHANYVQQPGCSSEFAG  60

Query  465  VDISDVQIIQIKITSAGLWFQNETEYNEVDVSS  563
            + +++ Q+IQIKI+SAGLW QN+++ N VDV+S
Sbjct  61   IRMTEAQLIQIKISSAGLWSQNDSDSNVVDVTS  93



>gb|KDO53490.1| hypothetical protein CISIN_1g005878mg [Citrus sinensis]
Length=649

 Score =   145 bits (367),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +3

Query  285  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  464
            MDPE TFIRVQERFS++L+PR+RA LEY  LF+A+TLFC+LVVMHANYVQQPGCSSE + 
Sbjct  1    MDPEHTFIRVQERFSRVLTPRVRAYLEYIYLFIAITLFCVLVVMHANYVQQPGCSSEFAG  60

Query  465  VDISDVQIIQIKITSAGLWFQNETEYNEVDVSS  563
            + +++ Q+IQIKI+SAGLW QN+++ N VDV+S
Sbjct  61   IRMTEAQLIQIKISSAGLWSQNDSDSNVVDVTS  93



>ref|XP_008378986.1| PREDICTED: uncharacterized protein LOC103442021 [Malus domestica]
Length=372

 Score =   143 bits (360),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 77/89 (87%), Gaps = 0/89 (0%)
 Frame = +3

Query  285  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  464
            MD EQTFIRVQERFSQ+L+P++RA LEY  LF+A+TLF ILVVMHANYVQQPGCSSELS 
Sbjct  1    MDAEQTFIRVQERFSQILTPKVRAALEYMYLFIAITLFFILVVMHANYVQQPGCSSELSG  60

Query  465  VDISDVQIIQIKITSAGLWFQNETEYNEV  551
            V+ ++ QIIQIKITSAGLW QN +E+  V
Sbjct  61   VETTEAQIIQIKITSAGLWSQNXSEFTNV  89



>ref|XP_006431851.1| hypothetical protein CICLE_v10000505mg [Citrus clementina]
 gb|ESR45091.1| hypothetical protein CICLE_v10000505mg [Citrus clementina]
Length=674

 Score =   145 bits (367),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +3

Query  285  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  464
            MDPE TFIRVQERFS++L+PR+RA LEY  LF+A+TLFC+LVVMHANYVQQPGCSSE + 
Sbjct  1    MDPEHTFIRVQERFSRVLTPRVRAYLEYIYLFIAITLFCVLVVMHANYVQQPGCSSEFAG  60

Query  465  VDISDVQIIQIKITSAGLWFQNETEYNEVDVSS  563
            + +++ Q+IQIKI+SAGLW QN+++ N VDV+S
Sbjct  61   IRMTEAQLIQIKISSAGLWSQNDSDSNVVDVTS  93



>ref|XP_006369359.1| hypothetical protein POPTR_0001s21920g [Populus trichocarpa]
 gb|ERP65928.1| hypothetical protein POPTR_0001s21920g [Populus trichocarpa]
Length=496

 Score =   144 bits (363),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = +3

Query  285  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  464
            MD EQTFIRVQERFSQML+P++RA  EY  LF+A+TLFCILVVMHANYVQQPGCSS+LS 
Sbjct  1    MDTEQTFIRVQERFSQMLTPKVRAAFEYMYLFIAITLFCILVVMHANYVQQPGCSSQLSG  60

Query  465  VDISDVQIIQIKITSAGLWFQNETEYN  545
            V+  + Q+IQIKITSAGLW QNE+E N
Sbjct  61   VETREAQLIQIKITSAGLWSQNESESN  87



>gb|KDP38854.1| hypothetical protein JCGZ_05011 [Jatropha curcas]
Length=673

 Score =   145 bits (366),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 70/91 (77%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = +3

Query  285  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  464
            MDPEQTFIRVQERFSQML+P++RA LEY  LFVAVTLFCILVVMHANYVQQPGCSSE S 
Sbjct  1    MDPEQTFIRVQERFSQMLTPKVRAALEYMYLFVAVTLFCILVVMHANYVQQPGCSSEFSG  60

Query  465  VDISDVQIIQIKITSAGLWFQNETEYNEVDV  557
            V+    Q+IQIKITSAGLW  N +E   VDV
Sbjct  61   VETMGAQLIQIKITSAGLWSHNGSESIIVDV  91



>ref|XP_002529547.1| Membralin, putative [Ricinus communis]
 gb|EEF32850.1| Membralin, putative [Ricinus communis]
Length=672

 Score =   144 bits (364),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/85 (78%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = +3

Query  285  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  464
            MDPEQTFIRVQERFSQML+P++RA LEY  LF+A+TLFCILVVMHANYVQQPGCSSELS 
Sbjct  1    MDPEQTFIRVQERFSQMLTPKVRAALEYVYLFIAITLFCILVVMHANYVQQPGCSSELSG  60

Query  465  VDISDVQIIQIKITSAGLWFQNETE  539
            V+  + Q+IQIKITSAGLW  +E E
Sbjct  61   VETKEAQLIQIKITSAGLWSNSEVE  85



>ref|XP_002298169.2| Nuf2 family protein [Populus trichocarpa]
 gb|EEE82974.2| Nuf2 family protein [Populus trichocarpa]
Length=670

 Score =   144 bits (364),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = +3

Query  285  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  464
            MD EQTFIRVQERFSQML+P++RA  EY  LF+A+TLFCILVVMHANYVQQPGCSS+LS 
Sbjct  1    MDTEQTFIRVQERFSQMLTPKVRAAFEYMYLFIAITLFCILVVMHANYVQQPGCSSQLSG  60

Query  465  VDISDVQIIQIKITSAGLWFQNETEYN  545
            V+  + Q+IQIKITSAGLW QNE+E N
Sbjct  61   VETREAQLIQIKITSAGLWSQNESESN  87



>ref|XP_009355233.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103946303 
[Pyrus x bretschneideri]
Length=640

 Score =   144 bits (363),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/89 (75%), Positives = 78/89 (88%), Gaps = 0/89 (0%)
 Frame = +3

Query  285  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  464
            MD EQTFIRVQERFSQ+L+P++RA LEY  LF+A+TLF ILVVMHANYVQQPGCSSELS 
Sbjct  1    MDAEQTFIRVQERFSQILTPKVRAALEYIYLFIAITLFFILVVMHANYVQQPGCSSELSG  60

Query  465  VDISDVQIIQIKITSAGLWFQNETEYNEV  551
            V+ ++ QIIQIKITSAGLW QNE+E+  V
Sbjct  61   VETTEAQIIQIKITSAGLWSQNESEFTNV  89



>ref|XP_011005215.1| PREDICTED: uncharacterized protein LOC105111532 [Populus euphratica]
Length=690

 Score =   144 bits (363),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = +3

Query  285  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  464
            MD EQTFIRVQERFSQML+P++RA  EY  LF+A+TLFCILVVMHANYVQQPGCSS+LS 
Sbjct  1    MDTEQTFIRVQERFSQMLTPKVRAAFEYMYLFIAITLFCILVVMHANYVQQPGCSSQLSG  60

Query  465  VDISDVQIIQIKITSAGLWFQNETEYN  545
            V+  + Q+IQIKITSAGLW QNE+E N
Sbjct  61   VETREAQLIQIKITSAGLWSQNESESN  87



>gb|KHG02113.1| Membralin [Gossypium arboreum]
Length=628

 Score =   144 bits (362),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/90 (72%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = +3

Query  285  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  464
            MDPEQTF+RVQ RFSQ+L+PR+R  LEY  LF+A+T FCILV MHANYVQQPGCSSELS 
Sbjct  1    MDPEQTFMRVQGRFSQILTPRVRVALEYIYLFIAITFFCILVTMHANYVQQPGCSSELSG  60

Query  465  VDISDVQIIQIKITSAGLWFQNETEYNEVD  554
            +D ++VQ+IQIKITSAGLW +NE+E   VD
Sbjct  61   IDSNEVQLIQIKITSAGLWSRNESETVTVD  90



>gb|KHG02112.1| Membralin [Gossypium arboreum]
Length=640

 Score =   144 bits (362),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/90 (72%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = +3

Query  285  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  464
            MDPEQTF+RVQ RFSQ+L+PR+R  LEY  LF+A+T FCILV MHANYVQQPGCSSELS 
Sbjct  1    MDPEQTFMRVQGRFSQILTPRVRVALEYIYLFIAITFFCILVTMHANYVQQPGCSSELSG  60

Query  465  VDISDVQIIQIKITSAGLWFQNETEYNEVD  554
            +D ++VQ+IQIKITSAGLW +NE+E   VD
Sbjct  61   IDSNEVQLIQIKITSAGLWSRNESETVTVD  90



>ref|XP_006471106.1| PREDICTED: uncharacterized protein LOC102618114 isoform X2 [Citrus 
sinensis]
Length=672

 Score =   144 bits (362),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +3

Query  285  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  464
            MDPE TFIRVQERFS++L+PR+RA LEY  LF+A+TLFC+LVVMHANYVQQPGCSSE + 
Sbjct  1    MDPEHTFIRVQERFSRVLTPRVRAYLEYIYLFIAITLFCVLVVMHANYVQQPGCSSEFAG  60

Query  465  VDISDVQIIQIKITSAGLWFQNETEYNEVDVSS  563
            + +++ Q+IQIKI+SAGLW Q++++ N VDV+S
Sbjct  61   IRMTEAQLIQIKISSAGLWSQHDSDSNVVDVTS  93



>ref|XP_010101164.1| hypothetical protein L484_016729 [Morus notabilis]
 gb|EXB87382.1| hypothetical protein L484_016729 [Morus notabilis]
Length=570

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/91 (71%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = +3

Query  285  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  464
            MDPEQTFIRVQER SQML+P++RA LEY  LF+A+TLFCILVVMHANYVQQPGCSSELS 
Sbjct  1    MDPEQTFIRVQERVSQMLTPKVRAALEYLCLFIAITLFCILVVMHANYVQQPGCSSELSG  60

Query  465  VDISDVQIIQIKITSAGLWFQNETEYNEVDV  557
            V  ++ Q+IQIKITSAGLW ++  E    D+
Sbjct  61   VRTTEAQLIQIKITSAGLWSRDAAEPTGTDI  91



>ref|XP_006471107.1| PREDICTED: uncharacterized protein LOC102618114 isoform X3 [Citrus 
sinensis]
Length=649

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +3

Query  285  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  464
            MDPE TFIRVQERFS++L+PR+RA LEY  LF+A+TLFC+LVVMHANYVQQPGCSSE + 
Sbjct  1    MDPEHTFIRVQERFSRVLTPRVRAYLEYIYLFIAITLFCVLVVMHANYVQQPGCSSEFAG  60

Query  465  VDISDVQIIQIKITSAGLWFQNETEYNEVDVSS  563
            + +++ Q+IQIKI+SAGLW Q++++ N VDV+S
Sbjct  61   IRMTEAQLIQIKISSAGLWSQHDSDSNVVDVTS  93



>ref|XP_006471105.1| PREDICTED: uncharacterized protein LOC102618114 isoform X1 [Citrus 
sinensis]
Length=674

 Score =   144 bits (362),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +3

Query  285  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  464
            MDPE TFIRVQERFS++L+PR+RA LEY  LF+A+TLFC+LVVMHANYVQQPGCSSE + 
Sbjct  1    MDPEHTFIRVQERFSRVLTPRVRAYLEYIYLFIAITLFCVLVVMHANYVQQPGCSSEFAG  60

Query  465  VDISDVQIIQIKITSAGLWFQNETEYNEVDVSS  563
            + +++ Q+IQIKI+SAGLW Q++++ N VDV+S
Sbjct  61   IRMTEAQLIQIKISSAGLWSQHDSDSNVVDVTS  93



>gb|KHG12184.1| Membralin [Gossypium arboreum]
Length=673

 Score =   142 bits (359),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = +3

Query  285  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  464
            MDPEQTFIRVQERFSQ+L+PR+R  LEY  LF+A+T FCILVVMHANYVQQPGCSSELS 
Sbjct  1    MDPEQTFIRVQERFSQILTPRVRVALEYIYLFIAITSFCILVVMHANYVQQPGCSSELSG  60

Query  465  VDISDVQIIQIKITSAGLWFQNETE  539
            V+ ++VQ++QIKITSAGLW Q+E+E
Sbjct  61   VESNEVQLVQIKITSAGLWSQDESE  85



>ref|XP_006392070.1| hypothetical protein EUTSA_v10023347mg [Eutrema salsugineum]
 gb|ESQ29356.1| hypothetical protein EUTSA_v10023347mg [Eutrema salsugineum]
Length=629

 Score =   142 bits (358),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 80/91 (88%), Gaps = 1/91 (1%)
 Frame = +3

Query  285  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  464
            MDPEQTFIRVQERFSQ+L+PRIRA LEY  LFVA+TLFCILVVMHANYVQQPGCSSEL+ 
Sbjct  1    MDPEQTFIRVQERFSQILTPRIRAFLEYTYLFVAITLFCILVVMHANYVQQPGCSSELTG  60

Query  465  VDISDVQIIQIKITSAGLWFQNETEYNEVDV  557
            V++++ +++QIKITSAGLW +N+ E    DV
Sbjct  61   VELAEAELLQIKITSAGLWSRND-ESTAADV  90



>ref|XP_010030118.1| PREDICTED: uncharacterized protein LOC104419970 [Eucalyptus grandis]
 gb|KCW57085.1| hypothetical protein EUGRSUZ_I02737 [Eucalyptus grandis]
Length=666

 Score =   142 bits (358),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 65/91 (71%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  285  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  464
            MDPEQTFIRVQERFSQ+L+PR+RA LEY  LF+AVTLFCILVVMHANYVQQPGCSSE + 
Sbjct  1    MDPEQTFIRVQERFSQILTPRLRAALEYVYLFIAVTLFCILVVMHANYVQQPGCSSEFTG  60

Query  465  VDISDVQIIQIKITSAGLWFQNETEYNEVDV  557
            V  +D Q+  IKITS GLW QNE   +  D+
Sbjct  61   VKTADAQLFHIKITSVGLWSQNEIALDRRDL  91



>ref|XP_004299931.1| PREDICTED: uncharacterized protein LOC101308680 [Fragaria vesca 
subsp. vesca]
Length=631

 Score =   142 bits (357),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = +3

Query  285  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  464
            MDPEQTFIRVQERFSQ+L+P++RA LEY  LF+A+TLF ILVVMHANYVQQPGCSSEL  
Sbjct  1    MDPEQTFIRVQERFSQILTPKVRAGLEYIYLFIAITLFSILVVMHANYVQQPGCSSELPG  60

Query  465  VDISDVQIIQIKITSAGLWFQNETEY  542
            V+ +D QII +KI+SAGLW QNE+++
Sbjct  61   VETADAQIIHVKISSAGLWSQNESDF  86



>gb|KJB77702.1| hypothetical protein B456_012G151900 [Gossypium raimondii]
Length=673

 Score =   142 bits (358),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = +3

Query  285  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  464
            MDPEQTFIRVQERFSQ+L+PR+R  LEY  LF+A+T FCILVVMHANYVQQPGCSSELS 
Sbjct  1    MDPEQTFIRVQERFSQILTPRVRVALEYIYLFIAITSFCILVVMHANYVQQPGCSSELSG  60

Query  465  VDISDVQIIQIKITSAGLWFQNETE  539
            V+ ++VQ++QIKITSAGLW Q+E+E
Sbjct  61   VESNEVQLVQIKITSAGLWSQSESE  85



>gb|KJB12208.1| hypothetical protein B456_002G006000 [Gossypium raimondii]
Length=649

 Score =   142 bits (357),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = +3

Query  285  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  464
            MDPEQTF+RVQ RFSQ+L+PR+R  LEY  LF+A+T FCILV MHANYVQQPGCSSELS 
Sbjct  1    MDPEQTFMRVQGRFSQILTPRVRVALEYIYLFIAITSFCILVTMHANYVQQPGCSSELSG  60

Query  465  VDISDVQIIQIKITSAGLWFQNETEYNEVD  554
            +D ++VQ+IQIKITSAGLW +NE+E   +D
Sbjct  61   IDSNEVQLIQIKITSAGLWSRNESETVTID  90



>gb|KJB12209.1| hypothetical protein B456_002G006000 [Gossypium raimondii]
Length=683

 Score =   142 bits (358),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = +3

Query  285  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  464
            MDPEQTF+RVQ RFSQ+L+PR+R  LEY  LF+A+T FCILV MHANYVQQPGCSSELS 
Sbjct  1    MDPEQTFMRVQGRFSQILTPRVRVALEYIYLFIAITSFCILVTMHANYVQQPGCSSELSG  60

Query  465  VDISDVQIIQIKITSAGLWFQNETEYNEVD  554
            +D ++VQ+IQIKITSAGLW +NE+E   +D
Sbjct  61   IDSNEVQLIQIKITSAGLWSRNESETVTID  90



>ref|XP_010674302.1| PREDICTED: uncharacterized protein LOC104890491 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=677

 Score =   142 bits (357),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = +3

Query  285  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  464
            MDPEQTFIRVQERFSQM++PR+RATLEYF LF A+TLF ILVVMHANYVQQPGCSSELS 
Sbjct  1    MDPEQTFIRVQERFSQMVTPRVRATLEYFYLFTAITLFAILVVMHANYVQQPGCSSELSG  60

Query  465  VDISDVQIIQIKITSAGLWFQNETEYNEVDVSS  563
            V  S+ Q+I IKIT  GL  QN +E N  D+SS
Sbjct  61   VQTSNAQLIYIKITGIGLLRQNASEPNFEDISS  93



>gb|KJB77701.1| hypothetical protein B456_012G151900 [Gossypium raimondii]
Length=700

 Score =   142 bits (358),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = +3

Query  285  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  464
            MDPEQTFIRVQERFSQ+L+PR+R  LEY  LF+A+T FCILVVMHANYVQQPGCSSELS 
Sbjct  1    MDPEQTFIRVQERFSQILTPRVRVALEYIYLFIAITSFCILVVMHANYVQQPGCSSELSG  60

Query  465  VDISDVQIIQIKITSAGLWFQNETE  539
            V+ ++VQ++QIKITSAGLW Q+E+E
Sbjct  61   VESNEVQLVQIKITSAGLWSQSESE  85



>gb|KJB12206.1| hypothetical protein B456_002G006000 [Gossypium raimondii]
Length=676

 Score =   142 bits (357),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = +3

Query  285  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  464
            MDPEQTF+RVQ RFSQ+L+PR+R  LEY  LF+A+T FCILV MHANYVQQPGCSSELS 
Sbjct  1    MDPEQTFMRVQGRFSQILTPRVRVALEYIYLFIAITSFCILVTMHANYVQQPGCSSELSG  60

Query  465  VDISDVQIIQIKITSAGLWFQNETEYNEVD  554
            +D ++VQ+IQIKITSAGLW +NE+E   +D
Sbjct  61   IDSNEVQLIQIKITSAGLWSRNESETVTID  90



>ref|XP_010674303.1| PREDICTED: uncharacterized protein LOC104890491 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=674

 Score =   142 bits (357),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = +3

Query  285  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  464
            MDPEQTFIRVQERFSQM++PR+RATLEYF LF A+TLF ILVVMHANYVQQPGCSSELS 
Sbjct  1    MDPEQTFIRVQERFSQMVTPRVRATLEYFYLFTAITLFAILVVMHANYVQQPGCSSELSG  60

Query  465  VDISDVQIIQIKITSAGLWFQNETEYNEVDVSS  563
            V  S+ Q+I IKIT  GL  QN +E N  D+SS
Sbjct  61   VQTSNAQLIYIKITGIGLLRQNASEPNFEDISS  93



>ref|XP_007042243.1| S3 self-incompatibility locus-linked pollen 3.15 protein isoform 
2 [Theobroma cacao]
 gb|EOX98074.1| S3 self-incompatibility locus-linked pollen 3.15 protein isoform 
2 [Theobroma cacao]
Length=677

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/90 (72%), Positives = 78/90 (87%), Gaps = 0/90 (0%)
 Frame = +3

Query  285  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  464
            MDPEQTFIRVQERFSQ+L+PR+R  LEY  L +A+T FC+LVVMHANYVQQPGCSSELS 
Sbjct  1    MDPEQTFIRVQERFSQILTPRVRVALEYIYLVIAITSFCMLVVMHANYVQQPGCSSELSG  60

Query  465  VDISDVQIIQIKITSAGLWFQNETEYNEVD  554
            V+  +VQ+IQIKITSAGLW +NE+E+  V+
Sbjct  61   VESKEVQLIQIKITSAGLWSRNESEHAVVN  90



>gb|KFK40737.1| hypothetical protein AALP_AA2G034600 [Arabis alpina]
Length=621

 Score =   140 bits (354),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/91 (73%), Positives = 79/91 (87%), Gaps = 1/91 (1%)
 Frame = +3

Query  285  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  464
            MDPEQTFIRVQERFSQ+L+PRIR  LEY  LFVA+TLFCILVVMHANYVQQPGCSSEL+ 
Sbjct  1    MDPEQTFIRVQERFSQILTPRIRGFLEYTYLFVAITLFCILVVMHANYVQQPGCSSELTG  60

Query  465  VDISDVQIIQIKITSAGLWFQNETEYNEVDV  557
            V++++ +++QIKITSAGLW +N+ E    DV
Sbjct  61   VELAEAELLQIKITSAGLWSRND-ESTAADV  90



>ref|XP_007042242.1| S3 self-incompatibility locus-linked pollen 3.15 protein isoform 
1 [Theobroma cacao]
 gb|EOX98073.1| S3 self-incompatibility locus-linked pollen 3.15 protein isoform 
1 [Theobroma cacao]
Length=674

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/90 (72%), Positives = 78/90 (87%), Gaps = 0/90 (0%)
 Frame = +3

Query  285  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  464
            MDPEQTFIRVQERFSQ+L+PR+R  LEY  L +A+T FC+LVVMHANYVQQPGCSSELS 
Sbjct  1    MDPEQTFIRVQERFSQILTPRVRVALEYIYLVIAITSFCMLVVMHANYVQQPGCSSELSG  60

Query  465  VDISDVQIIQIKITSAGLWFQNETEYNEVD  554
            V+  +VQ+IQIKITSAGLW +NE+E+  V+
Sbjct  61   VESKEVQLIQIKITSAGLWSRNESEHAVVN  90



>ref|XP_010274109.1| PREDICTED: uncharacterized protein LOC104609475 [Nelumbo nucifera]
Length=672

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/93 (71%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = +3

Query  285  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  464
            MDPEQTFIRVQERFSQML+PRIRA LEY  L VA+ LFC+LVVMHANYVQQPGCSSELS 
Sbjct  1    MDPEQTFIRVQERFSQMLTPRIRAALEYVYLVVAIALFCLLVVMHANYVQQPGCSSELSG  60

Query  465  VDISDVQIIQIKITSAGLWFQNETEYNEVDVSS  563
            ++ S+ Q++QIKITS GLW    +E N +D S+
Sbjct  61   IESSEAQLVQIKITSIGLWSGKASESNAMDNSN  93



>ref|XP_010430092.1| PREDICTED: membralin-like [Camelina sativa]
Length=626

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 76/83 (92%), Gaps = 0/83 (0%)
 Frame = +3

Query  285  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  464
            MDPEQTFIRVQERFSQ+L+PRIR  LEY  LFVA+TLFCILVVMHANYVQQPGCSSEL+ 
Sbjct  1    MDPEQTFIRVQERFSQILTPRIRGFLEYTYLFVAITLFCILVVMHANYVQQPGCSSELTG  60

Query  465  VDISDVQIIQIKITSAGLWFQNE  533
            V++++ +++QIKITSAGLW +N+
Sbjct  61   VELTEAELMQIKITSAGLWSRND  83



>ref|XP_002886570.1| hypothetical protein ARALYDRAFT_475227 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62829.1| hypothetical protein ARALYDRAFT_475227 [Arabidopsis lyrata subsp. 
lyrata]
Length=623

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/91 (73%), Positives = 79/91 (87%), Gaps = 1/91 (1%)
 Frame = +3

Query  285  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  464
            MDPEQTFIRVQERFSQ+L+PRIR  LEY  LFVA+TLFCILVVMHANYVQQPGCSSEL+ 
Sbjct  1    MDPEQTFIRVQERFSQILTPRIRGFLEYTYLFVAITLFCILVVMHANYVQQPGCSSELTG  60

Query  465  VDISDVQIIQIKITSAGLWFQNETEYNEVDV  557
            V++++ +++QIKITSAGLW +N+ E    DV
Sbjct  61   VELAEAELMQIKITSAGLWSRND-ESTAADV  90



>ref|NP_001077749.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAC43446.1| unknown protein [Arabidopsis thaliana]
 gb|AEE33764.1| uncharacterized protein AT1G60995 [Arabidopsis thaliana]
Length=623

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/91 (73%), Positives = 79/91 (87%), Gaps = 1/91 (1%)
 Frame = +3

Query  285  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  464
            MDPEQTFIRVQERFSQ+L+PRIR  LEY  LFVA+TLFCILVVMHANYVQQPGCSSEL+ 
Sbjct  1    MDPEQTFIRVQERFSQILTPRIRGFLEYTYLFVAITLFCILVVMHANYVQQPGCSSELTG  60

Query  465  VDISDVQIIQIKITSAGLWFQNETEYNEVDV  557
            V++++ +++QIKITSAGLW +N+ E    DV
Sbjct  61   VELAEAELMQIKITSAGLWSRND-ESTAADV  90



>ref|XP_010418050.1| PREDICTED: membralin-like [Camelina sativa]
Length=626

 Score =   140 bits (352),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 65/91 (71%), Positives = 79/91 (87%), Gaps = 1/91 (1%)
 Frame = +3

Query  285  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  464
            MDPEQTFIRVQERFSQ+L+PRIR  LEY  LFVA+TLFC+LVVMHANYVQQPGCSSEL+ 
Sbjct  1    MDPEQTFIRVQERFSQILTPRIRGFLEYTYLFVAITLFCVLVVMHANYVQQPGCSSELTG  60

Query  465  VDISDVQIIQIKITSAGLWFQNETEYNEVDV  557
            V++++ +++QIKITSAGLW +N+ E    DV
Sbjct  61   VELTEAELMQIKITSAGLWSRND-ESTAADV  90



>ref|XP_010533962.1| PREDICTED: membralin [Tarenaya hassleriana]
Length=601

 Score =   139 bits (349),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 66/93 (71%), Positives = 80/93 (86%), Gaps = 1/93 (1%)
 Frame = +3

Query  285  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  464
            MDPEQTFIRVQERFSQ+L+P+IRA LEY  LFVA+TLFCIL+VMHANYVQQPGCSSE+S 
Sbjct  1    MDPEQTFIRVQERFSQILTPKIRAFLEYTYLFVAITLFCILLVMHANYVQQPGCSSEVSG  60

Query  465  VDISDVQIIQIKITSAGLWFQNETEYNEVDVSS  563
            V++ +VQ+IQIKITS GLW +++ E    D+S 
Sbjct  61   VELVEVQLIQIKITSTGLWSRDD-ESTAADISG  92



>emb|CDY52486.1| BnaA01g36030D [Brassica napus]
Length=445

 Score =   137 bits (345),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 63/79 (80%), Positives = 73/79 (92%), Gaps = 0/79 (0%)
 Frame = +3

Query  285  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  464
            MDPEQTFIRVQERFSQ+L+PRIRA LEY  LFVA+TLF ILVVMHANYVQQPGCSSEL+ 
Sbjct  1    MDPEQTFIRVQERFSQILNPRIRALLEYTFLFVAITLFSILVVMHANYVQQPGCSSELTG  60

Query  465  VDISDVQIIQIKITSAGLW  521
            V++S+ +++QIKITSAGLW
Sbjct  61   VELSEAELLQIKITSAGLW  79



>ref|XP_010473303.1| PREDICTED: uncharacterized protein LOC104752769 [Camelina sativa]
Length=625

 Score =   139 bits (349),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = +3

Query  285  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  464
            MDPEQTFIRVQERFSQ+L+PRIR  LEY  LFVA+TLFCILVVMHANYVQQPGCSSEL+ 
Sbjct  1    MDPEQTFIRVQERFSQILTPRIRGFLEYTYLFVAITLFCILVVMHANYVQQPGCSSELTG  60

Query  465  VDISDVQIIQIKITSAGLWFQNE  533
             ++++ +++QIKITSAGLW +N+
Sbjct  61   FELTEAELMQIKITSAGLWSRND  83



>ref|XP_006301185.1| hypothetical protein CARUB_v10021584mg [Capsella rubella]
 gb|EOA34083.1| hypothetical protein CARUB_v10021584mg [Capsella rubella]
Length=623

 Score =   138 bits (348),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/91 (73%), Positives = 79/91 (87%), Gaps = 1/91 (1%)
 Frame = +3

Query  285  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  464
            MDPEQTFIRVQERFSQ+L+PRIR  LEY  L VA+TLFCILVVMHANYVQQPGCSSEL+ 
Sbjct  1    MDPEQTFIRVQERFSQILTPRIRGFLEYTYLCVAITLFCILVVMHANYVQQPGCSSELTG  60

Query  465  VDISDVQIIQIKITSAGLWFQNETEYNEVDV  557
            V++++ +++QIKITSAGLW +N+ E   VDV
Sbjct  61   VELTEAELMQIKITSAGLWSRND-ESTAVDV  90



>emb|CDY03777.1| BnaC01g28940D [Brassica napus]
Length=625

 Score =   138 bits (347),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/79 (80%), Positives = 73/79 (92%), Gaps = 0/79 (0%)
 Frame = +3

Query  285  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  464
            MDPEQTFIRVQERFSQ+L+PRIRA LEY  LFVA+TLF ILVVMHANYVQQPGCSSEL+ 
Sbjct  1    MDPEQTFIRVQERFSQILNPRIRALLEYTFLFVAITLFSILVVMHANYVQQPGCSSELTG  60

Query  465  VDISDVQIIQIKITSAGLW  521
            V++S+ +++QIKITSAGLW
Sbjct  61   VELSEAELLQIKITSAGLW  79



>ref|XP_009104283.1| PREDICTED: membralin [Brassica rapa]
Length=622

 Score =   138 bits (347),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/79 (80%), Positives = 73/79 (92%), Gaps = 0/79 (0%)
 Frame = +3

Query  285  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  464
            MDPEQTFIRVQERFSQ+L+PRIRA LEY  LFVA+TLF ILVVMHANYVQQPGCSSEL+ 
Sbjct  1    MDPEQTFIRVQERFSQILNPRIRALLEYTFLFVAITLFSILVVMHANYVQQPGCSSELTG  60

Query  465  VDISDVQIIQIKITSAGLW  521
            V++S+ +++QIKITSAGLW
Sbjct  61   VELSEAELLQIKITSAGLW  79



>emb|CDY61338.1| BnaCnng37740D [Brassica napus]
Length=615

 Score =   136 bits (343),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 64/91 (70%), Positives = 77/91 (85%), Gaps = 1/91 (1%)
 Frame = +3

Query  285  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  464
            MDPEQTFIRVQERFSQ+L PR+R  LEY  LFVA+TLFCILVVMHANYVQQPGCSSEL+ 
Sbjct  1    MDPEQTFIRVQERFSQILKPRVRDFLEYTFLFVAITLFCILVVMHANYVQQPGCSSELTG  60

Query  465  VDISDVQIIQIKITSAGLWFQNETEYNEVDV  557
            V++S+ +++ IKITSAGLW +++ E    DV
Sbjct  61   VELSEAELLHIKITSAGLWSRSD-ESTAADV  90



>gb|EPS72367.1| hypothetical protein M569_02391, partial [Genlisea aurea]
Length=568

 Score =   134 bits (338),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/84 (73%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +3

Query  285  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  464
            MDPE+TFIRVQERF+++LS RIR  LEYF LF+AVTLFCILVVMHANYV+QPGCS   S 
Sbjct  1    MDPEETFIRVQERFAEILSSRIRRKLEYFFLFLAVTLFCILVVMHANYVRQPGCSRAFSN  60

Query  465  VDISDVQIIQIKITSAGLWFQNET  536
            V +SD Q+IQI ITSAGLW  +E+
Sbjct  61   VQVSDAQLIQITITSAGLWVHDES  84



>gb|KDO53488.1| hypothetical protein CISIN_1g005878mg [Citrus sinensis]
Length=663

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/109 (59%), Positives = 82/109 (75%), Gaps = 16/109 (15%)
 Frame = +3

Query  285  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQ---------  437
            MDPE TFIRVQERFS++L+PR+RA LEY  LF+A+TLFC+LVVMHANYVQQ         
Sbjct  1    MDPEHTFIRVQERFSRVLTPRVRAYLEYIYLFIAITLFCVLVVMHANYVQQKSYAPFDLN  60

Query  438  -------PGCSSELSKVDISDVQIIQIKITSAGLWFQNETEYNEVDVSS  563
                   PGCSSE + + +++ Q+IQIKI+SAGLW QN+++ N VDV+S
Sbjct  61   LNILLIKPGCSSEFAGIRMTEAQLIQIKISSAGLWSQNDSDSNVVDVTS  109



>gb|KDO53492.1| hypothetical protein CISIN_1g005878mg [Citrus sinensis]
Length=644

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +3

Query  285  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  464
            MDPE TFIRVQERFS++L+PR+RA LEY  LF+A+TLFC+LVVMHANYVQQPGCSSE + 
Sbjct  1    MDPEHTFIRVQERFSRVLTPRVRAYLEYIYLFIAITLFCVLVVMHANYVQQPGCSSEFAG  60

Query  465  VDISDVQIIQIKITSAGL  518
            + +++ Q+IQIKI+SAG+
Sbjct  61   IRMTEAQLIQIKISSAGM  78



>ref|XP_006471108.1| PREDICTED: uncharacterized protein LOC102618114 isoform X4 [Citrus 
sinensis]
Length=646

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +3

Query  285  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  464
            MDPE TFIRVQERFS++L+PR+RA LEY  LF+A+TLFC+LVVMHANYVQQPGCSSE + 
Sbjct  1    MDPEHTFIRVQERFSRVLTPRVRAYLEYIYLFIAITLFCVLVVMHANYVQQPGCSSEFAG  60

Query  465  VDISDVQIIQIKITSAGL  518
            + +++ Q+IQIKI+SAG+
Sbjct  61   IRMTEAQLIQIKISSAGM  78



>gb|KDO53493.1| hypothetical protein CISIN_1g005878mg [Citrus sinensis]
Length=619

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 55/77 (71%), Positives = 69/77 (90%), Gaps = 0/77 (0%)
 Frame = +3

Query  285  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  464
            MDPE TFIRVQERFS++L+PR+RA LEY  LF+A+TLFC+LVVMHANYVQQPGCSSE + 
Sbjct  1    MDPEHTFIRVQERFSRVLTPRVRAYLEYIYLFIAITLFCVLVVMHANYVQQPGCSSEFAG  60

Query  465  VDISDVQIIQIKITSAG  515
            + +++ Q+IQIKI+SAG
Sbjct  61   IRMTEAQLIQIKISSAG  77



>ref|XP_006471109.1| PREDICTED: uncharacterized protein LOC102618114 isoform X5 [Citrus 
sinensis]
Length=621

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/77 (71%), Positives = 69/77 (90%), Gaps = 0/77 (0%)
 Frame = +3

Query  285  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  464
            MDPE TFIRVQERFS++L+PR+RA LEY  LF+A+TLFC+LVVMHANYVQQPGCSSE + 
Sbjct  1    MDPEHTFIRVQERFSRVLTPRVRAYLEYIYLFIAITLFCVLVVMHANYVQQPGCSSEFAG  60

Query  465  VDISDVQIIQIKITSAG  515
            + +++ Q+IQIKI+SAG
Sbjct  61   IRMTEAQLIQIKISSAG  77



>gb|KJB12207.1| hypothetical protein B456_002G006000 [Gossypium raimondii]
Length=604

 Score =   119 bits (299),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 63/73 (86%), Gaps = 0/73 (0%)
 Frame = +3

Query  285  MDPEQTFIRVQERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSK  464
            MDPEQTF+RVQ RFSQ+L+PR+R  LEY  LF+A+T FCILV MHANYVQQPGCSSELS 
Sbjct  1    MDPEQTFMRVQGRFSQILTPRVRVALEYIYLFIAITSFCILVTMHANYVQQPGCSSELSG  60

Query  465  VDISDVQIIQIKI  503
            +D ++VQ+IQIK 
Sbjct  61   IDSNEVQLIQIKF  73



>gb|AFW68066.1| hypothetical protein ZEAMMB73_082522, partial [Zea mays]
Length=169

 Score =   114 bits (284),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 52/90 (58%), Positives = 62/90 (69%), Gaps = 4/90 (4%)
 Frame = +3

Query  285  MDPEQTFIRVQERFS----QMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSS  452
            MDPEQTF+RV  R S    Q+L+PRIR  LEY  L  AV LFC+LVVMH N+VQQPGCSS
Sbjct  1    MDPEQTFLRVHARLSGTLSQLLTPRIRLVLEYLYLAGAVALFCLLVVMHTNFVQQPGCSS  60

Query  453  ELSKVDISDVQIIQIKITSAGLWFQNETEY  542
            E S ++  + Q++QIKI S GLW      Y
Sbjct  61   EFSGIEFGEAQLVQIKIISGGLWSSRGASY  90



>ref|XP_010923767.1| PREDICTED: uncharacterized protein LOC105046754 isoform X14 [Elaeis 
guineensis]
Length=304

 Score =   116 bits (291),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 67/94 (71%), Gaps = 4/94 (4%)
 Frame = +3

Query  285  MDPEQTFIRVQER----FSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSS  452
            MDPEQTF+RV  R     SQ+L+PR R  LEY  L VAV LFC+L VMH N+VQQPGCSS
Sbjct  1    MDPEQTFLRVHARVSGMLSQLLTPRTRLALEYGYLAVAVALFCLLAVMHINFVQQPGCSS  60

Query  453  ELSKVDISDVQIIQIKITSAGLWFQNETEYNEVD  554
            E S ++ ++ Q+IQIKI S GLW Q+  + N VD
Sbjct  61   EFSGIEFTEAQLIQIKIISGGLWAQSTADQNVVD  94



>gb|AAG51636.1|AC018908_2 unknown protein; 69131-60853 [Arabidopsis thaliana]
Length=974

 Score =   120 bits (301),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = +3

Query  315  QERFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSKVDISDVQIIQ  494
            QERFSQ+L+PRIR  LEY  LFVA+TLFCILVVMHANYVQQPGCSSEL+ V++++ +++Q
Sbjct  413  QERFSQILTPRIRGFLEYTYLFVAITLFCILVVMHANYVQQPGCSSELTGVELAEAELMQ  472

Query  495  IKITSAGLWFQNE  533
            IKITSAGLW +N+
Sbjct  473  IKITSAGLWSRND  485



>ref|XP_010923766.1| PREDICTED: uncharacterized protein LOC105046754 isoform X13 [Elaeis 
guineensis]
Length=334

 Score =   116 bits (291),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 67/94 (71%), Gaps = 4/94 (4%)
 Frame = +3

Query  285  MDPEQTFIRVQER----FSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSS  452
            MDPEQTF+RV  R     SQ+L+PR R  LEY  L VAV LFC+L VMH N+VQQPGCSS
Sbjct  1    MDPEQTFLRVHARVSGMLSQLLTPRTRLALEYGYLAVAVALFCLLAVMHINFVQQPGCSS  60

Query  453  ELSKVDISDVQIIQIKITSAGLWFQNETEYNEVD  554
            E S ++ ++ Q+IQIKI S GLW Q+  + N VD
Sbjct  61   EFSGIEFTEAQLIQIKIISGGLWAQSTADQNVVD  94



>ref|XP_010923765.1| PREDICTED: uncharacterized protein LOC105046754 isoform X12 [Elaeis 
guineensis]
Length=336

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 67/94 (71%), Gaps = 4/94 (4%)
 Frame = +3

Query  285  MDPEQTFIRVQER----FSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSS  452
            MDPEQTF+RV  R     SQ+L+PR R  LEY  L VAV LFC+L VMH N+VQQPGCSS
Sbjct  1    MDPEQTFLRVHARVSGMLSQLLTPRTRLALEYGYLAVAVALFCLLAVMHINFVQQPGCSS  60

Query  453  ELSKVDISDVQIIQIKITSAGLWFQNETEYNEVD  554
            E S ++ ++ Q+IQIKI S GLW Q+  + N VD
Sbjct  61   EFSGIEFTEAQLIQIKIISGGLWAQSTADQNVVD  94



>ref|XP_010923758.1| PREDICTED: uncharacterized protein LOC105046754 isoform X5 [Elaeis 
guineensis]
Length=476

 Score =   116 bits (291),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 67/94 (71%), Gaps = 4/94 (4%)
 Frame = +3

Query  285  MDPEQTFIRVQER----FSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSS  452
            MDPEQTF+RV  R     SQ+L+PR R  LEY  L VAV LFC+L VMH N+VQQPGCSS
Sbjct  1    MDPEQTFLRVHARVSGMLSQLLTPRTRLALEYGYLAVAVALFCLLAVMHINFVQQPGCSS  60

Query  453  ELSKVDISDVQIIQIKITSAGLWFQNETEYNEVD  554
            E S ++ ++ Q+IQIKI S GLW Q+  + N VD
Sbjct  61   EFSGIEFTEAQLIQIKIISGGLWAQSTADQNVVD  94



>ref|XP_010923763.1| PREDICTED: uncharacterized protein LOC105046754 isoform X10 [Elaeis 
guineensis]
Length=397

 Score =   115 bits (289),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 67/94 (71%), Gaps = 4/94 (4%)
 Frame = +3

Query  285  MDPEQTFIRVQER----FSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSS  452
            MDPEQTF+RV  R     SQ+L+PR R  LEY  L VAV LFC+L VMH N+VQQPGCSS
Sbjct  1    MDPEQTFLRVHARVSGMLSQLLTPRTRLALEYGYLAVAVALFCLLAVMHINFVQQPGCSS  60

Query  453  ELSKVDISDVQIIQIKITSAGLWFQNETEYNEVD  554
            E S ++ ++ Q+IQIKI S GLW Q+  + N VD
Sbjct  61   EFSGIEFTEAQLIQIKIISGGLWAQSTADQNVVD  94



>ref|XP_010923762.1| PREDICTED: uncharacterized protein LOC105046754 isoform X9 [Elaeis 
guineensis]
Length=414

 Score =   116 bits (290),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 67/94 (71%), Gaps = 4/94 (4%)
 Frame = +3

Query  285  MDPEQTFIRVQER----FSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSS  452
            MDPEQTF+RV  R     SQ+L+PR R  LEY  L VAV LFC+L VMH N+VQQPGCSS
Sbjct  1    MDPEQTFLRVHARVSGMLSQLLTPRTRLALEYGYLAVAVALFCLLAVMHINFVQQPGCSS  60

Query  453  ELSKVDISDVQIIQIKITSAGLWFQNETEYNEVD  554
            E S ++ ++ Q+IQIKI S GLW Q+  + N VD
Sbjct  61   EFSGIEFTEAQLIQIKIISGGLWAQSTADQNVVD  94



>ref|XP_010923759.1| PREDICTED: uncharacterized protein LOC105046754 isoform X6 [Elaeis 
guineensis]
Length=476

 Score =   115 bits (289),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 67/94 (71%), Gaps = 4/94 (4%)
 Frame = +3

Query  285  MDPEQTFIRVQER----FSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSS  452
            MDPEQTF+RV  R     SQ+L+PR R  LEY  L VAV LFC+L VMH N+VQQPGCSS
Sbjct  1    MDPEQTFLRVHARVSGMLSQLLTPRTRLALEYGYLAVAVALFCLLAVMHINFVQQPGCSS  60

Query  453  ELSKVDISDVQIIQIKITSAGLWFQNETEYNEVD  554
            E S ++ ++ Q+IQIKI S GLW Q+  + N VD
Sbjct  61   EFSGIEFTEAQLIQIKIISGGLWAQSTADQNVVD  94



>ref|XP_010923760.1| PREDICTED: uncharacterized protein LOC105046754 isoform X7 [Elaeis 
guineensis]
Length=466

 Score =   115 bits (289),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 67/94 (71%), Gaps = 4/94 (4%)
 Frame = +3

Query  285  MDPEQTFIRVQER----FSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSS  452
            MDPEQTF+RV  R     SQ+L+PR R  LEY  L VAV LFC+L VMH N+VQQPGCSS
Sbjct  1    MDPEQTFLRVHARVSGMLSQLLTPRTRLALEYGYLAVAVALFCLLAVMHINFVQQPGCSS  60

Query  453  ELSKVDISDVQIIQIKITSAGLWFQNETEYNEVD  554
            E S ++ ++ Q+IQIKI S GLW Q+  + N VD
Sbjct  61   EFSGIEFTEAQLIQIKIISGGLWAQSTADQNVVD  94



>ref|XP_010923761.1| PREDICTED: uncharacterized protein LOC105046754 isoform X8 [Elaeis 
guineensis]
Length=444

 Score =   115 bits (288),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 67/94 (71%), Gaps = 4/94 (4%)
 Frame = +3

Query  285  MDPEQTFIRVQER----FSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSS  452
            MDPEQTF+RV  R     SQ+L+PR R  LEY  L VAV LFC+L VMH N+VQQPGCSS
Sbjct  1    MDPEQTFLRVHARVSGMLSQLLTPRTRLALEYGYLAVAVALFCLLAVMHINFVQQPGCSS  60

Query  453  ELSKVDISDVQIIQIKITSAGLWFQNETEYNEVD  554
            E S ++ ++ Q+IQIKI S GLW Q+  + N VD
Sbjct  61   EFSGIEFTEAQLIQIKIISGGLWAQSTADQNVVD  94



>ref|XP_010923756.1| PREDICTED: uncharacterized protein LOC105046754 isoform X3 [Elaeis 
guineensis]
Length=515

 Score =   116 bits (290),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 67/94 (71%), Gaps = 4/94 (4%)
 Frame = +3

Query  285  MDPEQTFIRVQER----FSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSS  452
            MDPEQTF+RV  R     SQ+L+PR R  LEY  L VAV LFC+L VMH N+VQQPGCSS
Sbjct  1    MDPEQTFLRVHARVSGMLSQLLTPRTRLALEYGYLAVAVALFCLLAVMHINFVQQPGCSS  60

Query  453  ELSKVDISDVQIIQIKITSAGLWFQNETEYNEVD  554
            E S ++ ++ Q+IQIKI S GLW Q+  + N VD
Sbjct  61   EFSGIEFTEAQLIQIKIISGGLWAQSTADQNVVD  94



>ref|XP_010923757.1| PREDICTED: uncharacterized protein LOC105046754 isoform X4 [Elaeis 
guineensis]
Length=483

 Score =   115 bits (288),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 67/94 (71%), Gaps = 4/94 (4%)
 Frame = +3

Query  285  MDPEQTFIRVQER----FSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSS  452
            MDPEQTF+RV  R     SQ+L+PR R  LEY  L VAV LFC+L VMH N+VQQPGCSS
Sbjct  1    MDPEQTFLRVHARVSGMLSQLLTPRTRLALEYGYLAVAVALFCLLAVMHINFVQQPGCSS  60

Query  453  ELSKVDISDVQIIQIKITSAGLWFQNETEYNEVD  554
            E S ++ ++ Q+IQIKI S GLW Q+  + N VD
Sbjct  61   EFSGIEFTEAQLIQIKIISGGLWAQSTADQNVVD  94



>ref|XP_010923755.1| PREDICTED: uncharacterized protein LOC105046754 isoform X2 [Elaeis 
guineensis]
Length=529

 Score =   115 bits (289),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 67/94 (71%), Gaps = 4/94 (4%)
 Frame = +3

Query  285  MDPEQTFIRVQER----FSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSS  452
            MDPEQTF+RV  R     SQ+L+PR R  LEY  L VAV LFC+L VMH N+VQQPGCSS
Sbjct  1    MDPEQTFLRVHARVSGMLSQLLTPRTRLALEYGYLAVAVALFCLLAVMHINFVQQPGCSS  60

Query  453  ELSKVDISDVQIIQIKITSAGLWFQNETEYNEVD  554
            E S ++ ++ Q+IQIKI S GLW Q+  + N VD
Sbjct  61   EFSGIEFTEAQLIQIKIISGGLWAQSTADQNVVD  94



>ref|XP_010923754.1| PREDICTED: uncharacterized protein LOC105046754 isoform X1 [Elaeis 
guineensis]
Length=543

 Score =   116 bits (290),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 67/94 (71%), Gaps = 4/94 (4%)
 Frame = +3

Query  285  MDPEQTFIRVQER----FSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSS  452
            MDPEQTF+RV  R     SQ+L+PR R  LEY  L VAV LFC+L VMH N+VQQPGCSS
Sbjct  1    MDPEQTFLRVHARVSGMLSQLLTPRTRLALEYGYLAVAVALFCLLAVMHINFVQQPGCSS  60

Query  453  ELSKVDISDVQIIQIKITSAGLWFQNETEYNEVD  554
            E S ++ ++ Q+IQIKI S GLW Q+  + N VD
Sbjct  61   EFSGIEFTEAQLIQIKIISGGLWAQSTADQNVVD  94



>ref|XP_008787340.1| PREDICTED: uncharacterized protein LOC103705414 isoform X2 [Phoenix 
dactylifera]
Length=629

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 68/94 (72%), Gaps = 4/94 (4%)
 Frame = +3

Query  285  MDPEQTFIRVQER----FSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSS  452
            MDPEQTF+RV  R     SQ+L+PRIR  LEY  L VAV LFC+L VMH N+VQQPGCSS
Sbjct  1    MDPEQTFLRVHARVSGMLSQLLTPRIRLALEYGYLAVAVALFCLLAVMHVNFVQQPGCSS  60

Query  453  ELSKVDISDVQIIQIKITSAGLWFQNETEYNEVD  554
            E S V+ ++ Q++QIKI S GLW Q+  + N V+
Sbjct  61   EFSGVEFTEAQLVQIKIISGGLWGQSAADRNIVE  94



>dbj|BAK02995.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=308

 Score =   113 bits (282),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/90 (58%), Positives = 61/90 (68%), Gaps = 4/90 (4%)
 Frame = +3

Query  285  MDPEQTFIRVQERFSQMLS----PRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSS  452
            MDPEQTF+RV  R S MLS    PRIR  LEY  L  AV LFC+LVVMH N+VQQPGCSS
Sbjct  1    MDPEQTFLRVHARLSGMLSQLLTPRIRLALEYLYLAGAVALFCLLVVMHTNFVQQPGCSS  60

Query  453  ELSKVDISDVQIIQIKITSAGLWFQNETEY  542
            E + ++  + Q++QIKI S GLW      Y
Sbjct  61   EFTGIEFGEAQLVQIKIISGGLWASKGASY  90



>ref|XP_008787339.1| PREDICTED: uncharacterized protein LOC103705414 isoform X1 [Phoenix 
dactylifera]
Length=668

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 68/94 (72%), Gaps = 4/94 (4%)
 Frame = +3

Query  285  MDPEQTFIRVQER----FSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSS  452
            MDPEQTF+RV  R     SQ+L+PRIR  LEY  L VAV LFC+L VMH N+VQQPGCSS
Sbjct  1    MDPEQTFLRVHARVSGMLSQLLTPRIRLALEYGYLAVAVALFCLLAVMHVNFVQQPGCSS  60

Query  453  ELSKVDISDVQIIQIKITSAGLWFQNETEYNEVD  554
            E S V+ ++ Q++QIKI S GLW Q+  + N V+
Sbjct  61   EFSGVEFTEAQLVQIKIISGGLWGQSAADRNIVE  94



>ref|XP_010942375.1| PREDICTED: uncharacterized protein LOC105060393 [Elaeis guineensis]
Length=666

 Score =   113 bits (283),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 66/94 (70%), Gaps = 4/94 (4%)
 Frame = +3

Query  285  MDPEQTFIRVQER----FSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSS  452
            MD EQTF+RV  R     SQ+L+PRIR  LEY  L VAV LFC+LVVMH N+VQQPGCSS
Sbjct  1    MDTEQTFLRVHARVSGMLSQLLTPRIRLALEYGYLAVAVALFCLLVVMHTNFVQQPGCSS  60

Query  453  ELSKVDISDVQIIQIKITSAGLWFQNETEYNEVD  554
            E S ++ ++ Q++ IKI S GLW Q   + N VD
Sbjct  61   EFSGIEFTEAQLVHIKIISGGLWAQTAADQNIVD  94



>gb|EEE59630.1| hypothetical protein OsJ_11978 [Oryza sativa Japonica Group]
Length=996

 Score =   113 bits (283),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 61/90 (68%), Gaps = 4/90 (4%)
 Frame = +3

Query  285  MDPEQTFIRVQERFSQMLS----PRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSS  452
            MDPEQTF+RV  R S MLS    PRIR  LEY  L  AV LFC+LVVMH N+VQQPGCSS
Sbjct  1    MDPEQTFLRVHARLSGMLSQLLTPRIRLALEYLYLAGAVALFCLLVVMHTNFVQQPGCSS  60

Query  453  ELSKVDISDVQIIQIKITSAGLWFQNETEY  542
            E S ++  + Q++QIKI S GLW      Y
Sbjct  61   EFSGIEFGEAQLVQIKIISGGLWVSKGASY  90



>gb|EEC75863.1| hypothetical protein OsI_12877 [Oryza sativa Indica Group]
Length=713

 Score =   112 bits (281),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 61/90 (68%), Gaps = 4/90 (4%)
 Frame = +3

Query  285  MDPEQTFIRVQERFSQMLS----PRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSS  452
            MDPEQTF+RV  R S MLS    PRIR  LEY  L  AV LFC+LVVMH N+VQQPGCSS
Sbjct  1    MDPEQTFLRVHARLSGMLSQLLTPRIRLALEYLYLAGAVALFCLLVVMHTNFVQQPGCSS  60

Query  453  ELSKVDISDVQIIQIKITSAGLWFQNETEY  542
            E S ++  + Q++QIKI S GLW      Y
Sbjct  61   EFSGIEFGEAQLVQIKIISGGLWVSKGASY  90



>ref|XP_006650375.1| PREDICTED: uncharacterized protein LOC102702737 [Oryza brachyantha]
Length=660

 Score =   112 bits (281),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 61/90 (68%), Gaps = 4/90 (4%)
 Frame = +3

Query  285  MDPEQTFIRVQERFSQMLS----PRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSS  452
            MDPEQTF+RV  R S MLS    PRIR  LEY  L  AV LFC+LVVMH N+VQQPGCSS
Sbjct  1    MDPEQTFLRVHARLSGMLSQLLTPRIRLALEYLYLAGAVALFCLLVVMHTNFVQQPGCSS  60

Query  453  ELSKVDISDVQIIQIKITSAGLWFQNETEY  542
            E S ++  + Q++QIKI S GLW      Y
Sbjct  61   EFSGIEFGEAQLVQIKIISGGLWVSKGASY  90



>ref|NP_001050822.1| Os03g0659900 [Oryza sativa Japonica Group]
 gb|AAS07113.1| expressed protein [Oryza sativa Japonica Group]
 gb|ABF98007.1| S3 self-incompatibility locus-linked pollen 3.15 protein, putative, 
expressed [Oryza sativa Japonica Group]
 dbj|BAF12736.1| Os03g0659900 [Oryza sativa Japonica Group]
Length=664

 Score =   112 bits (281),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 61/90 (68%), Gaps = 4/90 (4%)
 Frame = +3

Query  285  MDPEQTFIRVQERFSQMLS----PRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSS  452
            MDPEQTF+RV  R S MLS    PRIR  LEY  L  AV LFC+LVVMH N+VQQPGCSS
Sbjct  1    MDPEQTFLRVHARLSGMLSQLLTPRIRLALEYLYLAGAVALFCLLVVMHTNFVQQPGCSS  60

Query  453  ELSKVDISDVQIIQIKITSAGLWFQNETEY  542
            E S ++  + Q++QIKI S GLW      Y
Sbjct  61   EFSGIEFGEAQLVQIKIISGGLWVSKGASY  90



>ref|XP_004982244.1| PREDICTED: uncharacterized protein LOC101752972 isoform X2 [Setaria 
italica]
Length=632

 Score =   112 bits (280),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/90 (58%), Positives = 62/90 (69%), Gaps = 4/90 (4%)
 Frame = +3

Query  285  MDPEQTFIRVQERFS----QMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSS  452
            MDPEQTF+RV  R S    Q+L+PRIR  LEY  L  AV LFC+LVVMH N+VQQPGCSS
Sbjct  1    MDPEQTFLRVHARLSGMLSQLLTPRIRLALEYLYLAGAVALFCLLVVMHTNFVQQPGCSS  60

Query  453  ELSKVDISDVQIIQIKITSAGLWFQNETEY  542
            E S ++  + Q++QIKI S GLW      Y
Sbjct  61   EFSGIEFGEAQLVQIKIISGGLWASRGASY  90



>ref|XP_010231807.1| PREDICTED: uncharacterized protein LOC100825172 isoform X2 [Brachypodium 
distachyon]
Length=634

 Score =   112 bits (280),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/90 (58%), Positives = 62/90 (69%), Gaps = 4/90 (4%)
 Frame = +3

Query  285  MDPEQTFIRVQERFS----QMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSS  452
            MDPEQTF+RV  R S    Q+L+PRIR  LEY  L  AV LFC+LVVMH N+VQQPGCSS
Sbjct  1    MDPEQTFLRVHARLSGMLSQLLTPRIRLALEYLYLAGAVALFCLLVVMHTNFVQQPGCSS  60

Query  453  ELSKVDISDVQIIQIKITSAGLWFQNETEY  542
            E S ++  + Q++QIKI S GLW      Y
Sbjct  61   EFSGIEFGEAQLVQIKIISGGLWASKGASY  90



>ref|XP_003561560.1| PREDICTED: uncharacterized protein LOC100825172 isoform X1 [Brachypodium 
distachyon]
Length=665

 Score =   112 bits (280),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 52/90 (58%), Positives = 62/90 (69%), Gaps = 4/90 (4%)
 Frame = +3

Query  285  MDPEQTFIRVQERFS----QMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSS  452
            MDPEQTF+RV  R S    Q+L+PRIR  LEY  L  AV LFC+LVVMH N+VQQPGCSS
Sbjct  1    MDPEQTFLRVHARLSGMLSQLLTPRIRLALEYLYLAGAVALFCLLVVMHTNFVQQPGCSS  60

Query  453  ELSKVDISDVQIIQIKITSAGLWFQNETEY  542
            E S ++  + Q++QIKI S GLW      Y
Sbjct  61   EFSGIEFGEAQLVQIKIISGGLWASKGASY  90



>ref|XP_004982243.1| PREDICTED: uncharacterized protein LOC101752972 isoform X1 [Setaria 
italica]
Length=663

 Score =   112 bits (280),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 52/90 (58%), Positives = 62/90 (69%), Gaps = 4/90 (4%)
 Frame = +3

Query  285  MDPEQTFIRVQERFS----QMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSS  452
            MDPEQTF+RV  R S    Q+L+PRIR  LEY  L  AV LFC+LVVMH N+VQQPGCSS
Sbjct  1    MDPEQTFLRVHARLSGMLSQLLTPRIRLALEYLYLAGAVALFCLLVVMHTNFVQQPGCSS  60

Query  453  ELSKVDISDVQIIQIKITSAGLWFQNETEY  542
            E S ++  + Q++QIKI S GLW      Y
Sbjct  61   EFSGIEFGEAQLVQIKIISGGLWASRGASY  90



>ref|XP_002464124.1| hypothetical protein SORBIDRAFT_01g012790 [Sorghum bicolor]
 gb|EER91122.1| hypothetical protein SORBIDRAFT_01g012790 [Sorghum bicolor]
Length=662

 Score =   112 bits (280),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 52/90 (58%), Positives = 62/90 (69%), Gaps = 4/90 (4%)
 Frame = +3

Query  285  MDPEQTFIRVQERFS----QMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSS  452
            MDPEQTF+RV  R S    Q+L+PRIR  LEY  L  AV LFC+LVVMH N+VQQPGCSS
Sbjct  1    MDPEQTFLRVHARLSGTLSQLLTPRIRLALEYLYLAGAVALFCLLVVMHTNFVQQPGCSS  60

Query  453  ELSKVDISDVQIIQIKITSAGLWFQNETEY  542
            E S ++  + Q++QIKI S GLW      Y
Sbjct  61   EFSGIEFGEAQLVQIKIISGGLWSSRGASY  90



>ref|XP_008782691.1| PREDICTED: uncharacterized protein LOC103702156 [Phoenix dactylifera]
Length=668

 Score =   112 bits (280),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 67/94 (71%), Gaps = 4/94 (4%)
 Frame = +3

Query  285  MDPEQTFIRVQER----FSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSS  452
            MD EQTF+RV  R     SQ+L+PRIR  LEY  L VAV LFC+LVVMH N+VQQPGCSS
Sbjct  1    MDTEQTFLRVHARVSGMLSQLLTPRIRLALEYGYLAVAVALFCLLVVMHTNFVQQPGCSS  60

Query  453  ELSKVDISDVQIIQIKITSAGLWFQNETEYNEVD  554
            E S ++ ++ Q++ IKI S GLW Q+  + N V+
Sbjct  61   EFSGIEFNEAQLVHIKIMSGGLWAQSAADQNIVN  94



>ref|XP_010231815.1| PREDICTED: uncharacterized protein LOC100825172 isoform X3 [Brachypodium 
distachyon]
Length=590

 Score =   111 bits (278),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 51/83 (61%), Positives = 61/83 (73%), Gaps = 4/83 (5%)
 Frame = +3

Query  285  MDPEQTFIRVQERFS----QMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSS  452
            MDPEQTF+RV  R S    Q+L+PRIR  LEY  L  AV LFC+LVVMH N+VQQPGCSS
Sbjct  1    MDPEQTFLRVHARLSGMLSQLLTPRIRLALEYLYLAGAVALFCLLVVMHTNFVQQPGCSS  60

Query  453  ELSKVDISDVQIIQIKITSAGLW  521
            E S ++  + Q++QIKI S GLW
Sbjct  61   EFSGIEFGEAQLVQIKIISGGLW  83



>gb|EMT20955.1| hypothetical protein F775_05632 [Aegilops tauschii]
Length=890

 Score =   112 bits (280),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 52/90 (58%), Positives = 61/90 (68%), Gaps = 4/90 (4%)
 Frame = +3

Query  285  MDPEQTFIRVQERFSQMLS----PRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSS  452
            MDPEQTF+RV  R S MLS    PRIR  LEY  L  AV LFC+LVVMH N+VQQPGCSS
Sbjct  1    MDPEQTFLRVHARLSGMLSQLLTPRIRLALEYLYLAGAVALFCLLVVMHTNFVQQPGCSS  60

Query  453  ELSKVDISDVQIIQIKITSAGLWFQNETEY  542
            E + ++  + Q++QIKI S GLW      Y
Sbjct  61   EFTGIEFGEAQLVQIKIISGGLWASKGASY  90



>gb|EMS54971.1| hypothetical protein TRIUR3_11843 [Triticum urartu]
Length=667

 Score =   112 bits (279),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 52/90 (58%), Positives = 61/90 (68%), Gaps = 4/90 (4%)
 Frame = +3

Query  285  MDPEQTFIRVQERFSQMLS----PRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSS  452
            MDPEQTF+RV  R S MLS    PRIR  LEY  L  AV LFC+LVVMH N+VQQPGCSS
Sbjct  1    MDPEQTFLRVHARLSGMLSQLLTPRIRLALEYLYLAGAVALFCLLVVMHTNFVQQPGCSS  60

Query  453  ELSKVDISDVQIIQIKITSAGLWFQNETEY  542
            E + ++  + Q++QIKI S GLW      Y
Sbjct  61   EFTGIEFGEAQLVQIKIISGGLWASKGASY  90



>ref|XP_009387979.1| PREDICTED: uncharacterized protein LOC103974813 [Musa acuminata 
subsp. malaccensis]
Length=647

 Score =   109 bits (272),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 63/98 (64%), Gaps = 4/98 (4%)
 Frame = +3

Query  285  MDPEQTFIRVQER----FSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSS  452
            MDPE TF+RV  R     SQ+L PR+R  LEY  L  A  LFC+LV+MH N+VQQPGCS 
Sbjct  1    MDPEHTFLRVHARVSGSLSQLLGPRVRLMLEYACLAAAGALFCLLVIMHINFVQQPGCSR  60

Query  453  ELSKVDISDVQIIQIKITSAGLWFQNETEYNEVDVSSG  566
            E S ++ ++ Q++QIKIT  GLW Q+  E   V    G
Sbjct  61   EFSGLEFTEAQVVQIKITGGGLWTQSSAETERVSFQKG  98



>gb|AFW68067.1| hypothetical protein ZEAMMB73_082522 [Zea mays]
Length=96

 Score =   100 bits (250),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 46/77 (60%), Positives = 57/77 (74%), Gaps = 4/77 (5%)
 Frame = +3

Query  285  MDPEQTFIRVQERFS----QMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSS  452
            MDPEQTF+RV  R S    Q+L+PRIR  LEY  L  AV LFC+LVVMH N+VQQPGCSS
Sbjct  1    MDPEQTFLRVHARLSGTLSQLLTPRIRLVLEYLYLAGAVALFCLLVVMHTNFVQQPGCSS  60

Query  453  ELSKVDISDVQIIQIKI  503
            E S ++  + Q++QIK+
Sbjct  61   EFSGIEFGEAQLVQIKV  77



>gb|ACN39930.1| unknown [Picea sitchensis]
Length=767

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 67/96 (70%), Gaps = 4/96 (4%)
 Frame = +3

Query  285  MDPEQTFIRVQERFS----QMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSS  452
            MDP+ TF+RV  R S    Q+L+PRIR++LEY  L VA+ L  IL VMH N+V QPGC++
Sbjct  1    MDPQHTFLRVHARLSGMLAQLLTPRIRSSLEYASLGVAIVLLGILTVMHVNFVAQPGCAN  60

Query  453  ELSKVDISDVQIIQIKITSAGLWFQNETEYNEVDVS  560
            ELS  +IS+ Q++QIKITS+ LW Q  TE +E    
Sbjct  61   ELSGSNISESQLVQIKITSSRLWSQTFTELSETSAG  96



>ref|XP_006853401.1| hypothetical protein AMTR_s00032p00148750 [Amborella trichopoda]
 gb|ERN14868.1| hypothetical protein AMTR_s00032p00148750 [Amborella trichopoda]
Length=573

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 51/67 (76%), Gaps = 0/67 (0%)
 Frame = +3

Query  321  RFSQMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSSELSKVDISDVQIIQIK  500
            + SQ+L PRIR  LEY  L VA  LFC+LVVMH N+V QPGCSSELS  +I +  ++QIK
Sbjct  12   KLSQLLKPRIRVALEYVFLVVAFALFCLLVVMHTNFVAQPGCSSELSGPEILEAHLVQIK  71

Query  501  ITSAGLW  521
            ITSAGLW
Sbjct  72   ITSAGLW  78



>gb|AAQ09998.1| S2 self-incompatibility locus-linked pollen 3.15 protein [Petunia 
integrifolia subsp. inflata]
Length=610

 Score = 82.8 bits (203),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = +3

Query  411  VMHANYVQQPGCSSELSKVDISDVQIIQIKITSAGLWFQNETEYNEVDVSS  563
            VMHANYVQQPGCSSELS+V+I + Q+IQIKITSAGLW QN+  Y+ VDV++
Sbjct  1    VMHANYVQQPGCSSELSRVNIMEAQLIQIKITSAGLWSQNQPNYDVVDVAN  51



>gb|AAQ09997.1| S1 self-incompatibility locus-linked pollen 3.15 protein [Petunia 
integrifolia subsp. inflata]
Length=610

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = +3

Query  411  VMHANYVQQPGCSSELSKVDISDVQIIQIKITSAGLWFQNETEYNEVDVSS  563
            VMHANYVQQPGCSSELSKV I + Q+IQIKIT AGLW QN+  Y+ V+V++
Sbjct  1    VMHANYVQQPGCSSELSKVTIMEAQLIQIKITRAGLWSQNQPNYDVVNVAN  51



>ref|XP_002970045.1| hypothetical protein SELMODRAFT_440969 [Selaginella moellendorffii]
 gb|EFJ29169.1| hypothetical protein SELMODRAFT_440969 [Selaginella moellendorffii]
Length=646

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 44/90 (49%), Positives = 59/90 (66%), Gaps = 6/90 (7%)
 Frame = +3

Query  285  MDPEQTFIRVQERFS----QMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSS  452
            MDPEQTF+RV  R S    ++L+PR R  LEY  LF AV L  +LVVMH N+V QPGC++
Sbjct  1    MDPEQTFLRVHARLSGVLARLLTPRFRTVLEYLCLFNAVVLLALLVVMHVNFVAQPGCAT  60

Query  453  ELSKVDISDVQIIQIKITSAGLWFQNETEY  542
            E      SD Q+IQ+KIT +   F+ + ++
Sbjct  61   EFHAA--SDAQLIQVKITGSSRAFEEQHQF  88



>ref|XP_002985235.1| hypothetical protein SELMODRAFT_446163 [Selaginella moellendorffii]
 gb|EFJ13729.1| hypothetical protein SELMODRAFT_446163 [Selaginella moellendorffii]
Length=681

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 44/90 (49%), Positives = 59/90 (66%), Gaps = 6/90 (7%)
 Frame = +3

Query  285  MDPEQTFIRVQERFS----QMLSPRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSS  452
            MDPEQTF+RV  R S    ++L+PR R  LEY  LF AV L  +LVVMH N+V QPGC++
Sbjct  1    MDPEQTFLRVHARLSGVLARLLTPRFRTVLEYLCLFNAVVLLALLVVMHVNFVAQPGCAA  60

Query  453  ELSKVDISDVQIIQIKITSAGLWFQNETEY  542
            E      SD Q+IQ+KIT +   F+ + ++
Sbjct  61   EFRAA--SDAQLIQVKITGSSRAFEEQHQF  88



>gb|KEH36424.1| S3 self-incompatibility locus-linked pollen 3.15 protein [Medicago 
truncatula]
Length=630

 Score = 61.2 bits (147),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +3

Query  435  QPGCSSELSKVDISDVQIIQIKITSAGLWFQNETEYNEVD  554
            +PGCSSELS V  SD Q+IQIKITSAGLW+ N++E N +D
Sbjct  6    KPGCSSELSGVLTSDAQLIQIKITSAGLWYHNDSEPNIID  45



>gb|ABK24891.1| unknown [Picea sitchensis]
Length=270

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 50/88 (57%), Gaps = 17/88 (19%)
 Frame = +3

Query  285  MDPEQTFIRVQERFSQMLS----PRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCS-  449
            MDP  TF+RV  R S ML+    PR R++L      +A+ L  +L VMH N+V Q G + 
Sbjct  1    MDPHHTFLRVHARLSGMLAQLLMPRNRSSLR-----LAIVLLGVLTVMHVNFVAQAGYAN  55

Query  450  -------SELSKVDISDVQIIQIKITSA  512
                   +ELS  +IS+ Q++QIK+  A
Sbjct  56   ELSGSNFNELSGSNISESQLLQIKLGYA  83



>gb|ABK23338.1| unknown [Picea sitchensis]
Length=270

 Score = 57.8 bits (138),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 50/88 (57%), Gaps = 17/88 (19%)
 Frame = +3

Query  285  MDPEQTFIRVQERFSQMLS----PRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCSS  452
            MDP  TF+RV  RFS ML+    PR R++L      +A+ L  +L VMH N++ Q G ++
Sbjct  1    MDPHHTFLRVHVRFSGMLAQLLMPRNRSSLR-----LAIVLLGVLTVMHVNFIAQAGYAN  55

Query  453  ELS--------KVDISDVQIIQIKITSA  512
            ELS          +IS+ Q+ QIK+  A
Sbjct  56   ELSGSNFNELLGSNISESQLPQIKLGYA  83



>gb|ACN41062.1| unknown [Picea sitchensis]
Length=280

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 50/88 (57%), Gaps = 17/88 (19%)
 Frame = +3

Query  285  MDPEQTFIRVQERFSQMLS----PRIRATLEYFLLFVAVTLFCILVVMHANYVQQPGCS-  449
            MDP  TF+RV  R S ML+    PR R++L      +A+ L  +L VMH N+V Q G + 
Sbjct  1    MDPHHTFLRVHARLSGMLAQLLMPRNRSSLR-----LAIVLLGVLTVMHVNFVAQVGYAN  55

Query  450  -------SELSKVDISDVQIIQIKITSA  512
                   +ELS  +IS+ Q++QIK+  A
Sbjct  56   ELSGSNFNELSGSNISESQLLQIKLGYA  83



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 658693633920