BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002C22

Length=572
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009592476.1|  PREDICTED: alpha-L-fucosidase 2                  95.1    6e-19   
ref|XP_009800211.1|  PREDICTED: alpha-L-fucosidase 2 isoform X1       94.7    8e-19   Nicotiana sylvestris
ref|XP_009800220.1|  PREDICTED: alpha-L-fucosidase 2 isoform X2       94.4    1e-18   Nicotiana sylvestris
ref|XP_004292088.2|  PREDICTED: alpha-L-fucosidase 2                  93.2    3e-18   Fragaria vesca subsp. vesca
ref|XP_010090595.1|  hypothetical protein L484_002038                 85.1    5e-17   
ref|XP_010271389.1|  PREDICTED: alpha-L-fucosidase 2                  88.2    1e-16   Nelumbo nucifera [Indian lotus]
ref|XP_011457799.1|  PREDICTED: alpha-L-fucosidase 2-like             88.2    1e-16   Fragaria vesca subsp. vesca
gb|KJB47346.1|  hypothetical protein B456_008G022200                  87.4    2e-16   Gossypium raimondii
gb|KJB47348.1|  hypothetical protein B456_008G022200                  87.0    3e-16   Gossypium raimondii
gb|KJB47347.1|  hypothetical protein B456_008G022200                  87.0    4e-16   Gossypium raimondii
ref|XP_007042561.1|  1,2-alpha-L-fucosidases                          86.3    6e-16   
ref|XP_007200942.1|  hypothetical protein PRUPE_ppa001398mg           84.0    4e-15   Prunus persica
gb|KJB47343.1|  hypothetical protein B456_008G022000                  82.4    9e-15   Gossypium raimondii
gb|KJB47344.1|  hypothetical protein B456_008G022000                  82.4    9e-15   Gossypium raimondii
gb|KJB47342.1|  hypothetical protein B456_008G022000                  82.8    9e-15   Gossypium raimondii
ref|XP_008236396.1|  PREDICTED: alpha-L-fucosidase 2                  82.8    9e-15   Prunus mume [ume]
emb|CDO97236.1|  unnamed protein product                              82.4    1e-14   Coffea canephora [robusta coffee]
emb|CAN67724.1|  hypothetical protein VITISV_006023                   78.2    1e-14   Vitis vinifera
ref|XP_008338239.1|  PREDICTED: alpha-L-fucosidase 2-like             81.6    2e-14   
gb|KEH44060.1|  alpha-L-fucosidase-like protein                       80.5    5e-14   Medicago truncatula
ref|XP_010647956.1|  PREDICTED: alpha-L-fucosidase 2                  80.1    8e-14   Vitis vinifera
ref|XP_011001337.1|  PREDICTED: alpha-L-fucosidase 2-like isoform X2  79.7    9e-14   Populus euphratica
emb|CBI22509.3|  unnamed protein product                              79.7    9e-14   Vitis vinifera
ref|XP_011001328.1|  PREDICTED: alpha-L-fucosidase 2-like isoform X1  79.7    9e-14   Populus euphratica
ref|XP_002313157.1|  hypothetical protein POPTR_0009s09650g           79.7    1e-13   
ref|XP_011001318.1|  PREDICTED: alpha-L-fucosidase 2-like             79.0    1e-13   Populus euphratica
ref|XP_009344361.1|  PREDICTED: alpha-L-fucosidase 2-like isoform X3  79.0    2e-13   
ref|XP_009335951.1|  PREDICTED: alpha-L-fucosidase 2                  79.0    2e-13   Pyrus x bretschneideri [bai li]
ref|XP_008338241.1|  PREDICTED: alpha-L-fucosidase 2                  79.0    2e-13   Malus domestica [apple tree]
ref|XP_009345064.1|  PREDICTED: alpha-L-fucosidase 2-like             79.0    2e-13   Pyrus x bretschneideri [bai li]
ref|XP_009344358.1|  PREDICTED: alpha-L-fucosidase 2-like isoform X1  78.6    2e-13   
ref|XP_008787125.1|  PREDICTED: alpha-L-fucosidase 2                  78.6    2e-13   Phoenix dactylifera
ref|XP_007042562.1|  1,2-alpha-L-fucosidases                          78.6    2e-13   
ref|XP_002313154.2|  hypothetical protein POPTR_0009s09690g           78.2    3e-13   
ref|XP_011088197.1|  PREDICTED: alpha-L-fucosidase 2 isoform X1       77.4    6e-13   Sesamum indicum [beniseed]
ref|XP_002298754.2|  hypothetical protein POPTR_0001s30620g           77.0    6e-13   
ref|XP_011030387.1|  PREDICTED: alpha-L-fucosidase 2-like             77.0    7e-13   Populus euphratica
ref|XP_011030378.1|  PREDICTED: alpha-L-fucosidase 2-like isoform X1  75.9    2e-12   Populus euphratica
ref|XP_011030379.1|  PREDICTED: alpha-L-fucosidase 2-like isoform X2  75.9    2e-12   Populus euphratica
gb|KDO47958.1|  hypothetical protein CISIN_1g003209mg                 75.5    3e-12   Citrus sinensis [apfelsine]
ref|XP_006486973.1|  PREDICTED: alpha-L-fucosidase 2-like isoform X2  75.1    3e-12   
ref|XP_006486972.1|  PREDICTED: alpha-L-fucosidase 2-like isoform X1  75.1    3e-12   Citrus sinensis [apfelsine]
gb|KHG11389.1|  hypothetical protein F383_14795                       75.1    3e-12   Gossypium arboreum [tree cotton]
gb|KDP44439.1|  hypothetical protein JCGZ_16272                       73.9    7e-12   Jatropha curcas
ref|XP_010936540.1|  PREDICTED: alpha-L-fucosidase 2-like isoform X2  73.9    7e-12   Elaeis guineensis
ref|XP_006422892.1|  hypothetical protein CICLE_v10027816mg           73.9    7e-12   Citrus clementina [clementine]
ref|XP_002298755.2|  hypothetical protein POPTR_0001s30610g           73.9    8e-12   
ref|XP_010936549.1|  PREDICTED: alpha-L-fucosidase 2-like isoform X2  73.9    8e-12   
ref|XP_010936539.1|  PREDICTED: alpha-L-fucosidase 2-like isoform X1  73.2    1e-11   Elaeis guineensis
ref|XP_006422893.1|  hypothetical protein CICLE_v10027816mg           72.8    2e-11   Citrus clementina [clementine]
ref|XP_010105050.1|  Alpha-L-fucosidase 2                             72.8    2e-11   Morus notabilis
gb|EYU37618.1|  hypothetical protein MIMGU_mgv1a001249mg              72.8    2e-11   Erythranthe guttata [common monkey flower]
ref|XP_010028398.1|  PREDICTED: alpha-L-fucosidase 2-like             72.0    3e-11   Eucalyptus grandis [rose gum]
ref|XP_010936547.1|  PREDICTED: alpha-L-fucosidase 2-like isoform X1  72.0    4e-11   Elaeis guineensis
ref|XP_003610049.1|  Macrophage migration inhibitory factor-like ...  71.6    4e-11   
gb|AES92246.2|  alpha-L-fucosidase                                    71.6    4e-11   Medicago truncatula
ref|XP_002527476.1|  conserved hypothetical protein                   71.2    6e-11   Ricinus communis
dbj|BAF85832.1|  alpha-1,2-fucosidase                                 70.5    1e-10   Lilium longiflorum [Easter lily]
ref|XP_006589631.1|  PREDICTED: alpha-L-fucosidase 2-like             67.0    1e-10   Glycine max [soybeans]
ref|XP_008456176.1|  PREDICTED: alpha-L-fucosidase 2                  69.7    2e-10   Cucumis melo [Oriental melon]
gb|KGN57492.1|  hypothetical protein Csa_3G199050                     69.3    2e-10   Cucumis sativus [cucumbers]
ref|XP_010547973.1|  PREDICTED: alpha-L-fucosidase 2                  69.3    3e-10   Tarenaya hassleriana [spider flower]
ref|XP_010936550.1|  PREDICTED: alpha-L-fucosidase 2-like             68.9    3e-10   
gb|KDP44440.1|  hypothetical protein JCGZ_16273                       68.9    3e-10   Jatropha curcas
ref|XP_006829279.1|  hypothetical protein AMTR_s00001p00272880        68.9    3e-10   
gb|KHN42345.1|  Alpha-L-fucosidase 2                                  68.6    5e-10   Glycine soja [wild soybean]
gb|KDO47957.1|  hypothetical protein CISIN_1g003571mg                 67.8    6e-10   Citrus sinensis [apfelsine]
ref|XP_006849299.1|  hypothetical protein AMTR_s00167p00034910        67.8    7e-10   Amborella trichopoda
gb|KDO47956.1|  hypothetical protein CISIN_1g003571mg                 67.8    7e-10   Citrus sinensis [apfelsine]
ref|XP_006605983.1|  PREDICTED: alpha-L-fucosidase 2-like isoform X2  67.8    7e-10   Glycine max [soybeans]
ref|XP_003555969.1|  PREDICTED: alpha-L-fucosidase 2-like isoform X1  67.8    8e-10   Glycine max [soybeans]
ref|XP_006605984.1|  PREDICTED: alpha-L-fucosidase 2-like isoform X3  67.4    9e-10   Glycine max [soybeans]
ref|XP_002527475.1|  conserved hypothetical protein                   67.4    9e-10   
ref|XP_006605979.1|  PREDICTED: alpha-L-fucosidase 2-like isoform X2  67.4    1e-09   Glycine max [soybeans]
ref|XP_004496923.1|  PREDICTED: alpha-L-fucosidase 2-like             67.0    1e-09   Cicer arietinum [garbanzo]
ref|XP_004140811.1|  PREDICTED: alpha-L-fucosidase 2-like             66.2    2e-09   
ref|XP_003555281.1|  PREDICTED: alpha-L-fucosidase 2-like isoform X1  66.2    3e-09   Glycine max [soybeans]
gb|KDO47950.1|  hypothetical protein CISIN_1g003571mg                 65.9    3e-09   Citrus sinensis [apfelsine]
ref|XP_006486970.1|  PREDICTED: alpha-L-fucosidase 2-like isoform X1  65.9    3e-09   Citrus sinensis [apfelsine]
ref|XP_006422890.1|  hypothetical protein CICLE_v10027838mg           65.9    3e-09   Citrus clementina [clementine]
ref|XP_006605981.1|  PREDICTED: alpha-L-fucosidase 2-like isoform X4  65.9    3e-09   Glycine max [soybeans]
ref|XP_006605982.1|  PREDICTED: alpha-L-fucosidase 2-like isoform X5  65.5    4e-09   Glycine max [soybeans]
gb|KFK30063.1|  hypothetical protein AALP_AA7G211900                  65.5    4e-09   Arabis alpina [alpine rockcress]
ref|XP_003573887.1|  PREDICTED: alpha-L-fucosidase 2-like             65.5    5e-09   Brachypodium distachyon [annual false brome]
gb|KEH44061.1|  hypothetical protein MTR_1g107145                     61.6    5e-09   Medicago truncatula
ref|XP_007143071.1|  hypothetical protein PHAVU_007G041400g           65.1    5e-09   Phaseolus vulgaris [French bean]
ref|XP_009421188.1|  PREDICTED: alpha-L-fucosidase 2-like             65.1    5e-09   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002869161.1|  hypothetical protein ARALYDRAFT_912968           64.7    6e-09   Arabidopsis lyrata subsp. lyrata
ref|XP_009421189.1|  PREDICTED: alpha-L-fucosidase 2-like             64.7    7e-09   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX69041.1|  BnaC01g04120D                                        64.7    7e-09   
gb|AID60138.1|  altered xyloglucan 8                                  64.7    7e-09   Brassica napus [oilseed rape]
ref|XP_009114732.1|  PREDICTED: alpha-L-fucosidase 2                  64.7    8e-09   Brassica rapa
ref|XP_006412250.1|  hypothetical protein EUTSA_v10024398mg           64.3    9e-09   Eutrema salsugineum [saltwater cress]
gb|KHN42346.1|  Alpha-L-fucosidase 2                                  64.3    9e-09   Glycine soja [wild soybean]
ref|XP_006605980.1|  PREDICTED: alpha-L-fucosidase 2-like isoform X3  64.3    9e-09   Glycine max [soybeans]
ref|XP_003536603.1|  PREDICTED: alpha-L-fucosidase 2-like             64.3    9e-09   Glycine max [soybeans]
ref|XP_010432442.1|  PREDICTED: alpha-L-fucosidase 2                  63.5    2e-08   Camelina sativa [gold-of-pleasure]
ref|XP_010437645.1|  PREDICTED: alpha-L-fucosidase 2-like             63.2    2e-08   Camelina sativa [gold-of-pleasure]
ref|XP_010447114.1|  PREDICTED: alpha-L-fucosidase 2-like             63.2    2e-08   Camelina sativa [gold-of-pleasure]
dbj|BAK00707.1|  predicted protein                                    58.9    2e-08   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CAB36703.1|  hypothetical protein                                 63.2    2e-08   Arabidopsis thaliana [mouse-ear cress]
gb|KCW55141.1|  hypothetical protein EUGRSUZ_I01092                   63.2    2e-08   Eucalyptus grandis [rose gum]
gb|KCW55139.1|  hypothetical protein EUGRSUZ_I01092                   62.8    3e-08   Eucalyptus grandis [rose gum]
ref|XP_010028395.1|  PREDICTED: alpha-L-fucosidase 2-like isoform X1  62.8    3e-08   Eucalyptus grandis [rose gum]
ref|NP_195152.2|  alpha-L-fucosidase 2                                62.8    3e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006283241.1|  hypothetical protein CARUB_v10004274mg           62.4    4e-08   
ref|XP_010691648.1|  PREDICTED: LOW QUALITY PROTEIN: alpha-L-fuco...  61.6    6e-08   
ref|XP_010691649.1|  PREDICTED: alpha-L-fucosidase 2-like             61.6    6e-08   Beta vulgaris subsp. vulgaris [field beet]
gb|KCW55138.1|  hypothetical protein EUGRSUZ_I01091                   61.2    1e-07   Eucalyptus grandis [rose gum]
ref|XP_002313155.2|  hypothetical protein POPTR_0009s09680g           57.0    1e-07   
tpg|DAA46849.1|  TPA: hypothetical protein ZEAMMB73_390456            60.1    1e-07   
ref|WP_030106659.1|  hypothetical protein                             58.9    2e-07   
ref|XP_004983274.1|  PREDICTED: alpha-L-fucosidase 2-like             60.5    2e-07   Setaria italica
ref|XP_004983276.1|  PREDICTED: alpha-L-fucosidase 2-like isoform X2  60.1    2e-07   Setaria italica
tpg|DAA46848.1|  TPA: hypothetical protein ZEAMMB73_390456            59.7    2e-07   
gb|EMS55421.1|  Alpha-L-fucosidase 2                                  59.7    3e-07   Triticum urartu
gb|KFA02918.1|  hypothetical protein A11K_0106740                     55.5    3e-07   Xanthomonas vasicola pv. vasculorum NCPPB 890
dbj|BAJ95753.1|  predicted protein                                    59.7    3e-07   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006661702.1|  PREDICTED: alpha-L-fucosidase 2-like             59.7    3e-07   Oryza brachyantha
ref|XP_004983275.1|  PREDICTED: alpha-L-fucosidase 2-like isoform X1  59.7    3e-07   Setaria italica
dbj|BAJ85441.1|  predicted protein                                    59.3    3e-07   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010238647.1|  PREDICTED: alpha-L-fucosidase 2-like isoform X2  59.3    4e-07   Brachypodium distachyon [annual false brome]
dbj|GAE07437.1|  putative large secreted protein                      58.9    4e-07   Paenibacillus sp. JCM 10914
gb|AAK98716.1|AC090483_6  Hypothetical protein                        58.9    5e-07   Oryza sativa Japonica Group [Japonica rice]
ref|WP_033160384.1|  alpha-L-fucosidase                               58.9    5e-07   
ref|XP_008659917.1|  PREDICTED: alpha-L-fucosidase 2 isoform X2       58.9    5e-07   Zea mays [maize]
ref|XP_003560237.1|  PREDICTED: alpha-L-fucosidase 2-like isoform X1  58.9    5e-07   Brachypodium distachyon [annual false brome]
gb|EEC66760.1|  hypothetical protein OsI_33136                        58.5    6e-07   Oryza sativa Indica Group [Indian rice]
gb|ABB47227.1|  large secreted protein, putative, expressed           58.5    6e-07   Oryza sativa Japonica Group [Japonica rice]
emb|CAJ23483.1|  conserved hypothetical protein                       58.5    6e-07   Xanthomonas campestris pv. vesicatoria str. 85-10
ref|WP_044661129.1|  alpha/beta hydrolase                             58.5    7e-07   Sphingobium
ref|WP_042826124.1|  alpha/beta hydrolase                             55.8    8e-07   
ref|XP_008659908.1|  PREDICTED: alpha-L-fucosidase 2 isoform X1       58.2    8e-07   Zea mays [maize]
ref|WP_039417657.1|  alpha/beta hydrolase                             58.2    9e-07   Xanthomonas euvesicatoria
ref|WP_031422336.1|  alpha/beta hydrolase                             58.2    9e-07   Xanthomonas euvesicatoria
ref|WP_014090004.1|  alpha/beta hydrolase                             58.2    9e-07   Xanthomonas euvesicatoria
ref|WP_008574429.1|  alpha/beta hydrolase                             58.2    9e-07   Xanthomonas perforans
gb|AIE84468.1|  putative large secreted protein                       58.2    9e-07   Fimbriimonas ginsengisoli Gsoil 348
ref|WP_010379703.1|  alpha/beta hydrolase                             58.2    9e-07   Xanthomonas
ref|WP_038474356.1|  hypothetical protein                             58.2    1e-06   
ref|WP_014219830.1|  alpha-L-fucosidase                               58.2    1e-06   Niastella koreensis
gb|EMS61938.1|  Alpha-L-fucosidase 2                                  58.2    1e-06   Triticum urartu
gb|EEC79728.1|  hypothetical protein OsI_21058                        58.2    1e-06   Oryza sativa Indica Group [Indian rice]
gb|ABG66022.1|  large secreted protein, putative, expressed           58.2    1e-06   Oryza sativa Japonica Group [Japonica rice]
gb|EFF47283.1|  conserved hypothetical protein                        57.8    1e-06   Xanthomonas citri pv. aurantifolii str. ICPB 10535
dbj|BAK06893.1|  predicted protein                                    57.8    1e-06   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EFF43160.1|  conserved hypothetical protein                        57.8    1e-06   Xanthomonas citri pv. aurantifolii str. ICPB 11122
gb|EGD09621.1|  hypothetical protein XVE_2098                         57.8    1e-06   Xanthomonas vesicatoria ATCC 35937
ref|WP_039423109.1|  alpha/beta hydrolase                             57.8    1e-06   
ref|WP_033485295.1|  alpha/beta hydrolase                             57.8    1e-06   Xanthomonas
ref|WP_039570142.1|  alpha/beta hydrolase                             57.8    1e-06   Xanthomonas
ref|WP_017159177.1|  alpha/beta hydrolase                             57.8    1e-06   Xanthomonas phaseoli
ref|WP_017115671.1|  alpha/beta hydrolase                             57.8    1e-06   
ref|WP_042827962.1|  alpha/beta hydrolase                             57.8    1e-06   
ref|WP_017155140.1|  alpha/beta hydrolase                             57.8    1e-06   Xanthomonas phaseoli
dbj|BAK07299.1|  predicted protein                                    57.8    1e-06   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|WP_017165717.1|  alpha/beta hydrolase                             57.8    1e-06   Xanthomonas phaseoli
ref|WP_029219619.1|  alpha/beta hydrolase                             57.8    1e-06   
ref|WP_003481940.1|  alpha/beta hydrolase                             57.8    1e-06   
ref|WP_017168761.1|  alpha/beta hydrolase                             57.4    1e-06   
ref|WP_042805837.1|  alpha/beta hydrolase                             57.4    1e-06   Xanthomonas citri
ref|WP_039430790.1|  alpha/beta hydrolase                             57.4    1e-06   Xanthomonas vasicola
ref|WP_005916595.1|  MULTISPECIES: hypothetical protein               57.4    1e-06   Xanthomonas
ref|WP_005924393.1|  alpha/beta hydrolase                             57.4    1e-06   Xanthomonas citri
ref|WP_031329735.1|  hypothetical protein                             57.4    1e-06   Xanthomonas phaseoli
gb|KFA29989.1|  alpha/beta hydrolase                                  57.4    1e-06   Xanthomonas vasicola pv. vasculorum NCPPB 1326
ref|WP_041470511.1|  alpha/beta hydrolase                             57.4    1e-06   Xanthomonas axonopodis
ref|WP_022559521.1|  MULTISPECIES: hypothetical protein               57.4    1e-06   Xanthomonas
gb|KGK58817.1|  alpha/beta hydrolase                                  57.4    1e-06   Xanthomonas cannabis pv. phaseoli
ref|WP_033486106.1|  alpha/beta hydrolase                             57.4    1e-06   Xanthomonas phaseoli
ref|WP_042675923.1|  alpha/beta hydrolase                             57.4    2e-06   Xanthomonas citri
ref|WP_039563834.1|  alpha/beta hydrolase                             57.4    2e-06   
ref|WP_039444828.1|  alpha/beta hydrolase                             57.4    2e-06   Xanthomonas vasicola
ref|WP_040245726.1|  alpha/beta hydrolase                             57.4    2e-06   Xanthomonas citri
ref|WP_011051132.1|  alpha/beta hydrolase                             57.4    2e-06   Xanthomonas
ref|WP_017118955.1|  alpha/beta hydrolase                             57.4    2e-06   Xanthomonas vasicola
ref|WP_017117247.1|  alpha/beta hydrolase                             57.4    2e-06   Xanthomonas
ref|WP_010370194.1|  alpha/beta hydrolase                             57.4    2e-06   
gb|AGH77269.1|  hypothetical protein XAC29_08925                      57.4    2e-06   Xanthomonas axonopodis Xac29-1
ref|WP_044271405.1|  alpha-L-fucosidase                               57.4    2e-06   Bacteroides timonensis
ref|WP_039404303.1|  alpha/beta hydrolase                             57.4    2e-06   
ref|WP_040281002.1|  alpha/beta hydrolase                             57.4    2e-06   Xanthomonas citri
ref|WP_040151880.1|  alpha/beta hydrolase                             57.4    2e-06   
ref|WP_042815126.1|  alpha/beta hydrolase                             57.4    2e-06   
ref|WP_022209650.1|  uncharacterized protein                          57.4    2e-06   
ref|WP_042831606.1|  alpha/beta hydrolase                             57.4    2e-06   
ref|WP_021967943.1|  MULTISPECIES: uncharacterized protein            57.4    2e-06   Bacteroides intestinalis
ref|WP_044153398.1|  alpha-L-fucosidase                               57.4    2e-06   Bacteroides cellulosilyticus
ref|WP_007217057.1|  glycoside hydrolase                              57.4    2e-06   Bacteroides cellulosilyticus
ref|WP_044533450.1|  alpha-L-fucosidase                               57.4    2e-06   Bacteroides intestinalis
gb|EEF91123.1|  hypothetical protein BACCELL_01254                    57.4    2e-06   Bacteroides cellulosilyticus DSM 14838
gb|EMI46558.1|  fibronectin type III domain protein                   57.4    2e-06   Rhodopirellula sp. SWK7
ref|WP_020819755.1|  MULTISPECIES: alpha/beta hydrolase               57.0    2e-06   Sphingobium
ref|WP_044251102.1|  fibronectin                                      57.0    2e-06   
gb|EDV07104.1|  hypothetical protein BACINT_00670                     57.0    2e-06   Bacteroides intestinalis DSM 17393
ref|WP_039917936.1|  alpha-L-fucosidase                               57.0    2e-06   
ref|WP_022394273.1|  uncharacterized protein                          57.0    2e-06   Bacteroides intestinalis
ref|WP_039586562.1|  alpha/beta hydrolase                             57.0    2e-06   Xanthomonas phaseoli
ref|WP_039582251.1|  alpha/beta hydrolase                             57.0    2e-06   Xanthomonas phaseoli
ref|WP_013053821.1|  alpha/beta hydrolase                             57.0    2e-06   Sphingobium japonicum
ref|WP_016849738.1|  alpha/beta hydrolase                             57.0    2e-06   Xanthomonas
ref|WP_037509604.1|  alpha/beta hydrolase                             56.2    2e-06   
ref|WP_008690950.1|  alpha-L-fucosidase                               57.0    2e-06   
dbj|GAE57445.1|  hypothetical protein XPR_4080                        57.0    2e-06   Xanthomonas arboricola pv. pruni MAFF 301420
gb|ETC88435.1|  hypothetical protein XHC_2089                         57.0    2e-06   Xanthomonas hortorum pv. carotae str. M081
ref|WP_035293230.1|  hypothetical protein                             57.0    2e-06   
ref|WP_039511821.1|  alpha/beta hydrolase                             57.0    2e-06   
gb|ENZ93886.1|  hypothetical protein O1K_18548                        57.0    2e-06   Xanthomonas fragariae LMG 25863
ref|WP_039522751.1|  alpha/beta hydrolase                             57.0    2e-06   Xanthomonas arboricola
gb|EGD16935.1|  hypothetical protein XGA_4498                         56.6    3e-06   Xanthomonas gardneri ATCC 19865
ref|WP_043910839.1|  alpha/beta hydrolase                             56.6    3e-06   Xanthomonas gardneri
ref|WP_039816874.1|  alpha/beta hydrolase                             56.6    3e-06   Xanthomonas
ref|WP_043889765.1|  alpha/beta hydrolase                             56.6    3e-06   Xanthomonas hortorum
ref|WP_040763005.1|  alpha/beta hydrolase                             56.6    3e-06   Xanthomonas fragariae
ref|WP_039530013.1|  alpha/beta hydrolase                             56.6    3e-06   Xanthomonas arboricola
tpg|DAA46850.1|  TPA: hypothetical protein ZEAMMB73_390456            56.6    3e-06   
ref|WP_009129495.1|  hypothetical protein                             56.6    3e-06   Bacteroides oleiciplenus
ref|WP_028563331.1|  alpha-L-fucosidase                               56.2    3e-06   Paenibacillus pinihumi
ref|XP_001549786.1|  hypothetical protein BC1G_11256                  56.2    4e-06   
ref|WP_026297319.1|  alpha-L-fucosidase                               56.2    4e-06   
ref|WP_029217201.1|  alpha/beta hydrolase                             56.2    4e-06   
ref|WP_008673774.1|  glycoside hydrolase, family 95                   56.2    4e-06   Rhodopirellula sallentina
ref|WP_042599112.1|  alpha/beta hydrolase                             56.2    4e-06   
ref|WP_029628972.1|  alpha/beta hydrolase                             56.2    4e-06   
emb|CAP51866.1|  conserved exported protein                           56.2    4e-06   Xanthomonas campestris pv. campestris
gb|KHN30427.1|  Alpha-L-fucosidase 2                                  56.2    4e-06   Glycine soja [wild soybean]
ref|WP_043877916.1|  alpha/beta hydrolase                             56.2    4e-06   
ref|WP_011036930.1|  alpha/beta hydrolase                             56.2    4e-06   Xanthomonas campestris
ref|WP_040941414.1|  alpha/beta hydrolase                             56.2    4e-06   Xanthomonas campestris
ref|XP_006573903.1|  PREDICTED: alpha-L-fucosidase 2-like             56.2    4e-06   Glycine max [soybeans]
ref|WP_042824371.1|  alpha/beta hydrolase                             56.2    4e-06   
ref|WP_043929950.1|  alpha/beta hydrolase                             55.8    4e-06   
ref|WP_026064487.1|  alpha/beta hydrolase                             55.8    4e-06   Xanthomonas arboricola
gb|AEL06885.1|  expressed protein                                     55.8    5e-06   Xanthomonas campestris pv. raphani 756C
ref|WP_022972906.1|  alpha/beta hydrolase                             55.5    6e-06   Xanthomonas maliensis
ref|WP_029561340.1|  alpha/beta hydrolase                             55.5    6e-06   Xanthomonas oryzae
gb|EMI55725.1|  hypothetical protein RSSM_02846                       55.5    7e-06   Rhodopirellula sallentina SM41
ref|WP_044302454.1|  large secreted protein                           55.5    7e-06   
ref|WP_028537475.1|  alpha-L-fucosidase                               55.5    8e-06   Paenibacillus sp. J14
ref|WP_016313812.1|  alpha-L-fucosidase 2                             55.5    8e-06   Paenibacillus barengoltzii
ref|WP_019004616.1|  hypothetical protein                             55.1    8e-06   Cohnella laeviribosi
ref|WP_022336397.1|  hypothetical protein                             55.1    8e-06   
ref|WP_013431879.1|  alpha-L-fucosidase                               55.1    8e-06   Caldicellulosiruptor kristjanssonii
ref|WP_014043004.1|  alpha-L-fucosidase                               55.1    9e-06   Caldicellulosiruptor lactoaceticus
ref|WP_044132542.1|  alpha-L-fucosidase                               52.8    9e-06   
ref|WP_009223841.1|  alpha-L-fucosidase                               55.1    9e-06   Paenibacillus sp. oral taxon 786
ref|WP_022813850.1|  alpha-fucosidase                                 55.1    9e-06   
ref|WP_010344637.1|  alpha-amylase                                    55.1    9e-06   Paenibacillus peoriae
ref|WP_011685626.1|  hypothetical protein                             55.1    1e-05   Candidatus Solibacter usitatus
ref|WP_013291122.1|  alpha-L-fucosidase                               55.1    1e-05   Caldicellulosiruptor obsidiansis
ref|WP_022149054.1|  hypothetical protein                             55.1    1e-05   
ref|WP_014278152.1|  alpha-amylase                                    54.7    1e-05   Paenibacillus terrae
ref|WP_033370361.1|  alpha-L-fucosidase                               54.7    1e-05   Hymenobacter norwichensis
ref|WP_024633361.1|  MULTISPECIES: alpha-L-fucosidase                 54.7    1e-05   Paenibacillus
emb|CCD55257.1|  glycoside hydrolase family 95 protein                54.7    1e-05   Botrytis cinerea T4
ref|WP_044107969.1|  alpha-L-fucosidase                               54.7    1e-05   
ref|WP_044756744.1|  hypothetical protein                             53.9    1e-05   
ref|WP_043509805.1|  hypothetical protein                             54.7    1e-05   
gb|EOR93815.1|  putative large secreted protein                       54.7    1e-05   Arcticibacter svalbardensis MN12-7
ref|WP_011259483.1|  hypothetical protein                             53.9    1e-05   
gb|EMI56445.1|  glycoside hydrolase family 95                         54.7    1e-05   Rhodopirellula sallentina SM41
ref|WP_022162189.1|  uncharacterized protein                          54.7    1e-05   
gb|ADU15248.1|  Alpha-L-fucosidase                                    54.7    1e-05   Asticcacaulis excentricus CB 48
ref|WP_013480864.1|  alpha/beta hydrolase                             54.7    1e-05   Asticcacaulis excentricus
emb|CDM64194.1|  glycerol-3-phosphate dehydrogenase                   54.7    1e-05   Pyrinomonas methylaliphatogenes
ref|WP_041973636.1|  alpha/beta hydrolase                             54.7    1e-05   
ref|WP_044302029.1|  alpha-L-fucosidase                               54.3    1e-05   
ref|WP_041659765.1|  hypothetical protein                             54.3    1e-05   
ref|WP_025684104.1|  alpha-amylase                                    54.3    2e-05   Paenibacillus sp. 1-49
ref|WP_033150347.1|  hypothetical protein                             54.3    2e-05   Prevotella sp. RM4
ref|WP_021316246.1|  alpha/beta hydrolase                             54.3    2e-05   Sphingobium ummariense
ref|WP_028906775.1|  hypothetical protein                             54.3    2e-05   Prevotella ruminicola
gb|KIM93158.1|  glycoside hydrolase family 95 protein                 54.3    2e-05   Oidiodendron maius Zn
gb|AFC30535.1|  hypothetical protein PM3016_3718                      54.3    2e-05   Paenibacillus mucilaginosus 3016
gb|AEI42820.1|  hypothetical protein KNP414_04288                     54.3    2e-05   Paenibacillus mucilaginosus KNP414
ref|WP_039731641.1|  hypothetical protein                             54.3    2e-05   
gb|EJP32702.1|  hypothetical protein HMPREF1146_1457                  53.9    2e-05   Prevotella sp. MSX73
ref|WP_036926624.1|  alpha-L-fucosidase                               53.9    2e-05   Prevotella sp. MSX73
ref|WP_008620441.1|  glycoside hydrolase                              53.9    2e-05   Paraprevotella clara
ref|WP_004341109.1|  alpha-L-fucosidase 2 (Alpha-L-fucosidefucohy...  53.9    2e-05   
ref|WP_028915434.1|  alpha/beta hydrolase                             53.9    2e-05   
ref|WP_004345058.1|  possible alpha-L-fucosidase                      53.9    2e-05   
ref|WP_036672607.1|  alpha-L-fucosidase                               53.9    2e-05   
gb|EGG35165.1|  hypothetical protein HMPREF9412_5205                  53.9    2e-05   
ref|WP_037274430.1|  hypothetical protein                             53.9    2e-05   
gb|AEI44617.1|  Alpha-L-fucosidase                                    53.9    2e-05   
ref|WP_036663643.1|  alpha-L-fucosidase                               53.9    2e-05   
ref|WP_041617404.1|  alpha-L-fucosidase                               53.9    2e-05   
ref|WP_014371748.1|  alpha-L-fucosidase                               53.9    2e-05   
ref|WP_013534727.1|  alpha/beta hydrolase                             53.9    2e-05   
ref|WP_028729955.1|  alpha-L-fucosidase                               53.9    2e-05   
ref|WP_021981200.1|  hypothetical protein                             53.9    2e-05   
gb|ETT62361.1|  alpha-L-fucosidase                                    53.9    2e-05   
ref|WP_037567484.1|  MULTISPECIES: alpha/beta hydrolase               53.9    2e-05   
ref|WP_013412627.1|  alpha-L-fucosidase                               53.9    2e-05   
ref|XP_002461732.1|  hypothetical protein SORBIDRAFT_02g007180        53.9    2e-05   
ref|WP_004309642.1|  MULTISPECIES: glycoside hydrolase                53.9    2e-05   
ref|WP_036724957.1|  alpha-L-fucosidase                               53.9    2e-05   
ref|WP_032846747.1|  MULTISPECIES: alpha-L-fucosidase                 53.9    2e-05   
ref|WP_008024370.1|  glycoside hydrolase                              53.9    2e-05   
ref|WP_015532253.1|  hypothetical protein                             53.5    2e-05   
ref|WP_004322238.1|  glycoside hydrolase                              53.5    2e-05   
ref|WP_008649501.1|  glycoside hydrolase                              53.5    2e-05   
ref|WP_004299676.1|  glycoside hydrolase                              53.5    2e-05   
gb|ERI69644.1|  hypothetical protein HMPREF1548_03093                 53.5    3e-05   
ref|WP_025489005.1|  hypothetical protein                             53.5    3e-05   
ref|WP_004316128.1|  MULTISPECIES: glycoside hydrolase                53.5    3e-05   
ref|WP_042238426.1|  alpha-L-fucosidase                               53.5    3e-05   
ref|WP_032852064.1|  alpha-L-fucosidase                               53.5    3e-05   
gb|EGN03702.1|  hypothetical protein HMPREF1017_02441                 53.5    3e-05   
ref|WP_020214566.1|  hypothetical protein                             53.5    3e-05   
gb|ADG75885.1|  Alpha-L-fucosidase                                    53.5    3e-05   
ref|WP_026991804.1|  alpha-L-fucosidase                               53.5    3e-05   
ref|WP_044644510.1|  alpha-amylase                                    53.5    3e-05   
ref|WP_035321639.1|  hypothetical protein                             53.5    3e-05   
gb|EGN02802.1|  hypothetical protein HMPREF1017_02792                 53.5    3e-05   
ref|WP_026905058.1|  alpha-L-fucosidase                               53.5    3e-05   
ref|WP_040309311.1|  alpha/beta hydrolase                             53.5    3e-05   
dbj|GAK38952.1|  alpha-L-fucosidase                                   53.5    3e-05   
ref|WP_013311986.1|  alpha-amylase                                    53.5    3e-05   
gb|EKU24406.1|  exported protein                                      53.1    3e-05   
ref|WP_039956491.1|  hypothetical protein                             53.1    3e-05   
ref|WP_036724118.1|  alpha-L-fucosidase                               53.1    3e-05   
ref|WP_022038933.1|  hypothetical protein                             53.1    3e-05   
gb|EKJ88892.1|  hypothetical protein HMPREF1057_04190                 53.1    4e-05   
ref|WP_017143183.1|  glycoside hydrolase                              53.1    4e-05   
ref|WP_018557520.1|  hypothetical protein                             53.1    4e-05   
ref|WP_008642948.1|  glycoside hydrolase                              53.1    4e-05   
ref|WP_008776479.1|  glycoside hydrolase                              53.1    4e-05   
ref|WP_009039790.1|  glycoside hydrolase                              53.1    4e-05   
ref|WP_009099629.1|  large secreted protein                           53.1    4e-05   
ref|WP_013429619.1|  alpha-L-fucosidase                               53.1    4e-05   
ref|WP_041885145.1|  hypothetical protein                             53.1    4e-05   
gb|KFZ00550.1|  hypothetical protein V500_01029                       53.1    4e-05   
gb|ESQ87096.1|  hypothetical protein ABAC460_21235                    53.1    4e-05   
ref|WP_004297727.1|  glycoside hydrolase                              53.1    4e-05   
ref|WP_024711395.1|  alpha/beta hydrolase                             53.1    4e-05   
ref|WP_029229180.1|  alpha-L-fucosidase                               53.1    4e-05   
gb|EFG15021.1|  conserved hypothetical protein                        52.8    4e-05   
gb|EEO58034.1|  hypothetical protein BSCG_04963                       53.1    4e-05   
ref|WP_013079029.1|  alpha/beta hydrolase                             53.1    4e-05   
ref|WP_029915324.1|  alpha/beta hydrolase                             52.8    4e-05   
ref|WP_032849760.1|  glycoside hydrolase                              53.1    5e-05   
ref|WP_039788766.1|  hypothetical protein                             52.8    5e-05   
ref|WP_034593786.1|  hypothetical protein                             52.8    5e-05   
ref|WP_020211186.1|  hypothetical protein                             52.8    5e-05   
ref|WP_024462181.1|  alpha-L-fucosidase                               52.8    5e-05   
ref|WP_044751541.1|  alpha/beta hydrolase                             52.8    5e-05   
ref|WP_009254916.1|  hypothetical protein                             52.8    5e-05   
ref|WP_042162232.1|  alpha-L-fucosidase                               52.4    5e-05   
ref|WP_035426511.1|  hypothetical protein                             52.8    5e-05   
ref|WP_039869974.1|  alpha-L-fucosidase                               52.8    5e-05   
ref|WP_027453129.1|  alpha-L-fucosidase                               52.8    5e-05   
gb|EFI72715.1|  alpha-L-fucosidase 2                                  52.8    5e-05   
ref|WP_031230656.1|  alpha/beta hydrolase                             52.8    5e-05   
ref|WP_008997998.1|  glycoside hydrolase                              52.8    5e-05   
ref|WP_019945337.1|  alpha-L-fucosidase                               52.8    5e-05   
ref|WP_044109607.1|  hypothetical protein                             52.8    5e-05   
gb|ESQ79120.1|  alpha/beta hydrolase                                  52.8    5e-05   
gb|KHF35651.1|  hypothetical protein CM49_02155                       49.3    5e-05   
ref|WP_024987997.1|  alpha-L-fucosidase                               52.8    5e-05   
ref|WP_044162505.1|  alpha-L-fucosidase                               52.8    5e-05   
ref|WP_028038270.1|  alpha/beta hydrolase                             52.8    5e-05   
ref|WP_014652371.1|  alpha-L-fucosidase                               52.8    5e-05   
ref|WP_044096920.1|  glycoside hydrolase                              52.8    5e-05   
ref|WP_022394418.1|  uncharacterized protein                          52.8    5e-05   
gb|EIY38987.1|  hypothetical protein HMPREF1062_00496                 52.8    5e-05   
ref|WP_043601023.1|  hypothetical protein                             52.8    5e-05   
ref|WP_041619465.1|  alpha-L-fucosidase                               52.8    5e-05   
ref|WP_041617902.1|  alpha-L-fucosidase                               52.8    5e-05   
ref|WP_031236563.1|  alpha/beta hydrolase                             52.8    6e-05   
ref|WP_022209736.1|  uncharacterized protein                          52.8    6e-05   
ref|WP_044533509.1|  glycoside hydrolase                              52.8    6e-05   
ref|WP_034752684.1|  glycoside hydrolase                              52.8    6e-05   
ref|WP_033160695.1|  glycoside hydrolase                              52.8    6e-05   
ref|WP_007212771.1|  glycoside hydrolase                              52.8    6e-05   
ref|WP_044263113.1|  large secreted protein                           52.8    6e-05   
ref|WP_034673837.1|  alpha-L-fucosidase                               52.8    6e-05   
gb|ESQ91294.1|  alpha/beta hydrolase                                  52.8    6e-05   
ref|WP_036699395.1|  alpha-L-fucosidase                               52.8    6e-05   
ref|WP_044270036.1|  glycoside hydrolase                              52.8    6e-05   
ref|WP_044631318.1|  alpha-L-fucosidase                               52.4    6e-05   
ref|WP_008626311.1|  glycoside hydrolase                              52.4    6e-05   
ref|WP_021967164.1|  uncharacterized protein                          52.4    6e-05   
ref|WP_039335895.1|  alpha/beta hydrolase                             52.4    7e-05   
gb|EHS55785.1|  alpha-L-fucosidase                                    52.4    7e-05   
ref|WP_039370715.1|  alpha-L-fucosidase                               52.4    7e-05   
gb|EKN13158.1|  hypothetical protein HMPREF1060_01744                 52.4    7e-05   
ref|WP_022321539.1|  uncharacterized protein                          52.4    7e-05   
ref|WP_036658023.1|  alpha-L-fucosidase                               52.4    7e-05   
ref|WP_044110485.1|  hypothetical protein                             52.4    7e-05   
gb|EKN34546.1|  hypothetical protein HMPREF1078_01162                 52.4    7e-05   
ref|WP_036705092.1|  alpha-L-fucosidase                               52.4    7e-05   
ref|WP_044657074.1|  alpha-L-fucosidase                               51.6    7e-05   
ref|WP_019183281.1|  alpha/beta hydrolase                             52.4    8e-05   
ref|WP_005633407.1|  hypothetical protein                             52.4    8e-05   
ref|WP_036647833.1|  alpha-amylase                                    52.0    8e-05   
ref|WP_032952873.1|  alpha-L-fucosidase                               52.0    8e-05   
ref|WP_025019606.1|  alpha-L-fucosidase                               52.0    8e-05   
ref|WP_007838536.1|  glycoside hydrolase                              52.0    8e-05   
ref|WP_022509044.1|  glycoside hydrolase family 95                    52.0    8e-05   
ref|WP_016276158.1|  MULTISPECIES: alpha-L-fucosidase 2               52.0    8e-05   
ref|WP_005847768.1|  glycoside hydrolase                              52.0    8e-05   
ref|WP_008667163.1|  MULTISPECIES: glycoside hydrolase                52.0    8e-05   
ref|WP_007844060.1|  MULTISPECIES: glycoside hydrolase                52.0    8e-05   
ref|WP_005846788.1|  glycoside hydrolase                              52.0    8e-05   
gb|KGT08515.1|  glycoside hydrolase                                   52.0    9e-05   
ref|WP_034846855.1|  glycoside hydrolase                              52.0    9e-05   
ref|WP_042267249.1|  alpha-L-fucosidase                               52.0    9e-05   
ref|WP_020598445.1|  hypothetical protein                             52.0    9e-05   
ref|WP_006281400.1|  glycoside hydrolase                              52.0    9e-05   
ref|WP_028611538.1|  alpha-L-fucosidase                               52.0    9e-05   
ref|WP_042212204.1|  alpha-L-fucosidase                               52.0    9e-05   
ref|WP_026815501.1|  alpha/beta hydrolase                             52.0    9e-05   
ref|WP_027454281.1|  alpha-L-fucosidase                               52.0    1e-04   
ref|WP_032944561.1|  alpha-L-fucosidase                               52.0    1e-04   
gb|KHJ39345.1|  hypothetical protein PBAC_03310                       52.0    1e-04   
ref|WP_022822740.1|  alpha-L-fucosidase                               52.0    1e-04   
ref|WP_039448004.1|  alpha-L-fucosidase                               52.0    1e-04   
ref|WP_029519236.1|  alpha-amylase                                    52.0    1e-04   
ref|WP_027328415.1|  alpha-L-fucosidase                               51.6    1e-04   
ref|WP_036885872.1|  hypothetical protein                             51.6    1e-04   
ref|WP_028548318.1|  alpha-L-fucosidase                               51.6    1e-04   
ref|WP_022081782.1|  uncharacterized protein                          51.6    1e-04   
ref|WP_029725003.1|  MULTISPECIES: alpha/beta hydrolase               51.6    1e-04   
ref|WP_029724557.1|  alpha/beta hydrolase                             51.6    1e-04   
ref|WP_022384438.1|  putative multimodular carbohydrate-active en...  51.6    1e-04   
emb|CCI71101.1|  Alpha-L-fucosidase 2                                 51.6    1e-04   
ref|WP_013373109.1|  alpha-amylase                                    51.6    1e-04   
ref|WP_024996350.1|  alpha-L-fucosidase                               51.6    1e-04   
ref|WP_034332146.1|  alpha-L-fucosidase                               51.6    1e-04   
ref|WP_025721948.1|  alpha-amylase                                    51.6    1e-04   
gb|KJF43562.1|  alpha-L-fucosidase                                    51.6    1e-04   
ref|WP_038572710.1|  alpha-L-fucosidase                               51.6    1e-04   
ref|WP_036683258.1|  alpha-L-fucosidase                               51.6    1e-04   
gb|AGA25657.1|  hypothetical protein Sinac_1268                       51.6    1e-04   
gb|EQB83654.1|  hypothetical protein L950_15005                       48.9    1e-04   
ref|WP_021970802.1|  intein C-terminal splicing region                51.6    1e-04   
ref|WP_040103824.1|  alpha-amylase                                    51.6    1e-04   
ref|WP_039273749.1|  alpha-amylase                                    51.6    1e-04   
gb|AHM67954.1|  putative alpha-l-fucosidase; glycoside hydrolase ...  51.6    1e-04   
ref|WP_007914066.1|  alpha-L-fucosidase                               51.6    1e-04   
ref|WP_036742595.1|  alpha-L-fucosidase                               51.6    1e-04   
ref|WP_034675138.1|  alpha-L-fucosidase                               51.6    1e-04   
ref|WP_017425533.1|  MULTISPECIES: alpha-amylase                      51.6    1e-04   
ref|WP_025674784.1|  alpha-amylase                                    51.6    1e-04   
ref|WP_039276230.1|  alpha-amylase                                    51.2    1e-04   
ref|WP_029515223.1|  alpha-amylase                                    51.2    1e-04   
ref|WP_044786267.1|  alpha-amylase                                    51.2    1e-04   
ref|WP_031462249.1|  alpha-amylase                                    51.2    1e-04   
ref|WP_025365851.1|  alpha-amylase                                    51.2    1e-04   
ref|WP_016820329.1|  alpha-amylase                                    51.2    1e-04   
gb|AEQ96300.1|  hypothetical protein XOC_2159                         51.2    1e-04   
ref|WP_029465763.1|  hypothetical protein                             51.2    1e-04   
ref|WP_041183691.1|  alpha/beta hydrolase                             51.2    1e-04   
ref|WP_013070519.1|  six-hairpin glycosidase                          51.2    2e-04   
ref|WP_035042325.1|  alpha/beta hydrolase                             51.2    2e-04   
ref|WP_020465811.1|  alpha-fucosidase                                 51.2    2e-04   
ref|WP_013994863.1|  alpha-L-fucosidase                               51.2    2e-04   
ref|WP_023990331.1|  alpha-amylase                                    51.2    2e-04   
ref|WP_042190753.1|  alpha-L-fucosidase                               51.2    2e-04   
ref|WP_027379581.1|  alpha-L-fucosidase                               51.2    2e-04   
ref|WP_009281724.1|  alpha-L-fucosidase                               51.2    2e-04   
ref|WP_037098611.1|  alpha/beta hydrolase                             51.2    2e-04   
ref|WP_029014958.1|  alpha/beta hydrolase                             51.2    2e-04   
ref|WP_037071164.1|  alpha/beta hydrolase                             51.2    2e-04   
ref|WP_010544096.1|  alpha/beta hydrolase                             51.2    2e-04   
gb|EJJ29437.1|  hypothetical protein PMI11_02312                      51.2    2e-04   
ref|WP_028541820.1|  alpha-amylase                                    51.2    2e-04   
ref|WP_038596617.1|  alpha-amylase                                    51.2    2e-04   
ref|WP_018619154.1|  alpha-L-fucosidase                               51.2    2e-04   
ref|WP_036634088.1|  alpha-L-fucosidase                               51.2    2e-04   
ref|WP_035774702.1|  hypothetical protein                             51.2    2e-04   
ref|WP_018615011.1|  hypothetical protein                             51.2    2e-04   
gb|EEC55034.1|  hypothetical protein BACEGG_00654                     51.2    2e-04   
ref|WP_021939520.1|  hypothetical protein                             51.2    2e-04   
ref|WP_028040060.1|  alpha/beta hydrolase                             51.2    2e-04   
ref|WP_042235167.1|  alpha-L-fucosidase                               51.2    2e-04   
ref|WP_022231326.1|  intein C-terminal splicing region                51.2    2e-04   
gb|EOR31238.1|  glycoside hydrolase                                   51.2    2e-04   
ref|XP_007157223.1|  hypothetical protein PHAVU_002G053000g           51.2    2e-04   
ref|WP_036876054.1|  alpha-L-fucosidase                               50.8    2e-04   
ref|WP_010404964.1|  alpha/beta hydrolase                             50.8    2e-04   
ref|WP_007216974.1|  hypothetical protein                             50.8    2e-04   
gb|EEF90998.1|  hypothetical protein BACCELL_01366                    50.8    2e-04   
gb|EDU99723.1|  intein C-terminal splicing region                     50.8    2e-04   
ref|WP_042562772.1|  alpha-L-fucosidase                               50.8    2e-04   
ref|WP_004293455.1|  glycoside hydrolase                              50.8    2e-04   
ref|WP_022124883.1|  MULTISPECIES: intein C-terminal splicing region  50.8    2e-04   
ref|WP_009280341.1|  Alpha-L-fucosidase                               50.8    2e-04   
ref|WP_012025099.1|  hypothetical protein                             50.8    2e-04   
ref|WP_010601624.1|  alpha-L-fucosidase                               50.8    2e-04   
ref|WP_036668063.1|  alpha-amylase                                    50.8    2e-04   
ref|WP_013042308.1|  alpha-L-fucosidase                               50.8    2e-04   
ref|WP_028539570.1|  alpha-L-fucosidase                               50.8    2e-04   
ref|WP_019050638.1|  hypothetical protein                             50.8    2e-04   
ref|XP_002981456.1|  hypothetical protein SELMODRAFT_178891           50.8    2e-04   
ref|WP_039871109.1|  alpha-L-fucosidase                               50.8    2e-04   
ref|WP_039953072.1|  alpha-L-fucosidase                               50.8    2e-04   
ref|WP_008510131.1|  glycoside hydrolase                              50.8    2e-04   



>ref|XP_009592476.1| PREDICTED: alpha-L-fucosidase 2 [Nicotiana tomentosiformis]
Length=820

 Score = 95.1 bits (235),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 50/72 (69%), Positives = 57/72 (79%), Gaps = 2/72 (3%)
 Frame = +3

Query  363  MEDFDWILVKELTDADMWspssg--sttessKPLEIRFNEPAKLWTDALPIGNXRLGAMV  536
            MED +W+LVKE TD D+W+PS      + S +PLEIRFNE AK WTDALPIGN RLGAMV
Sbjct  1    MEDCEWVLVKEPTDRDIWNPSLKYGEESSSLRPLEIRFNEAAKHWTDALPIGNGRLGAMV  60

Query  537  WGGVASETLNLN  572
            WGGV+SE LNLN
Sbjct  61   WGGVSSEILNLN  72



>ref|XP_009800211.1| PREDICTED: alpha-L-fucosidase 2 isoform X1 [Nicotiana sylvestris]
Length=820

 Score = 94.7 bits (234),  Expect = 8e-19, Method: Composition-based stats.
 Identities = 51/72 (71%), Positives = 58/72 (81%), Gaps = 2/72 (3%)
 Frame = +3

Query  363  MEDFDWILVKELTDADMWspssg--sttessKPLEIRFNEPAKLWTDALPIGNXRLGAMV  536
            MED +W+LVKE TD D+WSPS      + SS+PLEIRFNE AK WTDALPIGN RLGAM+
Sbjct  1    MEDCEWVLVKEPTDRDIWSPSLKNGEESSSSRPLEIRFNEAAKHWTDALPIGNGRLGAMI  60

Query  537  WGGVASETLNLN  572
            WGGV+SE LNLN
Sbjct  61   WGGVSSEILNLN  72



>ref|XP_009800220.1| PREDICTED: alpha-L-fucosidase 2 isoform X2 [Nicotiana sylvestris]
Length=791

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 51/72 (71%), Positives = 58/72 (81%), Gaps = 2/72 (3%)
 Frame = +3

Query  363  MEDFDWILVKELTDADMWspssg--sttessKPLEIRFNEPAKLWTDALPIGNXRLGAMV  536
            MED +W+LVKE TD D+WSPS      + SS+PLEIRFNE AK WTDALPIGN RLGAM+
Sbjct  1    MEDCEWVLVKEPTDRDIWSPSLKNGEESSSSRPLEIRFNEAAKHWTDALPIGNGRLGAMI  60

Query  537  WGGVASETLNLN  572
            WGGV+SE LNLN
Sbjct  61   WGGVSSEILNLN  72



>ref|XP_004292088.2| PREDICTED: alpha-L-fucosidase 2 [Fragaria vesca subsp. vesca]
Length=854

 Score = 93.2 bits (230),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 47/75 (63%), Positives = 58/75 (77%), Gaps = 1/75 (1%)
 Frame = +3

Query  348  FLCNSMEDFDWILVKELTDADMWspssgsttessKPLEIRFNEPAKLWTDALPIGNXRLG  527
            FLC +MED DW+LV++  + D+W+PS     E S+PL++ F  PAK WTDA+PIGN RLG
Sbjct  16   FLC-AMEDGDWVLVRQPAEKDLWTPSLVKEEERSEPLKVTFGGPAKFWTDAIPIGNGRLG  74

Query  528  AMVWGGVASETLNLN  572
            AMVWGGVASETL LN
Sbjct  75   AMVWGGVASETLQLN  89



>ref|XP_010090595.1| hypothetical protein L484_002038 [Morus notabilis]
 gb|EXB40023.1| hypothetical protein L484_002038 [Morus notabilis]
Length=175

 Score = 85.1 bits (209),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 52/71 (73%), Gaps = 1/71 (1%)
 Frame = +3

Query  363  MEDFDWILVKELTDADMWspssgsttes-sKPLEIRFNEPAKLWTDALPIGNXRLGAMVW  539
            MED  WILV+   + D+W PS     E  SKPL++ F EPAK WTDA+PIGN RLGAMVW
Sbjct  1    MEDGKWILVQRPAEKDLWRPSGSVKEEEDSKPLKVTFTEPAKHWTDAVPIGNGRLGAMVW  60

Query  540  GGVASETLNLN  572
            GGVASETL LN
Sbjct  61   GGVASETLQLN  71



>ref|XP_010271389.1| PREDICTED: alpha-L-fucosidase 2 [Nelumbo nucifera]
Length=847

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 49/71 (69%), Positives = 55/71 (77%), Gaps = 2/71 (3%)
 Frame = +3

Query  363  MED-FDWILVKELTDADMWspssgsttessKPLEIRFNEPAKLWTDALPIGNXRLGAMVW  539
            MED  DW+LV+  TDAD WSP+      S +PL++RF EPAK WTDALPIGN RLGAMVW
Sbjct  1    MEDQGDWVLVRRPTDADFWSPNLKEMDNS-QPLKLRFFEPAKHWTDALPIGNGRLGAMVW  59

Query  540  GGVASETLNLN  572
            GGVASETL LN
Sbjct  60   GGVASETLQLN  70



>ref|XP_011457799.1| PREDICTED: alpha-L-fucosidase 2-like [Fragaria vesca subsp. vesca]
Length=875

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 45/70 (64%), Positives = 54/70 (77%), Gaps = 0/70 (0%)
 Frame = +3

Query  363  MEDFDWILVKELTDADMWspssgsttessKPLEIRFNEPAKLWTDALPIGNXRLGAMVWG  542
            MED DW+LV+   + D+W+PS     ESS+PL++ F  PAK WTDA+PIGN RLGAMVWG
Sbjct  1    MEDGDWVLVRPPAEKDLWTPSLVKEHESSEPLKVTFGGPAKFWTDAIPIGNGRLGAMVWG  60

Query  543  GVASETLNLN  572
            GVASETL LN
Sbjct  61   GVASETLQLN  70



>gb|KJB47346.1| hypothetical protein B456_008G022200 [Gossypium raimondii]
Length=672

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 42/70 (60%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = +3

Query  363  MEDFDWILVKELTDADMWspssgsttessKPLEIRFNEPAKLWTDALPIGNXRLGAMVWG  542
            MED +W+LV++  + D W+P+S    ++SKPL++ F+ PAK WTDA+PIGN RLGAMVWG
Sbjct  1    MEDGEWVLVRKPAEKDFWNPTSMDLADTSKPLKVTFSGPAKHWTDAIPIGNGRLGAMVWG  60

Query  543  GVASETLNLN  572
            G+ASETL LN
Sbjct  61   GIASETLQLN  70



>gb|KJB47348.1| hypothetical protein B456_008G022200 [Gossypium raimondii]
Length=680

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 42/70 (60%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = +3

Query  363  MEDFDWILVKELTDADMWspssgsttessKPLEIRFNEPAKLWTDALPIGNXRLGAMVWG  542
            MED +W+LV++  + D W+P+S    ++SKPL++ F+ PAK WTDA+PIGN RLGAMVWG
Sbjct  1    MEDGEWVLVRKPAEKDFWNPTSMDLADTSKPLKVTFSGPAKHWTDAIPIGNGRLGAMVWG  60

Query  543  GVASETLNLN  572
            G+ASETL LN
Sbjct  61   GIASETLQLN  70



>gb|KJB47347.1| hypothetical protein B456_008G022200 [Gossypium raimondii]
Length=843

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 42/70 (60%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = +3

Query  363  MEDFDWILVKELTDADMWspssgsttessKPLEIRFNEPAKLWTDALPIGNXRLGAMVWG  542
            MED +W+LV++  + D W+P+S    ++SKPL++ F+ PAK WTDA+PIGN RLGAMVWG
Sbjct  1    MEDGEWVLVRKPAEKDFWNPTSMDLADTSKPLKVTFSGPAKHWTDAIPIGNGRLGAMVWG  60

Query  543  GVASETLNLN  572
            G+ASETL LN
Sbjct  61   GIASETLQLN  70



>ref|XP_007042561.1| 1,2-alpha-L-fucosidases [Theobroma cacao]
 gb|EOX98392.1| 1,2-alpha-L-fucosidases [Theobroma cacao]
Length=843

 Score = 86.3 bits (212),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 41/70 (59%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = +3

Query  363  MEDFDWILVKELTDADMWspssgsttessKPLEIRFNEPAKLWTDALPIGNXRLGAMVWG  542
            M+D +W+LV++  + D+W+P+S +  ++SKPL++ F+ PAK WTDA+PIGN RLGAMVWG
Sbjct  1    MDDGEWVLVRKPAEKDIWNPTSMALADTSKPLKVTFSGPAKHWTDAIPIGNGRLGAMVWG  60

Query  543  GVASETLNLN  572
            G+ASETL LN
Sbjct  61   GIASETLQLN  70



>ref|XP_007200942.1| hypothetical protein PRUPE_ppa001398mg [Prunus persica]
 gb|EMJ02141.1| hypothetical protein PRUPE_ppa001398mg [Prunus persica]
Length=837

 Score = 84.0 bits (206),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 43/70 (61%), Positives = 53/70 (76%), Gaps = 1/70 (1%)
 Frame = +3

Query  363  MEDFDWILVKELTDADMWspssgsttessKPLEIRFNEPAKLWTDALPIGNXRLGAMVWG  542
            MED +W+LV++  + DMW+PS      S KPL++ F+ PAK WTDA+PIGN RLGAMVWG
Sbjct  1    MEDAEWVLVRKPAEKDMWAPSLVKKESS-KPLKVTFSGPAKHWTDAIPIGNGRLGAMVWG  59

Query  543  GVASETLNLN  572
            GVASE L LN
Sbjct  60   GVASEKLQLN  69



>gb|KJB47343.1| hypothetical protein B456_008G022000 [Gossypium raimondii]
Length=617

 Score = 82.4 bits (202),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 41/70 (59%), Positives = 53/70 (76%), Gaps = 2/70 (3%)
 Frame = +3

Query  363  MEDFDWILVKELTDADMWspssgsttessKPLEIRFNEPAKLWTDALPIGNXRLGAMVWG  542
            M D +WI+V+  T AD+W+P    +T   +PL++ FNEPAK WTDALP+GN RLGAM+WG
Sbjct  1    MRDEEWIMVRRPTVADLWNPCFSDSTS--RPLKVIFNEPAKYWTDALPVGNGRLGAMIWG  58

Query  543  GVASETLNLN  572
            GVASE + LN
Sbjct  59   GVASELIQLN  68



>gb|KJB47344.1| hypothetical protein B456_008G022000 [Gossypium raimondii]
Length=612

 Score = 82.4 bits (202),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 41/70 (59%), Positives = 53/70 (76%), Gaps = 2/70 (3%)
 Frame = +3

Query  363  MEDFDWILVKELTDADMWspssgsttessKPLEIRFNEPAKLWTDALPIGNXRLGAMVWG  542
            M D +WI+V+  T AD+W+P    +T   +PL++ FNEPAK WTDALP+GN RLGAM+WG
Sbjct  1    MRDEEWIMVRRPTVADLWNPCFSDSTS--RPLKVIFNEPAKYWTDALPVGNGRLGAMIWG  58

Query  543  GVASETLNLN  572
            GVASE + LN
Sbjct  59   GVASELIQLN  68



>gb|KJB47342.1| hypothetical protein B456_008G022000 [Gossypium raimondii]
Length=823

 Score = 82.8 bits (203),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 41/70 (59%), Positives = 53/70 (76%), Gaps = 2/70 (3%)
 Frame = +3

Query  363  MEDFDWILVKELTDADMWspssgsttessKPLEIRFNEPAKLWTDALPIGNXRLGAMVWG  542
            M D +WI+V+  T AD+W+P    +T   +PL++ FNEPAK WTDALP+GN RLGAM+WG
Sbjct  1    MRDEEWIMVRRPTVADLWNPCFSDSTS--RPLKVIFNEPAKYWTDALPVGNGRLGAMIWG  58

Query  543  GVASETLNLN  572
            GVASE + LN
Sbjct  59   GVASELIQLN  68



>ref|XP_008236396.1| PREDICTED: alpha-L-fucosidase 2 [Prunus mume]
Length=836

 Score = 82.8 bits (203),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 42/70 (60%), Positives = 53/70 (76%), Gaps = 1/70 (1%)
 Frame = +3

Query  363  MEDFDWILVKELTDADMWspssgsttessKPLEIRFNEPAKLWTDALPIGNXRLGAMVWG  542
            MED +W+LV++  + D+W+PS      S KPL++ F+ PAK WTDA+PIGN RLGAMVWG
Sbjct  1    MEDAEWVLVRKPAEKDLWAPSLVEEESS-KPLKVTFSGPAKHWTDAIPIGNGRLGAMVWG  59

Query  543  GVASETLNLN  572
            GVASE L LN
Sbjct  60   GVASEKLQLN  69



>emb|CDO97236.1| unnamed protein product [Coffea canephora]
Length=837

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 46/73 (63%), Positives = 52/73 (71%), Gaps = 4/73 (5%)
 Frame = +3

Query  366  EDFDWILVKELTDADMWspssgsttessK----PLEIRFNEPAKLWTDALPIGNXRLGAM  533
            E   W+LVK+  D D WSP+  S+   S     PL+IRFNEPAK WTDALPIGN RLGAM
Sbjct  3    EGHRWVLVKKPCDRDAWSPTLSSSNTGSNSGSGPLKIRFNEPAKYWTDALPIGNGRLGAM  62

Query  534  VWGGVASETLNLN  572
            VWGGV +E LNLN
Sbjct  63   VWGGVPAEVLNLN  75



>emb|CAN67724.1| hypothetical protein VITISV_006023 [Vitis vinifera]
Length=151

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 52/73 (71%), Gaps = 3/73 (4%)
 Frame = +3

Query  363  MEDFDWILVKELTDADMWsps---sgsttessKPLEIRFNEPAKLWTDALPIGNXRLGAM  533
            MED +W+LV+  T+ + WSP          SS PL++RF  PAK WTDALPIGN RLGAM
Sbjct  1    MEDGEWVLVRPPTEIECWSPGWGGGEDEGGSSDPLKVRFFGPAKHWTDALPIGNGRLGAM  60

Query  534  VWGGVASETLNLN  572
            VWGGVASETL LN
Sbjct  61   VWGGVASETLQLN  73



>ref|XP_008338239.1| PREDICTED: alpha-L-fucosidase 2-like [Malus domestica]
Length=825

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 41/69 (59%), Positives = 53/69 (77%), Gaps = 0/69 (0%)
 Frame = +3

Query  366  EDFDWILVKELTDADMWspssgsttessKPLEIRFNEPAKLWTDALPIGNXRLGAMVWGG  545
            +D +W+LV+   + D+W+PS     ESS+PL++ F+ PAK WTDA+PIGN RLGAMVWGG
Sbjct  3    DDGEWVLVRSPAEKDLWTPSLVEEEESSRPLKVAFSGPAKHWTDAIPIGNGRLGAMVWGG  62

Query  546  VASETLNLN  572
            V SETL LN
Sbjct  63   VXSETLQLN  71



>gb|KEH44060.1| alpha-L-fucosidase-like protein [Medicago truncatula]
Length=902

 Score = 80.5 bits (197),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 43/76 (57%), Positives = 57/76 (75%), Gaps = 2/76 (3%)
 Frame = +3

Query  351  LCNSMEDFDWILVKELTDADMWspss--gsttessKPLEIRFNEPAKLWTDALPIGNXRL  524
            L ++MED DW+LV+  +  D+W+PSS   +  E S+PL++ F+ PAK WTDA+PIGN RL
Sbjct  56   LFSTMEDGDWVLVRSPSQKDLWNPSSPNAADNEPSRPLKLTFSAPAKYWTDAIPIGNGRL  115

Query  525  GAMVWGGVASETLNLN  572
            GAMVWGGV +E L LN
Sbjct  116  GAMVWGGVQTELLQLN  131



>ref|XP_010647956.1| PREDICTED: alpha-L-fucosidase 2 [Vitis vinifera]
Length=840

 Score = 80.1 bits (196),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 44/73 (60%), Positives = 51/73 (70%), Gaps = 3/73 (4%)
 Frame = +3

Query  363  MEDFDWILVKELTDADMWs---pssgsttessKPLEIRFNEPAKLWTDALPIGNXRLGAM  533
            MED +W+LV+  T+ + WS           SS PL++RF  PAK WTDALPIGN RLGAM
Sbjct  1    MEDGEWVLVRPPTEIECWSPGWGGGEDEGGSSDPLKVRFFGPAKHWTDALPIGNGRLGAM  60

Query  534  VWGGVASETLNLN  572
            VWGGVASETL LN
Sbjct  61   VWGGVASETLQLN  73



>ref|XP_011001337.1| PREDICTED: alpha-L-fucosidase 2-like isoform X2 [Populus euphratica]
Length=772

 Score = 79.7 bits (195),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 43/73 (59%), Positives = 52/73 (71%), Gaps = 3/73 (4%)
 Frame = +3

Query  363  MEDFDWILVKELTDADMWspssgstt---essKPLEIRFNEPAKLWTDALPIGNXRLGAM  533
            MED +W+LV+  T+ D WS S        E+S+ L+I FN PAK WTDA+PIGN RLGAM
Sbjct  1    MEDEEWVLVRRTTEKDWWSSSFMDDDDNGENSRSLKITFNGPAKHWTDAIPIGNGRLGAM  60

Query  534  VWGGVASETLNLN  572
            +WGGVA ETL LN
Sbjct  61   IWGGVALETLQLN  73



>emb|CBI22509.3| unnamed protein product [Vitis vinifera]
Length=781

 Score = 79.7 bits (195),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 44/73 (60%), Positives = 51/73 (70%), Gaps = 3/73 (4%)
 Frame = +3

Query  363  MEDFDWILVKELTDADMWs---pssgsttessKPLEIRFNEPAKLWTDALPIGNXRLGAM  533
            MED +W+LV+  T+ + WS           SS PL++RF  PAK WTDALPIGN RLGAM
Sbjct  1    MEDGEWVLVRPPTEIECWSPGWGGGEDEGGSSDPLKVRFFGPAKHWTDALPIGNGRLGAM  60

Query  534  VWGGVASETLNLN  572
            VWGGVASETL LN
Sbjct  61   VWGGVASETLQLN  73



>ref|XP_011001328.1| PREDICTED: alpha-L-fucosidase 2-like isoform X1 [Populus euphratica]
Length=847

 Score = 79.7 bits (195),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 43/73 (59%), Positives = 52/73 (71%), Gaps = 3/73 (4%)
 Frame = +3

Query  363  MEDFDWILVKELTDADMWspssgstt---essKPLEIRFNEPAKLWTDALPIGNXRLGAM  533
            MED +W+LV+  T+ D WS S        E+S+ L+I FN PAK WTDA+PIGN RLGAM
Sbjct  1    MEDEEWVLVRRTTEKDWWSSSFMDDDDNGENSRSLKITFNGPAKHWTDAIPIGNGRLGAM  60

Query  534  VWGGVASETLNLN  572
            +WGGVA ETL LN
Sbjct  61   IWGGVALETLQLN  73



>ref|XP_002313157.1| hypothetical protein POPTR_0009s09650g [Populus trichocarpa]
 gb|EEE87112.1| hypothetical protein POPTR_0009s09650g [Populus trichocarpa]
Length=836

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 43/70 (61%), Positives = 51/70 (73%), Gaps = 1/70 (1%)
 Frame = +3

Query  363  MEDFDWILVKELTDADMWspssgsttessKPLEIRFNEPAKLWTDALPIGNXRLGAMVWG  542
            MED  W+LV   TD DMW+P+S    +S KPL+I    PAK WTDA+PIGN RLGAMVWG
Sbjct  1    MEDGSWVLVTRPTDRDMWNPTSTYLEDS-KPLKITSTGPAKYWTDAIPIGNGRLGAMVWG  59

Query  543  GVASETLNLN  572
            GV+SE + LN
Sbjct  60   GVSSELIQLN  69



>ref|XP_011001318.1| PREDICTED: alpha-L-fucosidase 2-like [Populus euphratica]
Length=837

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 42/70 (60%), Positives = 51/70 (73%), Gaps = 1/70 (1%)
 Frame = +3

Query  363  MEDFDWILVKELTDADMWspssgsttessKPLEIRFNEPAKLWTDALPIGNXRLGAMVWG  542
            MED  W+LV   T+ DMW+P+S    +S KPL+I    PAK WTDA+PIGN RLGAMVWG
Sbjct  1    MEDGSWVLVTRSTNRDMWNPTSTDLEDS-KPLKITSTRPAKYWTDAIPIGNGRLGAMVWG  59

Query  543  GVASETLNLN  572
            GV+SE + LN
Sbjct  60   GVSSELIQLN  69



>ref|XP_009344361.1| PREDICTED: alpha-L-fucosidase 2-like isoform X3 [Pyrus x bretschneideri]
 ref|XP_009344365.1| PREDICTED: alpha-L-fucosidase 2-like isoform X3 [Pyrus x bretschneideri]
Length=661

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 40/70 (57%), Positives = 52/70 (74%), Gaps = 1/70 (1%)
 Frame = +3

Query  366  EDFDWILVKELTDADMWs-pssgsttessKPLEIRFNEPAKLWTDALPIGNXRLGAMVWG  542
            +D +W+LV+   + D+W+        ESS+PL++ F+ PAK WTDA+PIGN RLGAMVWG
Sbjct  3    DDGEWVLVRSPAEKDLWTPSLVEEEEESSRPLKVTFSGPAKHWTDAIPIGNGRLGAMVWG  62

Query  543  GVASETLNLN  572
            GVASETL LN
Sbjct  63   GVASETLQLN  72



>ref|XP_009335951.1| PREDICTED: alpha-L-fucosidase 2 [Pyrus x bretschneideri]
Length=836

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 42/71 (59%), Positives = 54/71 (76%), Gaps = 2/71 (3%)
 Frame = +3

Query  366  EDFDWILVKELTDADMWspssgstte--ssKPLEIRFNEPAKLWTDALPIGNXRLGAMVW  539
            +D +W+LV+   + D+W+PS     E  SS+PL++ F+ PAK WTDA+PIGN RLGAMVW
Sbjct  3    DDGEWVLVRSPAEKDLWTPSLVEEEEGESSRPLKVTFSGPAKHWTDAIPIGNGRLGAMVW  62

Query  540  GGVASETLNLN  572
            GGVASETL LN
Sbjct  63   GGVASETLQLN  73



>ref|XP_008338241.1| PREDICTED: alpha-L-fucosidase 2 [Malus domestica]
Length=836

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 42/71 (59%), Positives = 54/71 (76%), Gaps = 2/71 (3%)
 Frame = +3

Query  366  EDFDWILVKELTDADMWspssgstte--ssKPLEIRFNEPAKLWTDALPIGNXRLGAMVW  539
            +D +W+LV+   + D+W+PS     E  SS+PL++ F+ PAK WTDA+PIGN RLGAMVW
Sbjct  3    DDGEWVLVRSPAEKDLWTPSLVEEEEGESSRPLKVTFSGPAKHWTDAIPIGNGRLGAMVW  62

Query  540  GGVASETLNLN  572
            GGVASETL LN
Sbjct  63   GGVASETLQLN  73



>ref|XP_009345064.1| PREDICTED: alpha-L-fucosidase 2-like [Pyrus x bretschneideri]
Length=826

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 40/70 (57%), Positives = 52/70 (74%), Gaps = 1/70 (1%)
 Frame = +3

Query  366  EDFDWILVKELTDADMWs-pssgsttessKPLEIRFNEPAKLWTDALPIGNXRLGAMVWG  542
            +D +W+LV+   + D+W+        ESS+PL++ F+ PAK WTDA+PIGN RLGAMVWG
Sbjct  3    DDGEWVLVRSPAEKDLWTPSLVEEEEESSRPLKVTFSGPAKHWTDAIPIGNGRLGAMVWG  62

Query  543  GVASETLNLN  572
            GVASETL LN
Sbjct  63   GVASETLQLN  72



>ref|XP_009344358.1| PREDICTED: alpha-L-fucosidase 2-like isoform X1 [Pyrus x bretschneideri]
 ref|XP_009344362.1| PREDICTED: alpha-L-fucosidase 2-like isoform X1 [Pyrus x bretschneideri]
Length=826

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 40/70 (57%), Positives = 52/70 (74%), Gaps = 1/70 (1%)
 Frame = +3

Query  366  EDFDWILVKELTDADMWs-pssgsttessKPLEIRFNEPAKLWTDALPIGNXRLGAMVWG  542
            +D +W+LV+   + D+W+        ESS+PL++ F+ PAK WTDA+PIGN RLGAMVWG
Sbjct  3    DDGEWVLVRSPAEKDLWTPSLVEEEEESSRPLKVTFSGPAKHWTDAIPIGNGRLGAMVWG  62

Query  543  GVASETLNLN  572
            GVASETL LN
Sbjct  63   GVASETLQLN  72



>ref|XP_008787125.1| PREDICTED: alpha-L-fucosidase 2 [Phoenix dactylifera]
Length=863

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 42/70 (60%), Positives = 52/70 (74%), Gaps = 1/70 (1%)
 Frame = +3

Query  366  EDFDWILVKELTDADM-WspssgsttessKPLEIRFNEPAKLWTDALPIGNXRLGAMVWG  542
            E  +W+ V+  T+AD  W    G  TE ++PL+++F+EPAK WTDA PIGN RLGAMVWG
Sbjct  3    EGEEWVWVRPPTEADAEWWTGGGGETEDARPLKVQFSEPAKHWTDAAPIGNGRLGAMVWG  62

Query  543  GVASETLNLN  572
            GVASETL LN
Sbjct  63   GVASETLQLN  72



>ref|XP_007042562.1| 1,2-alpha-L-fucosidases [Theobroma cacao]
 gb|EOX98393.1| 1,2-alpha-L-fucosidases [Theobroma cacao]
Length=828

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 45/74 (61%), Positives = 56/74 (76%), Gaps = 4/74 (5%)
 Frame = +3

Query  363  MEDFDWILVKELTDADMWspssg----sttessKPLEIRFNEPAKLWTDALPIGNXRLGA  530
            M D +W+LV+  T +D+ +PSS     S + +S+PL++ FNEPAK WTDALPIGN RLGA
Sbjct  1    MGDEEWVLVRRPTVSDLLNPSSMVPSDSQSSTSRPLKVTFNEPAKYWTDALPIGNGRLGA  60

Query  531  MVWGGVASETLNLN  572
            MVWGGVASE L LN
Sbjct  61   MVWGGVASELLQLN  74



>ref|XP_002313154.2| hypothetical protein POPTR_0009s09690g [Populus trichocarpa]
 gb|EEE87109.2| hypothetical protein POPTR_0009s09690g [Populus trichocarpa]
Length=825

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 42/73 (58%), Positives = 52/73 (71%), Gaps = 3/73 (4%)
 Frame = +3

Query  363  MEDFDWILVKELTDADMWspssgstt---essKPLEIRFNEPAKLWTDALPIGNXRLGAM  533
            MED +W+LV+  T+ D WS S        E+S+ L+I FN PAK WTDA+PIGN RLGAM
Sbjct  1    MEDEEWVLVRRTTEKDWWSSSFMDDDDNGENSRSLKITFNGPAKHWTDAIPIGNGRLGAM  60

Query  534  VWGGVASETLNLN  572
            +WGGV+ ETL LN
Sbjct  61   IWGGVSLETLQLN  73



>ref|XP_011088197.1| PREDICTED: alpha-L-fucosidase 2 isoform X1 [Sesamum indicum]
Length=859

 Score = 77.4 bits (189),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 41/68 (60%), Positives = 50/68 (74%), Gaps = 1/68 (1%)
 Frame = +3

Query  372  FDWILVKELTDADMWspssgsttessKPLEIRFNE-PAKLWTDALPIGNXRLGAMVWGGV  548
            F  +L   + D D+WS S     +S++ LE+RFN  PAK WTDALPIGN RLGAMVWGGV
Sbjct  22   FGHVLGVAVKDKDVWSSSLEKNMDSTRSLEVRFNNGPAKHWTDALPIGNGRLGAMVWGGV  81

Query  549  ASETLNLN  572
            A+ET+NLN
Sbjct  82   ANETINLN  89



>ref|XP_002298754.2| hypothetical protein POPTR_0001s30620g [Populus trichocarpa]
 gb|EEE83559.2| hypothetical protein POPTR_0001s30620g [Populus trichocarpa]
Length=815

 Score = 77.0 bits (188),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 43/72 (60%), Positives = 52/72 (72%), Gaps = 2/72 (3%)
 Frame = +3

Query  363  MEDFDWILVKELTDADMWspssgstt--essKPLEIRFNEPAKLWTDALPIGNXRLGAMV  536
            MED +W+LV+  T+ D W+PS       ESSKPL + F+ PAK WTDA+PIGN R GAM+
Sbjct  1    MEDKEWVLVQRSTEKDWWNPSLMEDNNGESSKPLRVTFSGPAKHWTDAIPIGNGRHGAMI  60

Query  537  WGGVASETLNLN  572
            WGGVA ETL LN
Sbjct  61   WGGVALETLQLN  72



>ref|XP_011030387.1| PREDICTED: alpha-L-fucosidase 2-like [Populus euphratica]
Length=846

 Score = 77.0 bits (188),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 43/72 (60%), Positives = 53/72 (74%), Gaps = 2/72 (3%)
 Frame = +3

Query  363  MEDFDWILVKELTDADMWspssgstt--essKPLEIRFNEPAKLWTDALPIGNXRLGAMV  536
            M D +W+LV+  T+ D W+PS       ESSKPL++ F+ PAK WTDA+PIGN RLGAM+
Sbjct  1    MADKEWVLVQRSTEKDWWNPSWMEDNNGESSKPLKVTFSGPAKHWTDAIPIGNGRLGAMI  60

Query  537  WGGVASETLNLN  572
            WGGVA ETL LN
Sbjct  61   WGGVALETLQLN  72



>ref|XP_011030378.1| PREDICTED: alpha-L-fucosidase 2-like isoform X1 [Populus euphratica]
Length=845

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 51/70 (73%), Gaps = 1/70 (1%)
 Frame = +3

Query  363  MEDFDWILVKELTDADMWspssgsttessKPLEIRFNEPAKLWTDALPIGNXRLGAMVWG  542
            ME  +W+ V   TD D+W+P+S    +S +PL++ F+ PAK WTD +PIGN RLGAMVWG
Sbjct  1    MESGEWVFVTRPTDKDLWNPTSTELEDS-RPLKVTFSGPAKYWTDGIPIGNGRLGAMVWG  59

Query  543  GVASETLNLN  572
            GV+SE + LN
Sbjct  60   GVSSELIQLN  69



>ref|XP_011030379.1| PREDICTED: alpha-L-fucosidase 2-like isoform X2 [Populus euphratica]
Length=843

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 51/70 (73%), Gaps = 1/70 (1%)
 Frame = +3

Query  363  MEDFDWILVKELTDADMWspssgsttessKPLEIRFNEPAKLWTDALPIGNXRLGAMVWG  542
            ME  +W+ V   TD D+W+P+S    +S +PL++ F+ PAK WTD +PIGN RLGAMVWG
Sbjct  1    MESGEWVFVTRPTDKDLWNPTSTELEDS-RPLKVTFSGPAKYWTDGIPIGNGRLGAMVWG  59

Query  543  GVASETLNLN  572
            GV+SE + LN
Sbjct  60   GVSSELIQLN  69



>gb|KDO47958.1| hypothetical protein CISIN_1g003209mg [Citrus sinensis]
Length=839

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 41/69 (59%), Positives = 51/69 (74%), Gaps = 3/69 (4%)
 Frame = +3

Query  375  DWILVKELTDADMWspssgstt---essKPLEIRFNEPAKLWTDALPIGNXRLGAMVWGG  545
            +W+LV+  T+ D+W+PS        ESS+PL++ F  PAK WTDA+PIGN RLGAMVWGG
Sbjct  8    EWVLVRRSTEKDLWNPSGTVGDGGGESSEPLKVTFGGPAKHWTDAIPIGNGRLGAMVWGG  67

Query  546  VASETLNLN  572
            VASE L LN
Sbjct  68   VASEILQLN  76



>ref|XP_006486973.1| PREDICTED: alpha-L-fucosidase 2-like isoform X2 [Citrus sinensis]
Length=833

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 41/69 (59%), Positives = 51/69 (74%), Gaps = 3/69 (4%)
 Frame = +3

Query  375  DWILVKELTDADMWspssgstt---essKPLEIRFNEPAKLWTDALPIGNXRLGAMVWGG  545
            +W+LV+  T+ D+W+PS        ESS+PL++ F  PAK WTDA+PIGN RLGAMVWGG
Sbjct  8    EWVLVRRSTEKDLWNPSGSVGDGGGESSEPLKVTFGGPAKHWTDAIPIGNGRLGAMVWGG  67

Query  546  VASETLNLN  572
            VASE L LN
Sbjct  68   VASEILQLN  76



>ref|XP_006486972.1| PREDICTED: alpha-L-fucosidase 2-like isoform X1 [Citrus sinensis]
Length=839

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 41/69 (59%), Positives = 51/69 (74%), Gaps = 3/69 (4%)
 Frame = +3

Query  375  DWILVKELTDADMWspssgstt---essKPLEIRFNEPAKLWTDALPIGNXRLGAMVWGG  545
            +W+LV+  T+ D+W+PS        ESS+PL++ F  PAK WTDA+PIGN RLGAMVWGG
Sbjct  8    EWVLVRRSTEKDLWNPSGSVGDGGGESSEPLKVTFGGPAKHWTDAIPIGNGRLGAMVWGG  67

Query  546  VASETLNLN  572
            VASE L LN
Sbjct  68   VASEILQLN  76



>gb|KHG11389.1| hypothetical protein F383_14795 [Gossypium arboreum]
Length=884

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 38/63 (60%), Positives = 49/63 (78%), Gaps = 2/63 (3%)
 Frame = +3

Query  384  LVKELTDADMWspssgsttessKPLEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETL  563
            +V+  T AD+W+P S  +T   +PL++ FNEPAK WTDALP+GN RLGAM+WGGVASE +
Sbjct  1    MVRRPTVADLWNPCSSDSTS--RPLKVIFNEPAKYWTDALPVGNGRLGAMIWGGVASELI  58

Query  564  NLN  572
             LN
Sbjct  59   QLN  61



>gb|KDP44439.1| hypothetical protein JCGZ_16272 [Jatropha curcas]
Length=849

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 49/71 (69%), Gaps = 1/71 (1%)
 Frame = +3

Query  363  MEDFDWILVKELTDADMWs-pssgsttessKPLEIRFNEPAKLWTDALPIGNXRLGAMVW  539
            +ED +W++V+   + D W          S++PL+I F EPAK WTDA+PIGN RLGAMV+
Sbjct  3    VEDEEWVVVRRPAEKDWWKPSLVEDGESSTRPLKITFTEPAKHWTDAIPIGNGRLGAMVF  62

Query  540  GGVASETLNLN  572
            GGV SET+ LN
Sbjct  63   GGVKSETIRLN  73



>ref|XP_010936540.1| PREDICTED: alpha-L-fucosidase 2-like isoform X2 [Elaeis guineensis]
Length=810

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 40/71 (56%), Positives = 53/71 (75%), Gaps = 3/71 (4%)
 Frame = +3

Query  366  EDFDWILVKELTDADM--WspssgsttessKPLEIRFNEPAKLWTDALPIGNXRLGAMVW  539
            E  +W+ V+   +AD+  W+   G T ++ +PL+++F+EPAK WTDA PIGN RLGAMVW
Sbjct  3    EGEEWVWVRPPMEADVECWAGGGGETDDA-RPLKVQFSEPAKHWTDATPIGNGRLGAMVW  61

Query  540  GGVASETLNLN  572
            GGVASETL LN
Sbjct  62   GGVASETLQLN  72



>ref|XP_006422892.1| hypothetical protein CICLE_v10027816mg [Citrus clementina]
 gb|ESR36132.1| hypothetical protein CICLE_v10027816mg [Citrus clementina]
Length=839

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 41/69 (59%), Positives = 50/69 (72%), Gaps = 3/69 (4%)
 Frame = +3

Query  375  DWILVKELTDADMWspssgstt---essKPLEIRFNEPAKLWTDALPIGNXRLGAMVWGG  545
            +W+LV+  T+ D W+PS        ESS+PL++ F  PAK WTDA+PIGN RLGAMVWGG
Sbjct  8    EWVLVRRSTEKDWWNPSGTVGDGGGESSEPLKVTFGGPAKHWTDAIPIGNGRLGAMVWGG  67

Query  546  VASETLNLN  572
            VASE L LN
Sbjct  68   VASEILQLN  76



>ref|XP_002298755.2| hypothetical protein POPTR_0001s30610g [Populus trichocarpa]
 gb|EEE83560.2| hypothetical protein POPTR_0001s30610g [Populus trichocarpa]
Length=843

 Score = 73.9 bits (180),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 51/70 (73%), Gaps = 1/70 (1%)
 Frame = +3

Query  363  MEDFDWILVKELTDADMWspssgsttessKPLEIRFNEPAKLWTDALPIGNXRLGAMVWG  542
            ME  +W+ V   T+ D+W+P+S    +S +PL++ F+ PAK WTD +PIGN RLGAMVWG
Sbjct  1    MESGEWVFVTRPTEKDLWNPTSTELEDS-RPLKVTFSGPAKYWTDGIPIGNGRLGAMVWG  59

Query  543  GVASETLNLN  572
            GV+SE + LN
Sbjct  60   GVSSELIQLN  69



>ref|XP_010936549.1| PREDICTED: alpha-L-fucosidase 2-like isoform X2 [Elaeis guineensis]
Length=810

 Score = 73.9 bits (180),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 41/70 (59%), Positives = 52/70 (74%), Gaps = 1/70 (1%)
 Frame = +3

Query  366  EDFDWILVKELTDADM-WspssgsttessKPLEIRFNEPAKLWTDALPIGNXRLGAMVWG  542
            E  +W+ V+   +AD  W  S G  TE ++PL+++F+EPAK +TDA PIGN RLGAMVWG
Sbjct  3    EGEEWVWVQPPMEADAEWWASGGGETEDARPLKVQFSEPAKHFTDAAPIGNGRLGAMVWG  62

Query  543  GVASETLNLN  572
            GVASETL LN
Sbjct  63   GVASETLQLN  72



>ref|XP_010936539.1| PREDICTED: alpha-L-fucosidase 2-like isoform X1 [Elaeis guineensis]
Length=863

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 40/71 (56%), Positives = 53/71 (75%), Gaps = 3/71 (4%)
 Frame = +3

Query  366  EDFDWILVKELTDADM--WspssgsttessKPLEIRFNEPAKLWTDALPIGNXRLGAMVW  539
            E  +W+ V+   +AD+  W+   G T ++ +PL+++F+EPAK WTDA PIGN RLGAMVW
Sbjct  3    EGEEWVWVRPPMEADVECWAGGGGETDDA-RPLKVQFSEPAKHWTDATPIGNGRLGAMVW  61

Query  540  GGVASETLNLN  572
            GGVASETL LN
Sbjct  62   GGVASETLQLN  72



>ref|XP_006422893.1| hypothetical protein CICLE_v10027816mg [Citrus clementina]
 gb|ESR36133.1| hypothetical protein CICLE_v10027816mg [Citrus clementina]
Length=713

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 41/69 (59%), Positives = 50/69 (72%), Gaps = 3/69 (4%)
 Frame = +3

Query  375  DWILVKELTDADMWspssgstt---essKPLEIRFNEPAKLWTDALPIGNXRLGAMVWGG  545
            +W+LV+  T+ D W+PS        ESS+PL++ F  PAK WTDA+PIGN RLGAMVWGG
Sbjct  8    EWVLVRRSTEKDWWNPSGTVGDGGGESSEPLKVTFGGPAKHWTDAIPIGNGRLGAMVWGG  67

Query  546  VASETLNLN  572
            VASE L LN
Sbjct  68   VASEILQLN  76



>ref|XP_010105050.1| Alpha-L-fucosidase 2 [Morus notabilis]
 gb|EXC03763.1| Alpha-L-fucosidase 2 [Morus notabilis]
Length=831

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 38/70 (54%), Positives = 48/70 (69%), Gaps = 7/70 (10%)
 Frame = +3

Query  363  MEDFDWILVKELTDADMWspssgsttessKPLEIRFNEPAKLWTDALPIGNXRLGAMVWG  542
            M D  W+LV++  + +M          SS+PL++ F EPAK WTDALPIGN RLGAMVWG
Sbjct  1    MGDKGWVLVQDPEEKNM-------DDRSSRPLKVTFKEPAKHWTDALPIGNGRLGAMVWG  53

Query  543  GVASETLNLN  572
            GV+SE + LN
Sbjct  54   GVSSEIIQLN  63



>gb|EYU37618.1| hypothetical protein MIMGU_mgv1a001249mg [Erythranthe guttata]
Length=853

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 37/60 (62%), Positives = 46/60 (77%), Gaps = 1/60 (2%)
 Frame = +3

Query  396  LTDADMWspssgsttess-KPLEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            + D+D+WS S    T +    LE+RFN PAK WTDALPIGN RLGAM+WGGVA++T+NLN
Sbjct  30   VKDSDVWSSSLEEDTSTRFNNLEVRFNAPAKHWTDALPIGNGRLGAMIWGGVANDTINLN  89



>ref|XP_010028398.1| PREDICTED: alpha-L-fucosidase 2-like [Eucalyptus grandis]
 gb|KCW55142.1| hypothetical protein EUGRSUZ_I01093 [Eucalyptus grandis]
Length=841

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 41/74 (55%), Positives = 48/74 (65%), Gaps = 3/74 (4%)
 Frame = +3

Query  360  SMEDFDWILVKELTDADMWspssgsttessK---PLEIRFNEPAKLWTDALPIGNXRLGA  530
            +MED  W+LV +  + D WSPS       ++   PL+I   EPAK WTDA PIGN RLGA
Sbjct  2    AMEDEGWVLVSKPREKDHWSPSGLPMGSDAEDPGPLKITSGEPAKHWTDAFPIGNGRLGA  61

Query  531  MVWGGVASETLNLN  572
            MVWG V SETL LN
Sbjct  62   MVWGSVLSETLQLN  75



>ref|XP_010936547.1| PREDICTED: alpha-L-fucosidase 2-like isoform X1 [Elaeis guineensis]
Length=863

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 52/70 (74%), Gaps = 1/70 (1%)
 Frame = +3

Query  366  EDFDWILVKELTDADM-WspssgsttessKPLEIRFNEPAKLWTDALPIGNXRLGAMVWG  542
            E  +W+ V+   +AD  W  S G  TE ++PL+++F+EPAK +TDA PIGN RLGAMVWG
Sbjct  3    EGEEWVWVQPPMEADAEWWASGGGETEDARPLKVQFSEPAKHFTDAAPIGNGRLGAMVWG  62

Query  543  GVASETLNLN  572
            GVASETL LN
Sbjct  63   GVASETLQLN  72



>ref|XP_003610049.1| Macrophage migration inhibitory factor-like protein [Medicago 
truncatula]
Length=855

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 37/72 (51%), Positives = 49/72 (68%), Gaps = 2/72 (3%)
 Frame = +3

Query  363  MEDFDWILVKELTDADMW--spssgsttessKPLEIRFNEPAKLWTDALPIGNXRLGAMV  536
            MED +WI+V+     D+W  S ++    E S PL++ F+  AK WTDA+PIGN RLGAM+
Sbjct  1    MEDGEWIMVQCPPQKDLWNPSLANADDDEPSMPLKVTFSRSAKYWTDAIPIGNGRLGAMI  60

Query  537  WGGVASETLNLN  572
            WGG+ SE L LN
Sbjct  61   WGGIQSEVLQLN  72



>gb|AES92246.2| alpha-L-fucosidase [Medicago truncatula]
Length=853

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 37/72 (51%), Positives = 49/72 (68%), Gaps = 2/72 (3%)
 Frame = +3

Query  363  MEDFDWILVKELTDADMW--spssgsttessKPLEIRFNEPAKLWTDALPIGNXRLGAMV  536
            MED +WI+V+     D+W  S ++    E S PL++ F+  AK WTDA+PIGN RLGAM+
Sbjct  1    MEDGEWIMVQCPPQKDLWNPSLANADDDEPSMPLKVTFSRSAKYWTDAIPIGNGRLGAMI  60

Query  537  WGGVASETLNLN  572
            WGG+ SE L LN
Sbjct  61   WGGIQSEVLQLN  72



>ref|XP_002527476.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF34874.1| conserved hypothetical protein [Ricinus communis]
Length=849

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 50/72 (69%), Gaps = 3/72 (4%)
 Frame = +3

Query  366  EDFDWILVKELTDADMWspssgstte---ssKPLEIRFNEPAKLWTDALPIGNXRLGAMV  536
            ED +W++V+   + D W PSS          +PL+I F+ PAK WTDA+PIGN RLGAMV
Sbjct  4    EDGEWVVVRRPAEKDWWRPSSLIENNDDDEDRPLKIVFSGPAKHWTDAIPIGNGRLGAMV  63

Query  537  WGGVASETLNLN  572
            +GGVASETL +N
Sbjct  64   FGGVASETLRIN  75



>dbj|BAF85832.1| alpha-1,2-fucosidase [Lilium longiflorum]
Length=854

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 36/66 (55%), Positives = 48/66 (73%), Gaps = 3/66 (5%)
 Frame = +3

Query  375  DWILVKELTDADMWspssgsttessKPLEIRFNEPAKLWTDALPIGNXRLGAMVWGGVAS  554
            +W+ V+  T+A+       +  E+++PL++RF EPAK WTDA PIGN RLGAMVWGGV +
Sbjct  9    EWVWVRRPTEAE---AMGWAGEEAAQPLKLRFLEPAKHWTDAAPIGNGRLGAMVWGGVPT  65

Query  555  ETLNLN  572
            ETL LN
Sbjct  66   ETLQLN  71



>ref|XP_006589631.1| PREDICTED: alpha-L-fucosidase 2-like [Glycine max]
Length=207

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/91 (40%), Positives = 54/91 (59%), Gaps = 4/91 (4%)
 Frame = +3

Query  312  SEVFFRFTSVEEFLCN-SMEDFDWILVKELTDADMWspssgstt---essKPLEIRFNEP  479
            ++ FF  +S   +  + +++D + ++V+     + W PS  +        +PL++ F EP
Sbjct  18   TDFFFTLSSHAHYRLSWAVQDCERVMVRHTPQKNWWKPSLTNAEDDDPPPRPLKVTFAEP  77

Query  480  AKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            A  WTDA+PIGN RLGAMVWG V SE L LN
Sbjct  78   ATHWTDAIPIGNGRLGAMVWGAVPSEALQLN  108



>ref|XP_008456176.1| PREDICTED: alpha-L-fucosidase 2 [Cucumis melo]
Length=845

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 34/59 (58%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = +3

Query  396  LTDADMWspssgsttessKPLEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            + + D W  S    ++SS PL++ FN PAK WTDA+PIGN RLGAMVWGGV +E L LN
Sbjct  30   MAEKDFWRSSLVGMSDSSDPLKLTFNAPAKHWTDAIPIGNGRLGAMVWGGVDTEILQLN  88



>gb|KGN57492.1| hypothetical protein Csa_3G199050 [Cucumis sativus]
Length=845

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 33/59 (56%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = +3

Query  396  LTDADMWspssgsttessKPLEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            + + D W  +     +SS PL++ FN PAK WTDA+PIGN RLGAMVWGGV +E L LN
Sbjct  30   IAEKDFWRSTLVGMADSSDPLKLTFNAPAKHWTDAIPIGNGRLGAMVWGGVDTEILQLN  88



>ref|XP_010547973.1| PREDICTED: alpha-L-fucosidase 2 [Tarenaya hassleriana]
Length=846

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 32/64 (50%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = +3

Query  381  ILVKELTDADMWspssgsttessKPLEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASET  560
            I V+ +++ D W+P+     + S PL++ F  PA+ WTD++PIGN RLGA +WGGV+SET
Sbjct  32   IPVRRMSEKDRWTPTLMDGQDRSMPLKVTFGGPARNWTDSIPIGNGRLGATIWGGVSSET  91

Query  561  LNLN  572
            LN+N
Sbjct  92   LNIN  95



>ref|XP_010936550.1| PREDICTED: alpha-L-fucosidase 2-like [Elaeis guineensis]
Length=862

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 31/41 (76%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +3

Query  450  KPLEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            +PL+++F+EPAK +TDA PIGN RLGAMVWGGVASETL LN
Sbjct  31   RPLKVQFSEPAKHFTDAAPIGNGRLGAMVWGGVASETLQLN  71



>gb|KDP44440.1| hypothetical protein JCGZ_16273 [Jatropha curcas]
Length=835

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 34/70 (49%), Positives = 49/70 (70%), Gaps = 1/70 (1%)
 Frame = +3

Query  363  MEDFDWILVKELTDADMWspssgsttessKPLEIRFNEPAKLWTDALPIGNXRLGAMVWG  542
            M+D  W +V+  +   M    + + +  SKPL++ F+ PAK WTDA+P+GN RLGAMVWG
Sbjct  1    MDDEGWDIVQRYSPKTM-RVPTWTHSTVSKPLKVTFDGPAKFWTDAIPLGNGRLGAMVWG  59

Query  543  GVASETLNLN  572
            GV+S+T+ LN
Sbjct  60   GVSSDTIQLN  69



>ref|XP_006829279.1| hypothetical protein AMTR_s00001p00272880 [Amborella trichopoda]
 gb|ERM96695.1| hypothetical protein AMTR_s00001p00272880 [Amborella trichopoda]
Length=869

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 31/41 (76%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +3

Query  450  KPLEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            +PL+++F  PAK WTDALPIGN RLGAMVWGGV SETL LN
Sbjct  44   EPLKVQFLGPAKYWTDALPIGNGRLGAMVWGGVESETLQLN  84



>gb|KHN42345.1| Alpha-L-fucosidase 2 [Glycine soja]
Length=871

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 33/70 (47%), Positives = 45/70 (64%), Gaps = 0/70 (0%)
 Frame = +3

Query  363  MEDFDWILVKELTDADMWspssgsttessKPLEIRFNEPAKLWTDALPIGNXRLGAMVWG  542
            ++D + ++V+     + W PS  +     +PL++ F EPA  WTDA+PIGN RLGAMVWG
Sbjct  33   VQDGERVMVRNTPQKNWWKPSLTNGELPPRPLKVTFAEPATHWTDAIPIGNGRLGAMVWG  92

Query  543  GVASETLNLN  572
             V SE L LN
Sbjct  93   AVPSEALQLN  102



>gb|KDO47957.1| hypothetical protein CISIN_1g003571mg [Citrus sinensis]
Length=497

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +3

Query  453  PLEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            PL+I FN PAK +TDA+PIGN RLGAMVWGGV SETL LN
Sbjct  12   PLKITFNGPAKHFTDAIPIGNGRLGAMVWGGVPSETLKLN  51



>ref|XP_006849299.1| hypothetical protein AMTR_s00167p00034910 [Amborella trichopoda]
 gb|ERN10880.1| hypothetical protein AMTR_s00167p00034910 [Amborella trichopoda]
Length=869

 Score = 67.8 bits (164),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +3

Query  450  KPLEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            +PL+++F  PAK WTDA+PIGN RLGAMVWGGV SETL LN
Sbjct  44   EPLKVQFPGPAKHWTDAMPIGNGRLGAMVWGGVQSETLQLN  84



>gb|KDO47956.1| hypothetical protein CISIN_1g003571mg [Citrus sinensis]
Length=613

 Score = 67.8 bits (164),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +3

Query  453  PLEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            PL+I FN PAK +TDA+PIGN RLGAMVWGGV SETL LN
Sbjct  12   PLKITFNGPAKHFTDAIPIGNGRLGAMVWGGVPSETLKLN  51



>ref|XP_006605983.1| PREDICTED: alpha-L-fucosidase 2-like isoform X2 [Glycine max]
Length=795

 Score = 67.8 bits (164),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 33/70 (47%), Positives = 44/70 (63%), Gaps = 0/70 (0%)
 Frame = +3

Query  363  MEDFDWILVKELTDADMWspssgsttessKPLEIRFNEPAKLWTDALPIGNXRLGAMVWG  542
            ++D   ++V+     + W PS  +     +PL++ F EPA  WTDA+PIGN RLGAMVWG
Sbjct  33   VQDGKRVMVRNTPQKNWWKPSLTNGESPPRPLKVTFAEPATHWTDAIPIGNGRLGAMVWG  92

Query  543  GVASETLNLN  572
             V SE L LN
Sbjct  93   AVPSEALQLN  102



>ref|XP_003555969.1| PREDICTED: alpha-L-fucosidase 2-like isoform X1 [Glycine max]
Length=874

 Score = 67.8 bits (164),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 33/70 (47%), Positives = 44/70 (63%), Gaps = 0/70 (0%)
 Frame = +3

Query  363  MEDFDWILVKELTDADMWspssgsttessKPLEIRFNEPAKLWTDALPIGNXRLGAMVWG  542
            ++D   ++V+     + W PS  +     +PL++ F EPA  WTDA+PIGN RLGAMVWG
Sbjct  33   VQDGKRVMVRNTPQKNWWKPSLTNGESPPRPLKVTFAEPATHWTDAIPIGNGRLGAMVWG  92

Query  543  GVASETLNLN  572
             V SE L LN
Sbjct  93   AVPSEALQLN  102



>ref|XP_006605984.1| PREDICTED: alpha-L-fucosidase 2-like isoform X3 [Glycine max]
Length=786

 Score = 67.4 bits (163),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 33/70 (47%), Positives = 44/70 (63%), Gaps = 0/70 (0%)
 Frame = +3

Query  363  MEDFDWILVKELTDADMWspssgsttessKPLEIRFNEPAKLWTDALPIGNXRLGAMVWG  542
            ++D   ++V+     + W PS  +     +PL++ F EPA  WTDA+PIGN RLGAMVWG
Sbjct  33   VQDGKRVMVRNTPQKNWWKPSLTNGESPPRPLKVTFAEPATHWTDAIPIGNGRLGAMVWG  92

Query  543  GVASETLNLN  572
             V SE L LN
Sbjct  93   AVPSEALQLN  102



>ref|XP_002527475.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF34873.1| conserved hypothetical protein [Ricinus communis]
Length=840

 Score = 67.4 bits (163),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 46/70 (66%), Gaps = 7/70 (10%)
 Frame = +3

Query  363  MEDFDWILVKELTDADMWspssgsttessKPLEIRFNEPAKLWTDALPIGNXRLGAMVWG  542
            MED DW+LV+  T  D       S    +KPL++ FN PAK WTD++PIGN R+GAM+ G
Sbjct  1    MEDEDWVLVERPTFID-------SECSYNKPLKVTFNGPAKHWTDSIPIGNGRIGAMISG  53

Query  543  GVASETLNLN  572
            G+ SE + LN
Sbjct  54   GMQSEIIQLN  63



>ref|XP_006605979.1| PREDICTED: alpha-L-fucosidase 2-like isoform X2 [Glycine max]
Length=854

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 35/77 (45%), Positives = 46/77 (60%), Gaps = 0/77 (0%)
 Frame = +3

Query  342  EEFLCNSMEDFDWILVKELTDADMWspssgsttessKPLEIRFNEPAKLWTDALPIGNXR  521
            E F    ++D + ++V+       W PS  +     +PL++ F EPA  WTDA+PIGN R
Sbjct  6    EGFEIKCVKDGERVMVRNTPQKYWWKPSLTNDEPPPRPLKVTFAEPATHWTDAIPIGNGR  65

Query  522  LGAMVWGGVASETLNLN  572
            LGAMVWG V SE L LN
Sbjct  66   LGAMVWGAVPSEALQLN  82



>ref|XP_004496923.1| PREDICTED: alpha-L-fucosidase 2-like [Cicer arietinum]
Length=833

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 39/73 (53%), Positives = 51/73 (70%), Gaps = 3/73 (4%)
 Frame = +3

Query  363  MEDF-DWILVKELTDADMW--spssgsttessKPLEIRFNEPAKLWTDALPIGNXRLGAM  533
            MED  DW+LV+  +  D W  S S+    E+S+PL++ F++PA  +TDA+PIGN  LGAM
Sbjct  1    MEDGGDWVLVRRPSQKDFWNPSLSNADDDEASRPLKVTFSKPAVHFTDAIPIGNGSLGAM  60

Query  534  VWGGVASETLNLN  572
            VWGGV SE L LN
Sbjct  61   VWGGVQSEVLQLN  73



>ref|XP_004140811.1| PREDICTED: alpha-L-fucosidase 2-like [Cucumis sativus]
Length=803

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 29/40 (73%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +3

Query  453  PLEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            PL++ FN PAK WTDA+PIGN RLGAMVWGGV +E L LN
Sbjct  7    PLKLTFNAPAKHWTDAIPIGNGRLGAMVWGGVDTEILQLN  46



>ref|XP_003555281.1| PREDICTED: alpha-L-fucosidase 2-like isoform X1 [Glycine max]
Length=876

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 33/71 (46%), Positives = 45/71 (63%), Gaps = 0/71 (0%)
 Frame = +3

Query  360  SMEDFDWILVKELTDADMWspssgsttessKPLEIRFNEPAKLWTDALPIGNXRLGAMVW  539
            +++D + ++V+       W PS  +     +PL++ F EPA  WTDA+PIGN RLGAMVW
Sbjct  34   AVKDGERVMVRNTPQKYWWKPSLTNDEPPPRPLKVTFAEPATHWTDAIPIGNGRLGAMVW  93

Query  540  GGVASETLNLN  572
            G V SE L LN
Sbjct  94   GAVPSEALQLN  104



>gb|KDO47950.1| hypothetical protein CISIN_1g003571mg [Citrus sinensis]
Length=810

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 31/40 (78%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +3

Query  453  PLEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            PL+I FN PAK +TDA+PIGN RLGAMVWGGV SETL LN
Sbjct  12   PLKITFNGPAKHFTDAIPIGNGRLGAMVWGGVPSETLKLN  51



>ref|XP_006486970.1| PREDICTED: alpha-L-fucosidase 2-like isoform X1 [Citrus sinensis]
Length=810

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 31/40 (78%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +3

Query  453  PLEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            PL+I FN PAK +TDA+PIGN RLGAMVWGGV SETL LN
Sbjct  12   PLKITFNGPAKHFTDAIPIGNGRLGAMVWGGVPSETLKLN  51



>ref|XP_006422890.1| hypothetical protein CICLE_v10027838mg [Citrus clementina]
 gb|ESR36130.1| hypothetical protein CICLE_v10027838mg [Citrus clementina]
Length=810

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 31/40 (78%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +3

Query  453  PLEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            PL+I FN PAK +TDA+PIGN RLGAMVWGGV SETL LN
Sbjct  12   PLKITFNGPAKHFTDAIPIGNGRLGAMVWGGVPSETLKLN  51



>ref|XP_006605981.1| PREDICTED: alpha-L-fucosidase 2-like isoform X4 [Glycine max]
Length=700

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 33/71 (46%), Positives = 45/71 (63%), Gaps = 0/71 (0%)
 Frame = +3

Query  360  SMEDFDWILVKELTDADMWspssgsttessKPLEIRFNEPAKLWTDALPIGNXRLGAMVW  539
            +++D + ++V+       W PS  +     +PL++ F EPA  WTDA+PIGN RLGAMVW
Sbjct  34   AVKDGERVMVRNTPQKYWWKPSLTNDEPPPRPLKVTFAEPATHWTDAIPIGNGRLGAMVW  93

Query  540  GGVASETLNLN  572
            G V SE L LN
Sbjct  94   GAVPSEALQLN  104



>ref|XP_006605982.1| PREDICTED: alpha-L-fucosidase 2-like isoform X5 [Glycine max]
Length=699

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 33/71 (46%), Positives = 45/71 (63%), Gaps = 0/71 (0%)
 Frame = +3

Query  360  SMEDFDWILVKELTDADMWspssgsttessKPLEIRFNEPAKLWTDALPIGNXRLGAMVW  539
            +++D + ++V+       W PS  +     +PL++ F EPA  WTDA+PIGN RLGAMVW
Sbjct  34   AVKDGERVMVRNTPQKYWWKPSLTNDEPPPRPLKVTFAEPATHWTDAIPIGNGRLGAMVW  93

Query  540  GGVASETLNLN  572
            G V SE L LN
Sbjct  94   GAVPSEALQLN  104



>gb|KFK30063.1| hypothetical protein AALP_AA7G211900 [Arabis alpina]
Length=834

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +3

Query  450  KPLEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            KPL++ F  P++ WTDA+PIGN RLGA +WGGV+SETLN+N
Sbjct  41   KPLKLTFGGPSRNWTDAIPIGNGRLGATIWGGVSSETLNIN  81



>ref|XP_003573887.1| PREDICTED: alpha-L-fucosidase 2-like [Brachypodium distachyon]
Length=857

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 37/66 (56%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = +3

Query  375  DWILVKELTDADMWspssgsttessKPLEIRFNEPAKLWTDALPIGNXRLGAMVWGGVAS  554
            +WI V+ L +A+  + ++G   E S+PL++ F  PAK +TDA PIGN RLGAMVWGGVAS
Sbjct  14   EWIWVRRLQEAEAAAVAAGWQAEESRPLKVVFASPAKYFTDAAPIGNGRLGAMVWGGVAS  73

Query  555  ETLNLN  572
            E L LN
Sbjct  74   ERLQLN  79



>gb|KEH44061.1| hypothetical protein MTR_1g107145 [Medicago truncatula]
Length=132

 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +3

Query  450  KPLEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            +PL++ F+EPA+ W DA+PIGN RLGAM+WG V SE L LN
Sbjct  66   RPLKVTFSEPAEYWVDAIPIGNGRLGAMIWGCVPSEKLQLN  106



>ref|XP_007143071.1| hypothetical protein PHAVU_007G041400g [Phaseolus vulgaris]
 gb|ESW15065.1| hypothetical protein PHAVU_007G041400g [Phaseolus vulgaris]
Length=866

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 36/77 (47%), Positives = 48/77 (62%), Gaps = 3/77 (4%)
 Frame = +3

Query  351  LCNSMEDFDWILVKELTDADMWspssgst---tessKPLEIRFNEPAKLWTDALPIGNXR  521
            LC +M++ + + V+    +  W PSS +        +PL++ F  PA  WTDA+PIGN R
Sbjct  22   LCWAMQEGEGVTVRNTPQSSWWKPSSSNAGDDESPPRPLKVTFAGPATHWTDAIPIGNGR  81

Query  522  LGAMVWGGVASETLNLN  572
            LGAMVWGGV SE L LN
Sbjct  82   LGAMVWGGVPSELLQLN  98



>ref|XP_009421188.1| PREDICTED: alpha-L-fucosidase 2-like [Musa acuminata subsp. malaccensis]
Length=851

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +3

Query  450  KPLEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            +PL++ F  PA  WTDA P+GN RLGAMVWGGVASET+ LN
Sbjct  37   RPLKVVFTSPAAHWTDAAPLGNGRLGAMVWGGVASETIQLN  77



>ref|XP_002869161.1| hypothetical protein ARALYDRAFT_912968 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45420.1| hypothetical protein ARALYDRAFT_912968 [Arabidopsis lyrata subsp. 
lyrata]
Length=844

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +3

Query  450  KPLEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            +PL++ F  P++ WTDA+PIGN RLGA +WGGV+SETLN+N
Sbjct  49   RPLKLTFGGPSRNWTDAIPIGNGRLGATIWGGVSSETLNIN  89



>ref|XP_009421189.1| PREDICTED: alpha-L-fucosidase 2-like [Musa acuminata subsp. malaccensis]
Length=850

 Score = 64.7 bits (156),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +3

Query  450  KPLEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            +PL++ F  PA  WTDA P+GN RLGAMVWGGVASET+ LN
Sbjct  36   RPLKVVFTSPAAHWTDAAPLGNGRLGAMVWGGVASETIQLN  76



>emb|CDX69041.1| BnaC01g04120D [Brassica napus]
Length=833

 Score = 64.7 bits (156),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +3

Query  450  KPLEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            +PL++ F  P++ WTDA+PIGN RLGA +WGGV+SETLN+N
Sbjct  45   RPLKLTFAGPSRNWTDAIPIGNGRLGATIWGGVSSETLNIN  85



>gb|AID60138.1| altered xyloglucan 8 [Brassica napus]
 emb|CDX75416.1| BnaA01g02860D [Brassica napus]
Length=836

 Score = 64.7 bits (156),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +3

Query  450  KPLEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            +PL++ F  P++ WTDA+PIGN RLGA +WGGV+SETLN+N
Sbjct  48   RPLKLTFAGPSRNWTDAIPIGNGRLGATIWGGVSSETLNIN  88



>ref|XP_009114732.1| PREDICTED: alpha-L-fucosidase 2 [Brassica rapa]
Length=836

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +3

Query  450  KPLEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            +PL++ F  P++ WTDA+PIGN RLGA +WGGV+SETLN+N
Sbjct  48   RPLKLTFAGPSRNWTDAIPIGNGRLGATIWGGVSSETLNIN  88



>ref|XP_006412250.1| hypothetical protein EUTSA_v10024398mg [Eutrema salsugineum]
 gb|ESQ53703.1| hypothetical protein EUTSA_v10024398mg [Eutrema salsugineum]
Length=838

 Score = 64.3 bits (155),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +3

Query  450  KPLEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            +PL++ F  P++ WTDA+PIGN R GA +WGGV+SETLNLN
Sbjct  45   RPLKLTFGGPSRNWTDAIPIGNGRFGATIWGGVSSETLNLN  85



>gb|KHN42346.1| Alpha-L-fucosidase 2 [Glycine soja]
Length=835

 Score = 64.3 bits (155),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +3

Query  450  KPLEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            +PL++ F EPA  WTDA+PIGN RLGAMVWG V SE L LN
Sbjct  23   RPLKVTFAEPATHWTDAIPIGNGRLGAMVWGAVPSEALQLN  63



>ref|XP_006605980.1| PREDICTED: alpha-L-fucosidase 2-like isoform X3 [Glycine max]
Length=835

 Score = 64.3 bits (155),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +3

Query  450  KPLEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            +PL++ F EPA  WTDA+PIGN RLGAMVWG V SE L LN
Sbjct  23   RPLKVTFAEPATHWTDAIPIGNGRLGAMVWGAVPSEALQLN  63



>ref|XP_003536603.1| PREDICTED: alpha-L-fucosidase 2-like [Glycine max]
 gb|KHN06776.1| Alpha-L-fucosidase 2 [Glycine soja]
Length=877

 Score = 64.3 bits (155),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +3

Query  450  KPLEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            +PL++ F EPA  WTDA+PIGN RLGAMVWG V SE L LN
Sbjct  65   RPLKVTFAEPATHWTDAIPIGNGRLGAMVWGAVPSEALQLN  105



>ref|XP_010432442.1| PREDICTED: alpha-L-fucosidase 2 [Camelina sativa]
Length=831

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/40 (65%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +3

Query  453  PLEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            PL++ F  P++ WTDA+PIGN RLGA +WGGV+SETLN+N
Sbjct  39   PLKLTFAGPSRNWTDAIPIGNGRLGATIWGGVSSETLNIN  78



>ref|XP_010437645.1| PREDICTED: alpha-L-fucosidase 2-like [Camelina sativa]
Length=832

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/40 (65%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +3

Query  453  PLEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            PL++ F  P++ WTDA+PIGN RLGA +WGGV+SETLN+N
Sbjct  40   PLKLTFAGPSRNWTDAIPIGNGRLGATIWGGVSSETLNIN  79



>ref|XP_010447114.1| PREDICTED: alpha-L-fucosidase 2-like [Camelina sativa]
Length=833

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/40 (65%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +3

Query  453  PLEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            PL++ F  P++ WTDA+PIGN RLGA +WGGV+SETLN+N
Sbjct  41   PLKLTFAGPSRNWTDAIPIGNGRLGATIWGGVSSETLNIN  80



>dbj|BAK00707.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=81

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +3

Query  450  KPLEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            +PL++ F  PA+ +TDA PIGN RLGA+VWGGV SE L LN
Sbjct  39   RPLKVVFASPARYFTDAAPIGNGRLGALVWGGVTSEKLQLN  79



>emb|CAB36703.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB80143.1| hypothetical protein [Arabidopsis thaliana]
Length=847

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +3

Query  450  KPLEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            +PL++ F  P++ WTDA+PIGN RLGA +WGGV+SE LN+N
Sbjct  50   RPLKLTFGGPSRNWTDAIPIGNGRLGATIWGGVSSEILNIN  90



>gb|KCW55141.1| hypothetical protein EUGRSUZ_I01092 [Eucalyptus grandis]
Length=716

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +3

Query  450  KPLEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            +PL++ F  PAK +TDA PIGN RLGAMVWGGVASE L LN
Sbjct  99   EPLKVTFGGPAKYFTDAAPIGNGRLGAMVWGGVASELLQLN  139



>gb|KCW55139.1| hypothetical protein EUGRSUZ_I01092 [Eucalyptus grandis]
Length=893

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +3

Query  450  KPLEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            +PL++ F  PAK +TDA PIGN RLGAMVWGGVASE L LN
Sbjct  99   EPLKVTFGGPAKYFTDAAPIGNGRLGAMVWGGVASELLQLN  139



>ref|XP_010028395.1| PREDICTED: alpha-L-fucosidase 2-like isoform X1 [Eucalyptus grandis]
 gb|KCW55140.1| hypothetical protein EUGRSUZ_I01092 [Eucalyptus grandis]
Length=907

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +3

Query  450  KPLEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            +PL++ F  PAK +TDA PIGN RLGAMVWGGVASE L LN
Sbjct  99   EPLKVTFGGPAKYFTDAAPIGNGRLGAMVWGGVASELLQLN  139



>ref|NP_195152.2| alpha-L-fucosidase 2 [Arabidopsis thaliana]
 sp|Q8L7W8.1|FUCO2_ARATH RecName: Full=Alpha-L-fucosidase 2; AltName: Full=Alpha-1,2-fucosidase 
2; AltName: Full=Alpha-L-fucosidase 95A; Short=AtFuc95A; 
AltName: Full=Alpha-L-fucoside fucohydrolase 2; AltName: 
Full=Protein ALTERED XYLOGLUCAN 8; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAM78086.1| AT4g34260/F10M10_30 [Arabidopsis thaliana]
 gb|AAO11638.1| At4g34260/F10M10_30 [Arabidopsis thaliana]
 gb|AEE86349.1| alpha-L-fucosidase 2 [Arabidopsis thaliana]
Length=843

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +3

Query  450  KPLEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            +PL++ F  P++ WTDA+PIGN RLGA +WGGV+SE LN+N
Sbjct  50   RPLKLTFGGPSRNWTDAIPIGNGRLGATIWGGVSSEILNIN  90



>ref|XP_006283241.1| hypothetical protein CARUB_v10004274mg [Capsella rubella]
 gb|EOA16139.1| hypothetical protein CARUB_v10004274mg [Capsella rubella]
Length=691

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +3

Query  450  KPLEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            + L++ F  P++ WTDA+PIGN RLGA +WGGV+SETLN+N
Sbjct  47   RSLKLTFGGPSRNWTDAIPIGNGRLGATIWGGVSSETLNIN  87



>ref|XP_010691648.1| PREDICTED: LOW QUALITY PROTEIN: alpha-L-fucosidase 2-like [Beta 
vulgaris subsp. vulgaris]
Length=837

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 34/72 (47%), Positives = 45/72 (63%), Gaps = 3/72 (4%)
 Frame = +3

Query  366  EDFDWILVKELTDADMWspssg---sttessKPLEIRFNEPAKLWTDALPIGNXRLGAMV  536
            E  DW+ +K   +  +W PS+       E  +PL+I F E A+ WTDALPIGN R G M+
Sbjct  32   EHDDWLKIKNPKEKQLWKPSTSFVIEDNEERRPLKIIFKEAARNWTDALPIGNGRFGGMI  91

Query  537  WGGVASETLNLN  572
             GGV+SE +NLN
Sbjct  92   HGGVSSEIINLN  103



>ref|XP_010691649.1| PREDICTED: alpha-L-fucosidase 2-like [Beta vulgaris subsp. vulgaris]
Length=865

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 32/64 (50%), Positives = 43/64 (67%), Gaps = 2/64 (3%)
 Frame = +3

Query  387  VKELTDADMWsps--sgsttessKPLEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASET  560
            V+ + D ++W  S       E ++PL+I F E A+ WTDALPIGN RLGAM+ GG+ SE 
Sbjct  55   VESIKDRELWKHSRRLMMENEENRPLKIMFKEAARNWTDALPIGNGRLGAMIHGGIISEI  114

Query  561  LNLN  572
            +NLN
Sbjct  115  INLN  118



>gb|KCW55138.1| hypothetical protein EUGRSUZ_I01091 [Eucalyptus grandis]
Length=817

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +3

Query  450  KPLEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            +PL++ F+ PAK +TDA PIGN  LGAMVWGGVASE L LN
Sbjct  8    EPLKVTFSGPAKYFTDAAPIGNGSLGAMVWGGVASELLQLN  48



>ref|XP_002313155.2| hypothetical protein POPTR_0009s09680g [Populus trichocarpa]
 gb|EEE87110.2| hypothetical protein POPTR_0009s09680g [Populus trichocarpa]
Length=107

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 44/64 (69%), Gaps = 2/64 (3%)
 Frame = +3

Query  366  EDFDWILVKELTDADMWspssgs--ttessKPLEIRFNEPAKLWTDALPIGNXRLGAMVW  539
            +D  W+L++  T  D W+PS     + E  +PL++ F+ PAK WTDA+PI N RLGAM+W
Sbjct  3    DDEGWVLLQLGTKKDWWNPSLMEDNSGEGPRPLKVTFSGPAKHWTDAIPIANGRLGAMIW  62

Query  540  GGVA  551
            GGVA
Sbjct  63   GGVA  66



>tpg|DAA46849.1| TPA: hypothetical protein ZEAMMB73_390456 [Zea mays]
Length=457

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +3

Query  450  KPLEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            +PL++ F  PAK +TDA PIGN RLGAMVWG V SE L LN
Sbjct  40   RPLKVVFGSPAKYFTDAAPIGNGRLGAMVWGCVESERLQLN  80



>ref|WP_030106659.1| hypothetical protein, partial [Actinoalloteichus cyanogriseus]
Length=258

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +3

Query  459  EIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            E+R++ PA+ WT+ALP+GN RLGAMV+GG A+E L +N
Sbjct  14   ELRYDAPARRWTEALPVGNGRLGAMVFGGTATERLQIN  51



>ref|XP_004983274.1| PREDICTED: alpha-L-fucosidase 2-like [Setaria italica]
Length=861

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +3

Query  450  KPLEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            +PL++ F  PA+ +TDA PIGN RLGAMVWGGV SE L LN
Sbjct  43   RPLKVVFASPARYFTDAAPIGNGRLGAMVWGGVESERLQLN  83



>ref|XP_004983276.1| PREDICTED: alpha-L-fucosidase 2-like isoform X2 [Setaria italica]
Length=747

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +3

Query  450  KPLEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            +PL++ F  PA+ +TDA PIGN  LGAMVWGGVASE L LN
Sbjct  8    RPLKVVFASPAEYFTDAAPIGNGSLGAMVWGGVASEKLQLN  48



>tpg|DAA46848.1| TPA: hypothetical protein ZEAMMB73_390456 [Zea mays]
Length=567

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +3

Query  450  KPLEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            +PL++ F  PAK +TDA PIGN RLGAMVWG V SE L LN
Sbjct  40   RPLKVVFGSPAKYFTDAAPIGNGRLGAMVWGCVESERLQLN  80



>gb|EMS55421.1| Alpha-L-fucosidase 2 [Triticum urartu]
Length=860

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +3

Query  450  KPLEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            +PL++ F  PA+ +TDA PIGN RLGA+VWGGV SE L LN
Sbjct  36   RPLKVVFGSPARYFTDAAPIGNGRLGALVWGGVTSEKLQLN  76



>gb|KFA02918.1| hypothetical protein A11K_0106740, partial [Xanthomonas vasicola 
pv. vasculorum NCPPB 890]
Length=86

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +3

Query  456  LEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            L++ + EPA  W +ALP+GN RLGAMVWGG+A E L LN
Sbjct  25   LQLWYREPANEWVEALPVGNGRLGAMVWGGIAHERLQLN  63



>dbj|BAJ95753.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=857

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +3

Query  450  KPLEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            +PL++ F  PA+ +TDA PIGN RLGA+VWGGV SE L LN
Sbjct  39   RPLKVVFASPARYFTDAAPIGNGRLGALVWGGVTSEKLQLN  79



>ref|XP_006661702.1| PREDICTED: alpha-L-fucosidase 2-like [Oryza brachyantha]
Length=815

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +3

Query  450  KPLEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            +PL++ F+ PA+ +TDA PIGN  LGAMVWGGVASE L LN
Sbjct  20   RPLKVAFDSPAEHFTDAAPIGNGSLGAMVWGGVASEKLQLN  60



>ref|XP_004983275.1| PREDICTED: alpha-L-fucosidase 2-like isoform X1 [Setaria italica]
Length=800

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +3

Query  450  KPLEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            +PL++ F  PA+ +TDA PIGN  LGAMVWGGVASE L LN
Sbjct  8    RPLKVVFASPAEYFTDAAPIGNGSLGAMVWGGVASEKLQLN  48



>dbj|BAJ85441.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=636

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +3

Query  450  KPLEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            +PL++ F  PA+ +TDA PIGN RLGA+VWGGV SE L LN
Sbjct  39   RPLKVVFASPARYFTDAAPIGNGRLGALVWGGVTSEKLQLN  79



>ref|XP_010238647.1| PREDICTED: alpha-L-fucosidase 2-like isoform X2 [Brachypodium 
distachyon]
Length=604

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +3

Query  450  KPLEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            +PL++ F  PA+ +TDA PIGN  LGAMVWGGVASE L LN
Sbjct  19   RPLKVVFASPAEHFTDAAPIGNGSLGAMVWGGVASEKLQLN  59



>dbj|GAE07437.1| putative large secreted protein [Paenibacillus sp. JCM 10914]
Length=386

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +3

Query  456  LEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            +++++++PA +WT+ALPIGN RLGAM++GGV  ET++LN
Sbjct  5    MQLQYDKPASVWTEALPIGNGRLGAMIYGGVERETISLN  43



>gb|AAK98716.1|AC090483_6 Hypothetical protein [Oryza sativa Japonica Group]
Length=872

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +3

Query  450  KPLEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            +PLE+ F  P++ +TDA PIGN  LGA+VWGGVASE L LN
Sbjct  33   RPLEVVFASPSRYFTDAAPIGNGSLGALVWGGVASEKLQLN  73



>ref|WP_033160384.1| alpha-L-fucosidase, partial [Bacteroides cellulosilyticus]
Length=680

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +3

Query  456  LEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            L++ + +PAK+WT+ALP+GN RLGAMV+GGVA+E + LN
Sbjct  23   LKLWYQQPAKVWTEALPLGNSRLGAMVYGGVANEQIQLN  61



>ref|XP_008659917.1| PREDICTED: alpha-L-fucosidase 2 isoform X2 [Zea mays]
 tpg|DAA46847.1| TPA: hypothetical protein ZEAMMB73_390456 [Zea mays]
Length=727

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +3

Query  450  KPLEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            +PL++ F  PAK +TDA PIGN RLGAMVWG V SE L LN
Sbjct  40   RPLKVVFGSPAKYFTDAAPIGNGRLGAMVWGCVESERLQLN  80



>ref|XP_003560237.1| PREDICTED: alpha-L-fucosidase 2-like isoform X1 [Brachypodium 
distachyon]
Length=818

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +3

Query  450  KPLEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            +PL++ F  PA+ +TDA PIGN  LGAMVWGGVASE L LN
Sbjct  19   RPLKVVFASPAEHFTDAAPIGNGSLGAMVWGGVASEKLQLN  59



>gb|EEC66760.1| hypothetical protein OsI_33136 [Oryza sativa Indica Group]
Length=851

 Score = 58.5 bits (140),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +3

Query  450  KPLEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            +PLE+ F  P++ +TDA PIGN  LGA+VWGGVASE L LN
Sbjct  33   RPLEVVFASPSRYFTDAAPIGNGSLGALVWGGVASEKLQLN  73



>gb|ABB47227.1| large secreted protein, putative, expressed [Oryza sativa Japonica 
Group]
 gb|EEE50778.1| hypothetical protein OsJ_31136 [Oryza sativa Japonica Group]
Length=851

 Score = 58.5 bits (140),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +3

Query  450  KPLEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            +PLE+ F  P++ +TDA PIGN  LGA+VWGGVASE L LN
Sbjct  33   RPLEVVFASPSRYFTDAAPIGNGSLGALVWGGVASEKLQLN  73



>emb|CAJ23483.1| conserved hypothetical protein [Xanthomonas campestris pv. vesicatoria 
str. 85-10]
Length=856

 Score = 58.5 bits (140),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +3

Query  450  KPLEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            + L++ + EPA  W +ALP+GN RLGAMVWGG+A E L LN
Sbjct  109  QALQLWYREPANQWVEALPVGNGRLGAMVWGGIAHERLQLN  149



>ref|WP_044661129.1| alpha/beta hydrolase [Sphingobium sp. YBL2]
 gb|AJR23955.1| alpha/beta hydrolase [Sphingobium sp. YBL2]
Length=777

 Score = 58.5 bits (140),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 26/40 (65%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +3

Query  453  PLEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            PL + + +PA  WT+ALPIGN RLGAMV+GGVA E L LN
Sbjct  34   PLTLWYRQPAATWTEALPIGNGRLGAMVFGGVARERLQLN  73



>ref|WP_042826124.1| alpha/beta hydrolase, partial [Xanthomonas axonopodis]
 gb|KGT56486.1| alpha/beta hydrolase, partial [Xanthomonas axonopodis pv. phaseoli]
Length=173

 Score = 55.8 bits (133),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +3

Query  456  LEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            L++ + EPA  W +ALP+GN RLGAMVWGG+A E L LN
Sbjct  45   LQLWYREPANEWVEALPVGNGRLGAMVWGGIAHERLQLN  83



>ref|XP_008659908.1| PREDICTED: alpha-L-fucosidase 2 isoform X1 [Zea mays]
Length=858

 Score = 58.2 bits (139),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +3

Query  450  KPLEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            +PL++ F  PAK +TDA PIGN RLGAMVWG V SE L LN
Sbjct  40   RPLKVVFGSPAKYFTDAAPIGNGRLGAMVWGCVESERLQLN  80



>ref|WP_039417657.1| alpha/beta hydrolase [Xanthomonas euvesicatoria]
 gb|KHL61592.1| alpha/beta hydrolase [Xanthomonas euvesicatoria]
 gb|KHL65632.1| alpha/beta hydrolase [Xanthomonas euvesicatoria]
Length=790

 Score = 58.2 bits (139),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +3

Query  450  KPLEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            + L++ + EPA  W +ALP+GN RLGAMVWGG+A E L LN
Sbjct  43   QALQLWYREPANQWVEALPVGNGRLGAMVWGGIAHERLQLN  83



>ref|WP_031422336.1| alpha/beta hydrolase [Xanthomonas axonopodis]
Length=790

 Score = 58.2 bits (139),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +3

Query  450  KPLEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            + L++ + EPA  W +ALP+GN RLGAMVWGG+A E L LN
Sbjct  43   QALQLWYREPANQWVEALPVGNGRLGAMVWGGIAHERLQLN  83



>ref|WP_014090004.1| alpha/beta hydrolase [Xanthomonas alfalfae]
 gb|AEO42074.1| hypothetical protein XACM_1797 [Xanthomonas axonopodis pv. citrumelo 
F1]
Length=790

 Score = 58.2 bits (139),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +3

Query  450  KPLEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            + L++ + EPA  W +ALP+GN RLGAMVWGG+A E L LN
Sbjct  43   QALQLWYREPANQWVEALPVGNGRLGAMVWGGIAHERLQLN  83



>ref|WP_008574429.1| alpha/beta hydrolase [Xanthomonas perforans]
 gb|EGD14007.1| hypothetical protein XPE_2359 [Xanthomonas perforans 91-118]
Length=790

 Score = 58.2 bits (139),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +3

Query  450  KPLEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            + L++ + EPA  W +ALP+GN RLGAMVWGG+A E L LN
Sbjct  43   QALQLWYREPANQWVEALPVGNGRLGAMVWGGIAHERLQLN  83



>gb|AIE84468.1| putative large secreted protein [Fimbriimonas ginsengisoli Gsoil 
348]
Length=757

 Score = 58.2 bits (139),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +3

Query  462  IRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            +R++ PAK+WT+ALPIGN RL AMV+GGVA E L LN
Sbjct  18   LRYDRPAKIWTEALPIGNGRLAAMVFGGVAEERLALN  54



>ref|WP_010379703.1| alpha/beta hydrolase [Xanthomonas campestris]
 gb|KFA05298.1| alpha/beta hydrolase [Xanthomonas campestris pv. musacearum NCPPB 
4379]
 gb|KFA05505.1| alpha/beta hydrolase [Xanthomonas campestris pv. musacearum NCPPB 
2005]
 gb|KFA06279.1| alpha/beta hydrolase [Xanthomonas campestris pv. musacearum NCPPB 
4380]
 gb|KFA16607.1| alpha/beta hydrolase [Xanthomonas campestris pv. musacearum NCPPB 
4392]
 gb|KFA26123.1| alpha/beta hydrolase [Xanthomonas campestris pv. musacearum NCPPB 
4394]
 gb|KFA39573.1| alpha/beta hydrolase [Xanthomonas campestris pv. musacearum NCPPB 
4384]
Length=790

 Score = 58.2 bits (139),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +3

Query  450  KPLEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            + L++ + EPA  W +ALP+GN RLGAMVWGG+A E L LN
Sbjct  43   QALQLWYREPANQWVEALPVGNGRLGAMVWGGIAHERLQLN  83



>ref|WP_038474356.1| hypothetical protein [Fimbriimonas ginsengisoli]
Length=747

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +3

Query  462  IRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            +R++ PAK+WT+ALPIGN RL AMV+GGVA E L LN
Sbjct  8    LRYDRPAKIWTEALPIGNGRLAAMVFGGVAEERLALN  44



>ref|WP_014219830.1| alpha-L-fucosidase [Niastella koreensis]
 gb|AEV99916.1| Alpha-L-fucosidase [Niastella koreensis GR20-10]
Length=943

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +3

Query  450  KPLEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            +PL + + +PA  WTDALP+GN RLGAMV+GGV  E L LN
Sbjct  27   QPLRLWYQQPAATWTDALPLGNGRLGAMVFGGVGEEHLQLN  67



>gb|EMS61938.1| Alpha-L-fucosidase 2 [Triticum urartu]
Length=800

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +3

Query  450  KPLEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            +PL++ F  PA+ +TD+ PIGN  LGAMVWGGVASE L LN
Sbjct  19   RPLKVVFASPAEHFTDSAPIGNGSLGAMVWGGVASEKLQLN  59



>gb|EEC79728.1| hypothetical protein OsI_21058 [Oryza sativa Indica Group]
Length=815

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 32/70 (46%), Positives = 41/70 (59%), Gaps = 10/70 (14%)
 Frame = +3

Query  363  MEDFDWILVKELTDADMWspssgsttessKPLEIRFNEPAKLWTDALPIGNXRLGAMVWG  542
            M+   W+ V+   D D          E  +PL++ F+ PA+ +TDA PIGN  LGAMVWG
Sbjct  1    MDGDGWVWVRRPADDD----------EEERPLKVVFDSPAEHFTDAAPIGNGSLGAMVWG  50

Query  543  GVASETLNLN  572
             VASE L LN
Sbjct  51   SVASEKLQLN  60



>gb|ABG66022.1| large secreted protein, putative, expressed [Oryza sativa Japonica 
Group]
 gb|EEE50774.1| hypothetical protein OsJ_31132 [Oryza sativa Japonica Group]
Length=815

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 32/70 (46%), Positives = 41/70 (59%), Gaps = 10/70 (14%)
 Frame = +3

Query  363  MEDFDWILVKELTDADMWspssgsttessKPLEIRFNEPAKLWTDALPIGNXRLGAMVWG  542
            M+   W+ V+   D D          E  +PL++ F+ PA+ +TDA PIGN  LGAMVWG
Sbjct  1    MDGDGWVWVRRPADDD----------EEERPLKVVFDSPAEHFTDAAPIGNGSLGAMVWG  50

Query  543  GVASETLNLN  572
             VASE L LN
Sbjct  51   SVASEKLQLN  60



>gb|EFF47283.1| conserved hypothetical protein [Xanthomonas fuscans subsp. aurantifolii 
str. ICPB 10535]
Length=830

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +3

Query  456  LEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            L++ + EPA  W +ALP+GN RLGAMVWGG+A E L LN
Sbjct  85   LQLWYREPANEWVEALPVGNGRLGAMVWGGIAHERLQLN  123



>dbj|BAK06893.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=815

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +3

Query  450  KPLEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            +PL++ F  PA+ +TDA PIGN  LGAMVWGGVAS+ L LN
Sbjct  19   RPLKVVFASPAEHFTDAAPIGNGSLGAMVWGGVASDKLQLN  59



>gb|EFF43160.1| conserved hypothetical protein [Xanthomonas fuscans subsp. aurantifolii 
str. ICPB 11122]
Length=830

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +3

Query  456  LEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            L++ + EPA  W +ALP+GN RLGAMVWGG+A E L LN
Sbjct  85   LQLWYREPANEWVEALPVGNGRLGAMVWGGIAHERLQLN  123



>gb|EGD09621.1| hypothetical protein XVE_2098 [Xanthomonas vesicatoria ATCC 35937]
Length=776

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +3

Query  456  LEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            L++ + EPA  W +ALP+GN RLGAMVWGG+A E L LN
Sbjct  31   LQLWYREPANEWVEALPVGNGRLGAMVWGGIAHERLQLN  69



>ref|WP_039423109.1| alpha/beta hydrolase [Xanthomonas vesicatoria]
 gb|KHM94159.1| alpha/beta hydrolase [Xanthomonas vesicatoria]
 gb|KHM94425.1| alpha/beta hydrolase [Xanthomonas vesicatoria]
Length=790

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +3

Query  456  LEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            L++ + EPA  W +ALP+GN RLGAMVWGG+A E L LN
Sbjct  45   LQLWYREPANEWVEALPVGNGRLGAMVWGGIAHERLQLN  83



>ref|WP_033485295.1| alpha/beta hydrolase [Xanthomonas campestris]
 emb|CDN20612.1| hypothetical protein XVT_3287 [Xanthomonas campestris pv. viticola]
Length=790

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +3

Query  456  LEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            L++ + EPA  W +ALP+GN RLGAMVWGG+A E L LN
Sbjct  45   LQLWYREPANEWVEALPVGNGRLGAMVWGGIAHERLQLN  83



>ref|WP_039570142.1| alpha/beta hydrolase [Xanthomonas axonopodis]
 gb|KGT51258.1| alpha/beta hydrolase [Xanthomonas axonopodis pv. phaseoli]
 gb|KHD66684.1| alpha/beta hydrolase [Xanthomonas axonopodis pv. phaseoli]
 gb|KHD67765.1| alpha/beta hydrolase [Xanthomonas axonopodis pv. phaseoli]
 gb|KHD69110.1| alpha/beta hydrolase [Xanthomonas axonopodis pv. phaseoli]
 gb|KHS23507.1| alpha/beta hydrolase [Xanthomonas axonopodis pv. phaseoli]
 gb|KHS28492.1| alpha/beta hydrolase [Xanthomonas axonopodis pv. phaseoli]
 gb|KHS39343.1| alpha/beta hydrolase [Xanthomonas axonopodis pv. phaseoli]
 gb|KHS39872.1| alpha/beta hydrolase [Xanthomonas axonopodis pv. phaseoli]
 gb|KIJ00521.1| alpha/beta hydrolase [Xanthomonas axonopodis pv. phaseoli]
Length=794

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +3

Query  456  LEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            L++ + EPA  W +ALP+GN RLGAMVWGG+A E L LN
Sbjct  49   LQLWYREPANEWVEALPVGNGRLGAMVWGGIAHERLQLN  87



>ref|WP_017159177.1| alpha/beta hydrolase [Xanthomonas axonopodis]
Length=794

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +3

Query  456  LEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            L++ + EPA  W +ALP+GN RLGAMVWGG+A E L LN
Sbjct  49   LQLWYREPANEWVEALPVGNGRLGAMVWGGIAHERLQLN  87



>ref|WP_017115671.1| alpha/beta hydrolase [Xanthomonas vasicola]
Length=783

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +3

Query  456  LEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            L++ + EPA  W +ALP+GN RLGAMVWGG+A E L LN
Sbjct  45   LQLWYREPANEWVEALPVGNGRLGAMVWGGIAHERLQLN  83



>ref|WP_042827962.1| alpha/beta hydrolase [Xanthomonas vesicatoria]
Length=790

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +3

Query  456  LEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            L++ + EPA  W +ALP+GN RLGAMVWGG+A E L LN
Sbjct  45   LQLWYREPANEWVEALPVGNGRLGAMVWGGIAHERLQLN  83



>ref|WP_017155140.1| alpha/beta hydrolase [Xanthomonas axonopodis]
Length=794

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +3

Query  456  LEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            L++ + EPA  W +ALP+GN RLGAMVWGG+A E L LN
Sbjct  49   LQLWYREPANEWVEALPVGNGRLGAMVWGGIAHERLQLN  87



>dbj|BAK07299.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=832

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +3

Query  450  KPLEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            +PL++ F+ PA+ +TDA PIGN  LGAMVWGGV+S+ L LN
Sbjct  33   RPLKVAFSSPAEYFTDAAPIGNGSLGAMVWGGVSSDKLQLN  73



>ref|WP_017165717.1| alpha/beta hydrolase, partial [Xanthomonas axonopodis]
Length=779

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +3

Query  456  LEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            L++ + EPA  W +ALP+GN RLGAMVWGG+A E L LN
Sbjct  34   LQLWYREPANEWVEALPVGNGRLGAMVWGGIAHERLQLN  72



>ref|WP_029219619.1| alpha/beta hydrolase [Xanthomonas cassavae]
Length=790

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +3

Query  456  LEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            L++ + EPA  W +ALP+GN RLGAMVWGG+A E L LN
Sbjct  45   LQLWYREPANEWVEALPVGNGRLGAMVWGGIAHERLQLN  83



>ref|WP_003481940.1| alpha/beta hydrolase [Xanthomonas citri]
 emb|CCG35171.1| hypothetical protein XMIN_121 [Xanthomonas citri pv. mangiferaeindicae 
LMG 941]
Length=790

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +3

Query  456  LEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            L++ + EPA  W +ALP+GN RLGAMVWGG+A E L LN
Sbjct  45   LQLWYREPANEWVEALPVGNGRLGAMVWGGIAHERLQLN  83



>ref|WP_017168761.1| alpha/beta hydrolase, partial [Xanthomonas axonopodis]
Length=777

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +3

Query  456  LEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            L++ + EPA  W +ALP+GN RLGAMVWGG+A E L LN
Sbjct  32   LQLWYREPANEWVEALPVGNGRLGAMVWGGIAHERLQLN  70



>ref|WP_042805837.1| alpha/beta hydrolase [Xanthomonas fuscans]
Length=790

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +3

Query  456  LEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            L++ + EPA  W +ALP+GN RLGAMVWGG+A E L LN
Sbjct  45   LQLWYREPANEWVEALPVGNGRLGAMVWGGIAHERLQLN  83



>ref|WP_039430790.1| alpha/beta hydrolase [Xanthomonas vasicola]
 gb|KGR41706.1| alpha/beta hydrolase [Xanthomonas vasicola]
 gb|KGR44063.1| alpha/beta hydrolase [Xanthomonas vasicola]
 gb|KGR48432.1| alpha/beta hydrolase [Xanthomonas vasicola]
 gb|KGR61898.1| alpha/beta hydrolase [Xanthomonas vasicola]
Length=790

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +3

Query  456  LEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            L++ + EPA  W +ALP+GN RLGAMVWGG+A E L LN
Sbjct  45   LQLWYREPANEWVEALPVGNGRLGAMVWGGIAHERLQLN  83



>ref|WP_005916595.1| MULTISPECIES: hypothetical protein [Xanthomonas]
 gb|EKQ61175.1| hypothetical protein MOU_18224 [Xanthomonas axonopodis pv. malvacearum 
str. GSPB1386]
 gb|EKQ62899.1| hypothetical protein WS7_01835 [Xanthomonas axonopodis pv. malvacearum 
str. GSPB2388]
Length=790

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +3

Query  456  LEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            L++ + EPA  W +ALP+GN RLGAMVWGG+A E L LN
Sbjct  45   LQLWYREPANEWVEALPVGNGRLGAMVWGGIAHERLQLN  83



>ref|WP_005924393.1| alpha/beta hydrolase [Xanthomonas axonopodis]
 emb|CCF66427.1| hypothetical protein XAPC_114 [Xanthomonas axonopodis pv. punicae 
str. LMG 859]
Length=790

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +3

Query  456  LEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            L++ + EPA  W +ALP+GN RLGAMVWGG+A E L LN
Sbjct  45   LQLWYREPANEWVEALPVGNGRLGAMVWGGIAHERLQLN  83



>ref|WP_031329735.1| hypothetical protein, partial [Xanthomonas axonopodis]
Length=771

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +3

Query  456  LEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            L++ + EPA  W +ALP+GN RLGAMVWGG+A E L LN
Sbjct  26   LQLWYREPANEWVEALPVGNGRLGAMVWGGIAHERLQLN  64



>gb|KFA29989.1| alpha/beta hydrolase, partial [Xanthomonas vasicola pv. vasculorum 
NCPPB 1326]
Length=727

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +3

Query  456  LEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            L++ + EPA  W +ALP+GN RLGAMVWGG+A E L LN
Sbjct  44   LQLWYREPANEWVEALPVGNGRLGAMVWGGIAHERLQLN  82



>ref|WP_041470511.1| alpha/beta hydrolase [Xanthomonas axonopodis]
Length=790

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +3

Query  456  LEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            L++ + EPA  W +ALP+GN RLGAMVWGG+A E L LN
Sbjct  45   LQLWYREPANEWVEALPVGNGRLGAMVWGGIAHERLQLN  83



>ref|WP_022559521.1| MULTISPECIES: hypothetical protein [Xanthomonas]
 ref|YP_008639424.1| conserved hypothetical protein [Xanthomonas fuscans subsp. fuscans]
 emb|CDF62219.1| conserved hypothetical protein [Xanthomonas fuscans subsp. fuscans]
 gb|KGK66017.1| alpha/beta hydrolase [Xanthomonas axonopodis pv. phaseoli]
 gb|KGP21725.1| alpha/beta hydrolase [Xanthomonas axonopodis pv. phaseoli]
 gb|KGP28053.1| alpha/beta hydrolase [Xanthomonas axonopodis pv. phaseoli]
 gb|KGP30085.1| alpha/beta hydrolase [Xanthomonas axonopodis pv. phaseoli]
 gb|KGP34980.1| alpha/beta hydrolase [Xanthomonas axonopodis pv. phaseoli]
 gb|KGU46687.1| alpha/beta hydrolase [Xanthomonas axonopodis pv. phaseoli]
 gb|KGU47118.1| alpha/beta hydrolase [Xanthomonas axonopodis pv. phaseoli]
 gb|KGU49056.1| alpha/beta hydrolase [Xanthomonas axonopodis pv. phaseoli]
 gb|KGU51558.1| alpha/beta hydrolase [Xanthomonas axonopodis pv. phaseoli]
 gb|KHF71979.1| alpha/beta hydrolase [Xanthomonas axonopodis pv. phaseoli]
 gb|KIF09175.1| alpha/beta hydrolase [Xanthomonas axonopodis pv. phaseoli]
 gb|KII96724.1| alpha/beta hydrolase [Xanthomonas axonopodis pv. phaseoli]
Length=790

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +3

Query  456  LEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            L++ + EPA  W +ALP+GN RLGAMVWGG+A E L LN
Sbjct  45   LQLWYREPANEWVEALPVGNGRLGAMVWGGIAHERLQLN  83



>gb|KGK58817.1| alpha/beta hydrolase [Xanthomonas sp. Nyagatare]
Length=790

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +3

Query  456  LEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            L++ + EPA  W +ALP+GN RLGAMVWGG+A E L LN
Sbjct  45   LQLWYREPASEWVEALPVGNGRLGAMVWGGIAHERLQLN  83



>ref|WP_033486106.1| alpha/beta hydrolase [Xanthomonas axonopodis]
Length=770

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +3

Query  456  LEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            L++ + EPA  W +ALP+GN RLGAMVWGG+A E L LN
Sbjct  25   LQLWYREPANEWVEALPVGNGRLGAMVWGGIAHERLQLN  63



>ref|WP_042675923.1| alpha/beta hydrolase [Xanthomonas fuscans]
Length=790

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +3

Query  456  LEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            L++ + EPA  W +ALP+GN RLGAMVWGG+A E L LN
Sbjct  45   LQLWYREPANEWVEALPVGNGRLGAMVWGGIAHERLQLN  83



>ref|WP_039563834.1| alpha/beta hydrolase [Xanthomonas campestris]
 gb|KHL59465.1| alpha/beta hydrolase [Xanthomonas campestris pv. cannabis]
Length=790

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +3

Query  456  LEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            L++ + EPA  W +ALP+GN RLGAMVWGG+A E L LN
Sbjct  45   LQLWYREPANEWVEALPVGNGRLGAMVWGGIAHERLQLN  83



>ref|WP_039444828.1| alpha/beta hydrolase [Xanthomonas vasicola]
 gb|KGR52148.1| alpha/beta hydrolase [Xanthomonas vasicola]
 gb|KGR63170.1| alpha/beta hydrolase [Xanthomonas vasicola]
 gb|KGT82810.1| alpha/beta hydrolase [Xanthomonas vasicola]
Length=790

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +3

Query  456  LEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            L++ + EPA  W +ALP+GN RLGAMVWGG+A E L LN
Sbjct  45   LQLWYREPANEWVEALPVGNGRLGAMVWGGIAHERLQLN  83



>ref|WP_040245726.1| alpha/beta hydrolase [Xanthomonas citri]
 emb|CEH40228.1| conserved exported hypothetical protein [Xanthomonas citri pv. 
citri]
 emb|CEI11752.1| conserved exported hypothetical protein [Xanthomonas citri pv. 
citri]
Length=790

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +3

Query  456  LEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            L++ + EPA  W +ALP+GN RLGAMVWGG+A E L LN
Sbjct  45   LQLWYREPANEWVEALPVGNGRLGAMVWGGIAHERLQLN  83



>ref|WP_011051132.1| alpha/beta hydrolase [Xanthomonas citri]
 gb|AAM36638.1| conserved hypothetical protein [Xanthomonas axonopodis pv. citri 
str. 306]
 gb|AGI08079.1| Hypothetical Protein XCAW_02292 [Xanthomonas citri subsp. citri 
Aw12879]
 emb|CEH60848.1| conserved exported hypothetical protein [Xanthomonas citri pv. 
citri]
 emb|CEH47096.1| conserved exported hypothetical protein [Xanthomonas citri pv. 
citri]
 emb|CEH98808.1| conserved exported hypothetical protein [Xanthomonas citri pv. 
citri]
 emb|CEI38090.1| conserved exported hypothetical protein [Xanthomonas citri pv. 
citri]
 emb|CEH62195.1| conserved exported hypothetical protein [Xanthomonas citri pv. 
citri]
 emb|CEH39876.1| conserved exported hypothetical protein [Xanthomonas citri pv. 
citri]
 emb|CEH95416.1| conserved exported hypothetical protein [Xanthomonas citri pv. 
citri]
 emb|CEI18204.1| conserved exported hypothetical protein [Xanthomonas citri pv. 
citri]
 emb|CEI02526.1| conserved exported hypothetical protein [Xanthomonas citri pv. 
citri]
 emb|CEI11784.1| conserved exported hypothetical protein [Xanthomonas citri pv. 
citri]
 emb|CEI09410.1| conserved exported hypothetical protein [Xanthomonas citri pv. 
citri]
 emb|CEH94294.1| conserved exported hypothetical protein [Xanthomonas citri pv. 
citri]
 emb|CEH72933.1| conserved exported hypothetical protein [Xanthomonas citri pv. 
citri]
 gb|AJD68368.1| hypothetical protein J151_01929 [Xanthomonas citri subsp. citri 
A306]
 emb|CEL42146.1| conserved exported hypothetical protein [Xanthomonas citri pv. 
citri]
 emb|CEL51324.1| conserved exported hypothetical protein [Xanthomonas citri pv. 
citri]
Length=790

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +3

Query  456  LEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            L++ + EPA  W +ALP+GN RLGAMVWGG+A E L LN
Sbjct  45   LQLWYREPANEWVEALPVGNGRLGAMVWGGIAHERLQLN  83



>ref|WP_017118955.1| alpha/beta hydrolase [Xanthomonas vasicola]
 gb|KFA33361.1| alpha/beta hydrolase [Xanthomonas vasicola pv. vasculorum NCPPB 
206]
Length=790

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +3

Query  456  LEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            L++ + EPA  W +ALP+GN RLGAMVWGG+A E L LN
Sbjct  45   LQLWYREPANEWVEALPVGNGRLGAMVWGGIAHERLQLN  83



>ref|WP_017117247.1| alpha/beta hydrolase [Xanthomonas vasicola]
 gb|KFA31404.1| alpha/beta hydrolase [Xanthomonas vasicola pv. vasculorum NCPPB 
1381]
 gb|KGP56515.1| alpha/beta hydrolase [Xanthomonas campestris pv. arecae]
Length=790

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +3

Query  456  LEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            L++ + EPA  W +ALP+GN RLGAMVWGG+A E L LN
Sbjct  45   LQLWYREPANEWVEALPVGNGRLGAMVWGGIAHERLQLN  83



>ref|WP_010370194.1| alpha/beta hydrolase [Xanthomonas vasicola]
Length=792

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +3

Query  456  LEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            L++ + EPA  W +ALP+GN RLGAMVWGG+A E L LN
Sbjct  47   LQLWYREPANEWVEALPVGNGRLGAMVWGGIAHERLQLN  85



>gb|AGH77269.1| hypothetical protein XAC29_08925 [Xanthomonas axonopodis Xac29-1]
Length=783

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +3

Query  456  LEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            L++ + EPA  W +ALP+GN RLGAMVWGG+A E L LN
Sbjct  38   LQLWYREPANEWVEALPVGNGRLGAMVWGGIAHERLQLN  76



>ref|WP_044271405.1| alpha-L-fucosidase [Candidatus Bacteroides timonensis]
Length=809

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/39 (59%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +3

Query  456  LEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            L++ + +PAK+WT+ALP+GN RLGAMV+GGV +E + LN
Sbjct  23   LKLWYQQPAKVWTEALPLGNSRLGAMVYGGVVNEQIQLN  61



>ref|WP_039404303.1| alpha/beta hydrolase [Xanthomonas campestris]
 gb|KHL59512.1| alpha/beta hydrolase [Xanthomonas campestris pv. cannabis]
Length=790

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +3

Query  456  LEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            L++ + EPA  W +ALP+GN RLGAMVWGG+A E L LN
Sbjct  45   LQLWYREPANEWVEALPVGNGRLGAMVWGGIAHERLQLN  83



>ref|WP_040281002.1| alpha/beta hydrolase [Xanthomonas citri]
 emb|CEH63789.1| conserved hypothetical protein [Xanthomonas citri pv. citri]
 emb|CEJ27850.1| conserved hypothetical protein [Xanthomonas citri pv. citri]
 emb|CEJ23179.1| conserved hypothetical protein [Xanthomonas citri pv. citri]
 emb|CEL44336.1| conserved hypothetical protein [Xanthomonas citri pv. citri]
Length=770

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +3

Query  456  LEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            L++ + EPA  W +ALP+GN RLGAMVWGG+A E L LN
Sbjct  25   LQLWYREPANEWVEALPVGNGRLGAMVWGGIAHERLQLN  63



>ref|WP_040151880.1| alpha/beta hydrolase, partial [Xanthomonas citri]
Length=771

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +3

Query  456  LEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            L++ + EPA  W +ALP+GN RLGAMVWGG+A E L LN
Sbjct  26   LQLWYREPANEWVEALPVGNGRLGAMVWGGIAHERLQLN  64



>ref|WP_042815126.1| alpha/beta hydrolase, partial [Xanthomonas citri]
Length=773

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +3

Query  456  LEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            L++ + EPA  W +ALP+GN RLGAMVWGG+A E L LN
Sbjct  28   LQLWYREPANEWVEALPVGNGRLGAMVWGGIAHERLQLN  66



>ref|WP_022209650.1| uncharacterized protein [Bacteroides cellulosilyticus CAG:158]
 emb|CDB71004.1| uncharacterized protein BN506_02367 [Bacteroides cellulosilyticus 
CAG:158]
Length=809

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/39 (59%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +3

Query  456  LEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            L++ + +PAK+WT+ALP+GN RLGAMV+GGV +E + LN
Sbjct  23   LKLWYQQPAKVWTEALPLGNSRLGAMVYGGVVNEQIQLN  61



>ref|WP_042831606.1| alpha/beta hydrolase, partial [Xanthomonas citri]
Length=773

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +3

Query  456  LEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            L++ + EPA  W +ALP+GN RLGAMVWGG+A E L LN
Sbjct  28   LQLWYREPANEWVEALPVGNGRLGAMVWGGIAHERLQLN  66



>ref|WP_021967943.1| MULTISPECIES: uncharacterized protein [Bacteroides]
 emb|CCY85719.1| uncharacterized protein BN711_01967 [Bacteroides intestinalis 
CAG:564]
Length=809

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/39 (59%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +3

Query  456  LEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            L++ + +PAK+WT+ALP+GN RLGAMV+GGV +E + LN
Sbjct  23   LKLWYKQPAKVWTEALPLGNSRLGAMVYGGVVNEQIQLN  61



>ref|WP_044153398.1| alpha-L-fucosidase [Bacteroides cellulosilyticus]
Length=809

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/39 (59%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +3

Query  456  LEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            L++ + +PAK+WT+ALP+GN RLGAMV+GGV +E + LN
Sbjct  23   LKLWYQQPAKVWTEALPLGNSRLGAMVYGGVVNEQIQLN  61



>ref|WP_007217057.1| glycoside hydrolase [Bacteroides cellulosilyticus]
 gb|EIY31946.1| hypothetical protein HMPREF1062_02373 [Bacteroides cellulosilyticus 
CL02T12C19]
Length=809

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/39 (59%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +3

Query  456  LEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            L++ + +PAK+WT+ALP+GN RLGAMV+GGV +E + LN
Sbjct  23   LKLWYQQPAKVWTEALPLGNSRLGAMVYGGVVNEQIQLN  61



>ref|WP_044533450.1| alpha-L-fucosidase [Bacteroides intestinalis]
Length=809

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/39 (59%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +3

Query  456  LEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            L++ + +PAK+WT+ALP+GN RLGAMV+GGV +E + LN
Sbjct  23   LKLWYKQPAKVWTEALPLGNSRLGAMVYGGVVNEQIQLN  61



>gb|EEF91123.1| hypothetical protein BACCELL_01254 [Bacteroides cellulosilyticus 
DSM 14838]
Length=793

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/39 (59%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +3

Query  456  LEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            L++ + +PAK+WT+ALP+GN RLGAMV+GGV +E + LN
Sbjct  7    LKLWYQQPAKVWTEALPLGNSRLGAMVYGGVVNEQIQLN  45



>gb|EMI46558.1| fibronectin type III domain protein [Rhodopirellula sp. SWK7]
Length=799

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +3

Query  456  LEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            L + FNEPA  W DALP+GN RLGAMV+GGV +E + LN
Sbjct  49   LSLWFNEPATYWEDALPLGNGRLGAMVYGGVTNELIQLN  87



>ref|WP_020819755.1| MULTISPECIES: alpha/beta hydrolase [Sphingobium]
 gb|EPR15036.1| alpha/beta hydrolase [Sphingobium chinhatense IP26]
 gb|EQB05783.1| alpha/beta hydrolase [Sphingobium sp. HDIP04]
 gb|KER35791.1| alpha/beta hydrolase [Sphingobium lucknowense F2]
Length=777

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/40 (63%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +3

Query  453  PLEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            PL + + +PA  WT+ALPIGN RLGAM++GGVA E L LN
Sbjct  34   PLTLWYRQPAATWTEALPIGNGRLGAMLFGGVARERLQLN  73



>ref|WP_044251102.1| fibronectin [Rhodopirellula sp. SWK7]
Length=762

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +3

Query  456  LEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            L + FNEPA  W DALP+GN RLGAMV+GGV +E + LN
Sbjct  12   LSLWFNEPATYWEDALPLGNGRLGAMVYGGVTNELIQLN  50



>gb|EDV07104.1| hypothetical protein BACINT_00670 [Bacteroides intestinalis DSM 
17393]
Length=794

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/39 (59%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +3

Query  456  LEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            L++ + +PAK+WT+ALP+GN RLGAMV+GGV +E + LN
Sbjct  8    LKLWYKQPAKVWTEALPLGNSRLGAMVYGGVVNEQIQLN  46



>ref|WP_039917936.1| alpha-L-fucosidase [Cellvibrio mixtus]
Length=829

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +3

Query  450  KPLEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            KPL++ F++PA  W +ALP+GN RLGAMV+GGV  E L LN
Sbjct  24   KPLKLWFDKPANQWEEALPLGNGRLGAMVYGGVTHENLQLN  64



>ref|WP_022394273.1| uncharacterized protein [Bacteroides intestinalis CAG:315]
 emb|CDD97309.1| uncharacterized protein BN604_03274 [Bacteroides intestinalis 
CAG:315]
Length=809

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/39 (59%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +3

Query  456  LEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            L++ + +PAK+WT+ALP+GN RLGAMV+GGV +E + LN
Sbjct  23   LKLWYKQPAKVWTEALPLGNSRLGAMVYGGVVNEQIQLN  61



>ref|WP_039586562.1| alpha/beta hydrolase [Xanthomonas axonopodis]
 gb|KHS06782.1| alpha/beta hydrolase [Xanthomonas axonopodis pv. phaseoli]
Length=790

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +3

Query  456  LEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            L++ + EPA  W +ALP+GN RLGAMVWGG+A E L LN
Sbjct  45   LQLWYREPAGEWVEALPVGNGRLGAMVWGGIAHERLQLN  83



>ref|WP_039582251.1| alpha/beta hydrolase [Xanthomonas axonopodis]
 gb|KGU57689.1| alpha/beta hydrolase [Xanthomonas axonopodis pv. phaseoli]
 gb|KHF49728.1| alpha/beta hydrolase [Xanthomonas axonopodis pv. phaseoli]
 gb|KHS24293.1| alpha/beta hydrolase [Xanthomonas axonopodis pv. phaseoli]
Length=790

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +3

Query  456  LEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            L++ + EPA  W +ALP+GN RLGAMVWGG+A E L LN
Sbjct  45   LQLWYREPAGEWVEALPVGNGRLGAMVWGGIAHERLQLN  83



>ref|WP_013053821.1| alpha/beta hydrolase [Sphingobium japonicum]
 dbj|BAI98597.1| hypothetical protein SJA_C2-02340 [Sphingobium japonicum UT26S]
Length=777

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/40 (63%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +3

Query  453  PLEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            PL + + +PA  WT+ALPIGN RLGAM++GGVA E L LN
Sbjct  34   PLTLWYRQPAAAWTEALPIGNGRLGAMLFGGVARERLQLN  73



>ref|WP_016849738.1| alpha/beta hydrolase [Xanthomonas axonopodis]
 gb|EWC53052.1| alpha/beta hydrolase [Xanthomonas axonopodis pv. glycines str. 
8ra]
Length=790

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +3

Query  456  LEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            L++ + EPA  W +ALP+GN RLGAMVWGG+A E L LN
Sbjct  45   LQLWYREPAGEWVEALPVGNGRLGAMVWGGIAHERLQLN  83



>ref|WP_037509604.1| alpha/beta hydrolase, partial [Sphingomonas sp. BHC-A]
 gb|KEY99140.1| hypothetical protein AI27_06710, partial [Sphingomonas sp. BHC-A]
Length=281

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +3

Query  450  KPLEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
             PL + + +PA  WT+ALPIGN RLGAM++GGVA E L LN
Sbjct  33   HPLTLWYRQPAATWTEALPIGNGRLGAMLFGGVARERLQLN  73



>ref|WP_008690950.1| alpha-L-fucosidase, partial [Rhodopirellula maiorica]
 gb|EMI22576.1| alpha-L-fucosidase, partial [Rhodopirellula maiorica SM1]
Length=646

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +3

Query  450  KPLEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            +PL + +N PA  W +ALP+GN RLGAMV+GGV+ E + LN
Sbjct  51   QPLSLWYNRPATHWEEALPVGNGRLGAMVYGGVSKEIIQLN  91



>dbj|GAE57445.1| hypothetical protein XPR_4080 [Xanthomonas arboricola pv. pruni 
MAFF 301420]
 dbj|GAE50003.1| alpha-L-fucosidase [Xanthomonas arboricola pv. pruni str. MAFF 
311562]
 dbj|GAE62129.1| hypothetical protein XPN_4035 [Xanthomonas arboricola pv. pruni 
MAFF 301427]
 gb|KCX00468.1| alpha/beta hydrolase [Xanthomonas arboricola pv. pruni]
Length=796

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +3

Query  456  LEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            L++ + EPA  W  ALP+GN RLGAMVWGG+A E L LN
Sbjct  51   LQLWYREPANEWVQALPVGNGRLGAMVWGGIAHERLQLN  89



>gb|ETC88435.1| hypothetical protein XHC_2089 [Xanthomonas hortorum pv. carotae 
str. M081]
Length=806

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +3

Query  456  LEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            L++ + EPA  W  ALP+GN RLGAMVWGG+A E L LN
Sbjct  61   LQLWYREPANEWVQALPVGNGRLGAMVWGGIAHERLQLN  99



>ref|WP_035293230.1| hypothetical protein, partial [Actinoalloteichus cyanogriseus]
Length=792

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/38 (61%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +3

Query  459  EIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            E+R++ PA+ WT+ALP+GN RLGAMV+GG A+E L +N
Sbjct  12   ELRYDAPARRWTEALPVGNGRLGAMVFGGTATERLQIN  49



>ref|WP_039511821.1| alpha/beta hydrolase [Xanthomonas arboricola]
Length=793

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +3

Query  456  LEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            L++ + EPA  W  ALP+GN RLGAMVWGG+A E L LN
Sbjct  48   LQLWYREPANEWVQALPVGNGRLGAMVWGGIAHERLQLN  86



>gb|ENZ93886.1| hypothetical protein O1K_18548 [Xanthomonas fragariae LMG 25863]
Length=797

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +3

Query  456  LEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            L++ + EPA  W  ALP+GN RLGAMVWGG+A E L LN
Sbjct  52   LQLWYREPANEWVQALPVGNGRLGAMVWGGIAHERLQLN  90



>ref|WP_039522751.1| alpha/beta hydrolase [Xanthomonas arboricola]
 gb|KER85642.1| alpha/beta hydrolase [Xanthomonas arboricola pv. celebensis]
Length=793

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +3

Query  456  LEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            L++ + EPA  W  ALP+GN RLGAMVWGG+A E L LN
Sbjct  48   LQLWYREPANEWVQALPVGNGRLGAMVWGGIAHERLQLN  86



>gb|EGD16935.1| hypothetical protein XGA_4498 [Xanthomonas gardneri ATCC 19865]
Length=795

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +3

Query  456  LEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            L++ + EPA  W  ALP+GN RLGAMVWGG+A E L LN
Sbjct  50   LQLWYREPANEWVQALPVGNGRLGAMVWGGIAHERLQLN  88



>ref|WP_043910839.1| alpha/beta hydrolase [Xanthomonas gardneri]
Length=793

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +3

Query  456  LEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            L++ + EPA  W  ALP+GN RLGAMVWGG+A E L LN
Sbjct  48   LQLWYREPANEWVQALPVGNGRLGAMVWGGIAHERLQLN  86



>ref|WP_039816874.1| alpha/beta hydrolase [Xanthomonas arboricola]
Length=793

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +3

Query  456  LEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            L++ + EPA  W  ALP+GN RLGAMVWGG+A E L LN
Sbjct  48   LQLWYREPANEWVQALPVGNGRLGAMVWGGIAHERLQLN  86



>ref|WP_043889765.1| alpha/beta hydrolase [Xanthomonas hortorum]
Length=795

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +3

Query  456  LEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            L++ + EPA  W  ALP+GN RLGAMVWGG+A E L LN
Sbjct  50   LQLWYREPANEWVQALPVGNGRLGAMVWGGIAHERLQLN  88



>ref|WP_040763005.1| alpha/beta hydrolase [Xanthomonas fragariae]
Length=795

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +3

Query  456  LEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            L++ + EPA  W  ALP+GN RLGAMVWGG+A E L LN
Sbjct  50   LQLWYREPANEWVQALPVGNGRLGAMVWGGIAHERLQLN  88



>ref|WP_039530013.1| alpha/beta hydrolase [Xanthomonas arboricola]
 gb|KER82807.1| alpha/beta hydrolase [Xanthomonas arboricola pv. celebensis]
Length=793

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +3

Query  456  LEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            L++ + EPA  W  ALP+GN RLGAMVWGG+A E L LN
Sbjct  48   LQLWYREPANEWVQALPVGNGRLGAMVWGGIAHERLQLN  86



>tpg|DAA46850.1| TPA: hypothetical protein ZEAMMB73_390456 [Zea mays]
Length=579

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +3

Query  450  KPLEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            +PL++ F  PAK +TDA PIGN RLGAMVWG V SE L LN
Sbjct  40   RPLKVVFGSPAKYFTDAAPIGNGRLGAMVWGCVESERLQLN  80



>ref|WP_009129495.1| hypothetical protein [Bacteroides oleiciplenus]
 gb|EKU90515.1| hypothetical protein HMPREF9447_01933 [Bacteroides oleiciplenus 
YIT 12058]
Length=809

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 22/39 (56%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +3

Query  456  LEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            L++ +++PAK+WT+ALP+GN RLGAM++GGV +E + LN
Sbjct  23   LKLWYSQPAKVWTEALPLGNSRLGAMLYGGVVNEQIQLN  61



>ref|WP_028563331.1| alpha-L-fucosidase [Paenibacillus pinihumi]
Length=798

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +3

Query  450  KPLEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            KP ++++  PA +WT+ALPIGN RLGAMV+GGV  E + LN
Sbjct  5    KPAKLQYGRPAGVWTEALPIGNGRLGAMVFGGVEKERIALN  45



>ref|XP_001549786.1| hypothetical protein BC1G_11256 [Botrytis cinerea B05.10]
Length=490

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +3

Query  462  IRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            + +  PAK W+++LPIGN RLGAMV+GG++ ETL LN
Sbjct  10   LHYTSPAKEWSESLPIGNGRLGAMVYGGISRETLQLN  46



>ref|WP_026297319.1| alpha-L-fucosidase [Paenibacillus daejeonensis]
Length=799

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +3

Query  456  LEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            + IRF++PA  WT+ALP+GN +LGAMV+GGV SE + LN
Sbjct  11   MSIRFSKPAVYWTEALPVGNGKLGAMVFGGVESERIQLN  49



>ref|WP_029217201.1| alpha/beta hydrolase [Xanthomonas campestris]
Length=787

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +3

Query  456  LEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            L + + EPA  W  ALP+GN RLGAMVWGG+A E L LN
Sbjct  42   LHLWYREPANEWVQALPVGNGRLGAMVWGGIAHERLQLN  80



>ref|WP_008673774.1| glycoside hydrolase, family 95 [Rhodopirellula sallentina]
 gb|EMI58185.1| glycoside hydrolase, family 95 [Rhodopirellula sallentina SM41]
Length=799

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +3

Query  468  FNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            +N PAK W +ALP+GN RLGAMV+GGV+SE + LN
Sbjct  53   YNRPAKFWEEALPLGNGRLGAMVYGGVSSELIQLN  87



>ref|WP_042599112.1| alpha/beta hydrolase [Xanthomonas campestris]
 gb|KIQ24025.1| alpha/beta hydrolase [Xanthomonas campestris]
Length=787

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +3

Query  456  LEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            L + + EPA  W  ALP+GN RLGAMVWGG+A E L LN
Sbjct  42   LHLWYREPANEWVQALPVGNGRLGAMVWGGIAHERLQLN  80



>ref|WP_029628972.1| alpha/beta hydrolase [Xanthomonas campestris]
Length=787

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +3

Query  456  LEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            L + + EPA  W  ALP+GN RLGAMVWGG+A E L LN
Sbjct  42   LHLWYREPANEWVQALPVGNGRLGAMVWGGIAHERLQLN  80



>emb|CAP51866.1| conserved exported protein [Xanthomonas campestris pv. campestris]
Length=790

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +3

Query  456  LEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            L + + EPA  W  ALP+GN RLGAMVWGG+A E L LN
Sbjct  45   LHLWYREPANEWVQALPVGNGRLGAMVWGGIAHERLQLN  83



>gb|KHN30427.1| Alpha-L-fucosidase 2 [Glycine soja]
Length=825

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +3

Query  450  KPLEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            + L+IRF E  K WTDA+PIGN RLGAMV G V SET++LN
Sbjct  8    RNLKIRFREGGKHWTDAVPIGNGRLGAMVCGHVHSETIHLN  48



>ref|WP_043877916.1| alpha/beta hydrolase [Xanthomonas campestris]
Length=787

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +3

Query  456  LEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            L + + EPA  W  ALP+GN RLGAMVWGG+A E L LN
Sbjct  42   LHLWYREPANEWVQALPVGNGRLGAMVWGGIAHERLQLN  80



>ref|WP_011036930.1| alpha/beta hydrolase [Xanthomonas campestris]
 ref|NP_637123.1| hypothetical protein XCC1756 [Xanthomonas campestris pv. campestris 
str. ATCC 33913]
 gb|AAM41047.1| conserved hypothetical protein [Xanthomonas campestris pv. campestris 
str. ATCC 33913]
 gb|AAY49529.1| conserved hypothetical protein [Xanthomonas campestris pv. campestris 
str. 8004]
Length=790

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +3

Query  456  LEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            L + + EPA  W  ALP+GN RLGAMVWGG+A E L LN
Sbjct  45   LHLWYREPANEWVQALPVGNGRLGAMVWGGIAHERLQLN  83



>ref|WP_040941414.1| alpha/beta hydrolase [Xanthomonas campestris]
Length=787

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +3

Query  456  LEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            L + + EPA  W  ALP+GN RLGAMVWGG+A E L LN
Sbjct  42   LHLWYREPANEWVQALPVGNGRLGAMVWGGIAHERLQLN  80



>ref|XP_006573903.1| PREDICTED: alpha-L-fucosidase 2-like [Glycine max]
Length=821

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +3

Query  450  KPLEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            + L+IRF E  K WTDA+PIGN RLGAMV G V SET++LN
Sbjct  8    RNLKIRFREGGKHWTDAVPIGNGRLGAMVCGHVHSETIHLN  48



>ref|WP_042824371.1| alpha/beta hydrolase [Xanthomonas axonopodis]
 gb|KGE50505.1| alpha/beta hydrolase [Xanthomonas axonopodis pv. vasculorum]
Length=792

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 23/39 (59%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +3

Query  456  LEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            L++ + EPA  W +ALP+GN RLGAM WGG+A E L LN
Sbjct  45   LQLWYREPANEWVEALPVGNGRLGAMAWGGIAHERLQLN  83



>ref|WP_043929950.1| alpha/beta hydrolase, partial [Xanthomonas citri]
Length=455

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +3

Query  456  LEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            L++ + EPA  W +ALP+GN RLGAMVWGG+A E L LN
Sbjct  27   LQLWYREPANEWVEALPVGNGRLGAMVWGGIAHERLQLN  65



>ref|WP_026064487.1| alpha/beta hydrolase [Xanthomonas arboricola]
Length=793

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 23/39 (59%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +3

Query  456  LEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            +++ + EPA  W  ALP+GN RLGAMVWGG+A E L LN
Sbjct  48   MQLWYREPANEWVQALPVGNGRLGAMVWGGIAHERLQLN  86



>gb|AEL06885.1| expressed protein [Xanthomonas campestris pv. raphani 756C]
Length=764

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +3

Query  456  LEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            L + + EPA  W  ALP+GN RLGAMVWGG+A E L LN
Sbjct  19   LHLWYREPANEWVQALPVGNGRLGAMVWGGIAHERLQLN  57



>ref|WP_022972906.1| alpha/beta hydrolase [Xanthomonas sp. M97]
Length=790

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 23/39 (59%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +3

Query  456  LEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            L++ + +PA  W  ALP+GN RLGAMVWGG+A E L LN
Sbjct  45   LQLWYRQPANEWVQALPVGNGRLGAMVWGGIAHERLQLN  83



>ref|WP_029561340.1| alpha/beta hydrolase [Xanthomonas oryzae]
Length=765

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 23/39 (59%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +3

Query  456  LEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            L++ + +PA  W +ALP+GN RLGAMVWGG+A E L LN
Sbjct  45   LQLWYPQPANEWVEALPVGNGRLGAMVWGGIAHERLQLN  83



>gb|EMI55725.1| hypothetical protein RSSM_02846 [Rhodopirellula sallentina SM41]
Length=817

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +3

Query  450  KPLEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            KPL++  ++PA  W++ALPIGN RLGAMV+GGV  E L LN
Sbjct  44   KPLQLWCSQPAGQWSEALPIGNGRLGAMVFGGVDQEHLQLN  84



>ref|WP_044302454.1| large secreted protein [Rhodopirellula sallentina]
Length=789

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +3

Query  450  KPLEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            KPL++  ++PA  W++ALPIGN RLGAMV+GGV  E L LN
Sbjct  16   KPLQLWCSQPAGQWSEALPIGNGRLGAMVFGGVDQEHLQLN  56



>ref|WP_028537475.1| alpha-L-fucosidase [Paenibacillus sp. J14]
Length=817

 Score = 55.5 bits (132),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 22/37 (59%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +3

Query  462  IRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            ++++ PA +WT+ALPIGN RLGAM++GGV  ET++LN
Sbjct  7    LQYDRPAAVWTEALPIGNGRLGAMIYGGVERETISLN  43



>ref|WP_016313812.1| alpha-L-fucosidase 2 [Paenibacillus barengoltzii]
 gb|EOS54629.1| alpha-L-fucosidase 2 [Paenibacillus barengoltzii G22]
Length=817

 Score = 55.5 bits (132),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 22/37 (59%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +3

Query  462  IRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            ++++ PA +WT+ALPIGN RLGAM++GGV  ET++LN
Sbjct  7    LQYDRPAAVWTEALPIGNGRLGAMIYGGVERETISLN  43



>ref|WP_019004616.1| hypothetical protein [Cohnella laeviribosi]
Length=796

 Score = 55.1 bits (131),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 23/39 (59%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +3

Query  456  LEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            ++++++ PA+ WT+ALPIGN RLGAMV+GGV +E L LN
Sbjct  1    MKLQYDAPARAWTEALPIGNGRLGAMVFGGVETERLQLN  39



>ref|WP_022336397.1| hypothetical protein [Firmicutes bacterium CAG:94]
 emb|CDD29370.1| putative uncharacterized protein [Firmicutes bacterium CAG:94]
Length=782

 Score = 55.1 bits (131),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 23/39 (59%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +3

Query  456  LEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            L++ + +PA  W +ALP+GN RLGAMVW GV  ETL+LN
Sbjct  2    LQLWYQKPATYWEEALPLGNGRLGAMVWSGVDHETLSLN  40



>ref|WP_013431879.1| alpha-L-fucosidase [Caldicellulosiruptor kristjanssonii]
 gb|ADQ40039.1| Alpha-L-fucosidase [Caldicellulosiruptor kristjanssonii I77R1B]
Length=752

 Score = 55.1 bits (131),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 23/39 (59%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +3

Query  456  LEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            L++ FN+PA+ W +ALPIGN  LGAM++GGV  ET+ LN
Sbjct  6    LKVIFNKPARCWEEALPIGNGSLGAMIYGGVKYETIQLN  44



>ref|WP_014043004.1| alpha-L-fucosidase [Caldicellulosiruptor lactoaceticus]
 gb|AEM74445.1| alpha-L-fucosidase [Caldicellulosiruptor lactoaceticus 6A]
Length=752

 Score = 55.1 bits (131),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 23/39 (59%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +3

Query  456  LEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            L++ FN+PA+ W +ALPIGN  LGAM++GGV  ET+ LN
Sbjct  6    LKVIFNKPARCWEEALPIGNGSLGAMIYGGVKYETIQLN  44



>ref|WP_044132542.1| alpha-L-fucosidase, partial [Bacteroides fragilis]
 gb|EXY31976.1| alpha-L-fucosidase domain protein, partial [Bacteroides fragilis 
str. 3397 T10]
Length=160

 Score = 52.8 bits (125),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +3

Query  456  LEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            L++ +++PA+ W++ALPIGN RLGAMV+GG+  E L LN
Sbjct  4    LKLWYSQPAQNWSEALPIGNSRLGAMVYGGIEREELQLN  42



>ref|WP_009223841.1| alpha-L-fucosidase [Paenibacillus sp. oral taxon 786]
 gb|EES74072.1| Alpha-L-fucosidase 2 family protein [Paenibacillus sp. oral taxon 
786 str. D14]
Length=817

 Score = 55.1 bits (131),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +3

Query  459  EIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            +++++ PA +WT+ALP+GN RLGAM++GGV  ET++LN
Sbjct  6    KLQYDRPATVWTEALPVGNGRLGAMIYGGVERETISLN  43



>ref|WP_022813850.1| alpha-fucosidase [Poribacteria bacterium WGA-3G]
Length=765

 Score = 55.1 bits (131),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +3

Query  468  FNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            +++PA+ WTDALP+GN RLGAMV+GGVA E + LN
Sbjct  11   YHKPAEAWTDALPVGNGRLGAMVFGGVARERIQLN  45



>ref|WP_010344637.1| alpha-amylase [Paenibacillus peoriae]
Length=826

 Score = 55.1 bits (131),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +3

Query  450  KPLEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            +PL + + +PA++W +ALP+GN RLGAMV+GG+  E L LN
Sbjct  8    QPLRLWYRQPAEVWEEALPVGNGRLGAMVFGGIREERLQLN  48



>ref|WP_011685626.1| hypothetical protein [Candidatus Solibacter usitatus]
 gb|ABJ84868.1| conserved hypothetical protein [Candidatus Solibacter usitatus 
Ellin6076]
Length=759

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 22/40 (55%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +3

Query  453  PLEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            PL + +  PA +WTDALP+GN R+GAMV+GG A E +  N
Sbjct  18   PLTLWYTHPADIWTDALPVGNGRMGAMVFGGAAHERIQFN  57



>ref|WP_013291122.1| alpha-L-fucosidase [Caldicellulosiruptor obsidiansis]
 gb|ADL43125.1| Alpha-L-fucosidase [Caldicellulosiruptor obsidiansis OB47]
Length=753

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +3

Query  456  LEIRFNEPAKLWTDALPIGNXRLGAMVWGGVASETLNLN  572
            L+I FN PA  W +ALPIGN  LGAM++GGV  ET+ LN
Sbjct  6    LKILFNHPANCWEEALPIGNGSLGAMIYGGVEYETIQLN  44



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 669314531515