BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002C23

Length=495
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009761175.1|  PREDICTED: SNAP25 homologous protein SNAP33      97.4    5e-21   Nicotiana sylvestris
ref|XP_009623745.1|  PREDICTED: SNAP25 homologous protein SNAP33-...  94.7    3e-20   Nicotiana tomentosiformis
ref|XP_009801843.1|  PREDICTED: SNAP25 homologous protein SNAP33      94.7    4e-20   Nicotiana sylvestris
ref|XP_006354763.1|  PREDICTED: SNAP25 homologous protein SNAP33-...  94.4    6e-20   Solanum tuberosum [potatoes]
emb|CDP17499.1|  unnamed protein product                              92.8    1e-19   Coffea canephora [robusta coffee]
ref|XP_009595358.1|  PREDICTED: SNAP25 homologous protein SNAP33      91.3    7e-19   Nicotiana tomentosiformis
ref|XP_010322574.1|  PREDICTED: SNAP25 homologous protein SNAP33-...  90.5    1e-18   Solanum lycopersicum
ref|XP_006345160.1|  PREDICTED: SNAP25 homologous protein SNAP33-...  89.7    2e-18   Solanum tuberosum [potatoes]
gb|AEB71568.1|  SNAP33                                                88.2    8e-18   Solanum chacoense
ref|XP_011087328.1|  PREDICTED: SNAP25 homologous protein SNAP33      87.0    2e-17   Sesamum indicum [beniseed]
ref|XP_006440694.1|  hypothetical protein CICLE_v10021320mg           82.4    7e-16   Citrus clementina [clementine]
gb|KDO54588.1|  hypothetical protein CISIN_1g021914mg                 82.4    7e-16   Citrus sinensis [apfelsine]
ref|XP_006477622.1|  PREDICTED: SNAP25 homologous protein SNAP33-...  82.4    7e-16   
ref|XP_004236003.1|  PREDICTED: SNAP25 homologous protein SNAP33-...  81.6    2e-15   Solanum lycopersicum
ref|XP_011072852.1|  PREDICTED: SNAP25 homologous protein SNAP33-...  79.3    9e-15   Sesamum indicum [beniseed]
ref|XP_007037493.1|  Synaptosomal associated protein, putative        76.6    9e-14   
ref|XP_002284486.1|  PREDICTED: SNAP25 homologous protein SNAP33      73.9    7e-13   Vitis vinifera
ref|XP_002514694.1|  synaptosomal associated protein, putative        73.9    7e-13   Ricinus communis
gb|EYU23575.1|  hypothetical protein MIMGU_mgv1a010387mg              73.6    1e-12   Erythranthe guttata [common monkey flower]
gb|KJB50983.1|  hypothetical protein B456_008G196700                  70.5    1e-11   Gossypium raimondii
gb|KDP31313.1|  hypothetical protein JCGZ_11689                       68.6    7e-11   Jatropha curcas
ref|XP_010106653.1|  SNAP25-like protein                              67.0    2e-10   Morus notabilis
gb|KHG22115.1|  SNAP25 ous SNAP33 -like protein                       65.9    6e-10   Gossypium arboreum [tree cotton]
ref|XP_010044425.1|  PREDICTED: putative SNAP25 homologous protei...  65.1    1e-09   Eucalyptus grandis [rose gum]
ref|XP_008447897.1|  PREDICTED: SNAP25 homologous protein SNAP33-...  64.7    2e-09   
ref|XP_002322041.1|  hypothetical protein POPTR_0015s03450g           64.7    2e-09   Populus trichocarpa [western balsam poplar]
ref|XP_010678419.1|  PREDICTED: SNAP25 homologous protein SNAP33-...  64.3    2e-09   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011013081.1|  PREDICTED: SNAP25 homologous protein SNAP33      64.3    3e-09   Populus euphratica
gb|KJB08340.1|  hypothetical protein B456_001G078100                  63.9    3e-09   Gossypium raimondii
gb|KHG01928.1|  SNAP25 ous SNAP33 -like protein                       63.5    4e-09   Gossypium arboreum [tree cotton]
ref|XP_003524667.1|  PREDICTED: SNAP25 homologous protein SNAP33-...  63.2    6e-09   Glycine max [soybeans]
ref|XP_011010041.1|  PREDICTED: SNAP25 homologous protein SNAP33-...  62.4    1e-08   Populus euphratica
ref|XP_004137424.1|  PREDICTED: SNAP25 homologous protein SNAP33-...  60.1    6e-08   Cucumis sativus [cucumbers]
ref|XP_011010042.1|  PREDICTED: SNAP25 homologous protein SNAP33-...  60.1    6e-08   Populus euphratica
ref|XP_004299325.1|  PREDICTED: SNAP25 homologous protein SNAP33-...  58.5    2e-07   Fragaria vesca subsp. vesca
ref|XP_007155259.1|  hypothetical protein PHAVU_003G186500g           58.2    3e-07   Phaseolus vulgaris [French bean]
ref|XP_010258125.1|  PREDICTED: SNAP25 homologous protein SNAP33-...  58.2    3e-07   Nelumbo nucifera [Indian lotus]
ref|XP_004508695.1|  PREDICTED: SNAP25 homologous protein SNAP33-...  57.8    4e-07   Cicer arietinum [garbanzo]
ref|NP_001241533.1|  uncharacterized protein LOC100793323             57.8    4e-07   Glycine max [soybeans]
ref|XP_007209588.1|  hypothetical protein PRUPE_ppa011254mg           55.5    1e-06   
ref|XP_006376804.1|  hypothetical protein POPTR_0012s06830g           55.5    2e-06   
gb|AFK41395.1|  unknown                                               55.8    2e-06   Lotus japonicus
ref|XP_010546183.1|  PREDICTED: SNAP25 homologous protein SNAP33      55.5    3e-06   Tarenaya hassleriana [spider flower]
ref|XP_002317966.1|  hypothetical protein POPTR_0012s06830g           55.5    3e-06   Populus trichocarpa [western balsam poplar]
ref|XP_006394530.1|  hypothetical protein EUTSA_v10004672mg           55.1    3e-06   Eutrema salsugineum [saltwater cress]
ref|XP_008239879.1|  PREDICTED: SNAP25 homologous protein SNAP33-...  54.7    5e-06   Prunus mume [ume]
ref|XP_002316150.2|  hypothetical protein POPTR_0010s16780g           53.9    6e-06   
ref|XP_010259208.1|  PREDICTED: SNAP25 homologous protein SNAP33-...  53.9    9e-06   Nelumbo nucifera [Indian lotus]
ref|XP_006281801.1|  hypothetical protein CARUB_v10027974mg           53.9    1e-05   Capsella rubella
gb|KEH33106.1|  soluble N-ethylmaleimide-sensitive factor adaptor...  53.1    1e-05   Medicago truncatula
gb|KEH33105.1|  soluble N-ethylmaleimide-sensitive factor adaptor...  53.1    2e-05   Medicago truncatula
ref|XP_011018220.1|  PREDICTED: putative SNAP25 homologous protei...  52.8    2e-05   Populus euphratica
ref|XP_009338645.1|  PREDICTED: SNAP25 homologous protein SNAP33      52.4    3e-05   Pyrus x bretschneideri [bai li]
ref|XP_002312278.1|  SNAP25 homologous protein SNAP30                 52.4    3e-05   Populus trichocarpa [western balsam poplar]
ref|XP_010457045.1|  PREDICTED: SNAP25 homologous protein SNAP33-...  52.0    4e-05   Camelina sativa [gold-of-pleasure]
ref|XP_008374599.1|  PREDICTED: SNAP25 homologous protein SNAP33-...  51.6    6e-05   Malus domestica [apple tree]
ref|XP_004135151.1|  PREDICTED: putative SNAP25 homologous protei...  51.6    6e-05   Cucumis sativus [cucumbers]
ref|XP_008393203.1|  PREDICTED: SNAP25 homologous protein SNAP33      51.2    7e-05   
ref|XP_002864724.1|  synaptosomal-associated protein 33               51.2    7e-05   Arabidopsis lyrata subsp. lyrata
ref|XP_010483785.1|  PREDICTED: SNAP25 homologous protein SNAP33      51.2    8e-05   Camelina sativa [gold-of-pleasure]
ref|NP_001241453.1|  uncharacterized protein LOC100794076             50.8    1e-04   Glycine max [soybeans]
gb|KHN48757.1|  SNAP25 like protein SNAP33                            50.4    1e-04   Glycine soja [wild soybean]
ref|XP_010443936.1|  PREDICTED: SNAP25 homologous protein SNAP33-...  50.4    1e-04   
gb|AAM62553.1|  snap25a                                               50.1    2e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004499490.1|  PREDICTED: SNAP25 homologous protein SNAP33-...  50.1    2e-04   Cicer arietinum [garbanzo]
ref|XP_010030467.1|  PREDICTED: SNAP25 homologous protein SNAP33      50.1    2e-04   Eucalyptus grandis [rose gum]
ref|XP_008446422.1|  PREDICTED: putative SNAP25 homologous protei...  49.7    2e-04   Cucumis melo [Oriental melon]
ref|NP_200929.1|  soluble N-ethylmaleimide-sensitive factor adapt...  49.3    4e-04   Arabidopsis thaliana [mouse-ear cress]
gb|EYU29393.1|  hypothetical protein MIMGU_mgv1a010876mg              48.1    8e-04   Erythranthe guttata [common monkey flower]
emb|CDY23079.1|  BnaC07g31080D                                        47.8    0.001   Brassica napus [oilseed rape]



>ref|XP_009761175.1| PREDICTED: SNAP25 homologous protein SNAP33 [Nicotiana sylvestris]
Length=305

 Score = 97.4 bits (241),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 72/97 (74%), Gaps = 6/97 (6%)
 Frame = +2

Query  212  MFGHKKSPLHGNSKSHSIVPG--SNSTSNPFDSDDECDKKQNVKQSR-TSSEPTPVTLNT  382
            MFG KKSPLH N+K+HS  PG    S+SNPFDSD+E D KQ +  +R TSSEP+ +T + 
Sbjct  1    MFGLKKSPLHLNAKNHSANPGFHGYSSSNPFDSDNESDSKQTITPARRTSSEPSLITPHL  60

Query  383  STNPFDDDEAKGKsssssssTYSFTTERNRYKNDFRD  493
            STNPFDDD+ KG  SS+ S+T   +T RNRYKNDFRD
Sbjct  61   STNPFDDDDVKGTHSSAYSTT---STARNRYKNDFRD  94



>ref|XP_009623745.1| PREDICTED: SNAP25 homologous protein SNAP33-like [Nicotiana tomentosiformis]
Length=305

 Score = 94.7 bits (234),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 70/98 (71%), Gaps = 8/98 (8%)
 Frame = +2

Query  212  MFGHKKSPLHGNSKSHSIVPG--SNSTSNPFDSDDECDKKQNVKQSR-TSSEPTPVTLNT  382
            MFG KKSPLH N+K+HS  PG    S+SNP DSD+E D KQ +  +R TSSEP+ +T + 
Sbjct  1    MFGLKKSPLHLNAKNHSANPGFHGYSSSNPVDSDNESDSKQTITPARRTSSEPSLITPHL  60

Query  383  STNPFDDDEAKGKsssssssTYSFT-TERNRYKNDFRD  493
            STNPFDDD+ KG    + SS YS T T RNRYKNDFRD
Sbjct  61   STNPFDDDDIKG----THSSAYSATSTARNRYKNDFRD  94



>ref|XP_009801843.1| PREDICTED: SNAP25 homologous protein SNAP33 [Nicotiana sylvestris]
 ref|XP_009801844.1| PREDICTED: SNAP25 homologous protein SNAP33 [Nicotiana sylvestris]
Length=303

 Score = 94.7 bits (234),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 64/96 (67%), Gaps = 6/96 (6%)
 Frame = +2

Query  212  MFGHKKSPLHGNSKSHSIVPG--SNSTSNPFDSDDECDKKQNVKQSRTSSEPTPVTLNTS  385
            M G KKSPLH N++ +S  P     S SNPFDSDDE DKKQ VK  RTSSEP+  T N S
Sbjct  1    MHGFKKSPLHWNARKNSTDPAFHGKSGSNPFDSDDESDKKQTVKPRRTSSEPSVATPNLS  60

Query  386  TNPFDDDEAKGKsssssssTYSFTTERNRYKNDFRD  493
             NPFDD+E K     + S  YS +T RN+YKNDFR+
Sbjct  61   ANPFDDEEIK----ETPSRAYSTSTARNKYKNDFRE  92



>ref|XP_006354763.1| PREDICTED: SNAP25 homologous protein SNAP33-like [Solanum tuberosum]
Length=306

 Score = 94.4 bits (233),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 65/97 (67%), Gaps = 7/97 (7%)
 Frame = +2

Query  212  MFGHKKSPLHGNSKSHSI--VPGSNSTSNPFDSDDECDKKQNVKQS-RTSSEPTPVTLNT  382
            M G KKSPLH +++  S   V  SNS SNPFDSDDE DKKQ VK S R SSEP+  T N 
Sbjct  1    MHGLKKSPLHWSARKKSADPVAHSNSGSNPFDSDDESDKKQTVKPSRRISSEPSAATPNL  60

Query  383  STNPFDDDEAKGKsssssssTYSFTTERNRYKNDFRD  493
            STNPFDDDE K     + S  YS  T RN+YKNDFR+
Sbjct  61   STNPFDDDEIK----ETPSHAYSTLTARNKYKNDFRE  93



>emb|CDP17499.1| unnamed protein product [Coffea canephora]
Length=302

 Score = 92.8 bits (229),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 69/95 (73%), Gaps = 5/95 (5%)
 Frame = +2

Query  212  MFGHKKSPLHGNSKSHSIVPGSNSTSNPFDSDDECDKKQNVKQSR-TSSEPTPVTLNTST  388
            MFGHKKSPLH N++ H+ V    S SNPFDSD E D KQ +  SR TSSEP+ VT NTST
Sbjct  1    MFGHKKSPLHRNAR-HTSVDSRISGSNPFDSDGESDNKQALTTSRRTSSEPSLVTQNTST  59

Query  389  NPFDDDEAKGKsssssssTYSFTTERNRYKNDFRD  493
            NPFDD+E KG   +SSSS  S  + RN+YKNDFR+
Sbjct  60   NPFDDEEVKG---TSSSSYISNHSARNKYKNDFRE  91



>ref|XP_009595358.1| PREDICTED: SNAP25 homologous protein SNAP33 [Nicotiana tomentosiformis]
 ref|XP_009595360.1| PREDICTED: SNAP25 homologous protein SNAP33 [Nicotiana tomentosiformis]
Length=304

 Score = 91.3 bits (225),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 65/97 (67%), Gaps = 7/97 (7%)
 Frame = +2

Query  212  MFGHKKSPLHGNSKSHSIVPG--SNSTSNPFDSDDECDKKQNVKQS-RTSSEPTPVTLNT  382
            M G KKSPLH N++ +S  P     S SNPFDSDDE DK+Q VK S RTSSEP+  T N 
Sbjct  1    MHGFKKSPLHWNARKNSADPAFHGKSGSNPFDSDDESDKRQTVKPSRRTSSEPSVATPNL  60

Query  383  STNPFDDDEAKGKsssssssTYSFTTERNRYKNDFRD  493
            S NPFDD+E K     + S  YS +T RN+YKNDFR+
Sbjct  61   SANPFDDEEIK----ETPSRAYSTSTARNKYKNDFRE  93



>ref|XP_010322574.1| PREDICTED: SNAP25 homologous protein SNAP33-like [Solanum lycopersicum]
 ref|XP_010322575.1| PREDICTED: SNAP25 homologous protein SNAP33-like [Solanum lycopersicum]
Length=306

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 65/97 (67%), Gaps = 7/97 (7%)
 Frame = +2

Query  212  MFGHKKSPLHGNSKSHSI--VPGSNSTSNPFDSDDECDKKQNVKQSR-TSSEPTPVTLNT  382
            M G KKSPLH +++  S   V  SNS SNPFDSD+E DKKQ VK SR  SSEP+    N 
Sbjct  1    MHGLKKSPLHRSARKKSADPVAHSNSGSNPFDSDNESDKKQTVKPSRKISSEPSAAAPNL  60

Query  383  STNPFDDDEAKGKsssssssTYSFTTERNRYKNDFRD  493
            STNPFDDDE K     + S  YS +T RN+YKNDFR+
Sbjct  61   STNPFDDDEIK----ETPSHAYSTSTARNKYKNDFRE  93



>ref|XP_006345160.1| PREDICTED: SNAP25 homologous protein SNAP33-like [Solanum tuberosum]
Length=306

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 71/98 (72%), Gaps = 7/98 (7%)
 Frame = +2

Query  212  MFGHKKSPLHGNSKSHSIVPGSN--STSNPFDSDDECDKKQNVKQS-RTSSEPTPVTLNT  382
            MF  KK PLH N+++HS+ PGS   S+SNPFDSD+E D K+ +K + RTSSEP+ +T + 
Sbjct  1    MFRLKKLPLHRNARNHSVNPGSGGYSSSNPFDSDNESDNKETIKPARRTSSEPSLITPHL  60

Query  383  STNPFDDDEAKGKsssssssTYSFT-TERNRYKNDFRD  493
            STNPFDDD+       + SS YS T TERNR+KN+FRD
Sbjct  61   STNPFDDDD---DIKRTHSSAYSATSTERNRFKNEFRD  95



>gb|AEB71568.1| SNAP33 [Solanum chacoense]
Length=306

 Score = 88.2 bits (217),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 71/98 (72%), Gaps = 7/98 (7%)
 Frame = +2

Query  212  MFGHKKSPLHGNSKSHSIVPGSN--STSNPFDSDDECDKKQNVKQS-RTSSEPTPVTLNT  382
            MF  KKS LH N+++HS+ PGS   S+SNPFDSD+E D K+ +K + RTSSEP+ +T + 
Sbjct  1    MFRLKKSLLHRNARNHSVNPGSGGYSSSNPFDSDNESDNKETIKPARRTSSEPSLITPHL  60

Query  383  STNPFDDDEAKGKsssssssTYSFT-TERNRYKNDFRD  493
            STNPFDDD+       + SS YS T TERNR+KN+FRD
Sbjct  61   STNPFDDDD---DIKRTHSSAYSATSTERNRFKNEFRD  95



>ref|XP_011087328.1| PREDICTED: SNAP25 homologous protein SNAP33 [Sesamum indicum]
Length=305

 Score = 87.0 bits (214),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 67/99 (68%), Gaps = 10/99 (10%)
 Frame = +2

Query  212  MFGHKKSPLHGNSK---SHSIVPGSNSTSNPFDSDDECD-KKQNVKQSRTSSEPTPVTLN  379
            MFG KKSPLH  SK   + S  P SN  +NPFDSDDE D KK     +RTSSEP+ V  N
Sbjct  1    MFGLKKSPLHRFSKHNSADSAFPVSNH-ANPFDSDDELDNKKIREASARTSSEPSLVASN  59

Query  380  TSTNPFDDDEAKGKsssssssTYSF-TTERNRYKNDFRD  493
             STNPFDDDE KG    +SS+ +S  ++ RNRYKNDFRD
Sbjct  60   LSTNPFDDDETKG----TSSTQWSINSSARNRYKNDFRD  94



>ref|XP_006440694.1| hypothetical protein CICLE_v10021320mg [Citrus clementina]
 gb|ESR53934.1| hypothetical protein CICLE_v10021320mg [Citrus clementina]
Length=305

 Score = 82.4 bits (202),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 67/98 (68%), Gaps = 8/98 (8%)
 Frame = +2

Query  212  MFGHKKSPLHGNSKSHSIVPG--SNSTSNPFDSDDECDKKQNVKQS-RTSSEPTPVTLNT  382
            MFG KKSPL    + +S+ PG   +S SNPFDSDDE D KQ +K S RTSSEP   T   
Sbjct  1    MFGLKKSPLR-VGRHNSVDPGHQVSSRSNPFDSDDELDNKQTLKPSKRTSSEPNLTTSKV  59

Query  383  STNPFDDDEAKGKsssssssTYSFTT-ERNRYKNDFRD  493
            STNPFDDD+ K    +++ S+YS T+  RN+Y+NDFRD
Sbjct  60   STNPFDDDDIK---ENTAVSSYSLTSAARNKYRNDFRD  94



>gb|KDO54588.1| hypothetical protein CISIN_1g021914mg [Citrus sinensis]
Length=305

 Score = 82.4 bits (202),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 67/98 (68%), Gaps = 8/98 (8%)
 Frame = +2

Query  212  MFGHKKSPLHGNSKSHSIVPG--SNSTSNPFDSDDECDKKQNVKQS-RTSSEPTPVTLNT  382
            MFG KKSPL    + +S+ PG   +S SNPFDSDDE D KQ +K S RTSSEP   T   
Sbjct  1    MFGLKKSPLR-VGRHNSVDPGHQVSSRSNPFDSDDELDNKQTLKPSKRTSSEPNLTTSKV  59

Query  383  STNPFDDDEAKGKsssssssTYSFTT-ERNRYKNDFRD  493
            STNPFDDD+ K    +++ S+YS T+  RN+Y+NDFRD
Sbjct  60   STNPFDDDDIK---ENTAVSSYSLTSAARNKYRNDFRD  94



>ref|XP_006477622.1| PREDICTED: SNAP25 homologous protein SNAP33-like [Citrus sinensis]
Length=305

 Score = 82.4 bits (202),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 67/98 (68%), Gaps = 8/98 (8%)
 Frame = +2

Query  212  MFGHKKSPLHGNSKSHSIVPG--SNSTSNPFDSDDECDKKQNVKQS-RTSSEPTPVTLNT  382
            MFG KKSPL    + +S+ PG   +S SNPFDSDDE D KQ +K S RTSSEP   T   
Sbjct  1    MFGLKKSPLR-VGRHNSVDPGHRVSSRSNPFDSDDELDNKQTLKPSKRTSSEPNLTTSKV  59

Query  383  STNPFDDDEAKGKsssssssTYSFTT-ERNRYKNDFRD  493
            STNPFDDD+ K    +++ S+YS T+  RN+Y+NDFRD
Sbjct  60   STNPFDDDDIK---ENTAVSSYSLTSAARNKYRNDFRD  94



>ref|XP_004236003.1| PREDICTED: SNAP25 homologous protein SNAP33-like [Solanum lycopersicum]
 ref|XP_010318837.1| PREDICTED: SNAP25 homologous protein SNAP33-like [Solanum lycopersicum]
Length=343

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 58/135 (43%), Positives = 73/135 (54%), Gaps = 44/135 (33%)
 Frame = +2

Query  212  MFGHKKSPLHGNSKSHSIVPGSN--STSNPFDSDDECDKKQNVKQSRT------------  349
            MFG KKSPLH N+++HS+ PGS   S+SNPFDSD+E D K+ +K +RT            
Sbjct  1    MFGLKKSPLHRNARNHSVNPGSGGYSSSNPFDSDNESDNKETIKPARTPLHRNARNHSVN  60

Query  350  --------------------------SSEPTPVTLNTSTNPFDDDEAKGKsssssssTYS  451
                                      SSEP+PVT + STN FDDD+       + SS YS
Sbjct  61   PGFGGYPSSNPFDSDNKETIKPVRRTSSEPSPVTPHLSTNTFDDDD---DIKQTHSSAYS  117

Query  452  FT-TERNRYKNDFRD  493
             T TERN+YKN+FRD
Sbjct  118  VTSTERNKYKNEFRD  132



>ref|XP_011072852.1| PREDICTED: SNAP25 homologous protein SNAP33-like [Sesamum indicum]
 ref|XP_011072853.1| PREDICTED: SNAP25 homologous protein SNAP33-like [Sesamum indicum]
 ref|XP_011072854.1| PREDICTED: SNAP25 homologous protein SNAP33-like [Sesamum indicum]
Length=321

 Score = 79.3 bits (194),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 66/114 (58%), Gaps = 23/114 (20%)
 Frame = +2

Query  212  MFGHKKSPLHGNSKSHSIVPG--SNSTSNPFDSDDECDKKQNVKQS--------------  343
            MFG KKSPLH  SK +S  PG   N+ +NPFDSDDE D KQ +K S              
Sbjct  1    MFGLKKSPLHRFSKHNSADPGFPVNNHTNPFDSDDELDNKQTLKSSGRTSSHELDNKQTL  60

Query  344  ----RTSSEPTPVTLNTSTNPFDDDEAKGKsssssssTYSFTTERNRYKNDFRD  493
                RTSSEP+  T + STNPFDD E KG   +SSS  Y  +  +N+YKNDF D
Sbjct  61   KSSGRTSSEPSLFTSDLSTNPFDDVEIKG---TSSSQNYLSSAAKNKYKNDFHD  111



>ref|XP_007037493.1| Synaptosomal associated protein, putative [Theobroma cacao]
 gb|EOY21994.1| Synaptosomal associated protein, putative [Theobroma cacao]
Length=305

 Score = 76.6 bits (187),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 65/97 (67%), Gaps = 6/97 (6%)
 Frame = +2

Query  212  MFGHKKSPLHGNSKSHSIVPGSN--STSNPFDSDDECDKKQNVKQS-RTSSEPTPVTLNT  382
            M G KKSPL   +K +S+ PG    S SNPFDSDDE D KQ +K S RTSSEPT    N 
Sbjct  1    MLGFKKSPLK-TAKHNSVDPGRVVPSRSNPFDSDDELDNKQTLKPSRRTSSEPTLNPPNF  59

Query  383  STNPFDDDEAKGKsssssssTYSFTTERNRYKNDFRD  493
             TNPFDDDE   K +SSSSS +  +  R++YKNDFRD
Sbjct  60   GTNPFDDDEE--KVNSSSSSYWQASATRDKYKNDFRD  94



>ref|XP_002284486.1| PREDICTED: SNAP25 homologous protein SNAP33 [Vitis vinifera]
Length=305

 Score = 73.9 bits (180),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 68/97 (70%), Gaps = 6/97 (6%)
 Frame = +2

Query  212  MFGHKKSPLHGNSKSHSIVPG--SNSTSNPFDSDDECDKKQNVKQSR-TSSEPTPVTLNT  382
            MFG KKSPLH  +K +S+ PG   +S++NPFDS D+ D K+ +K SR TSSEP  +T   
Sbjct  1    MFGLKKSPLHKFAKHNSVDPGYPHSSSTNPFDSHDDLDGKKALKPSRRTSSEPM-LTTQP  59

Query  383  STNPFDDDEAKGKsssssssTYSFTTERNRYKNDFRD  493
            + NPFDDD  KG   SSSSS +  ++ERN+YKNDF D
Sbjct  60   NPNPFDDDVGKGS--SSSSSNFLLSSERNKYKNDFHD  94



>ref|XP_002514694.1| synaptosomal associated protein, putative [Ricinus communis]
 gb|EEF47800.1| synaptosomal associated protein, putative [Ricinus communis]
Length=305

 Score = 73.9 bits (180),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 61/97 (63%), Gaps = 6/97 (6%)
 Frame = +2

Query  212  MFGHKKSPLHGNSKSHSIVPG--SNSTSNPFDSDDECDKKQNVKQSR-TSSEPTPVTLNT  382
            MFG KKSPLH   K + + P       SNPFDSDDE D+KQ +K SR TS EP   T N 
Sbjct  1    MFGLKKSPLH-LGKHNKVDPQYPDPPRSNPFDSDDELDRKQTLKTSRKTSPEPNLTTPNF  59

Query  383  STNPFDDDEAKGKsssssssTYSFTTERNRYKNDFRD  493
              NPFDDDE KG   SSSSS    ++ RN YKNDFRD
Sbjct  60   GANPFDDDEEKGT--SSSSSYALTSSARNNYKNDFRD  94



>gb|EYU23575.1| hypothetical protein MIMGU_mgv1a010387mg [Erythranthe guttata]
Length=313

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 67/100 (67%), Gaps = 6/100 (6%)
 Frame = +2

Query  212  MFGHKKSPLHGNSKSHSIVPG--SNSTSNPFDSDDECD--KKQNVK-QSRTSSEPTPVTL  376
            MFGH KSPLH  SK  S  PG    + +NPFDSDDE D  K+  +K  +RTSSEP+ +T 
Sbjct  1    MFGHMKSPLHKLSKHKSADPGFVKPAAANPFDSDDELDINKQPTLKTAARTSSEPSVITS  60

Query  377  NTSTNPFDDDEA-KGKsssssssTYSFTTERNRYKNDFRD  493
            N  ++ FDDD   KG SSSSSS T   ++ RN+YKNDFR+
Sbjct  61   NMRSSLFDDDVVTKGTSSSSSSQTSVTSSARNKYKNDFRE  100



>gb|KJB50983.1| hypothetical protein B456_008G196700 [Gossypium raimondii]
 gb|KJB50984.1| hypothetical protein B456_008G196700 [Gossypium raimondii]
 gb|KJB50985.1| hypothetical protein B456_008G196700 [Gossypium raimondii]
Length=304

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 62/97 (64%), Gaps = 7/97 (7%)
 Frame = +2

Query  212  MFGHKKSPLHGNSKSHSI--VPGSNSTSNPFDSDDECDKKQNVKQS-RTSSEPTPVTLNT  382
            M G KKSPL   +K +S+   P + S SNPFDSDDE D KQ +K S RTSSEPT    N 
Sbjct  1    MLGLKKSPLK-TAKHNSVDPAPVAASRSNPFDSDDEFDNKQTLKPSRRTSSEPTLSPPNF  59

Query  383  STNPFDDDEAKGKsssssssTYSFTTERNRYKNDFRD  493
              NP DD+E K    +SSSS +  +  RN+YKNDFRD
Sbjct  60   GANPLDDNEGK---VNSSSSYWQSSASRNKYKNDFRD  93



>gb|KDP31313.1| hypothetical protein JCGZ_11689 [Jatropha curcas]
Length=302

 Score = 68.6 bits (166),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 52/95 (55%), Positives = 58/95 (61%), Gaps = 5/95 (5%)
 Frame = +2

Query  212  MFGHKKSPLHGNSKSHSIVPGSNSTSNPFDSDDECDKKQNVKQSR-TSSEPTPVTLNTST  388
            MFG KKSPL      H+ V      SNPFDSDDE D K+ +K SR TS EP   T N  T
Sbjct  1    MFGLKKSPLR--VPKHNKVDPDLPRSNPFDSDDELDNKKTIKPSRKTSPEPNLTTPNFGT  58

Query  389  NPFDDDEAKGKsssssssTYSFTTERNRYKNDFRD  493
            NPFDD E  G  +SSSSS    +  RN+YKNDFRD
Sbjct  59   NPFDDKEEIG--TSSSSSYSYASGARNQYKNDFRD  91



>ref|XP_010106653.1| SNAP25-like protein [Morus notabilis]
 gb|EXC11032.1| SNAP25-like protein [Morus notabilis]
Length=306

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 50/97 (52%), Positives = 63/97 (65%), Gaps = 4/97 (4%)
 Frame = +2

Query  212  MFGHKKSPLH-GNSKSHSIVPGSNSTSNPFDSDDECDKKQNVKQSR-TSSEPTPVTLNTS  385
            MFG KKSPL  G   +   V  + S +NPFDSDDE + K     SR TSSEPT     +S
Sbjct  1    MFGLKKSPLKFGKHNTVDPVYPNPSRTNPFDSDDEIETKPKHNSSRRTSSEPTLFVPESS  60

Query  386  TNPFDDDEAKGKsssssssTYSFT-TERNRYKNDFRD  493
            TNPFDDD+ +G+ ++SS  ++S T   RN+YKNDFRD
Sbjct  61   TNPFDDDD-QGRGTTSSLYSHSSTLAARNKYKNDFRD  96



>gb|KHG22115.1| SNAP25 ous SNAP33 -like protein [Gossypium arboreum]
Length=304

 Score = 65.9 bits (159),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 60/97 (62%), Gaps = 7/97 (7%)
 Frame = +2

Query  212  MFGHKKSPLHGNSKSHSIVPG--SNSTSNPFDSDDECDKKQNVKQS-RTSSEPTPVTLNT  382
            M G KKSPL   +K +S+ P   + S SNPFDSDDE D KQ +K S RTSSEPT    N 
Sbjct  1    MLGLKKSPLK-TAKHNSVDPARVAASRSNPFDSDDEFDNKQTLKPSRRTSSEPTLSPPNF  59

Query  383  STNPFDDDEAKGKsssssssTYSFTTERNRYKNDFRD  493
              NP  D+E K    +SSSS +  +  RN YKNDFRD
Sbjct  60   GANPLIDNEGK---VNSSSSYWQSSASRNNYKNDFRD  93



>ref|XP_010044425.1| PREDICTED: putative SNAP25 homologous protein SNAP30 [Eucalyptus 
grandis]
 ref|XP_010044426.1| PREDICTED: putative SNAP25 homologous protein SNAP30 [Eucalyptus 
grandis]
 ref|XP_010044427.1| PREDICTED: putative SNAP25 homologous protein SNAP30 [Eucalyptus 
grandis]
 gb|KCW86518.1| hypothetical protein EUGRSUZ_B03167 [Eucalyptus grandis]
Length=303

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 60/93 (65%), Gaps = 2/93 (2%)
 Frame = +2

Query  212  MFGHKKSPLHGNSKSHSIVPGSNSTSNPFDSDDECDKKQNVKQSRTS-SEPTPVTLNTST  388
            MFG  KSP++  SK +S+ P S+ T NPFDSD E D K  +K SR + SEP  +  N   
Sbjct  1    MFGFLKSPVNKVSKQNSVDPPSSGT-NPFDSDTESDTKSTIKPSRRANSEPVLIVPNLGG  59

Query  389  NPFDDDEAKGKsssssssTYSFTTERNRYKNDF  487
            +PFDDD+ +  +SSS+S     +T R++Y+NDF
Sbjct  60   SPFDDDKGRRGASSSASPYSGSSTARDKYRNDF  92



>ref|XP_008447897.1| PREDICTED: SNAP25 homologous protein SNAP33-like [Cucumis melo]
 ref|XP_008447972.1| PREDICTED: SNAP25 homologous protein SNAP33-like [Cucumis melo]
Length=292

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 58/87 (67%), Gaps = 5/87 (6%)
 Frame = +2

Query  236  LHGNSKSHSIVPGSNSTSNPFDSDDECDKKQNVKQS-RTSSEPTPVTLNTSTNPFDDDEA  412
            + G+ K H  +   +ST NPF+SDD+   KQN+  S RTSS+P+ +T   S+NPFDDD  
Sbjct  1    MFGSKKVHFRIGKHSSTPNPFESDDDVKAKQNLVSSQRTSSDPSLLTEKFSSNPFDDDHG  60

Query  413  KGKsssssssTYSFTTERNRYKNDFRD  493
                SSSSS T+S   ERN+YKNDFRD
Sbjct  61   HA-PSSSSSITWS---ERNKYKNDFRD  83



>ref|XP_002322041.1| hypothetical protein POPTR_0015s03450g [Populus trichocarpa]
 gb|EEF06168.1| hypothetical protein POPTR_0015s03450g [Populus trichocarpa]
Length=305

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 60/98 (61%), Gaps = 8/98 (8%)
 Frame = +2

Query  212  MFGHKKSPLHGNSKSHSIVPGSNSTS--NPFDSDDECDKKQNVKQSR-TSSEPTPVTLNT  382
            MFG KKSPL   SK   + P   + S  NPFDSDDE D K+ +K SR TSSEP       
Sbjct  1    MFGSKKSPLK-ISKHTRVDPECPAPSRPNPFDSDDEFDTKKTLKTSRKTSSEPNLTAPCF  59

Query  383  STNPFDDDEAKGKsssssssTYSF-TTERNRYKNDFRD  493
            STNPFD DE +G   SS+SSTY   +  R +Y NDFRD
Sbjct  60   STNPFDGDEERG---SSASSTYFLASAARQKYNNDFRD  94



>ref|XP_010678419.1| PREDICTED: SNAP25 homologous protein SNAP33-like [Beta vulgaris 
subsp. vulgaris]
Length=311

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 50/101 (50%), Positives = 65/101 (64%), Gaps = 8/101 (8%)
 Frame = +2

Query  212  MFGHKKSPLHGNSK---SHSIVPGSNSTSNPFDSDDECDK--KQNVKQSRTSSEPTPVTL  376
            M G K SPLH  +K   + S VP SN++SNPFDSDDE D+  KQ       S+ P  +  
Sbjct  1    MIGIKNSPLHRFAKPSSARSKVP-SNTSSNPFDSDDESDRKPKQGSATKPPSAPPKDLPN  59

Query  377  NTSTNPFDDD-EAKGKsssssssTYSFT-TERNRYKNDFRD  493
            ++ TNPFDDD + + +  SSS+S YSFT  +RN+YKNDF D
Sbjct  60   SSMTNPFDDDVDNREREESSSTSKYSFTYAQRNKYKNDFYD  100



>ref|XP_011013081.1| PREDICTED: SNAP25 homologous protein SNAP33 [Populus euphratica]
 ref|XP_011013082.1| PREDICTED: SNAP25 homologous protein SNAP33 [Populus euphratica]
Length=305

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 61/98 (62%), Gaps = 8/98 (8%)
 Frame = +2

Query  212  MFGHKKSPLHGNSKSHSIVPGSNSTS--NPFDSDDECDKKQNVKQSR-TSSEPTPVTLNT  382
            MFG KKSPL   SK   + P   + S  NPFDSDDE D K+ +K SR TSSEP       
Sbjct  1    MFGSKKSPLK-ISKHTRVDPECPAPSRPNPFDSDDEFDTKKTLKPSRKTSSEPNLTAPCF  59

Query  383  STNPFDDDEAKGKsssssssTYSF-TTERNRYKNDFRD  493
            STNPFD DE +G   SS+SSTY   +  R++Y NDFRD
Sbjct  60   STNPFDGDEERG---SSASSTYFLASAARHKYNNDFRD  94



>gb|KJB08340.1| hypothetical protein B456_001G078100 [Gossypium raimondii]
 gb|KJB08341.1| hypothetical protein B456_001G078100 [Gossypium raimondii]
 gb|KJB08343.1| hypothetical protein B456_001G078100 [Gossypium raimondii]
 gb|KJB08344.1| hypothetical protein B456_001G078100 [Gossypium raimondii]
Length=304

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 65/98 (66%), Gaps = 8/98 (8%)
 Frame = +2

Query  212  MFGHKKSPLHGNSKSHSIVPGSNST-SNPFDSDDECDKKQNVKQSRTSSEPTPVTLNT--  382
            M G K+SPL    K +S+ PG  +  +NPFDSDDE D  Q +K +RT+S  + +TLN   
Sbjct  1    MSGLKRSPLK-TVKLNSVDPGRVAAQTNPFDSDDELDNMQTLKPTRTTS--SKLTLNPPN  57

Query  383  -STNPFDDDEAKGKsssssssTYSFTTERNRYKNDFRD  493
              TNPFDDDE K  +SSSSSS +  +  +N+YKNDFRD
Sbjct  58   FRTNPFDDDEEK-VNSSSSSSYWQTSALQNKYKNDFRD  94



>gb|KHG01928.1| SNAP25 ous SNAP33 -like protein [Gossypium arboreum]
Length=303

 Score = 63.5 bits (153),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 63/95 (66%), Gaps = 3/95 (3%)
 Frame = +2

Query  212  MFGHKKSPLHGNSKSHSIVPGSNS-TSNPFDSDDECDKKQNVKQSRTSSEPTPVTLNTST  388
            M G K+SPL   +K +S+ P   +  +NPFDSDDE D  Q +K +RT+S    ++ N  T
Sbjct  1    MSGLKRSPLK-TAKLNSVDPRRIAPQTNPFDSDDELDNMQTLKPTRTTSSKPTLSPNFRT  59

Query  389  NPFDDDEAKGKsssssssTYSFTTERNRYKNDFRD  493
            NPFDDDE K  +SSSSSS +  +  +N+YKNDFRD
Sbjct  60   NPFDDDEEK-VNSSSSSSYWQTSALQNKYKNDFRD  93



>ref|XP_003524667.1| PREDICTED: SNAP25 homologous protein SNAP33-like [Glycine max]
 gb|KHN48724.1| SNAP25 like protein SNAP33 [Glycine soja]
Length=300

 Score = 63.2 bits (152),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 57/96 (59%), Gaps = 9/96 (9%)
 Frame = +2

Query  212  MFGHKKSPLHGNSKSHSIVPGSNSTSNPFDSDDEC-DKKQNVKQSRTSSEPTPVTLNTST  388
            M G KKSPL     S      + S +NPFDSDDE  D K+     +TSSE    TL  +T
Sbjct  1    MSGSKKSPLKVAKPS-----SAESWTNPFDSDDEGKDSKKYSSSRKTSSERALATLEVNT  55

Query  389  NPFDDDEAKGKsssssssTYSF-TTERNRYKNDFRD  493
            NPFDDD    K   SSS++Y+F +  RNRYKNDFRD
Sbjct  56   NPFDDDIDANK--KSSSTSYAFQSANRNRYKNDFRD  89



>ref|XP_011010041.1| PREDICTED: SNAP25 homologous protein SNAP33-like isoform X1 [Populus 
euphratica]
Length=326

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 63/102 (62%), Gaps = 12/102 (12%)
 Frame = +2

Query  206  LKMFGHKKSPL----HGNSKSHSIVPGSNSTSNPFDSDDECDKKQNVKQSR-TSSEPTPV  370
            ++MFG KKSPL    H  +      P   S SNPF+S++    K+++K SR TSSEP   
Sbjct  20   IRMFGSKKSPLKISEHNKADPECPAP---SRSNPFESENAVGTKKSLKPSRKTSSEPNLT  76

Query  371  TLNTSTNPFDDDEAKGKsssssssTYSFT-TERNRYKNDFRD  493
            + N  +NPFD+DE +G    SSSSTYS   + R++YKNDF D
Sbjct  77   SPNFRSNPFDNDEERG---LSSSSTYSLALSTRHKYKNDFLD  115



>ref|XP_004137424.1| PREDICTED: SNAP25 homologous protein SNAP33-like [Cucumis sativus]
 ref|XP_004157458.1| PREDICTED: SNAP25 homologous protein SNAP33-like [Cucumis sativus]
 gb|KGN64035.1| hypothetical protein Csa_1G039020 [Cucumis sativus]
Length=293

 Score = 60.1 bits (144),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 55/87 (63%), Gaps = 5/87 (6%)
 Frame = +2

Query  236  LHGNSKSHSIVPGSNSTSNPFDSDDECDKKQNVKQS-RTSSEPTPVTLNTSTNPFDDDEA  412
            + G+ K H  +   +ST NP +SDD+   KQN+  S RTSS+P+ +T   S+NPFDDD  
Sbjct  1    MFGSRKVHFRLGKHSSTPNPIESDDDVKAKQNLVSSQRTSSDPSLLTEKFSSNPFDDDHG  60

Query  413  KGKsssssssTYSFTTERNRYKNDFRD  493
                   SSS+ +  +ERN+YKNDFRD
Sbjct  61   HA----PSSSSSTTWSERNKYKNDFRD  83



>ref|XP_011010042.1| PREDICTED: SNAP25 homologous protein SNAP33-like isoform X2 [Populus 
euphratica]
Length=305

 Score = 60.1 bits (144),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 47/100 (47%), Positives = 61/100 (61%), Gaps = 12/100 (12%)
 Frame = +2

Query  212  MFGHKKSPL----HGNSKSHSIVPGSNSTSNPFDSDDECDKKQNVKQSR-TSSEPTPVTL  376
            MFG KKSPL    H  +      P   S SNPF+S++    K+++K SR TSSEP   + 
Sbjct  1    MFGSKKSPLKISEHNKADPECPAP---SRSNPFESENAVGTKKSLKPSRKTSSEPNLTSP  57

Query  377  NTSTNPFDDDEAKGKsssssssTYSFT-TERNRYKNDFRD  493
            N  +NPFD+DE +G    SSSSTYS   + R++YKNDF D
Sbjct  58   NFRSNPFDNDEERG---LSSSSTYSLALSTRHKYKNDFLD  94



>ref|XP_004299325.1| PREDICTED: SNAP25 homologous protein SNAP33-like [Fragaria vesca 
subsp. vesca]
Length=307

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 45/103 (44%), Positives = 60/103 (58%), Gaps = 14/103 (14%)
 Frame = +2

Query  212  MFGHKKSPLHGNSKSHSIVPG--SNSTSNPFDSDDECDKKQNVKQSRTSS-------EPT  364
            MFG KKSP+   +K +S+ P   ++S+SNPFD D+    +QN K +           +  
Sbjct  1    MFGLKKSPIRA-AKHNSVDPLYPASSSSNPFD-DEPAQVRQNEKHALVGQNAKHANDKQA  58

Query  365  PVTLNTSTNPFDDDEAKGKsssssssTYSFTTERNRYKNDFRD  493
                NTST PFDDD+ K  +SSS   TY+   ERN+YKNDFRD
Sbjct  59   LFGQNTSTKPFDDDQGKENNSSSYKGTYA---ERNKYKNDFRD  98



>ref|XP_007155259.1| hypothetical protein PHAVU_003G186500g [Phaseolus vulgaris]
 ref|XP_007155260.1| hypothetical protein PHAVU_003G186500g [Phaseolus vulgaris]
 gb|ESW27253.1| hypothetical protein PHAVU_003G186500g [Phaseolus vulgaris]
 gb|ESW27254.1| hypothetical protein PHAVU_003G186500g [Phaseolus vulgaris]
Length=300

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 57/96 (59%), Gaps = 9/96 (9%)
 Frame = +2

Query  212  MFGHKKSPLHGNSKSHSIVPGSNSTSNPFDSDDECDKKQNVKQSR-TSSEPTPVTLNTST  388
            M G KKSPL   +K  S+     S +NPFDSDDE    +    SR TSS+   V+L  +T
Sbjct  1    MSGAKKSPLK-VAKPSSV----ESWTNPFDSDDEEKNTKRYSSSRKTSSDRALVSLEVNT  55

Query  389  NPFDDDEAKGKsssssssTYSF-TTERNRYKNDFRD  493
            NPFDDD    K   SSS +Y+F +  RNRYKN FRD
Sbjct  56   NPFDDDIDATK--KSSSVSYAFQSANRNRYKNGFRD  89



>ref|XP_010258125.1| PREDICTED: SNAP25 homologous protein SNAP33-like [Nelumbo nucifera]
Length=298

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 61/95 (64%), Gaps = 9/95 (9%)
 Frame = +2

Query  212  MFGHKKSPLHGNSKSHSIVPGSNSTSNPFDSDDECDKKQNVKQSR-TSSEPTPVTLNTST  388
            MFG +K+P   N  +         +SNPFDSD E D K  +K SR  SSEP+ VT N ++
Sbjct  1    MFGFRKTPPSANKVA-------KHSSNPFDSDSETDAKHTLKPSRRISSEPSLVTPNFNS  53

Query  389  NPFDDDEAKGKsssssssTYSFTTERNRYKNDFRD  493
            NPFDDD+  G+ +SSSS + + +  RN+YKNDFRD
Sbjct  54   NPFDDDDDDGRGASSSSYSAT-SAARNKYKNDFRD  87



>ref|XP_004508695.1| PREDICTED: SNAP25 homologous protein SNAP33-like isoform X1 [Cicer 
arietinum]
 ref|XP_004508696.1| PREDICTED: SNAP25 homologous protein SNAP33-like isoform X2 [Cicer 
arietinum]
Length=308

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 64/98 (65%), Gaps = 5/98 (5%)
 Frame = +2

Query  212  MFGHKKSPLHGNSKSHSIVPGS-NSTSNPFDSDD-ECDKKQNVKQSRTSSEPTPVTLNTS  385
            MF  KKSP+    K  S+ P +  S SNPFDSDD E D ++     +TSS+   VTL  +
Sbjct  1    MFNSKKSPMKV-GKPSSVAPANIKSWSNPFDSDDEEKDNRKYNSSKKTSSQRPLVTLEVN  59

Query  386  TNPFDD-DEAKGKsssssssTYSF-TTERNRYKNDFRD  493
            TNPFDD D+ K  SSSSSSS+Y   + +RNRYKN+FRD
Sbjct  60   TNPFDDIDDNKHSSSSSSSSSYVRQSADRNRYKNNFRD  97



>ref|NP_001241533.1| uncharacterized protein LOC100793323 [Glycine max]
 ref|XP_006600190.1| PREDICTED: uncharacterized protein LOC100793323 isoform X1 [Glycine 
max]
 gb|ACU23055.1| unknown [Glycine max]
 gb|KHN18338.1| SNAP25 like protein SNAP33 [Glycine soja]
Length=300

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 56/96 (58%), Gaps = 9/96 (9%)
 Frame = +2

Query  212  MFGHKKSPLHGNSKSHSIVPGSNSTSNPFDSDDE-CDKKQNVKQSRTSSEPTPVTLNTST  388
            MFG KKSPL   +K  S+     S +NPFDS+DE  D K+     +TSSE    TL  +T
Sbjct  1    MFGSKKSPLK-VAKPSSV----ESWTNPFDSNDEGMDTKKYSSSRKTSSERALTTLGVNT  55

Query  389  NPFDDDEAKGKsssssssTYSF-TTERNRYKNDFRD  493
            NPFDD     K   SSS+ Y F +   N+YKNDFRD
Sbjct  56   NPFDDGTDANK--KSSSTLYGFQSANWNKYKNDFRD  89



>ref|XP_007209588.1| hypothetical protein PRUPE_ppa011254mg [Prunus persica]
 gb|EMJ10787.1| hypothetical protein PRUPE_ppa011254mg [Prunus persica]
Length=217

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 50/97 (52%), Gaps = 29/97 (30%)
 Frame = +2

Query  212  MFGHKKSPLHGNSKSHSIVPGSNSTSNPFDSDDECDKKQNVKQSRTSSEPTPVTLNTSTN  391
            MFG KKSPL   +  H  V  ++S SNPF++                    PV  N STN
Sbjct  1    MFGLKKSPL--KAAKHITVNPASSGSNPFEN-------------------APVGQNASTN  39

Query  392  PFDDDEAKGKsssssssTYSF---TTERNRYKNDFRD  493
            PFDD + + K S     +YS+    TERN+YKNDFRD
Sbjct  40   PFDDGQGEEKYS-----SYSYKTTLTERNKYKNDFRD  71



>ref|XP_006376804.1| hypothetical protein POPTR_0012s06830g [Populus trichocarpa]
 gb|ERP54601.1| hypothetical protein POPTR_0012s06830g [Populus trichocarpa]
Length=249

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 59/100 (59%), Gaps = 12/100 (12%)
 Frame = +2

Query  212  MFGHKKSPL----HGNSKSHSIVPGSNSTSNPFDSDDECDKKQNVKQSR-TSSEPTPVTL  376
            MFG KKSPL    H  +      P   S SN F+S++    K+++K  R TSSEP   + 
Sbjct  1    MFGSKKSPLKISEHNKADPECPAP---SRSNHFESENAVGTKKSLKPPRKTSSEPNLTSP  57

Query  377  NTSTNPFDDDEAKGKsssssssTYSFT-TERNRYKNDFRD  493
            N  TNPFD+DE +G    SSSSTYS   + R++YKNDF D
Sbjct  58   NFRTNPFDNDEERG---LSSSSTYSLALSTRHKYKNDFLD  94



>gb|AFK41395.1| unknown [Lotus japonicus]
Length=305

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 57/97 (59%), Gaps = 6/97 (6%)
 Frame = +2

Query  212  MFGHKKSPLHGNSKSHSIVPG--SNSTSNPFDSDDECDKKQNVKQSR-TSSEPTPVTLNT  382
            MF  KKSP+   +K  S+ P     S SNPFDSDDE +  +    SR TSSE    TL  
Sbjct  1    MFSSKKSPVK-VAKPSSVGPVYPVKSGSNPFDSDDEGNDNKKYNSSRKTSSERALATLEV  59

Query  383  STNPFDDDEAKGKsssssssTYSFTTERNRYKNDFRD  493
            +TNPFDD +   K SSS  +  S   +RNRY+NDFR+
Sbjct  60   NTNPFDDVDDTKKPSSSLYAAPS--ADRNRYRNDFRE  94



>ref|XP_010546183.1| PREDICTED: SNAP25 homologous protein SNAP33 [Tarenaya hassleriana]
Length=305

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 57/97 (59%), Gaps = 6/97 (6%)
 Frame = +2

Query  212  MFGHKKSPLHGNSKSHSIVPG--SNSTSNPFDSDDECDKKQNVKQS-RTSSEPTPVTLNT  382
            MFG KKSP     K  S+ PG   +S +NPFDSDDE D +Q +K S RTSS+P+    + 
Sbjct  1    MFGLKKSPAR-IPKHKSVDPGFAPSSKANPFDSDDEFDNRQTLKPSKRTSSDPSLAATSF  59

Query  383  STNPFDDDEAKGKsssssssTYSFTTERNRYKNDFRD  493
             TNPFDD++ + + + S +        +N YK DF D
Sbjct  60   GTNPFDDEQVETEHAPSKNPLTR--DAKNMYKTDFCD  94



>ref|XP_002317966.1| hypothetical protein POPTR_0012s06830g [Populus trichocarpa]
 gb|EEE96186.1| hypothetical protein POPTR_0012s06830g [Populus trichocarpa]
Length=305

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 59/100 (59%), Gaps = 12/100 (12%)
 Frame = +2

Query  212  MFGHKKSPL----HGNSKSHSIVPGSNSTSNPFDSDDECDKKQNVKQSR-TSSEPTPVTL  376
            MFG KKSPL    H  +      P   S SN F+S++    K+++K  R TSSEP   + 
Sbjct  1    MFGSKKSPLKISEHNKADPECPAP---SRSNHFESENAVGTKKSLKPPRKTSSEPNLTSP  57

Query  377  NTSTNPFDDDEAKGKsssssssTYSFT-TERNRYKNDFRD  493
            N  TNPFD+DE +G    SSSSTYS   + R++YKNDF D
Sbjct  58   NFRTNPFDNDEERG---LSSSSTYSLALSTRHKYKNDFLD  94



>ref|XP_006394530.1| hypothetical protein EUTSA_v10004672mg [Eutrema salsugineum]
 dbj|BAJ34130.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ31816.1| hypothetical protein EUTSA_v10004672mg [Eutrema salsugineum]
Length=302

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 58/98 (59%), Gaps = 11/98 (11%)
 Frame = +2

Query  212  MFGHKKSPLHGNSKSHSIVPGSN--STSNPFDSDDECDKKQNVKQS-RTSSEPTPVTLNT  382
            MFG +KSP     K +S+ PG    S  NPFDSDDE D K  +  S RTSSEP   +L  
Sbjct  1    MFGLRKSPAK-LPKHNSVDPGFQKFSKPNPFDSDDELDNKHTLNPSKRTSSEP---SLAE  56

Query  383  STNPFDDDEA-KGKsssssssTYSFTTERNRYKNDFRD  493
             TNPFD +E  KG SSS  S T   +  R +YKN+FRD
Sbjct  57   MTNPFDAEEVEKGYSSSKQSLT---SNSRYQYKNNFRD  91



>ref|XP_008239879.1| PREDICTED: SNAP25 homologous protein SNAP33-like [Prunus mume]
Length=284

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 52/96 (54%), Gaps = 24/96 (25%)
 Frame = +2

Query  212  MFGHKKSPLHGNSKSHSIVPG--SNSTSNPFDSDDECDKKQNVKQSRTSSEPTPVTLNTS  385
            MFG KKSPL   +K  ++ P   ++S SNPF                   E  PV  NTS
Sbjct  1    MFGLKKSPLKA-AKHITVNPVYPASSGSNPF-------------------ENAPVGQNTS  40

Query  386  TNPFDDDEAKGKsssssssTYSFTTERNRYKNDFRD  493
            TNPFDD + + K SS S+ T    TERN+YKNDFRD
Sbjct  41   TNPFDDGQGEEKYSSYSNKT--MLTERNKYKNDFRD  74



>ref|XP_002316150.2| hypothetical protein POPTR_0010s16780g [Populus trichocarpa]
 gb|EEF02321.2| hypothetical protein POPTR_0010s16780g [Populus trichocarpa]
Length=247

 Score = 53.9 bits (128),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 49/96 (51%), Gaps = 25/96 (26%)
 Frame = +2

Query  212  MFGHKKSPLHGNS-KSHSIVPGSNSTSNPFDSDDECDKKQNVKQS-RTSSEPTPVTLNTS  385
            MFG  KSP +  + K  S+ P ++STSNPFDSDDE + KQ +    R SSE     LN  
Sbjct  1    MFGFGKSPANNKATKQSSVNPPASSTSNPFDSDDESNAKQTLHLGKRASSES---MLNVL  57

Query  386  TNPFDDDEAKGKsssssssTYSFTTERNRYKNDFRD  493
             N FDD                    ++RYKNDFRD
Sbjct  58   DNAFDD--------------------KDRYKNDFRD  73



>ref|XP_010259208.1| PREDICTED: SNAP25 homologous protein SNAP33-like [Nelumbo nucifera]
Length=289

 Score = 53.9 bits (128),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 57/95 (60%), Gaps = 16/95 (17%)
 Frame = +2

Query  212  MFGHKKSPLHGNSKSHSIVPGSNSTSNPFDSDDECDKKQNVKQSRTSSEPTPVTLNTSTN  391
            MF   K+P +  +K +S+  GSN    PFDSD +CD KQ++K SR +S  + + +N    
Sbjct  1    MFAFMKAPANKVTKQNSVDTGSN----PFDSDSDCDTKQSLKPSRRTSSESSLNVN----  52

Query  392  PFDDDEAKGKsssssssTYSFT-TERNRYKNDFRD  493
               D + KG     SSS+Y+ T  +R++YKNDFRD
Sbjct  53   ---DGDGKGS----SSSSYTVTAAQRSKYKNDFRD  80



>ref|XP_006281801.1| hypothetical protein CARUB_v10027974mg [Capsella rubella]
 gb|EOA14699.1| hypothetical protein CARUB_v10027974mg [Capsella rubella]
Length=306

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 58/97 (60%), Gaps = 5/97 (5%)
 Frame = +2

Query  212  MFGHKKSPLHGNSKSHSIVPGSNSTS--NPFDSDDECDKKQNVKQS-RTSSEPTPVTLNT  382
            MFG +KSP     K  S+  G + +S  NPFDSDDE D K  +  S RT+SEP+   L T
Sbjct  1    MFGLRKSPAK-LPKHSSVDLGFHKSSKPNPFDSDDESDNKHTLNPSKRTTSEPSLADL-T  58

Query  383  STNPFDDDEAKGKsssssssTYSFTTERNRYKNDFRD  493
             TNPFD +EA+   ++SSS     +    +YKN+FRD
Sbjct  59   KTNPFDAEEAQRGFATSSSKQSLISNSNYQYKNNFRD  95



>gb|KEH33106.1| soluble N-ethylmaleimide-sensitive factor adaptor protein [Medicago 
truncatula]
Length=260

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 56/96 (58%), Gaps = 13/96 (14%)
 Frame = +2

Query  212  MFGHKKSPLHGNSKSHSIVPGSNSTSNPFDSDDEC-DKKQNVKQSRTSSEPTPVTLNTST  388
            M G KKSPL              S  NPFDSD+E  D ++N+   + SS+   V  +T+T
Sbjct  1    MLGSKKSPLKD--------AKPRSKHNPFDSDEEKKDNRKNISSKKNSSQYNLVQRDTNT  52

Query  389  NPFDDDEAKGKsssssss-TYSFTTERNRYKNDFRD  493
            NPFDD +A+G SSSSS + +Y     RN YKNDFRD
Sbjct  53   NPFDDVDARGHSSSSSYAPSYG---NRNMYKNDFRD  85



>gb|KEH33105.1| soluble N-ethylmaleimide-sensitive factor adaptor protein [Medicago 
truncatula]
Length=296

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 59/96 (61%), Gaps = 13/96 (14%)
 Frame = +2

Query  212  MFGHKKSPLHGNSKSHSIVPGSNSTSNPFDSDDEC-DKKQNVKQSRTSSEPTPVTLNTST  388
            M G KKSPL  ++K  S         NPFDSD+E  D ++N+   + SS+   V  +T+T
Sbjct  1    MLGSKKSPLK-DAKPRS-------KHNPFDSDEEKKDNRKNISSKKNSSQYNLVQRDTNT  52

Query  389  NPFDDDEAKGKsssssss-TYSFTTERNRYKNDFRD  493
            NPFDD +A+G SSSSS + +Y     RN YKNDFRD
Sbjct  53   NPFDDVDARGHSSSSSYAPSYG---NRNMYKNDFRD  85



>ref|XP_011018220.1| PREDICTED: putative SNAP25 homologous protein SNAP30 [Populus 
euphratica]
 ref|XP_011018226.1| PREDICTED: putative SNAP25 homologous protein SNAP30 [Populus 
euphratica]
Length=282

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 48/96 (50%), Gaps = 25/96 (26%)
 Frame = +2

Query  212  MFGHKKSPLHGNSKSHSIV-PGSNSTSNPFDSDDECDKKQNVKQS-RTSSEPTPVTLNTS  385
            MFG +KSP +      S V P ++ TSNPFDSDDE + KQ +    RTSSEP    LN  
Sbjct  1    MFGFRKSPANNKPTKQSPVNPPASFTSNPFDSDDESNAKQALHHGKRTSSEP---MLNVP  57

Query  386  TNPFDDDEAKGKsssssssTYSFTTERNRYKNDFRD  493
            ++ FDD E                     YKNDFRD
Sbjct  58   SDAFDDREG--------------------YKNDFRD  73



>ref|XP_009338645.1| PREDICTED: SNAP25 homologous protein SNAP33 [Pyrus x bretschneideri]
Length=283

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 53/96 (55%), Gaps = 24/96 (25%)
 Frame = +2

Query  212  MFGHKKSPLHGNSKSHSIVPG--SNSTSNPFDSDDECDKKQNVKQSRTSSEPTPVTLNTS  385
            MFG KKSPL   +K  ++ P   ++S SNPF                   E  PV  N S
Sbjct  1    MFGLKKSPLK-TAKHITLDPVHPASSGSNPF-------------------EDAPVGQNAS  40

Query  386  TNPFDDDEAKGKsssssssTYSFTTERNRYKNDFRD  493
            TNPFDD+  +G+ +S+S +  +  TERN+YKNDFRD
Sbjct  41   TNPFDDE--RGQENSASYAYKTALTERNKYKNDFRD  74



>ref|XP_002312278.1| SNAP25 homologous protein SNAP30 [Populus trichocarpa]
 gb|ABK93599.1| unknown [Populus trichocarpa]
 gb|EEE89645.1| SNAP25 homologous protein SNAP30 [Populus trichocarpa]
Length=282

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 49/96 (51%), Gaps = 25/96 (26%)
 Frame = +2

Query  212  MFGHKKSPLHGN-SKSHSIVPGSNSTSNPFDSDDECDKKQNVKQS-RTSSEPTPVTLNTS  385
            MFG +KSP +   +K  S+ P ++ TSNPFDSDDE + KQ +    RT SEP    LN  
Sbjct  1    MFGFRKSPANNKPTKQSSVNPPASFTSNPFDSDDESNAKQTLHHGKRTYSEP---MLNVP  57

Query  386  TNPFDDDEAKGKsssssssTYSFTTERNRYKNDFRD  493
             + FDD                    R+ YKNDFRD
Sbjct  58   NDAFDD--------------------RDGYKNDFRD  73



>ref|XP_010457045.1| PREDICTED: SNAP25 homologous protein SNAP33-like [Camelina sativa]
Length=306

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 58/97 (60%), Gaps = 5/97 (5%)
 Frame = +2

Query  212  MFGHKKSPLHGNSKSHSIVPGSNSTS--NPFDSDDECDKKQNVKQS-RTSSEPTPVTLNT  382
            MFG +KSP     K +S+  G + +S  NPFDSDDE D K  +  S RT+SEP+ +  + 
Sbjct  1    MFGLRKSPAK-LPKHNSVDLGFHKSSKPNPFDSDDESDNKHTLNPSKRTTSEPSSLA-DM  58

Query  383  STNPFDDDEAKGKsssssssTYSFTTERNRYKNDFRD  493
            +TNPFD  E   K  SSS  +   +  + +YKN+FRD
Sbjct  59   TTNPFDGGEVVQKGGSSSKQSLVSSNSKYQYKNNFRD  95



>ref|XP_008374599.1| PREDICTED: SNAP25 homologous protein SNAP33-like [Malus domestica]
 ref|XP_008374601.1| PREDICTED: SNAP25 homologous protein SNAP33-like [Malus domestica]
Length=283

 Score = 51.6 bits (122),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 52/96 (54%), Gaps = 24/96 (25%)
 Frame = +2

Query  212  MFGHKKSPLHGNSKSHSIVPG--SNSTSNPFDSDDECDKKQNVKQSRTSSEPTPVTLNTS  385
            MFG KKSPL  ++K  ++ P   ++S SNPF                   E  PV  NTS
Sbjct  1    MFGLKKSPLK-SAKHITLNPVHPASSDSNPF-------------------EDAPVGQNTS  40

Query  386  TNPFDDDEAKGKsssssssTYSFTTERNRYKNDFRD  493
            TNPFD    +G+  SSS +  +  TERN+YKNDFRD
Sbjct  41   TNPFDGQ--RGQEKSSSYAYKTVLTERNKYKNDFRD  74



>ref|XP_004135151.1| PREDICTED: putative SNAP25 homologous protein SNAP30-like [Cucumis 
sativus]
 ref|XP_004155298.1| PREDICTED: putative SNAP25 homologous protein SNAP30-like [Cucumis 
sativus]
 gb|KGN51968.1| hypothetical protein Csa_5G606590 [Cucumis sativus]
Length=302

 Score = 51.6 bits (122),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 55/97 (57%), Gaps = 8/97 (8%)
 Frame = +2

Query  212  MFGHKKSPLHGNSKSHSIVP--GSNSTSNPFDSDDECDKKQNVKQS-RTSSEPTPVTLNT  382
            MF   KSP    +K +S+ P   + S +NPFDSD   D KQ +  + RTSSE  PV    
Sbjct  1    MFSFMKSPAK-VTKQNSVDPELSTGSGTNPFDSDTGPDAKQTLNAARRTSSE--PVLPMP  57

Query  383  STNPFDDDEAKGKsssssssTYSFTTERNRYKNDFRD  493
              NPFDDD+  G      ++T S +  ++RYKNDFRD
Sbjct  58   KANPFDDDDDTGFVGRKGTATSSGS--KDRYKNDFRD  92



>ref|XP_008393203.1| PREDICTED: SNAP25 homologous protein SNAP33 [Malus domestica]
Length=276

 Score = 51.2 bits (121),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 48/96 (50%), Gaps = 31/96 (32%)
 Frame = +2

Query  212  MFGHKKSPLHGNSKSHSIVPG--SNSTSNPFDSDDECDKKQNVKQSRTSSEPTPVTLNTS  385
            MFG KKSPL   +K+ ++ P   ++S SNPF                   E  P+  N S
Sbjct  1    MFGLKKSPLK-TAKNITLNPVHPASSGSNPF-------------------EDAPIGQNAS  40

Query  386  TNPFDDDEAKGKsssssssTYSFTTERNRYKNDFRD  493
            TNPFDD++ +           S  TERN+YKNDFRD
Sbjct  41   TNPFDDEQGQ---------XNSALTERNKYKNDFRD  67



>ref|XP_002864724.1| synaptosomal-associated protein 33 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40983.1| synaptosomal-associated protein 33 [Arabidopsis lyrata subsp. 
lyrata]
Length=300

 Score = 51.2 bits (121),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 55/95 (58%), Gaps = 7/95 (7%)
 Frame = +2

Query  212  MFGHKKSPLHGNSKSHSIVPGSNSTSNPFDSDDECDKKQNVKQS-RTSSEPTPVTLNTST  388
            MFG +KSP   N   H+ V   +S  NPFDSDDE D K  +  S RT+SEP   +L   T
Sbjct  1    MFGLRKSP--ANLPKHNSVDLKSSKPNPFDSDDELDNKHTLNPSKRTTSEP---SLADMT  55

Query  389  NPFDDDEAKGKsssssssTYSFTTERNRYKNDFRD  493
            NPF  +  + K  SSSS     +T + +YKN+FRD
Sbjct  56   NPFHGERVE-KGFSSSSKQSLISTSKYQYKNNFRD  89



>ref|XP_010483785.1| PREDICTED: SNAP25 homologous protein SNAP33 [Camelina sativa]
 ref|XP_010483786.1| PREDICTED: SNAP25 homologous protein SNAP33 [Camelina sativa]
 ref|XP_010483787.1| PREDICTED: SNAP25 homologous protein SNAP33 [Camelina sativa]
Length=302

 Score = 51.2 bits (121),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 55/97 (57%), Gaps = 9/97 (9%)
 Frame = +2

Query  212  MFGHKKSPLHGNSKSHSIVPGSNSTS--NPFDSDDECDKKQNVKQS-RTSSEPTPVTLNT  382
            MFG +KSP     K +S+  G + TS  NPFDSDDE D K  +  S RT+SEP+  +L  
Sbjct  1    MFGLRKSPAK-LPKHNSVDLGYHKTSKPNPFDSDDESDNKHTLNPSKRTTSEPS--SLAD  57

Query  383  STNPFDDDEAKGKsssssssTYSFTTERNRYKNDFRD  493
             TNPFD  E +      SS     +  R +YKN+FRD
Sbjct  58   MTNPFDGGEVQ---RGGSSKQSLVSNSRYQYKNNFRD  91



>ref|NP_001241453.1| uncharacterized protein LOC100794076 [Glycine max]
 gb|ACU17955.1| unknown [Glycine max]
Length=291

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 55/95 (58%), Gaps = 16/95 (17%)
 Frame = +2

Query  212  MFGHKKSPLHGNSKSHSIVPGSNSTSNPFDSDDEC-DKKQNVKQSRTSSEPTPVTLNTST  388
            MFG KK+PL  ++K  S+    +   NPFDSD++  D K N      SS+ T     T+T
Sbjct  1    MFGSKKTPLR-DAKPTSV----DHAHNPFDSDEDTKDNKYN------SSKKTL----TNT  45

Query  389  NPFDDDEAKGKsssssssTYSFTTERNRYKNDFRD  493
            NPFDDD       SSSSS    +T RNRYKNDFRD
Sbjct  46   NPFDDDHVNATGHSSSSSYGLSSTHRNRYKNDFRD  80



>gb|KHN48757.1| SNAP25 like protein SNAP33 [Glycine soja]
Length=291

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 55/95 (58%), Gaps = 16/95 (17%)
 Frame = +2

Query  212  MFGHKKSPLHGNSKSHSIVPGSNSTSNPFDSDDEC-DKKQNVKQSRTSSEPTPVTLNTST  388
            MFG KK+PL  ++K  S+    +   NPFDSD++  D K N      SS+ T     T+T
Sbjct  1    MFGSKKTPLR-DAKPTSV----DHAHNPFDSDEDTKDNKYN------SSKKTL----TNT  45

Query  389  NPFDDDEAKGKsssssssTYSFTTERNRYKNDFRD  493
            NPFDDD       SSSSS    +T RNRYKNDFRD
Sbjct  46   NPFDDDHVDATGHSSSSSYGLSSTHRNRYKNDFRD  80



>ref|XP_010443936.1| PREDICTED: SNAP25 homologous protein SNAP33-like [Camelina sativa]
Length=303

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 56/97 (58%), Gaps = 8/97 (8%)
 Frame = +2

Query  212  MFGHKKSPLHGNSKSHSIVPGSNSTS--NPFDSDDECDKKQNVKQS-RTSSEPTPVTLNT  382
            MFG +KSP     K +S+  G + TS  NPFDSDDE D K  +  S RT+S+P+  +L  
Sbjct  1    MFGLRKSPAK-LPKHNSVDLGFHKTSKPNPFDSDDESDNKHTLNPSKRTTSDPS--SLAD  57

Query  383  STNPFDDDEAKGKsssssssTYSFTTERNRYKNDFRD  493
             TNPFD  E +    SS  S  S    R +YKN+FRD
Sbjct  58   MTNPFDGQEVQKGGGSSKQSLVS--NSRYQYKNNFRD  92



>gb|AAM62553.1| snap25a [Arabidopsis thaliana]
Length=300

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 55/95 (58%), Gaps = 7/95 (7%)
 Frame = +2

Query  212  MFGHKKSPLHGNSKSHSIVPGSNSTSNPFDSDDECDKKQNVKQS-RTSSEPTPVTLNTST  388
            MFG +KSP   N   H+ V   +S  NPFDSDDE D K  +  S RT+SEP   +L   T
Sbjct  1    MFGLRKSP--ANLPKHNSVDLKSSKPNPFDSDDESDNKHTLNXSKRTTSEP---SLADMT  55

Query  389  NPFDDDEAKGKsssssssTYSFTTERNRYKNDFRD  493
            NPF  +  + K  SSSS    F+  + +YKN+FRD
Sbjct  56   NPFGGERVQ-KGDSSSSKQSLFSNSKYQYKNNFRD  89



>ref|XP_004499490.1| PREDICTED: SNAP25 homologous protein SNAP33-like [Cicer arietinum]
Length=295

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 54/97 (56%), Gaps = 16/97 (16%)
 Frame = +2

Query  212  MFGHKKSPLHGNSKSHSIVPGSNSTSNPFDSDDECDKKQNVK---QSRTSSEPTPVTLNT  382
            MFG KKSPL     S        S  NPFDSD+E  KK N K     +TSS    V   T
Sbjct  1    MFGSKKSPLKDTKPS--------SKHNPFDSDEE--KKDNRKYNSSRKTSSGYNLVQGET  50

Query  383  STNPFDDDEAKGKsssssssTYSFTTERNRYKNDFRD  493
            +TNPFDD +A+G SSS  +++   +  R  YKNDFRD
Sbjct  51   NTNPFDDVDARGHSSSPYAAS---SGNRTLYKNDFRD  84



>ref|XP_010030467.1| PREDICTED: SNAP25 homologous protein SNAP33 [Eucalyptus grandis]
 gb|KCW83691.1| hypothetical protein EUGRSUZ_B00569 [Eucalyptus grandis]
Length=295

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 57/98 (58%), Gaps = 17/98 (17%)
 Frame = +2

Query  212  MFGHKKSPLHGNSKSHSIVPGSN---STSNPFDSDDECDKKQNVKQS-RTSSEPTPVTLN  379
            MFG KKSPL      H+ V  ++   S SNPF SDD+ D KQ++  S RTSSEP      
Sbjct  1    MFGSKKSPL--KLAKHNSVDNAHPMASGSNPFGSDDKVDNKQSLNSSRRTSSEPM-----  53

Query  380  TSTNPFDDDEAKGKsssssssTYSFTTERNRYKNDFRD  493
                   D   KG S+SS SS+ ++ T RN+YKNDFRD
Sbjct  54   -----LGDHTQKGISTSSYSSSLTYAT-RNKYKNDFRD  85



>ref|XP_008446422.1| PREDICTED: putative SNAP25 homologous protein SNAP30 [Cucumis 
melo]
Length=300

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 52/97 (54%), Gaps = 10/97 (10%)
 Frame = +2

Query  212  MFGHKKSPLHGNSKSHSIVP--GSNSTSNPFDSDDECDKKQNVKQS-RTSSEPTPVTLNT  382
            MF   KSP    +K +S+ P   + S +NPFDSD   D KQ +  + RTSSEP     N 
Sbjct  1    MFSFMKSPAK-VTKQNSVDPELSTGSGTNPFDSDTGPDAKQTLNAARRTSSEPVLPIPN-  58

Query  383  STNPFDDDEAKGKsssssssTYSFTTERNRYKNDFRD  493
              NPFDDD+           T + +  ++RYKNDFRD
Sbjct  59   -ANPFDDDDG----FVGRKGTATSSGSKDRYKNDFRD  90



>ref|NP_200929.1| soluble N-ethylmaleimide-sensitive factor adaptor protein 33 
[Arabidopsis thaliana]
 sp|Q9S7P9.1|SNP33_ARATH RecName: Full=SNAP25 homologous protein SNAP33; Short=AtSNAP33; 
AltName: Full=Snap25a; AltName: Full=Synaptosomal-associated 
protein SNAP25-like 1; Short=SNAP-25-like protein 1 [Arabidopsis 
thaliana]
 emb|CAB52582.1| SNAP33 protein [Arabidopsis thaliana]
 emb|CAB52583.1| SNAP33B protein [Arabidopsis thaliana]
 dbj|BAB10383.1| SNAP25A protein [Arabidopsis thaliana]
 gb|AAL15258.1| AT5g61210/maf19_210 [Arabidopsis thaliana]
 emb|CAC79615.1| SNAP-25 like protein [Arabidopsis thaliana]
 gb|AAM98258.1| At5g61210/maf19_210 [Arabidopsis thaliana]
 gb|AED97436.1| soluble N-ethylmaleimide-sensitive factor adaptor protein 33 
[Arabidopsis thaliana]
Length=300

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 55/95 (58%), Gaps = 7/95 (7%)
 Frame = +2

Query  212  MFGHKKSPLHGNSKSHSIVPGSNSTSNPFDSDDECDKKQNVKQS-RTSSEPTPVTLNTST  388
            MFG +KSP   N   H+ V   +S  NPFDSDDE D K  +  S RT+SEP   +L   T
Sbjct  1    MFGLRKSP--ANLPKHNSVDLKSSKPNPFDSDDESDNKHTLNPSKRTTSEP---SLADMT  55

Query  389  NPFDDDEAKGKsssssssTYSFTTERNRYKNDFRD  493
            NPF  +  + K  SSSS    F+  + +YKN+FRD
Sbjct  56   NPFGGERVQ-KGDSSSSKQSLFSNSKYQYKNNFRD  89



>gb|EYU29393.1| hypothetical protein MIMGU_mgv1a010876mg [Erythranthe guttata]
Length=299

 Score = 48.1 bits (113),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 49/97 (51%), Gaps = 13/97 (13%)
 Frame = +2

Query  212  MFGHKKSPLHGNSKSHSIVPG--SNSTSNPFDSDD-ECDKKQNVKQSRTSSEPTPVTLNT  382
            M G K S   G  K  S+  G   N  +NPFDSDD E D  Q +K   T+S       N 
Sbjct  1    MSGLKSSLSQGVPKHKSVNHGITVNKYANPFDSDDDELDSNQTIKNPVTAS-------NL  53

Query  383  STNPFDDDEAKGKsssssssTYSFTTERNRYKNDFRD  493
            STNPFDD + KG   +SSS  +      NRYK DF D
Sbjct  54   STNPFDDGDVKG---TSSSQIHLSPAAENRYKKDFTD  87



>emb|CDY23079.1| BnaC07g31080D [Brassica napus]
Length=304

 Score = 47.8 bits (112),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 57/100 (57%), Gaps = 13/100 (13%)
 Frame = +2

Query  212  MFGHKKSPLHGNSKSHSIVPGSNSTS--NPFDSDDECDKKQNVK----QSRTSSEPTPVT  373
            MFG +KSP     K +S  PG + +S  NPFDSDDE D   N        RTSSEP   +
Sbjct  1    MFGLRKSPAK-LPKHNSADPGFHKSSKPNPFDSDDELDNNSNKHTLNPSKRTSSEP---S  56

Query  374  LNTSTNPFDDDEAKGKsssssssTYSFTTERNRYKNDFRD  493
            L   TNPFD +E KG +SSS  S  S    R +YKN+FRD
Sbjct  57   LADMTNPFDGEE-KGFTSSSKQSLTS--NSRYQYKNNFRD  93



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 552737873190