BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002C21

Length=543
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011072735.1|  PREDICTED: 60S ribosomal protein L7-4-like i...    258   5e-83   Sesamum indicum [beniseed]
ref|XP_011072736.1|  PREDICTED: 60S ribosomal protein L7-4-like i...    257   8e-83   Sesamum indicum [beniseed]
ref|XP_003632932.1|  PREDICTED: 60S ribosomal protein L7-2              256   1e-82   Vitis vinifera
ref|XP_010269530.1|  PREDICTED: 60S ribosomal protein L7-2              254   9e-82   Nelumbo nucifera [Indian lotus]
gb|EYU21221.1|  hypothetical protein MIMGU_mgv1a012680mg                251   2e-80   Erythranthe guttata [common monkey flower]
ref|XP_010276711.1|  PREDICTED: 60S ribosomal protein L7-2-like         251   2e-80   Nelumbo nucifera [Indian lotus]
ref|XP_006854234.1|  hypothetical protein AMTR_s00048p00227650          247   8e-79   Amborella trichopoda
ref|XP_009780830.1|  PREDICTED: 60S ribosomal protein L7-4-like         246   1e-78   Nicotiana sylvestris
emb|CDO97748.1|  unnamed protein product                                245   2e-78   Coffea canephora [robusta coffee]
emb|CDP14387.1|  unnamed protein product                                245   3e-78   Coffea canephora [robusta coffee]
ref|XP_009601427.1|  PREDICTED: 60S ribosomal protein L7-2-like         244   7e-78   Nicotiana tomentosiformis
ref|XP_011046524.1|  PREDICTED: 60S ribosomal protein L7-4              244   7e-78   Populus euphratica
ref|XP_006857736.1|  hypothetical protein AMTR_s00061p00187310          244   8e-78   Amborella trichopoda
ref|XP_004167340.1|  PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma...    244   9e-78   
ref|XP_002315382.1|  hypothetical protein POPTR_0010s25740g             244   1e-77   Populus trichocarpa [western balsam poplar]
ref|XP_010105399.1|  60S ribosomal protein L7-4                         245   1e-77   
ref|XP_004134063.1|  PREDICTED: 60S ribosomal protein L7-4-like         243   2e-77   Cucumis sativus [cucumbers]
ref|XP_004242791.1|  PREDICTED: 60S ribosomal protein L7-3              243   2e-77   
ref|XP_010040054.1|  PREDICTED: 60S ribosomal protein L7-2              242   4e-77   Eucalyptus grandis [rose gum]
ref|XP_009610771.1|  PREDICTED: 60S ribosomal protein L7-4              242   6e-77   Nicotiana tomentosiformis
ref|XP_010034075.1|  PREDICTED: 60S ribosomal protein L7-2-like         241   7e-77   Eucalyptus grandis [rose gum]
gb|ABB16984.1|  thaliana 60S ribosomal protein L7 (At2g44120)           241   8e-77   Solanum tuberosum [potatoes]
gb|KCW53961.1|  hypothetical protein EUGRSUZ_J031651                    241   9e-77   Eucalyptus grandis [rose gum]
ref|XP_006342481.1|  PREDICTED: 60S ribosomal protein L7-4-like         241   1e-76   Solanum tuberosum [potatoes]
ref|XP_008438517.1|  PREDICTED: 60S ribosomal protein L7-4-like         241   2e-76   Cucumis melo [Oriental melon]
ref|XP_002308103.1|  hypothetical protein POPTR_0006s07290g             241   2e-76   
ref|XP_002262697.1|  PREDICTED: 60S ribosomal protein L7-2              240   3e-76   Vitis vinifera
ref|XP_009610447.1|  PREDICTED: 60S ribosomal protein L7-2-like         240   3e-76   Nicotiana tomentosiformis
ref|XP_006596959.1|  PREDICTED: uncharacterized protein LOC100500...    241   3e-76   
ref|XP_010099900.1|  60S ribosomal protein L7-4                         240   3e-76   Morus notabilis
ref|XP_009788725.1|  PREDICTED: 60S ribosomal protein L7-2-like         240   3e-76   Nicotiana sylvestris
ref|XP_008460307.1|  PREDICTED: 60S ribosomal protein L7-4-like i...    238   3e-76   Cucumis melo [Oriental melon]
gb|KHN24635.1|  60S ribosomal protein L7-4                              241   4e-76   Glycine soja [wild soybean]
ref|XP_004246043.1|  PREDICTED: 60S ribosomal protein L7-3              240   4e-76   Solanum lycopersicum
ref|XP_006359941.1|  PREDICTED: 60S ribosomal protein L7-3-like         240   4e-76   Solanum tuberosum [potatoes]
ref|XP_010063653.1|  PREDICTED: 60S ribosomal protein L7-4              239   5e-76   Eucalyptus grandis [rose gum]
ref|NP_001276141.1|  60S ribosomal protein L7-4-like                    238   5e-76   
ref|XP_011033034.1|  PREDICTED: 60S ribosomal protein L7-4-like         239   6e-76   Populus euphratica
gb|ABK95515.1|  unknown                                                 239   7e-76   Populus trichocarpa [western balsam poplar]
ref|XP_002310943.1|  60S ribosomal protein L7-2                         239   8e-76   Populus trichocarpa [western balsam poplar]
gb|KCW45520.1|  hypothetical protein EUGRSUZ_L00752                     241   8e-76   Eucalyptus grandis [rose gum]
ref|XP_010040056.1|  PREDICTED: 60S ribosomal protein L7-2-like         239   8e-76   Eucalyptus grandis [rose gum]
gb|KCW70888.1|  hypothetical protein EUGRSUZ_F04018                     241   1e-75   Eucalyptus grandis [rose gum]
ref|XP_010104963.1|  60S ribosomal protein L7-2                         239   1e-75   Morus notabilis
ref|XP_009782941.1|  PREDICTED: 60S ribosomal protein L7-4              238   1e-75   Nicotiana sylvestris
ref|XP_007223754.1|  hypothetical protein PRUPE_ppa010542mg             238   2e-75   Prunus persica
emb|CBI17892.3|  unnamed protein product                                240   2e-75   Vitis vinifera
gb|KDO61963.1|  hypothetical protein CISIN_1g026136mg                   237   6e-75   Citrus sinensis [apfelsine]
ref|XP_004507013.1|  PREDICTED: 60S ribosomal protein L7-4-like i...    236   7e-75   Cicer arietinum [garbanzo]
gb|ACV83305.2|  hypothetical protein UP-4                               236   9e-75   Dimocarpus longan [longan]
gb|KHG17811.1|  60S ribosomal L7-4 -like protein                        236   9e-75   Gossypium arboreum [tree cotton]
gb|KDP35522.1|  hypothetical protein JCGZ_08960                         236   1e-74   Jatropha curcas
ref|XP_002517516.1|  60S ribosomal protein L7, putative                 236   1e-74   Ricinus communis
ref|XP_007015363.1|  Ribosomal protein L30/L7 family protein isof...    236   1e-74   Theobroma cacao [chocolate]
ref|NP_187967.1|  60S ribosomal protein L7-4                            236   1e-74   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004144427.1|  PREDICTED: 60S ribosomal protein L7-4-like i...    236   1e-74   Cucumis sativus [cucumbers]
ref|XP_004488017.1|  PREDICTED: 60S ribosomal protein L7-4-like         236   1e-74   Cicer arietinum [garbanzo]
ref|XP_006582827.1|  PREDICTED: uncharacterized protein LOC100305...    236   1e-74   Glycine max [soybeans]
gb|AFK47136.1|  unknown                                                 236   2e-74   Lotus japonicus
ref|XP_006585662.1|  PREDICTED: 60S ribosomal protein L7-4-like         236   2e-74   
ref|XP_008460306.1|  PREDICTED: 60S ribosomal protein L7-2-like i...    235   2e-74   Cucumis melo [Oriental melon]
gb|AGV54399.1|  60S ribosomal protein L7-4-like protein                 235   2e-74   Phaseolus vulgaris [French bean]
ref|XP_002263512.2|  PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma...    235   2e-74   
ref|XP_006582828.1|  PREDICTED: uncharacterized protein LOC100305...    235   2e-74   
ref|XP_010678597.1|  PREDICTED: 60S ribosomal protein L7-2              235   2e-74   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007023816.1|  Ribosomal protein L30/L7 family protein            235   2e-74   Theobroma cacao [chocolate]
ref|XP_006453224.1|  hypothetical protein CICLE_v10009162mg             235   2e-74   
gb|AFK37004.1|  unknown                                                 235   3e-74   Lotus japonicus
ref|XP_002882831.1|  hypothetical protein ARALYDRAFT_478749             235   3e-74   
gb|KJB35653.1|  hypothetical protein B456_006G122600                    235   3e-74   Gossypium raimondii
ref|XP_010465202.1|  PREDICTED: 60S ribosomal protein L7-4              235   3e-74   Camelina sativa [gold-of-pleasure]
gb|KJB35652.1|  hypothetical protein B456_006G122600                    234   4e-74   Gossypium raimondii
gb|EPS63412.1|  hypothetical protein M569_11371                         235   4e-74   Genlisea aurea
ref|XP_010534880.1|  PREDICTED: 60S ribosomal protein L7-2              234   4e-74   Tarenaya hassleriana [spider flower]
ref|NP_001235225.1|  uncharacterized protein LOC100305682               234   6e-74   
ref|XP_006427756.1|  hypothetical protein CICLE_v10026360mg             234   6e-74   Citrus clementina [clementine]
gb|KJB83614.1|  hypothetical protein B456_013G255000                    234   7e-74   Gossypium raimondii
ref|NP_001235578.1|  uncharacterized protein LOC100500011               234   8e-74   
ref|XP_008799461.1|  PREDICTED: 60S ribosomal protein L7-4-like         234   8e-74   Phoenix dactylifera
ref|XP_007142128.1|  hypothetical protein PHAVU_008G255000g             234   8e-74   Phaseolus vulgaris [French bean]
ref|XP_009382840.1|  PREDICTED: 60S ribosomal protein L7-2-like         234   9e-74   Musa acuminata subsp. malaccensis [pisang utan]
gb|KEH40165.1|  60S ribosomal protein L7                                235   9e-74   Medicago truncatula
ref|XP_007015365.1|  Ribosomal protein L30/L7 family protein isof...    235   1e-73   
ref|XP_010543980.1|  PREDICTED: 60S ribosomal protein L7-2-like         233   1e-73   Tarenaya hassleriana [spider flower]
gb|KHG30088.1|  60S ribosomal L7-4 -like protein                        233   1e-73   Gossypium arboreum [tree cotton]
ref|XP_004144426.1|  PREDICTED: 60S ribosomal protein L7-4-like i...    236   1e-73   
ref|XP_008227948.1|  PREDICTED: 60S ribosomal protein L7-2              233   1e-73   Prunus mume [ume]
ref|XP_009420403.1|  PREDICTED: 60S ribosomal protein L7-2              233   1e-73   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006407195.1|  hypothetical protein EUTSA_v10021411mg             233   1e-73   Eutrema salsugineum [saltwater cress]
ref|XP_004488015.1|  PREDICTED: 60S ribosomal protein L7-4-like         233   1e-73   Cicer arietinum [garbanzo]
ref|XP_009348620.1|  PREDICTED: 60S ribosomal protein L7-2-like         233   2e-73   Pyrus x bretschneideri [bai li]
ref|XP_002524137.1|  60S ribosomal protein L7, putative                 233   2e-73   Ricinus communis
gb|KJB35651.1|  hypothetical protein B456_006G122600                    234   2e-73   Gossypium raimondii
ref|XP_004168560.1|  PREDICTED: 60S ribosomal protein L7-4-like i...    233   2e-73   
gb|KJB09280.1|  hypothetical protein B456_001G132600                    233   2e-73   Gossypium raimondii
ref|XP_009359955.1|  PREDICTED: 60S ribosomal protein L7-2-like         233   2e-73   Pyrus x bretschneideri [bai li]
ref|XP_010692954.1|  PREDICTED: 60S ribosomal protein L7-2-like         233   2e-73   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007217754.1|  hypothetical protein PRUPE_ppa010610mg             233   3e-73   Prunus persica
ref|XP_007138756.1|  hypothetical protein PHAVU_009G234700g             232   3e-73   Phaseolus vulgaris [French bean]
ref|XP_006586618.1|  PREDICTED: uncharacterized protein LOC100306...    232   3e-73   
ref|XP_010542455.1|  PREDICTED: 60S ribosomal protein L7-2-like         232   3e-73   Tarenaya hassleriana [spider flower]
ref|NP_001077863.1|  60S ribosomal protein L7-2                         230   4e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004168559.1|  PREDICTED: 60S ribosomal protein L7-4-like i...    233   4e-73   
gb|ACJ84111.1|  unknown                                                 232   5e-73   Medicago truncatula
gb|KHG06940.1|  60S ribosomal L7-4 -like protein                        231   6e-73   Gossypium arboreum [tree cotton]
ref|XP_003595099.1|  60S ribosomal protein L7-4                         231   6e-73   Medicago truncatula
ref|XP_009395464.1|  PREDICTED: 60S ribosomal protein L7-2-like         231   1e-72   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008462217.1|  PREDICTED: 60S ribosomal protein L7-4              231   1e-72   Cucumis melo [Oriental melon]
gb|ACJ84153.1|  unknown                                                 230   2e-72   Medicago truncatula
ref|XP_008342419.1|  PREDICTED: 60S ribosomal protein L7-2              230   2e-72   
gb|KHG19979.1|  60S ribosomal L7-4 -like protein                        236   2e-72   Gossypium arboreum [tree cotton]
gb|KDP40134.1|  hypothetical protein JCGZ_02132                         230   2e-72   Jatropha curcas
gb|AFK45232.1|  unknown                                                 230   2e-72   Medicago truncatula
gb|AFK34881.1|  unknown                                                 230   2e-72   Medicago truncatula
gb|KEH28610.1|  60S ribosomal protein L7                                230   2e-72   Medicago truncatula
ref|XP_009396236.1|  PREDICTED: 60S ribosomal protein L7-2-like         230   3e-72   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008781795.1|  PREDICTED: 60S ribosomal protein L7-2-like         229   4e-72   Phoenix dactylifera
gb|EYU38737.1|  hypothetical protein MIMGU_mgv1a012615mg                229   4e-72   Erythranthe guttata [common monkey flower]
gb|ACN40686.1|  unknown                                                 229   6e-72   Picea sitchensis
gb|ABK26757.1|  unknown                                                 229   7e-72   Picea sitchensis
ref|XP_009333969.1|  PREDICTED: 60S ribosomal protein L7-2              229   8e-72   Pyrus x bretschneideri [bai li]
ref|XP_004141745.1|  PREDICTED: 60S ribosomal protein L7-4-like         229   8e-72   
ref|XP_010520183.1|  PREDICTED: 60S ribosomal protein L7-2-like         228   1e-71   Tarenaya hassleriana [spider flower]
gb|KDP23476.1|  hypothetical protein JCGZ_23309                         228   1e-71   Jatropha curcas
ref|XP_009345996.1|  PREDICTED: 60S ribosomal protein L7-2-like         228   1e-71   Pyrus x bretschneideri [bai li]
ref|XP_010424860.1|  PREDICTED: 60S ribosomal protein L7-2              228   1e-71   Camelina sativa [gold-of-pleasure]
gb|ABK22465.1|  unknown                                                 228   3e-71   Picea sitchensis
ref|NP_178234.1|  60S ribosomal protein L7-2                            227   3e-71   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002876738.1|  60S ribosomal protein L7                           227   4e-71   Arabidopsis lyrata subsp. lyrata
ref|XP_009340520.1|  PREDICTED: 60S ribosomal protein L7-2-like         227   5e-71   Pyrus x bretschneideri [bai li]
ref|XP_008789605.1|  PREDICTED: 60S ribosomal protein L7-2              227   5e-71   Phoenix dactylifera
ref|XP_002862275.1|  60S ribosomal protein L7                           226   5e-71   
gb|KCW45526.1|  hypothetical protein EUGRSUZ_L00756                     226   6e-71   Eucalyptus grandis [rose gum]
emb|CDY30456.1|  BnaA04g25570D                                          227   7e-71   Brassica napus [oilseed rape]
ref|XP_004303828.1|  PREDICTED: 60S ribosomal protein L7-2              226   1e-70   Fragaria vesca subsp. vesca
ref|XP_002880084.1|  60S ribosomal protein L7                           226   1e-70   
ref|NP_850411.1|  60S ribosomal protein L7-3                            226   1e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009101359.1|  PREDICTED: 60S ribosomal protein L7-2-like         226   1e-70   Brassica rapa
ref|NP_850410.1|  60S ribosomal protein L7-3                            225   2e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009133658.1|  PREDICTED: 60S ribosomal protein L7-3-like         225   2e-70   
gb|AAO00739.1|  Unknown protein                                         225   2e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009142247.1|  PREDICTED: 60S ribosomal protein L7-3-like         225   2e-70   Brassica rapa
emb|CDY17686.1|  BnaA06g35050D                                          224   3e-70   Brassica napus [oilseed rape]
ref|XP_009107124.1|  PREDICTED: 60S ribosomal protein L7-2              224   5e-70   Brassica rapa
emb|CDY41074.1|  BnaA09g18530D                                          224   6e-70   Brassica napus [oilseed rape]
emb|CDY25941.1|  BnaC09g20460D                                          224   6e-70   Brassica napus [oilseed rape]
ref|XP_006397587.1|  hypothetical protein EUTSA_v10001606mg             224   7e-70   Eutrema salsugineum [saltwater cress]
ref|XP_009114246.1|  PREDICTED: 60S ribosomal protein L7-2-like         224   8e-70   Brassica rapa
gb|ABK23069.1|  unknown                                                 223   9e-70   Picea sitchensis
emb|CDY37358.1|  BnaC02g33760D                                          223   1e-69   Brassica napus [oilseed rape]
emb|CDY23419.1|  BnaC04g49470D                                          224   2e-69   Brassica napus [oilseed rape]
ref|XP_011094120.1|  PREDICTED: 60S ribosomal protein L7-2-like         222   4e-69   Sesamum indicum [beniseed]
ref|XP_004972521.1|  PREDICTED: 60S ribosomal protein L7-4-like         222   5e-69   Setaria italica
ref|XP_006465164.1|  PREDICTED: 60S ribosomal protein L7-4-like         221   6e-69   Citrus sinensis [apfelsine]
ref|NP_001130274.1|  uncharacterized protein LOC100191368               221   8e-69   Zea mays [maize]
ref|XP_004952153.1|  PREDICTED: 60S ribosomal protein L7-4-like i...    221   1e-68   Setaria italica
ref|XP_006398510.1|  hypothetical protein EUTSA_v10001008mg             221   1e-68   Eutrema salsugineum [saltwater cress]
ref|XP_011020071.1|  PREDICTED: 60S ribosomal protein L7-3-like         220   2e-68   Populus euphratica
gb|ACR37625.1|  unknown                                                 218   2e-68   Zea mays [maize]
ref|XP_011077741.1|  PREDICTED: 60S ribosomal protein L7-2-like         219   4e-68   Sesamum indicum [beniseed]
ref|XP_003564261.1|  PREDICTED: 60S ribosomal protein L7-2-like         219   5e-68   Brachypodium distachyon [annual false brome]
tpg|DAA36126.1|  TPA: hypothetical protein ZEAMMB73_294867              220   5e-68   
ref|XP_006453223.1|  hypothetical protein CICLE_v10009162mg             219   7e-68   
ref|XP_002324681.1|  hypothetical protein POPTR_0018s13700g             220   8e-68   Populus trichocarpa [western balsam poplar]
ref|NP_001148262.1|  60S ribosomal protein L7-2                         218   9e-68   Zea mays [maize]
ref|XP_011017700.1|  PREDICTED: 60S ribosomal protein L7-2-like         218   1e-67   Populus euphratica
emb|CDX83440.1|  BnaA03g20660D                                          217   2e-67   
dbj|BAJ88948.1|  predicted protein                                      217   2e-67   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AFW57062.1|  hypothetical protein ZEAMMB73_288685                    216   2e-67   
ref|XP_006853664.1|  hypothetical protein AMTR_s00056p00107780          218   4e-67   
ref|XP_002975494.1|  hypothetical protein SELMODRAFT_103994             216   5e-67   
ref|NP_001148714.1|  60S ribosomal protein L7-1                         216   5e-67   Zea mays [maize]
gb|EPS59863.1|  hypothetical protein M569_14942                         213   6e-67   Genlisea aurea
gb|EMS66993.1|  60S ribosomal protein L7-4                              219   9e-67   Triticum urartu
dbj|BAK00792.1|  predicted protein                                      216   1e-66   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_001753162.1|  predicted protein                                  215   1e-66   
ref|XP_001773467.1|  predicted protein                                  214   3e-66   
ref|NP_001148360.1|  60S ribosomal protein L7-1                         214   3e-66   Zea mays [maize]
ref|XP_002978735.1|  hypothetical protein SELMODRAFT_109549             214   4e-66   
gb|EMS55671.1|  60S ribosomal protein L7-2                              213   1e-65   Triticum urartu
gb|EMT21799.1|  60S ribosomal protein L7-2                              212   3e-65   
ref|XP_010928704.1|  PREDICTED: 60S ribosomal protein L7-2-like         212   4e-65   Elaeis guineensis
ref|XP_009796889.1|  PREDICTED: 60S ribosomal protein L7-4-like         211   6e-65   Nicotiana sylvestris
pdb|3J61|F  Chain F, Localization Of The Large Subunit Ribosomal ...    211   7e-65   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004976724.1|  PREDICTED: 60S ribosomal protein L7-3-like i...    209   5e-64   Setaria italica
ref|XP_003580434.1|  PREDICTED: 60S ribosomal protein L7-2-like         209   5e-64   Brachypodium distachyon [annual false brome]
ref|XP_006652781.1|  PREDICTED: 60S ribosomal protein L7-3-like         209   6e-64   Oryza brachyantha
ref|XP_010913723.1|  PREDICTED: 60S ribosomal protein L7-2              208   7e-64   Elaeis guineensis
ref|XP_006387691.1|  hypothetical protein POPTR_0672s00220g             204   9e-64   
ref|XP_006652782.1|  PREDICTED: 60S ribosomal protein L7-3-like         207   1e-63   Oryza brachyantha
ref|NP_001053797.1|  Os04g0605900                                       207   2e-63   
ref|XP_009784717.1|  PREDICTED: 60S ribosomal protein L7-4-like         208   2e-63   Nicotiana sylvestris
ref|XP_006652780.1|  PREDICTED: 60S ribosomal protein L7-3-like         207   2e-63   Oryza brachyantha
ref|NP_001061310.1|  Os08g0234000                                       207   2e-63   
emb|CAE02124.2|  OSJNBa0035M09.3                                        207   3e-63   Oryza sativa Japonica Group [Japonica rice]
gb|EPS65773.1|  hypothetical protein M569_09004                         203   5e-63   Genlisea aurea
gb|EAZ41966.1|  hypothetical protein OsJ_26511                          207   6e-63   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009142992.1|  PREDICTED: 60S ribosomal protein L7-3              205   2e-62   Brassica rapa
ref|XP_001752042.1|  predicted protein                                  204   6e-62   
ref|XP_001778687.1|  predicted protein                                  203   6e-62   
ref|XP_010927261.1|  PREDICTED: 60S ribosomal protein L7-4 isofor...    203   7e-62   Elaeis guineensis
ref|XP_001757460.1|  predicted protein                                  202   2e-61   
ref|XP_010927260.1|  PREDICTED: 60S ribosomal protein L7-4 isofor...    203   3e-61   
tpg|DAA46492.1|  TPA: hypothetical protein ZEAMMB73_274894              201   5e-61   
ref|XP_002448479.1|  hypothetical protein SORBIDRAFT_06g027740          200   1e-60   
emb|CBI18484.3|  unnamed protein product                                197   2e-60   Vitis vinifera
ref|XP_005643653.1|  60S ribosomal protein L7                           196   6e-59   Coccomyxa subellipsoidea C-169
ref|XP_008658767.1|  PREDICTED: 60S ribosomal protein L7-3-like         196   8e-59   
gb|KJB35649.1|  hypothetical protein B456_006G122500                    194   9e-58   Gossypium raimondii
emb|CBI18496.3|  unnamed protein product                                190   2e-57   Vitis vinifera
gb|EMT07499.1|  60S ribosomal protein L7-2                              192   8e-57   
gb|AFW59366.1|  hypothetical protein ZEAMMB73_437813                    186   3e-56   
ref|NP_001235500.1|  uncharacterized protein LOC100306213               188   3e-56   
gb|EYU18200.1|  hypothetical protein MIMGU_mgv1a026225mg                185   9e-55   Erythranthe guttata [common monkey flower]
ref|XP_011396691.1|  60S ribosomal protein L7-2                         183   5e-54   Auxenochlorella protothecoides
ref|XP_007509794.1|  60S ribosomal protein L7                           182   4e-53   Bathycoccus prasinos
ref|XP_001416891.1|  Ribosomal protein L7, component of cytosolic...    181   5e-53   Ostreococcus lucimarinus CCE9901
emb|CBI18494.3|  unnamed protein product                                176   6e-53   Vitis vinifera
emb|CEF97056.1|  Ribosomal protein L30, ferredoxin-like fold domain     177   8e-52   Ostreococcus tauri
ref|XP_005843719.1|  hypothetical protein CHLNCDRAFT_49213              177   8e-52   Chlorella variabilis
ref|XP_002489001.1|  hypothetical protein SORBIDRAFT_0541s002010        175   1e-51   
gb|KDD75837.1|  hypothetical protein H632_c477p1                        177   1e-51   Helicosporidium sp. ATCC 50920
emb|CDP13837.1|  unnamed protein product                                172   3e-51   Coffea canephora [robusta coffee]
emb|CBI18486.3|  unnamed protein product                                172   2e-50   Vitis vinifera
ref|XP_001753880.1|  predicted protein                                  173   3e-50   
ref|XP_003056478.1|  predicted protein                                  173   4e-50   Micromonas pusilla CCMP1545
ref|XP_002500935.1|  predicted protein                                  172   1e-49   Micromonas commoda
ref|XP_002452034.1|  hypothetical protein SORBIDRAFT_04g017103          165   1e-48   
ref|XP_006841172.1|  hypothetical protein AMTR_s00086p00164400          168   3e-48   
ref|XP_002447060.1|  hypothetical protein SORBIDRAFT_06g027780          166   4e-48   
ref|XP_005763901.1|  hypothetical protein EMIHUDRAFT_446099             167   5e-48   Emiliania huxleyi CCMP1516
gb|KIZ06280.1|  60S ribosomal protein L7-3                              167   6e-48   Monoraphidium neglectum
gb|KIZ06126.1|  60S ribosomal protein L7-3                              167   6e-48   Monoraphidium neglectum
ref|XP_010506874.1|  PREDICTED: 60S ribosomal protein L7-2-like         167   6e-48   
gb|ABW90388.1|  putative ribosomal protein L7                           162   1e-45   Barentsia elongata
gb|AIY85430.1|  60S ribosomal protein L7                                157   7e-45   Elaeagnus umbellata [aki-gumi]
gb|ABW23162.1|  ribosomal protein rpl7                                  159   9e-45   Arenicola marina [rock worm]
ref|XP_003078067.1|  putative 60S ribosomal protein L7 (ISS)            160   1e-44   
ref|XP_005510285.1|  PREDICTED: 60S ribosomal protein L7 isoform X1     158   2e-44   Columba livia [carrier pigeon]
dbj|BAF98652.1|  Ribosomal protein L7                                   158   3e-44   Solea senegalensis
ref|XP_009270925.1|  PREDICTED: 60S ribosomal protein L7                158   3e-44   Aptenodytes forsteri
ref|XP_002950779.1|  component of cytosolic 80S ribosome and 60S ...    157   4e-44   Volvox carteri f. nagariensis
ref|XP_010184556.1|  PREDICTED: 60S ribosomal protein L7                157   5e-44   Mesitornis unicolor
ref|XP_005150859.1|  PREDICTED: 60S ribosomal protein L7                157   7e-44   Melopsittacus undulatus
ref|XP_009467280.1|  PREDICTED: 60S ribosomal protein L7                157   9e-44   Nipponia nippon
ref|XP_010574186.1|  PREDICTED: 60S ribosomal protein L7                157   9e-44   Haliaeetus leucocephalus
ref|XP_010155588.1|  PREDICTED: 60S ribosomal protein L7                156   1e-43   Eurypyga helias
ref|XP_009084291.1|  PREDICTED: 60S ribosomal protein L7                156   1e-43   Serinus canaria [canary]
ref|XP_002587985.1|  hypothetical protein BRAFLDRAFT_125387             156   1e-43   Branchiostoma floridae
ref|XP_005042240.1|  PREDICTED: 60S ribosomal protein L7                156   2e-43   Ficedula albicollis
ref|XP_005517151.1|  PREDICTED: 60S ribosomal protein L7                156   2e-43   Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_005479426.1|  PREDICTED: 60S ribosomal protein L7                156   2e-43   Zonotrichia albicollis
gb|AIU94828.1|  60S ribosomal protein                                   155   2e-43   Phragmatopoma lapidosa
emb|CAJ17239.1|  ribosomal protein L7e                                  156   2e-43   Scarabaeus laticollis
ref|XP_009905910.1|  PREDICTED: 60S ribosomal protein L7                155   2e-43   Picoides pubescens
ref|XP_004365489.2|  ribosomal protein L7                               155   3e-43   Capsaspora owczarzaki ATCC 30864
ref|XP_009017047.1|  hypothetical protein HELRODRAFT_186995             155   3e-43   Helobdella robusta
ref|XP_007554668.1|  PREDICTED: 60S ribosomal protein L7                155   3e-43   Poecilia formosa
gb|AAX48837.1|  L7                                                      155   4e-43   Suberites domuncula
ref|XP_001692973.1|  ribosomal protein L7, component of cytosolic...    155   4e-43   Chlamydomonas reinhardtii
ref|NP_001153209.1|  ribosomal protein L7                               155   6e-43   Taeniopygia guttata
ref|XP_005797927.1|  PREDICTED: 60S ribosomal protein L7-like           155   6e-43   Xiphophorus maculatus
ref|XP_002198597.2|  PREDICTED: 60S ribosomal protein L7-like           152   7e-43   Taeniopygia guttata
ref|XP_011450773.1|  PREDICTED: 60S ribosomal protein L7-like           154   9e-43   Crassostrea gigas
emb|CAD89885.1|  ribosomal protein L7                                   154   9e-43   Crassostrea gigas
ref|XP_004546673.1|  PREDICTED: 60S ribosomal protein L7-like           154   9e-43   Maylandia zebra
ref|XP_003219624.2|  PREDICTED: 60S ribosomal protein L7                154   9e-43   Anolis carolinensis [Carolina anole]
ref|XP_008930465.1|  PREDICTED: 60S ribosomal protein L7                157   1e-42   
ref|NP_001098340.1|  60S ribosomal protein L7                           154   1e-42   Oryzias latipes [Japanese rice fish]
ref|NP_001284397.1|  ribosomal protein L7                               154   1e-42   Poecilia reticulata
gb|AAN05591.1|  ribosomal protein L7                                    154   1e-42   Argopecten irradians
ref|XP_008490543.1|  PREDICTED: 60S ribosomal protein L7                154   2e-42   Calypte anna
ref|XP_008163523.1|  PREDICTED: 60S ribosomal protein L7                154   2e-42   Chrysemys picta bellii
gb|ACO09163.1|  60S ribosomal protein L7                                153   2e-42   Osmerus mordax
gb|AAN73358.1|  ribosomal protein L7                                    153   2e-42   Branchiostoma lanceolatum [common lancelet]
ref|XP_009875617.1|  PREDICTED: 60S ribosomal protein L7                153   3e-42   Apaloderma vittatum
ref|XP_010132080.1|  PREDICTED: 60S ribosomal protein L7                153   3e-42   Buceros rhinoceros silvestris
ref|XP_002430313.1|  60S ribosomal protein L7, putative                 154   3e-42   Pediculus humanus corporis [human body lice]
emb|CAF98023.1|  unnamed protein product                                153   3e-42   Tetraodon nigroviridis
ref|XP_008305835.1|  PREDICTED: 60S ribosomal protein L7                153   3e-42   
ref|XP_005423111.1|  PREDICTED: 60S ribosomal protein L7                153   3e-42   
ref|XP_001628718.1|  predicted protein                                  152   3e-42   
gb|KFP92686.1|  60S ribosomal protein L7                                152   3e-42   
gb|KFQ31663.1|  60S ribosomal protein L7                                152   3e-42   
gb|EMC82125.1|  60S ribosomal protein L7                                152   3e-42   
ref|XP_007424874.1|  PREDICTED: 60S ribosomal protein L7                153   3e-42   
ref|XP_003443517.1|  PREDICTED: 60S ribosomal protein L7-like           152   3e-42   
ref|XP_008940617.1|  PREDICTED: 60S ribosomal protein L7                153   4e-42   
ref|NP_001005020.1|  ribosomal protein L7                               152   4e-42   
ref|XP_010282318.1|  PREDICTED: 60S ribosomal protein L7                152   4e-42   
gb|AFK10604.1|  Ribosomal protein L7                                    152   4e-42   
gb|KGL98827.1|  60S ribosomal protein L7                                152   4e-42   
ref|NP_001090097.1|  ribosomal protein L7                               152   4e-42   
gb|KFM03097.1|  60S ribosomal protein L7                                152   4e-42   
gb|KFQ72256.1|  60S ribosomal protein L7                                152   4e-42   
ref|XP_008394601.1|  PREDICTED: 60S ribosomal protein L7 isoform X1     152   5e-42   
ref|NP_001290567.1|  ribosomal protein L7                               152   5e-42   
gb|AFM88250.1|  Ribosomal protein L7                                    152   5e-42   
gb|KFZ69061.1|  60S ribosomal protein L7                                152   5e-42   
gb|EHJ65173.1|  ribosomal protein L7                                    152   5e-42   
gb|KFW88054.1|  60S ribosomal protein L7                                152   6e-42   
gb|AFM89985.1|  Ribosomal protein L7                                    152   7e-42   
dbj|BAN20450.1|  ribosomal protein L7                                   152   7e-42   
ref|XP_010301097.1|  PREDICTED: 60S ribosomal protein L7                152   7e-42   
gb|AFM87934.1|  Ribosomal protein L7                                    152   8e-42   
gb|KFV09213.1|  60S ribosomal protein L7                                151   8e-42   
ref|XP_010074525.1|  PREDICTED: 60S ribosomal protein L7                151   8e-42   
gb|KFQ37450.1|  60S ribosomal protein L7                                151   9e-42   
gb|KFO04976.1|  60S ribosomal protein L7                                151   9e-42   
gb|AFM88142.1|  Ribosomal protein L7                                    152   9e-42   
gb|KFP67869.1|  60S ribosomal protein L7                                151   9e-42   
gb|KFV42846.1|  60S ribosomal protein L7                                151   9e-42   
ref|XP_009890266.1|  PREDICTED: 60S ribosomal protein L7                152   9e-42   
gb|AFM85640.1|  Ribosomal protein L7                                    151   9e-42   
ref|XP_009938843.1|  PREDICTED: 60S ribosomal protein L7                151   1e-41   
ref|NP_001006345.1|  60S ribosomal protein L7                           151   1e-41   
gb|KFR15405.1|  60S ribosomal protein L7                                151   1e-41   
ref|XP_009810322.1|  PREDICTED: 60S ribosomal protein L7                151   1e-41   
gb|KFP29668.1|  60S ribosomal protein L7                                151   1e-41   
gb|KFP97103.1|  60S ribosomal protein L7                                151   1e-41   
gb|KFO99703.1|  60S ribosomal protein L7                                151   1e-41   
gb|KFP12367.1|  60S ribosomal protein L7                                151   1e-41   
gb|KFO57334.1|  60S ribosomal protein L7                                151   1e-41   
ref|XP_009945886.1|  PREDICTED: 60S ribosomal protein L7                151   1e-41   
ref|XP_005229960.1|  PREDICTED: 60S ribosomal protein L7                153   1e-41   
ref|XP_003902914.1|  PREDICTED: 60S ribosomal protein L7 isoform X2     151   1e-41   
emb|CDQ94004.1|  unnamed protein product                                151   1e-41   
ref|XP_010170417.1|  PREDICTED: 60S ribosomal protein L7                151   1e-41   
ref|XP_009982551.1|  PREDICTED: 60S ribosomal protein L7                151   1e-41   
gb|KFZ62330.1|  60S ribosomal protein L7                                151   1e-41   
gb|KFR01335.1|  60S ribosomal protein L7                                151   1e-41   
gb|ACH70988.1|  ribosomal protein L7-1                                  151   1e-41   
tpe|CAL69057.1|  TPA: putative 60S ribosomal protein L7 isoform 1       151   1e-41   
ref|XP_009704239.1|  PREDICTED: 60S ribosomal protein L7                151   1e-41   
gb|KFW10474.1|  60S ribosomal protein L7                                151   1e-41   
ref|XP_009632750.1|  PREDICTED: 60S ribosomal protein L7                151   1e-41   
ref|XP_008299972.1|  PREDICTED: 60S ribosomal protein L7                151   1e-41   
gb|KIM28736.1|  hypothetical protein M408DRAFT_132083                   151   1e-41   
gb|ACO07661.1|  60S ribosomal protein L7                                151   1e-41   
gb|KFQ07643.1|  60S ribosomal protein L7                                150   2e-41   
gb|KFV16328.1|  60S ribosomal protein L7                                150   2e-41   
ref|XP_010127915.1|  PREDICTED: 60S ribosomal protein L7                150   2e-41   
ref|XP_006272285.1|  PREDICTED: 60S ribosomal protein L7                150   2e-41   
gb|ADT80650.1|  ribosomal protein L7                                    151   2e-41   
gb|KFP34971.1|  60S ribosomal protein L7                                150   2e-41   
ref|XP_009924752.1|  PREDICTED: 60S ribosomal protein L7                151   2e-41   
gb|KFV44908.1|  60S ribosomal protein L7                                150   2e-41   
ref|XP_006634045.1|  PREDICTED: 60S ribosomal protein L7-like           150   2e-41   
gb|AEL28829.1|  ribosomal protein L7                                    151   2e-41   
ref|XP_011260128.1|  PREDICTED: 60S ribosomal protein L7                151   2e-41   
ref|XP_010019611.1|  PREDICTED: 60S ribosomal protein L7                150   2e-41   
gb|KFQ74511.1|  60S ribosomal protein L7                                150   2e-41   
gb|KFQ55799.1|  60S ribosomal protein L7                                150   2e-41   
ref|XP_009585540.1|  PREDICTED: 60S ribosomal protein L7                150   2e-41   
ref|XP_009489411.1|  PREDICTED: 60S ribosomal protein L7                150   2e-41   
ref|XP_010403511.1|  PREDICTED: 60S ribosomal protein L7                151   2e-41   
ref|XP_007253038.1|  PREDICTED: 60S ribosomal protein L7-like           150   2e-41   
emb|CAJ17237.1|  ribosomal protein L7e                                  151   2e-41   
ref|XP_005706689.1|  60S ribosomal protein L7e                          150   2e-41   
emb|CCJ29882.1|  unnamed protein product                                150   3e-41   
gb|KFV89491.1|  60S ribosomal protein L7                                150   3e-41   
ref|XP_008629612.1|  PREDICTED: 60S ribosomal protein L7                151   3e-41   
emb|CEI88889.1|  Putative 50S ribosomal protein L7e                     150   3e-41   
gb|KFQ66299.1|  60S ribosomal protein L7                                150   3e-41   
ref|XP_005715352.1|  60S ribosomal protein L7                           151   3e-41   
emb|CEG74859.1|  Putative 50S ribosomal protein L7e                     150   3e-41   
gb|ACN10035.1|  60S ribosomal protein L7                                151   3e-41   
ref|XP_009081905.1|  PREDICTED: 60S ribosomal protein L7                150   3e-41   
gb|AAK95131.1|  ribosomal protein L7                                    150   3e-41   
emb|CAJ17238.1|  ribosomal protein L7e                                  150   3e-41   
ref|XP_003269473.1|  PREDICTED: 60S ribosomal protein L7 isoform 1      150   3e-41   
gb|KFP71682.1|  60S ribosomal protein L7                                150   3e-41   
ref|XP_006737146.1|  PREDICTED: 60S ribosomal protein L7                148   3e-41   
ref|XP_974347.1|  PREDICTED: 60S ribosomal protein L7                   150   3e-41   
emb|CDQ98342.1|  unnamed protein product                                149   3e-41   
ref|XP_009974827.1|  PREDICTED: 60S ribosomal protein L7                150   3e-41   
gb|KFV73708.1|  60S ribosomal protein L7                                150   3e-41   
ref|XP_003800086.1|  PREDICTED: 60S ribosomal protein L7 isoform 1      150   4e-41   
ref|XP_009993909.1|  PREDICTED: 60S ribosomal protein L7                150   4e-41   
gb|KFU88082.1|  60S ribosomal protein L7                                150   4e-41   
gb|ACD65158.1|  putative 60S ribosomal protein RPL7                     150   4e-41   
gb|KFW63041.1|  60S ribosomal protein L7                                149   4e-41   
ref|XP_004762414.1|  PREDICTED: 60S ribosomal protein L7                152   5e-41   
dbj|BAM18954.1|  ribosomal protein L7                                   150   5e-41   
ref|XP_009333345.1|  PREDICTED: 60S ribosomal protein L7                151   6e-41   
ref|XP_005689120.1|  PREDICTED: 60S ribosomal protein L7                149   6e-41   
ref|XP_009498821.1|  PREDICTED: 60S ribosomal protein L7                149   6e-41   
gb|ACH73061.1|  ribosomal protein L7                                    149   6e-41   
gb|KFW88246.1|  60S ribosomal protein L7                                149   6e-41   
emb|CBN81910.1|  60S ribosomal protein L7                               149   6e-41   
emb|CDJ56154.1|  60S ribosomal protein L7, putative                     150   6e-41   
ref|XP_002759041.1|  PREDICTED: 60S ribosomal protein L7                150   6e-41   
ref|NP_001133952.1|  60S ribosomal protein L7                           149   7e-41   
gb|KFO71164.1|  60S ribosomal protein L7                                149   7e-41   
ref|XP_003831370.1|  PREDICTED: 60S ribosomal protein L7 isoform X1     149   7e-41   
ref|XP_519807.3|  PREDICTED: 60S ribosomal protein L7 isoform X1        149   8e-41   
ref|XP_001607539.1|  PREDICTED: 60S ribosomal protein L7                149   8e-41   
gb|ACY71256.1|  ribosomal protein L7                                    149   8e-41   
ref|XP_009569249.1|  PREDICTED: 60S ribosomal protein L7                149   8e-41   
ref|XP_002735960.1|  PREDICTED: 60S ribosomal protein L7-like           149   8e-41   
gb|ELW63935.1|  60S ribosomal protein L7                                149   9e-41   
ref|XP_003140775.1|  60S ribosomal protein L7                           149   9e-41   
ref|XP_011302112.1|  PREDICTED: 60S ribosomal protein L7                149   9e-41   
ref|XP_004607150.1|  PREDICTED: 60S ribosomal protein L7-like           149   9e-41   
gb|ACQ57965.1|  60S ribosomal protein L7                                149   1e-40   
ref|XP_010195081.1|  PREDICTED: 60S ribosomal protein L7                151   1e-40   
gb|EFN65855.1|  60S ribosomal protein L7                                157   1e-40   
ref|XP_005678035.1|  PREDICTED: 60S ribosomal protein L7-like           149   1e-40   
ref|XP_003408394.2|  PREDICTED: 60S ribosomal protein L7                149   1e-40   
ref|XP_010218922.1|  PREDICTED: 60S ribosomal protein L7                148   1e-40   
ref|XP_007885176.1|  PREDICTED: 60S ribosomal protein L7                152   1e-40   
gb|KFV88892.1|  60S ribosomal protein L7                                148   2e-40   
gb|AAL62469.1|  ribosomal protein L7                                    149   2e-40   
ref|XP_010620732.1|  PREDICTED: 60S ribosomal protein L7                148   2e-40   
ref|XP_001089573.1|  PREDICTED: 60S ribosomal protein L7-like iso...    148   2e-40   
gb|ELR47778.1|  60S ribosomal protein L7                                148   2e-40   
ref|NP_001014928.1|  60S ribosomal protein L7                           148   2e-40   
ref|XP_004695932.1|  PREDICTED: LOW QUALITY PROTEIN: ribosomal pr...    148   2e-40   
ref|XP_006071011.1|  PREDICTED: 60S ribosomal protein L7-like           148   2e-40   
ref|XP_010917039.1|  PREDICTED: 60S ribosomal protein L7-2-like         148   2e-40   
ref|XP_004588103.1|  PREDICTED: 60S ribosomal protein L7                148   2e-40   
ref|XP_004280620.1|  PREDICTED: 60S ribosomal protein L7                148   2e-40   
ref|XP_007185108.1|  PREDICTED: 60S ribosomal protein L7                148   2e-40   
ref|XP_004314065.1|  PREDICTED: 60S ribosomal protein L7-like           148   2e-40   
ref|XP_001102825.1|  PREDICTED: 60S ribosomal protein L7-like           147   2e-40   
ref|XP_011152697.1|  PREDICTED: 60S ribosomal protein L7-like           148   2e-40   
ref|NP_001239156.1|  60S ribosomal protein L7                           148   3e-40   
gb|KGL81436.1|  60S ribosomal protein L7                                147   3e-40   
ref|XP_011138066.1|  PREDICTED: 60S ribosomal protein L7-like           148   3e-40   
gb|EAW95808.1|  hCG2015956                                              148   3e-40   
ref|XP_003694297.1|  PREDICTED: 60S ribosomal protein L7-like           147   3e-40   
gb|EFN75670.1|  60S ribosomal protein L7                                148   3e-40   
ref|XP_005974364.1|  PREDICTED: 60S ribosomal protein L7-like           147   3e-40   
gb|AAI54760.1|  Ribosomal protein L7                                    147   4e-40   
dbj|BAM17698.1|  ribosomal protein L7                                   148   4e-40   
ref|XP_010732148.1|  PREDICTED: 60S ribosomal protein L7                147   4e-40   
gb|ACR24943.1|  ribosomal protein L7                                    145   4e-40   
ref|XP_007999065.1|  PREDICTED: 60S ribosomal protein L7                147   4e-40   
ref|XP_003785071.1|  PREDICTED: 60S ribosomal protein L7-like iso...    147   4e-40   
ref|XP_005335882.1|  PREDICTED: 60S ribosomal protein L7                147   5e-40   
ref|XP_004406010.1|  PREDICTED: 60S ribosomal protein L7-like           145   5e-40   
gb|EHH27279.1|  hypothetical protein EGK_17441                          146   5e-40   
gb|KIW08496.1|  60S ribosomal protein L7                                147   5e-40   
gb|KFO88303.1|  60S ribosomal protein L7                                147   5e-40   
ref|NP_001291536.1|  60S ribosomal protein L7                           147   5e-40   
gb|KDR08207.1|  60S ribosomal protein L7                                148   5e-40   
ref|XP_010361809.1|  PREDICTED: 60S ribosomal protein L7                147   5e-40   
gb|EFZ09294.1|  hypothetical protein SINV_12629                         147   5e-40   
ref|NP_998809.1|  60S ribosomal protein L7                              147   6e-40   
ref|XP_011500004.1|  PREDICTED: 60S ribosomal protein L7                147   7e-40   
gb|AAX62456.1|  ribosomal protein L7 isoform A                          147   7e-40   
ref|XP_004392099.1|  PREDICTED: 60S ribosomal protein L7-like           147   7e-40   
ref|XP_004653343.1|  PREDICTED: 60S ribosomal protein L7-like           146   8e-40   
gb|ABG74705.1|  putative ribosomal protein L7                           147   9e-40   
gb|ABZ04220.1|  ribosomal protein rpl7                                  145   9e-40   
ref|XP_007105128.1|  PREDICTED: 60S ribosomal protein L7-like iso...    147   1e-39   
gb|AAI07516.1|  Ribosomal protein L7                                    146   1e-39   
ref|XP_007932741.1|  PREDICTED: 60S ribosomal protein L7                146   1e-39   
dbj|GAM88907.1|  hypothetical protein ANO11243_069410                   146   1e-39   
ref|XP_005985710.1|  PREDICTED: LOW QUALITY PROTEIN: ribosomal pr...    146   1e-39   
gb|EJU05248.1|  60S ribosomal protein L7                                146   1e-39   
ref|XP_008847109.1|  PREDICTED: 60S ribosomal protein L7                146   1e-39   
ref|XP_008577211.1|  PREDICTED: 60S ribosomal protein L7                146   1e-39   
ref|XP_003491265.1|  PREDICTED: 60S ribosomal protein L7-like           146   1e-39   
ref|XP_006054268.1|  PREDICTED: 60S ribosomal protein L7                148   1e-39   
gb|EYE91396.1|  60S ribosomal protein L7                                146   1e-39   
gb|AAA42075.1|  ribosomal protein L7                                    146   1e-39   
ref|XP_005372493.1|  PREDICTED: LOW QUALITY PROTEIN: ribosomal pr...    146   2e-39   
ref|XP_009687799.1|  PREDICTED: 60S ribosomal protein L7                149   2e-39   
gb|KJB35650.1|  hypothetical protein B456_006G122500                    145   2e-39   
ref|XP_001378363.3|  PREDICTED: 60S ribosomal protein L7                146   2e-39   
ref|XP_004710141.1|  PREDICTED: 60S ribosomal protein L7-like           145   2e-39   
ref|XP_006924091.1|  PREDICTED: 60S ribosomal protein L7                146   2e-39   
ref|XP_010949649.1|  PREDICTED: 60S ribosomal protein L7                146   2e-39   
gb|EAW61751.1|  hCG1783090                                              145   2e-39   
ref|XP_007710505.1|  hypothetical protein COCCADRAFT_24820              145   2e-39   
emb|CDY01953.1|  BnaC02g27740D                                          142   2e-39   
ref|XP_003395129.1|  PREDICTED: 60S ribosomal protein L7-like           145   2e-39   
ref|NP_001094004.1|  60S ribosomal protein L7                           146   2e-39   
gb|EMD93502.1|  hypothetical protein COCHEDRAFT_1192825                 145   2e-39   
emb|CDI80084.1|  60S ribosomal protein L7, putative                     145   2e-39   
gb|ERL88218.1|  hypothetical protein D910_05606                         145   2e-39   
gb|AAX29344.1|  ribosomal protein L7                                    145   2e-39   
ref|XP_008070843.1|  PREDICTED: 60S ribosomal protein L7                145   2e-39   
sp|P05426.2|RL7_RAT  RecName: Full=60S ribosomal protein L7             145   2e-39   
gb|AAA03081.1|  ribosomal protein L7                                    145   2e-39   
ref|XP_004462534.1|  PREDICTED: 60S ribosomal protein L7                145   2e-39   
ref|NP_000962.2|  60S ribosomal protein L7                              145   2e-39   
ref|XP_007080427.1|  PREDICTED: 60S ribosomal protein L7                145   2e-39   
ref|XP_003732765.1|  PREDICTED: 60S ribosomal protein L7                145   2e-39   
ref|XP_011337799.1|  PREDICTED: 60S ribosomal protein L7-like           145   2e-39   
ref|XP_006974774.1|  PREDICTED: 60S ribosomal protein L7 isoform X2     145   2e-39   
gb|ENN70905.1|  hypothetical protein YQE_12309                          145   3e-39   
gb|ELT94343.1|  hypothetical protein CAPTEDRAFT_221278                  145   3e-39   
ref|XP_001750829.1|  hypothetical protein                               145   3e-39   
gb|AAH85590.2|  Ribosomal protein L7                                    145   3e-39   
ref|XP_006974773.1|  PREDICTED: 60S ribosomal protein L7 isoform X1     145   3e-39   
ref|XP_001896338.1|  60S ribosomal protein L7                           145   3e-39   
ref|XP_003759751.1|  PREDICTED: 60S ribosomal protein L7                145   3e-39   
gb|AAA40070.1|  ribosomal protein L7                                    145   3e-39   



>ref|XP_011072735.1| PREDICTED: 60S ribosomal protein L7-4-like isoform X1 [Sesamum 
indicum]
Length=248

 Score =   258 bits (658),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 144/162 (89%), Positives = 154/162 (95%), Gaps = 3/162 (2%)
 Frame = +1

Query  58   LQMAEAQTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyake  237
            ++MAE   KGGP+VPESVLKKQKR+EEWALAKKQELAA+K+K A NRKLI+ RAKQYAKE
Sbjct  4    VEMAE---KGGPIVPESVLKKQKRSEEWALAKKQELAALKEKKAANRKLIYSRAKQYAKE  60

Query  238  yeeqqkeLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNG  417
            YEEQ KELIQLKREARLKGGFYVNPEAKLLFI+RIRGINAMHP TKKILQLLRLRQIFNG
Sbjct  61   YEEQDKELIQLKREARLKGGFYVNPEAKLLFIVRIRGINAMHPRTKKILQLLRLRQIFNG  120

Query  418  VFLKVNKATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            VFLKVNKAT+NMLH+VEPYVTYGYPNLKSVRELIYKRGYGKV
Sbjct  121  VFLKVNKATMNMLHRVEPYVTYGYPNLKSVRELIYKRGYGKV  162



>ref|XP_011072736.1| PREDICTED: 60S ribosomal protein L7-4-like isoform X2 [Sesamum 
indicum]
Length=243

 Score =   257 bits (656),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 144/160 (90%), Positives = 152/160 (95%), Gaps = 3/160 (2%)
 Frame = +1

Query  64   MAEAQTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeye  243
            MAE   KGGP+VPESVLKKQKR+EEWALAKKQELAA+K+K A NRKLI+ RAKQYAKEYE
Sbjct  1    MAE---KGGPIVPESVLKKQKRSEEWALAKKQELAALKEKKAANRKLIYSRAKQYAKEYE  57

Query  244  eqqkeLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVF  423
            EQ KELIQLKREARLKGGFYVNPEAKLLFI+RIRGINAMHP TKKILQLLRLRQIFNGVF
Sbjct  58   EQDKELIQLKREARLKGGFYVNPEAKLLFIVRIRGINAMHPRTKKILQLLRLRQIFNGVF  117

Query  424  LKVNKATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LKVNKAT+NMLH+VEPYVTYGYPNLKSVRELIYKRGYGKV
Sbjct  118  LKVNKATMNMLHRVEPYVTYGYPNLKSVRELIYKRGYGKV  157



>ref|XP_003632932.1| PREDICTED: 60S ribosomal protein L7-2 [Vitis vinifera]
 emb|CBI18498.3| unnamed protein product [Vitis vinifera]
Length=246

 Score =   256 bits (654),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = +1

Query  64   MAEAQTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeye  243
            M E   KGGPV+PESVLKKQKRNEEW LAKKQE+ A KKKNA+NRKLI+ RAKQYAKEYE
Sbjct  1    MGEEDAKGGPVIPESVLKKQKRNEEWTLAKKQEVEAKKKKNADNRKLIYSRAKQYAKEYE  60

Query  244  eqqkeLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVF  423
            EQQKELIQLKREA+LKGGFYV+PEAKLLF+IRIRGINAMHP T+KILQLLRLRQIFNGVF
Sbjct  61   EQQKELIQLKREAKLKGGFYVDPEAKLLFMIRIRGINAMHPKTRKILQLLRLRQIFNGVF  120

Query  424  LKVNKATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LKVNKAT+NMLH+VEPYVTYGYPNLKSVRELIYKRGYGK+
Sbjct  121  LKVNKATMNMLHRVEPYVTYGYPNLKSVRELIYKRGYGKL  160



>ref|XP_010269530.1| PREDICTED: 60S ribosomal protein L7-2 [Nelumbo nucifera]
Length=246

 Score =   254 bits (649),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 138/160 (86%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = +1

Query  64   MAEAQTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeye  243
            M E +TKGG +VPESVLKK+KR+EEWALAKKQ L A KKKNAENRKLIF RA+QY KEY+
Sbjct  1    MGEEETKGGAIVPESVLKKRKRSEEWALAKKQTLEAQKKKNAENRKLIFKRAEQYVKEYQ  60

Query  244  eqqkeLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVF  423
            EQ+KELI+LKREA+LKGGFYVNPEAKLLFIIRIRGINAMHP T+KILQLLRLRQIFNGVF
Sbjct  61   EQEKELIRLKREAKLKGGFYVNPEAKLLFIIRIRGINAMHPKTRKILQLLRLRQIFNGVF  120

Query  424  LKVNKATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LKVNKAT+NMLH+VEPYVTYGYPNLKSVRELIYKRGYGK+
Sbjct  121  LKVNKATMNMLHRVEPYVTYGYPNLKSVRELIYKRGYGKL  160



>gb|EYU21221.1| hypothetical protein MIMGU_mgv1a012680mg [Erythranthe guttata]
Length=243

 Score =   251 bits (640),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 148/160 (93%), Gaps = 3/160 (2%)
 Frame = +1

Query  64   MAEAQTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeye  243
            MAE   K  P+VPESVLKKQKRNEEWALAKKQ L AVK+K +ENRKLIF RAKQYAKEY 
Sbjct  1    MAE---KEAPIVPESVLKKQKRNEEWALAKKQALVAVKEKKSENRKLIFNRAKQYAKEYA  57

Query  244  eqqkeLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVF  423
            EQ KELIQLKREARLKGGFYVNPEAKL+FIIRIRGINAMHP TKKILQLLRLRQIFNGVF
Sbjct  58   EQDKELIQLKREARLKGGFYVNPEAKLIFIIRIRGINAMHPTTKKILQLLRLRQIFNGVF  117

Query  424  LKVNKATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LKVNKAT+NMLH+VEPYVTYGYPNLKSVRELIYKRG+GKV
Sbjct  118  LKVNKATMNMLHRVEPYVTYGYPNLKSVRELIYKRGFGKV  157



>ref|XP_010276711.1| PREDICTED: 60S ribosomal protein L7-2-like [Nelumbo nucifera]
Length=246

 Score =   251 bits (640),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 139/160 (87%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +1

Query  64   MAEAQTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeye  243
            M E + KG  VVPESVLKK+KR+EEWALAKKQE+ A+KKKN ENRKLIF RA QYAKEY+
Sbjct  1    MGEEEAKGCAVVPESVLKKRKRSEEWALAKKQEVDALKKKNVENRKLIFKRAMQYAKEYD  60

Query  244  eqqkeLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVF  423
            EQQKELI+LKREA+LKGGFYVNPEAKLLFIIRIRGINAMHP T+KILQLLRLRQIFNGVF
Sbjct  61   EQQKELIRLKREAKLKGGFYVNPEAKLLFIIRIRGINAMHPKTRKILQLLRLRQIFNGVF  120

Query  424  LKVNKATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LKVNKATVNMLH+VEPYVTYGYPNLKSVRELIYKRGYGK+
Sbjct  121  LKVNKATVNMLHRVEPYVTYGYPNLKSVRELIYKRGYGKL  160



>ref|XP_006854234.1| hypothetical protein AMTR_s00048p00227650 [Amborella trichopoda]
 gb|ERN15701.1| hypothetical protein AMTR_s00048p00227650 [Amborella trichopoda]
Length=245

 Score =   247 bits (630),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 133/156 (85%), Positives = 146/156 (94%), Gaps = 0/156 (0%)
 Frame = +1

Query  76   QTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqk  255
            + KGGPVVPESVLKK+KR+E WALAKK  L A KKKNAENRKLIF RA+QY KEY++Q+ 
Sbjct  4    EVKGGPVVPESVLKKRKRSESWALAKKTALEAKKKKNAENRKLIFKRAEQYMKEYKQQEL  63

Query  256  eLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVN  435
            ELI+LKREA+LKGGFYVNPEAKLLFIIRIRGINAMHP T+KILQLLRLRQIFNGVFLKVN
Sbjct  64   ELIKLKREAKLKGGFYVNPEAKLLFIIRIRGINAMHPKTRKILQLLRLRQIFNGVFLKVN  123

Query  436  KATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            KAT+NMLH+VEPYVTYGYPNLKSVRELIYKRGYGK+
Sbjct  124  KATMNMLHRVEPYVTYGYPNLKSVRELIYKRGYGKL  159



>ref|XP_009780830.1| PREDICTED: 60S ribosomal protein L7-4-like [Nicotiana sylvestris]
Length=242

 Score =   246 bits (628),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 136/154 (88%), Positives = 145/154 (94%), Gaps = 0/154 (0%)
 Frame = +1

Query  82   KGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeL  261
            +GG +VPESVLKKQKR+EEWAL KKQEL A KKKN ENRKLI+ RAKQYAKEYE Q++EL
Sbjct  3    EGGVLVPESVLKKQKRSEEWALVKKQELEAAKKKNTENRKLIYNRAKQYAKEYEAQEREL  62

Query  262  IQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKA  441
            IQLKREARLKGGFYV+PEAKLLFIIRIRGINAM P TKKILQLLRLRQIFNGVFLKVNKA
Sbjct  63   IQLKREARLKGGFYVDPEAKLLFIIRIRGINAMAPQTKKILQLLRLRQIFNGVFLKVNKA  122

Query  442  TVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            TVNMLH+VEPYVTYGYPNLKS+RELIYKRGYGKV
Sbjct  123  TVNMLHRVEPYVTYGYPNLKSIRELIYKRGYGKV  156



>emb|CDO97748.1| unnamed protein product [Coffea canephora]
Length=243

 Score =   245 bits (626),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 139/160 (87%), Positives = 146/160 (91%), Gaps = 3/160 (2%)
 Frame = +1

Query  64   MAEAQTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeye  243
            MAE Q KG   VPESVLKKQKRNEEWALAKKQE  A KKKN  NRKLI+ RAKQYAKEY 
Sbjct  1    MAEEQAKG---VPESVLKKQKRNEEWALAKKQEFEAAKKKNLANRKLIYNRAKQYAKEYA  57

Query  244  eqqkeLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVF  423
            EQQ+ELI+LKREARLKGGFYVNPEAKLLFI+RIRGINAMHP TKKILQLLRLRQIFNGVF
Sbjct  58   EQQRELIKLKREARLKGGFYVNPEAKLLFIVRIRGINAMHPRTKKILQLLRLRQIFNGVF  117

Query  424  LKVNKATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LKVNKAT+NMLH+VEPYV YGYPNLKSV+ELIYKRGYGKV
Sbjct  118  LKVNKATLNMLHRVEPYVAYGYPNLKSVKELIYKRGYGKV  157



>emb|CDP14387.1| unnamed protein product [Coffea canephora]
Length=243

 Score =   245 bits (625),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 148/160 (93%), Gaps = 3/160 (2%)
 Frame = +1

Query  64   MAEAQTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeye  243
            MAE Q K   VVPESVLKKQKRNEEWALAKKQEL A KKKN  NRKLI+ RAKQYAKEYE
Sbjct  1    MAEEQAK---VVPESVLKKQKRNEEWALAKKQELDAAKKKNLANRKLIYNRAKQYAKEYE  57

Query  244  eqqkeLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVF  423
            EQQKELI+LKREARLKGGFYVNPEAKLLFI+RIRGINAMHP TKKILQLLRLRQIFNGVF
Sbjct  58   EQQKELIKLKREARLKGGFYVNPEAKLLFIVRIRGINAMHPRTKKILQLLRLRQIFNGVF  117

Query  424  LKVNKATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LKVNKAT+NMLH+VEPYV YGYPNLK+V+ELIYKRGYGKV
Sbjct  118  LKVNKATLNMLHRVEPYVAYGYPNLKTVKELIYKRGYGKV  157



>ref|XP_009601427.1| PREDICTED: 60S ribosomal protein L7-2-like [Nicotiana tomentosiformis]
Length=242

 Score =   244 bits (623),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 136/154 (88%), Positives = 144/154 (94%), Gaps = 0/154 (0%)
 Frame = +1

Query  82   KGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeL  261
            +GG  VPESVLKKQKR+EEWAL KKQEL A KKKN ENRKLI+ RAKQYAKEYE Q++EL
Sbjct  3    EGGVPVPESVLKKQKRSEEWALVKKQELEAAKKKNTENRKLIYNRAKQYAKEYEAQEREL  62

Query  262  IQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKA  441
            IQLKREARLKGGFYV+PEAKLLFIIRIRGINAM P TKKILQLLRLRQIFNGVFLKVNKA
Sbjct  63   IQLKREARLKGGFYVDPEAKLLFIIRIRGINAMAPQTKKILQLLRLRQIFNGVFLKVNKA  122

Query  442  TVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            TVNMLH+VEPYVTYGYPNLKS+RELIYKRGYGKV
Sbjct  123  TVNMLHRVEPYVTYGYPNLKSIRELIYKRGYGKV  156



>ref|XP_011046524.1| PREDICTED: 60S ribosomal protein L7-4 [Populus euphratica]
 ref|XP_011046525.1| PREDICTED: 60S ribosomal protein L7-4 [Populus euphratica]
Length=244

 Score =   244 bits (623),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 137/160 (86%), Positives = 147/160 (92%), Gaps = 2/160 (1%)
 Frame = +1

Query  64   MAEAQTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeye  243
            M E  TK    VPESVLKKQKR EEWALAKKQELAA KKKNAENRKLIF RAKQYAKEY+
Sbjct  1    MGEEATK--VAVPESVLKKQKREEEWALAKKQELAATKKKNAENRKLIFNRAKQYAKEYQ  58

Query  244  eqqkeLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVF  423
            EQ+K+L+Q KREARLKGGFYV+PEAKLLFIIRIRGINAMHP T+ ILQLLRLRQIFNGVF
Sbjct  59   EQEKQLVQWKREARLKGGFYVDPEAKLLFIIRIRGINAMHPKTRSILQLLRLRQIFNGVF  118

Query  424  LKVNKATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LKVNKATVNMLH+VEPYVT+GYPNLKSVRELIYKRG+GK+
Sbjct  119  LKVNKATVNMLHRVEPYVTFGYPNLKSVRELIYKRGFGKL  158



>ref|XP_006857736.1| hypothetical protein AMTR_s00061p00187310 [Amborella trichopoda]
 gb|ERN19203.1| hypothetical protein AMTR_s00061p00187310 [Amborella trichopoda]
Length=246

 Score =   244 bits (623),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 131/160 (82%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = +1

Query  64   MAEAQTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeye  243
            M E + K G +VP SVLKK+KR+EEWALAKK+ L A KKKNA+NRKL+F RA++YAKEY+
Sbjct  1    MGEEEVKTGAIVPASVLKKRKRSEEWALAKKKALQATKKKNADNRKLMFKRAQEYAKEYQ  60

Query  244  eqqkeLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVF  423
            EQ+ EL++LKREA+LKGGFYVNPEAKLLFIIRIRGINAMHP T+KILQLLRLRQIFNGVF
Sbjct  61   EQELELVRLKREAKLKGGFYVNPEAKLLFIIRIRGINAMHPKTRKILQLLRLRQIFNGVF  120

Query  424  LKVNKATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LKVNKATVNMLH+VEPYVTYGYPNLKSVRELIYKRGYGK+
Sbjct  121  LKVNKATVNMLHRVEPYVTYGYPNLKSVRELIYKRGYGKL  160



>ref|XP_004167340.1| PREDICTED: LOW QUALITY PROTEIN: 60S ribosomal protein L7-4-like 
[Cucumis sativus]
Length=246

 Score =   244 bits (623),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 134/160 (84%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = +1

Query  64   MAEAQTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeye  243
            M+    KGGPVVPESVLKKQKRNEEWALA+K+ L   KKKNAENRKLI+ RAK YAKEY+
Sbjct  1    MSAEGVKGGPVVPESVLKKQKRNEEWALAEKKXLEVAKKKNAENRKLIYTRAKLYAKEYD  60

Query  244  eqqkeLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVF  423
            EQQKELIQLKREA+LKGGFYV+PEAKLLFIIRIRGINA+ P T+KILQLLRLRQIFNGVF
Sbjct  61   EQQKELIQLKREAKLKGGFYVDPEAKLLFIIRIRGINAIDPKTRKILQLLRLRQIFNGVF  120

Query  424  LKVNKATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LKVNKAT+NMLH+VEPYVTYGYPNLKSV+ELIYKRG+GK+
Sbjct  121  LKVNKATLNMLHRVEPYVTYGYPNLKSVKELIYKRGFGKL  160



>ref|XP_002315382.1| hypothetical protein POPTR_0010s25740g [Populus trichocarpa]
 ref|XP_006378855.1| 60S ribosomal protein L7-2 [Populus trichocarpa]
 gb|ABK94792.1| unknown [Populus trichocarpa]
 gb|EEF01553.1| hypothetical protein POPTR_0010s25740g [Populus trichocarpa]
 gb|ERP56652.1| 60S ribosomal protein L7-2 [Populus trichocarpa]
Length=244

 Score =   244 bits (622),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 146/160 (91%), Gaps = 2/160 (1%)
 Frame = +1

Query  64   MAEAQTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeye  243
            M E  TK    VPESVLKKQKR EEWALAKKQELAA KKKNAENRKLIF RAK YAKEY+
Sbjct  1    MGEEATK--VAVPESVLKKQKREEEWALAKKQELAATKKKNAENRKLIFNRAKLYAKEYQ  58

Query  244  eqqkeLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVF  423
            EQ+K+L+Q KREARLKGGFYV+PEAKLLFIIRIRGINAMHP T+ ILQLLRLRQIFNGVF
Sbjct  59   EQEKQLVQWKREARLKGGFYVDPEAKLLFIIRIRGINAMHPKTRSILQLLRLRQIFNGVF  118

Query  424  LKVNKATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LKVNKATVNMLH+VEPYVT+GYPNLKSVRELIYKRG+GK+
Sbjct  119  LKVNKATVNMLHRVEPYVTFGYPNLKSVRELIYKRGFGKL  158



>ref|XP_010105399.1| 60S ribosomal protein L7-4 [Morus notabilis]
 gb|EXC04599.1| 60S ribosomal protein L7-4 [Morus notabilis]
Length=291

 Score =   245 bits (626),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 137/171 (80%), Positives = 151/171 (88%), Gaps = 2/171 (1%)
 Frame = +1

Query  31   NCPVVSIAQLQMAEAQTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIF  210
            +C   S  QL     + K   V+PESVLKK+KR EEWALAKKQEL A+KKKNAENRKLIF
Sbjct  37   DCGTNSYQQLFKMVEEVK--TVIPESVLKKKKREEEWALAKKQELEALKKKNAENRKLIF  94

Query  211  CRakqyakeyeeqqkeLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQL  390
             RAKQY+KEY E++KELIQLKREA+LKGGFYV PEAKLLFI+RIRGINAMHP T+KILQL
Sbjct  95   NRAKQYSKEYAEKEKELIQLKREAKLKGGFYVEPEAKLLFIVRIRGINAMHPKTRKILQL  154

Query  391  LRLRQIFNGVFLKVNKATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LRLRQIFNGVFLKVNKATVNMLH+VEPYVT+GYPNLKSVRELIYKRGYGK+
Sbjct  155  LRLRQIFNGVFLKVNKATVNMLHRVEPYVTFGYPNLKSVRELIYKRGYGKL  205



>ref|XP_004134063.1| PREDICTED: 60S ribosomal protein L7-4-like [Cucumis sativus]
 gb|KGN56853.1| hypothetical protein Csa_3G135010 [Cucumis sativus]
Length=246

 Score =   243 bits (621),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 134/160 (84%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = +1

Query  64   MAEAQTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeye  243
            M+    KGGPVVPESVLKKQKRNEEWALA+K+ L   KKKNAENRKLI+ RAK YAKEY+
Sbjct  1    MSAEGVKGGPVVPESVLKKQKRNEEWALAEKKGLEVAKKKNAENRKLIYTRAKLYAKEYD  60

Query  244  eqqkeLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVF  423
            EQQKELIQLKREA+LKGGFYV+PEAKLLFIIRIRGINA+ P T+KILQLLRLRQIFNGVF
Sbjct  61   EQQKELIQLKREAKLKGGFYVDPEAKLLFIIRIRGINAIDPKTRKILQLLRLRQIFNGVF  120

Query  424  LKVNKATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LKVNKAT+NMLH+VEPYVTYGYPNLKSV+ELIYKRG+GK+
Sbjct  121  LKVNKATLNMLHRVEPYVTYGYPNLKSVKELIYKRGFGKL  160



>ref|XP_004242791.1| PREDICTED: 60S ribosomal protein L7-3 [Solanum lycopersicum]
 ref|XP_006366954.1| PREDICTED: 60S ribosomal protein L7-3-like [Solanum tuberosum]
 prf||1909359B ribosomal protein L7
Length=242

 Score =   243 bits (620),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 136/154 (88%), Positives = 145/154 (94%), Gaps = 0/154 (0%)
 Frame = +1

Query  82   KGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeL  261
            +GG VVPESVLKKQKRNEEWAL KKQELA  KKK+ ENRKLI+ RAKQYAKEY EQ+KEL
Sbjct  3    EGGVVVPESVLKKQKRNEEWALVKKQELAVAKKKSVENRKLIYNRAKQYAKEYSEQEKEL  62

Query  262  IQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKA  441
            I+LKREARLKGGFYV+PEAKLLFIIRIRGINAM P TKKILQLLRLRQIFNGVFLKVNKA
Sbjct  63   IRLKREARLKGGFYVDPEAKLLFIIRIRGINAMPPQTKKILQLLRLRQIFNGVFLKVNKA  122

Query  442  TVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            TVNMLH+VEPYVTYGYPNLKS++ELIYKRGYGKV
Sbjct  123  TVNMLHRVEPYVTYGYPNLKSIKELIYKRGYGKV  156



>ref|XP_010040054.1| PREDICTED: 60S ribosomal protein L7-2 [Eucalyptus grandis]
 gb|KCW45521.1| hypothetical protein EUGRSUZ_L00752 [Eucalyptus grandis]
Length=244

 Score =   242 bits (618),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 132/150 (88%), Positives = 144/150 (96%), Gaps = 0/150 (0%)
 Frame = +1

Query  94   VVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLK  273
            +VPESVLKKQKRNEEWALAKKQEL + K+KNAENRKLI+ RAKQYAKEY EQ+KELIQLK
Sbjct  9    IVPESVLKKQKRNEEWALAKKQELESAKQKNAENRKLIYNRAKQYAKEYAEQEKELIQLK  68

Query  274  REARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNM  453
            REA+L+GGFYV+PEAKLLFIIRIRGINAMHP T+ ILQLLRLRQIFNGVFLKVNKATVNM
Sbjct  69   REAKLRGGFYVDPEAKLLFIIRIRGINAMHPKTRTILQLLRLRQIFNGVFLKVNKATVNM  128

Query  454  LHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LH+VEPYVT+GYPNLKSVRELIYKRGYGK+
Sbjct  129  LHRVEPYVTFGYPNLKSVRELIYKRGYGKL  158



>ref|XP_009610771.1| PREDICTED: 60S ribosomal protein L7-4 [Nicotiana tomentosiformis]
Length=240

 Score =   242 bits (617),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 135/153 (88%), Positives = 145/153 (95%), Gaps = 0/153 (0%)
 Frame = +1

Query  85   GGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLI  264
            G   VPESVLKKQKR+EEWALAKKQEL A KKKNA+NRKLI+ RAKQY+KEYE+Q+KELI
Sbjct  2    GETPVPESVLKKQKRSEEWALAKKQELEAAKKKNADNRKLIYNRAKQYSKEYEQQEKELI  61

Query  265  QLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKAT  444
            +LKREARLKGGFYV+PEAKLLFIIRIRGINAM P TKKILQLLRLRQIFNGVFLKVNKAT
Sbjct  62   RLKREARLKGGFYVDPEAKLLFIIRIRGINAMPPQTKKILQLLRLRQIFNGVFLKVNKAT  121

Query  445  VNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            VNMLH+VEPYVTYGYPNLKSVRELIYKRGYGK+
Sbjct  122  VNMLHRVEPYVTYGYPNLKSVRELIYKRGYGKL  154



>ref|XP_010034075.1| PREDICTED: 60S ribosomal protein L7-2-like [Eucalyptus grandis]
Length=244

 Score =   241 bits (616),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 130/150 (87%), Positives = 144/150 (96%), Gaps = 0/150 (0%)
 Frame = +1

Query  94   VVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLK  273
            ++PESVLKKQKRNEEWALAKKQEL + K+KNAENRKLI+ RAKQYAKEY +Q+KELIQLK
Sbjct  9    IIPESVLKKQKRNEEWALAKKQELESAKQKNAENRKLIYNRAKQYAKEYAKQEKELIQLK  68

Query  274  REARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNM  453
            REA+L+GGFYV+PEAKLLFIIRIRGINAMHP T+ ILQLLRLRQIFNGVFLKVNKATVNM
Sbjct  69   REAKLRGGFYVDPEAKLLFIIRIRGINAMHPKTRTILQLLRLRQIFNGVFLKVNKATVNM  128

Query  454  LHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LH+VEPYVT+GYPNLKSVRELIYKRGYGK+
Sbjct  129  LHRVEPYVTFGYPNLKSVRELIYKRGYGKL  158



>gb|ABB16984.1| thaliana 60S ribosomal protein L7 (At2g44120) [Solanum tuberosum]
Length=242

 Score =   241 bits (616),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 135/154 (88%), Positives = 144/154 (94%), Gaps = 0/154 (0%)
 Frame = +1

Query  82   KGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeL  261
            +GG VVPESVLKKQKRNEEWAL KKQELA  K K+ ENRKLI+ RAKQYAKEY EQ+KEL
Sbjct  3    EGGVVVPESVLKKQKRNEEWALVKKQELAVAKNKSVENRKLIYNRAKQYAKEYSEQEKEL  62

Query  262  IQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKA  441
            I+LKREARLKGGFYV+PEAKLLFIIRIRGINAM P TKKILQLLRLRQIFNGVFLKVNKA
Sbjct  63   IRLKREARLKGGFYVDPEAKLLFIIRIRGINAMPPQTKKILQLLRLRQIFNGVFLKVNKA  122

Query  442  TVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            TVNMLH+VEPYVTYGYPNLKS++ELIYKRGYGKV
Sbjct  123  TVNMLHRVEPYVTYGYPNLKSIKELIYKRGYGKV  156



>gb|KCW53961.1| hypothetical protein EUGRSUZ_J031651, partial [Eucalyptus grandis]
Length=248

 Score =   241 bits (616),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 130/150 (87%), Positives = 144/150 (96%), Gaps = 0/150 (0%)
 Frame = +1

Query  94   VVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLK  273
            ++PESVLKKQKRNEEWALAKKQEL + K+KNAENRKLI+ RAKQYAKEY +Q+KELIQLK
Sbjct  13   IIPESVLKKQKRNEEWALAKKQELESAKQKNAENRKLIYNRAKQYAKEYAKQEKELIQLK  72

Query  274  REARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNM  453
            REA+L+GGFYV+PEAKLLFIIRIRGINAMHP T+ ILQLLRLRQIFNGVFLKVNKATVNM
Sbjct  73   REAKLRGGFYVDPEAKLLFIIRIRGINAMHPKTRTILQLLRLRQIFNGVFLKVNKATVNM  132

Query  454  LHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LH+VEPYVT+GYPNLKSVRELIYKRGYGK+
Sbjct  133  LHRVEPYVTFGYPNLKSVRELIYKRGYGKL  162



>ref|XP_006342481.1| PREDICTED: 60S ribosomal protein L7-4-like [Solanum tuberosum]
 ref|XP_010314810.1| PREDICTED: 60S ribosomal protein L7-4 [Solanum lycopersicum]
Length=240

 Score =   241 bits (615),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 135/153 (88%), Positives = 142/153 (93%), Gaps = 0/153 (0%)
 Frame = +1

Query  85   GGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLI  264
            G   VPESVLKKQKR+EEWALAKKQEL + KKKNAENRKLI+ RAK YAKEY EQ KELI
Sbjct  2    GETPVPESVLKKQKRSEEWALAKKQELESAKKKNAENRKLIYNRAKLYAKEYAEQDKELI  61

Query  265  QLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKAT  444
            +LKREARLKGGFYV+PEAKLLFIIRIRGINAM P TKKILQLLRLRQIFNGVFLKVNKAT
Sbjct  62   RLKREARLKGGFYVDPEAKLLFIIRIRGINAMPPQTKKILQLLRLRQIFNGVFLKVNKAT  121

Query  445  VNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            VNMLH+VEPYVTYGYPNLKSVRELIYKRGYGK+
Sbjct  122  VNMLHRVEPYVTYGYPNLKSVRELIYKRGYGKL  154



>ref|XP_008438517.1| PREDICTED: 60S ribosomal protein L7-4-like [Cucumis melo]
Length=246

 Score =   241 bits (614),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 134/160 (84%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = +1

Query  64   MAEAQTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeye  243
            M+    KGGPVVPESVLKK+KRN+EWALA+KQ L A KKKNAENRKLI+ RAK YAKEY+
Sbjct  1    MSGDGVKGGPVVPESVLKKRKRNDEWALAEKQGLEAAKKKNAENRKLIYNRAKLYAKEYD  60

Query  244  eqqkeLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVF  423
            EQQKELIQLKREA+LKGGFYV+PEAKLLFIIRIRGINA+ P T+KILQLLRLRQIFNGVF
Sbjct  61   EQQKELIQLKREAKLKGGFYVDPEAKLLFIIRIRGINAIDPKTRKILQLLRLRQIFNGVF  120

Query  424  LKVNKATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LKVNKAT+NMLH+VEPYVTYGYPNLKSV+ELIYKRG GK+
Sbjct  121  LKVNKATLNMLHRVEPYVTYGYPNLKSVKELIYKRGLGKL  160



>ref|XP_002308103.1| hypothetical protein POPTR_0006s07290g [Populus trichocarpa]
 ref|XP_006381146.1| hypothetical protein POPTR_0006s07290g [Populus trichocarpa]
 gb|EEE91626.1| hypothetical protein POPTR_0006s07290g [Populus trichocarpa]
 gb|ERP58943.1| hypothetical protein POPTR_0006s07290g [Populus trichocarpa]
Length=244

 Score =   241 bits (614),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 130/150 (87%), Positives = 144/150 (96%), Gaps = 0/150 (0%)
 Frame = +1

Query  94   VVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLK  273
             VPESVLKKQKRNEEWALAKK+E  A+KKKNAENRKLI+ RAKQYA++Y+E+QKELI+LK
Sbjct  9    AVPESVLKKQKRNEEWALAKKEEKLAIKKKNAENRKLIYSRAKQYAQQYDEEQKELIRLK  68

Query  274  REARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNM  453
            REARLKGGFYVNPEAKLLFI+RIRGINAMHP T+ ILQLLRLRQIFNGVFLKVNKATVNM
Sbjct  69   REARLKGGFYVNPEAKLLFIVRIRGINAMHPKTRSILQLLRLRQIFNGVFLKVNKATVNM  128

Query  454  LHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LH+VEPYVT+GYPNLKSV+ELIYKRGYGK+
Sbjct  129  LHRVEPYVTFGYPNLKSVKELIYKRGYGKL  158



>ref|XP_002262697.1| PREDICTED: 60S ribosomal protein L7-2 [Vitis vinifera]
Length=245

 Score =   240 bits (613),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 134/152 (88%), Positives = 144/152 (95%), Gaps = 0/152 (0%)
 Frame = +1

Query  88   GPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQ  267
            G VVPESVLKK+KR+EEWALAKKQEL   KKKNA NR LI+ RAKQYAKEY+EQQKELIQ
Sbjct  8    GVVVPESVLKKRKRSEEWALAKKQELECTKKKNATNRTLIYVRAKQYAKEYDEQQKELIQ  67

Query  268  LKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATV  447
            LKREA+LKGGFYV+PEAKLLFIIRIRGINAMHP T+KILQLLRLRQIFNGVFLKVNKAT+
Sbjct  68   LKREAKLKGGFYVSPEAKLLFIIRIRGINAMHPKTRKILQLLRLRQIFNGVFLKVNKATM  127

Query  448  NMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            NMLH+VEPYVTYGYPNLKSVRELIYKRGYGK+
Sbjct  128  NMLHRVEPYVTYGYPNLKSVRELIYKRGYGKL  159



>ref|XP_009610447.1| PREDICTED: 60S ribosomal protein L7-2-like [Nicotiana tomentosiformis]
Length=245

 Score =   240 bits (613),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 136/156 (87%), Positives = 145/156 (93%), Gaps = 0/156 (0%)
 Frame = +1

Query  76   QTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqk  255
            + KG   VPESVLKKQKR+EEWALAKKQEL A KKK++ENRKLI+ RAKQYAKEYE+Q K
Sbjct  4    EVKGAVPVPESVLKKQKRSEEWALAKKQELEAAKKKSSENRKLIYNRAKQYAKEYEQQDK  63

Query  256  eLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVN  435
            ELI LKREARLKGGFYV+PEAKLLFIIRIRGINAM P TKKILQLLRLRQIFNGVFLKVN
Sbjct  64   ELICLKREARLKGGFYVDPEAKLLFIIRIRGINAMPPQTKKILQLLRLRQIFNGVFLKVN  123

Query  436  KATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            KATVNMLH+VEPYVTYGYPNLKSVRELIYKRG+GKV
Sbjct  124  KATVNMLHRVEPYVTYGYPNLKSVRELIYKRGFGKV  159



>ref|XP_006596959.1| PREDICTED: uncharacterized protein LOC100500011 isoform X1 [Glycine 
max]
Length=272

 Score =   241 bits (615),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 137/173 (79%), Positives = 151/173 (87%), Gaps = 4/173 (2%)
 Frame = +1

Query  25   KRNCPVVSIAQLQMAEAQTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKL  204
            +R C   + + +QM EA+     +VPESV+KK+KRNEEWALAKKQEL A KK   E RKL
Sbjct  18   RRRCKQSTTSIIQMGEAKA----LVPESVVKKEKRNEEWALAKKQELDAAKKMRFETRKL  73

Query  205  IFCRakqyakeyeeqqkeLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKIL  384
            IF RAKQY+KEY+EQQKELI+LKREA+LKGGFYV PEAKLLFIIRIRGINAM P T+KIL
Sbjct  74   IFNRAKQYSKEYDEQQKELIRLKREAKLKGGFYVEPEAKLLFIIRIRGINAMDPKTRKIL  133

Query  385  QLLRLRQIFNGVFLKVNKATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            QLLRLRQIFNGVFLKVNKATVNMLH+VEPYVTYGYPNLKSVRELIYKRGYGKV
Sbjct  134  QLLRLRQIFNGVFLKVNKATVNMLHRVEPYVTYGYPNLKSVRELIYKRGYGKV  186



>ref|XP_010099900.1| 60S ribosomal protein L7-4 [Morus notabilis]
 gb|EXB80829.1| 60S ribosomal protein L7-4 [Morus notabilis]
Length=243

 Score =   240 bits (612),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 129/150 (86%), Positives = 144/150 (96%), Gaps = 0/150 (0%)
 Frame = +1

Query  94   VVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLK  273
            V+PESVLKK+KR +EWA+AKKQE+ A+KKKNAENRKLIF RAKQY+KEY +++KELIQLK
Sbjct  8    VIPESVLKKRKREDEWAVAKKQEVEALKKKNAENRKLIFNRAKQYSKEYAKKEKELIQLK  67

Query  274  REARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNM  453
            REA+LKGGFYV PEAKLLFIIRIRGINAMHP T+KILQLLRLRQIFNGVFLKVNKATVNM
Sbjct  68   REAKLKGGFYVEPEAKLLFIIRIRGINAMHPKTRKILQLLRLRQIFNGVFLKVNKATVNM  127

Query  454  LHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LH+VEPYVTYGYPNLKSV+ELIYKRGYGK+
Sbjct  128  LHRVEPYVTYGYPNLKSVKELIYKRGYGKL  157



>ref|XP_009788725.1| PREDICTED: 60S ribosomal protein L7-2-like [Nicotiana sylvestris]
Length=245

 Score =   240 bits (612),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 135/156 (87%), Positives = 145/156 (93%), Gaps = 0/156 (0%)
 Frame = +1

Query  76   QTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqk  255
            + KG   VPESVLKKQKR++EWALAK QEL A KKK+AENRKLI+ RAKQYAKEYE+Q K
Sbjct  4    EVKGAVPVPESVLKKQKRSQEWALAKMQELEAAKKKSAENRKLIYNRAKQYAKEYEQQDK  63

Query  256  eLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVN  435
            ELI+LKREARLKGGFYV+PEAKLLFIIRIRGINAM P TKKILQLLRLRQIFNGVFLKVN
Sbjct  64   ELIRLKREARLKGGFYVDPEAKLLFIIRIRGINAMAPQTKKILQLLRLRQIFNGVFLKVN  123

Query  436  KATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            KATVNMLH+VEPYVTYGYPNLKSVRELIYKRG+GKV
Sbjct  124  KATVNMLHRVEPYVTYGYPNLKSVRELIYKRGFGKV  159



>ref|XP_008460307.1| PREDICTED: 60S ribosomal protein L7-4-like isoform X2 [Cucumis 
melo]
Length=187

 Score =   238 bits (607),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 143/150 (95%), Gaps = 0/150 (0%)
 Frame = +1

Query  94   VVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLK  273
            ++P+SVLKK+KRNEEW LAK+QEL A KKKNAENRKLI+ RAK Y+KEYEEQ+KELI+LK
Sbjct  8    LIPDSVLKKRKRNEEWTLAKQQELEAAKKKNAENRKLIYNRAKLYSKEYEEQEKELIRLK  67

Query  274  REARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNM  453
            REA+LKGGFYV+PEAKLLFI RIRGINAMHP T+KILQLLRLRQIFNGVFLKVNKAT+NM
Sbjct  68   REAKLKGGFYVDPEAKLLFITRIRGINAMHPKTRKILQLLRLRQIFNGVFLKVNKATLNM  127

Query  454  LHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LH+VEPYVTYGYPNLKSV+ELIYKRGYGK+
Sbjct  128  LHRVEPYVTYGYPNLKSVKELIYKRGYGKL  157



>gb|KHN24635.1| 60S ribosomal protein L7-4 [Glycine soja]
Length=272

 Score =   241 bits (614),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 137/173 (79%), Positives = 151/173 (87%), Gaps = 4/173 (2%)
 Frame = +1

Query  25   KRNCPVVSIAQLQMAEAQTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKL  204
            +R C   + + +QM EA+     +VPESV+KK+KRNEEWALAKKQEL A KK   E RKL
Sbjct  18   RRRCKQCTTSIIQMGEAKA----LVPESVVKKEKRNEEWALAKKQELDAAKKMRFETRKL  73

Query  205  IFCRakqyakeyeeqqkeLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKIL  384
            IF RAKQY+KEY+EQQKELI+LKREA+LKGGFYV PEAKLLFIIRIRGINAM P T+KIL
Sbjct  74   IFNRAKQYSKEYDEQQKELIRLKREAKLKGGFYVEPEAKLLFIIRIRGINAMDPKTRKIL  133

Query  385  QLLRLRQIFNGVFLKVNKATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            QLLRLRQIFNGVFLKVNKATVNMLH+VEPYVTYGYPNLKSVRELIYKRGYGKV
Sbjct  134  QLLRLRQIFNGVFLKVNKATVNMLHRVEPYVTYGYPNLKSVRELIYKRGYGKV  186



>ref|XP_004246043.1| PREDICTED: 60S ribosomal protein L7-3 [Solanum lycopersicum]
Length=245

 Score =   240 bits (612),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = +1

Query  79   TKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqke  258
             KG   VPESVLKKQKR+EEWALAK QEL A KKK+AENRKLI+ RAKQYAKEY++Q+KE
Sbjct  5    VKGAVPVPESVLKKQKRSEEWALAKTQELVAAKKKSAENRKLIYNRAKQYAKEYDQQEKE  64

Query  259  LIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNK  438
            LI+LKREARLKGGFYV+PEAKLLFI RIRGINAM P TKKILQLLRLRQIFNGVFLKVNK
Sbjct  65   LIRLKREARLKGGFYVDPEAKLLFITRIRGINAMPPQTKKILQLLRLRQIFNGVFLKVNK  124

Query  439  ATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            ATVNMLH+VEPYVTYGYPNLKS+RELIYKRGYGKV
Sbjct  125  ATVNMLHRVEPYVTYGYPNLKSIRELIYKRGYGKV  159



>ref|XP_006359941.1| PREDICTED: 60S ribosomal protein L7-3-like [Solanum tuberosum]
Length=245

 Score =   240 bits (612),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = +1

Query  79   TKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqke  258
             KG   VPESVLKKQKR+EEWALAK QEL A KKK+AENRKLI+ RAKQYAKEY++Q+KE
Sbjct  5    VKGAVPVPESVLKKQKRSEEWALAKTQELVAAKKKSAENRKLIYNRAKQYAKEYDQQEKE  64

Query  259  LIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNK  438
            LI+LKREARLKGGFYV+PEAKLLFI RIRGINAM P TKKILQLLRLRQIFNGVFLKVNK
Sbjct  65   LIRLKREARLKGGFYVDPEAKLLFITRIRGINAMPPQTKKILQLLRLRQIFNGVFLKVNK  124

Query  439  ATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            ATVNMLH+VEPYVTYGYPNLKS+RELIYKRGYGKV
Sbjct  125  ATVNMLHRVEPYVTYGYPNLKSIRELIYKRGYGKV  159



>ref|XP_010063653.1| PREDICTED: 60S ribosomal protein L7-4 [Eucalyptus grandis]
Length=242

 Score =   239 bits (611),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 133/160 (83%), Positives = 147/160 (92%), Gaps = 4/160 (3%)
 Frame = +1

Query  64   MAEAQTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeye  243
            MAE +     VVPESVLKK+KRNEEWALAK QE+ A KKKN ENRKLI+ RAKQY++EYE
Sbjct  1    MAEVKA----VVPESVLKKRKRNEEWALAKNQEIEATKKKNVENRKLIYIRAKQYSQEYE  56

Query  244  eqqkeLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVF  423
            EQ+KELI LKREA+LKGGFYV+PEAKLLFIIRIRGINAMHP T+KILQLLRLRQIFNGVF
Sbjct  57   EQEKELIHLKREAKLKGGFYVDPEAKLLFIIRIRGINAMHPKTRKILQLLRLRQIFNGVF  116

Query  424  LKVNKATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LKVNKATVNMLH+VEPYVT+GYPNLKSVRELIYKRG+GK+
Sbjct  117  LKVNKATVNMLHRVEPYVTFGYPNLKSVRELIYKRGFGKL  156



>ref|NP_001276141.1| 60S ribosomal protein L7-4-like [Glycine max]
 gb|ACU19026.1| unknown [Glycine max]
Length=198

 Score =   238 bits (607),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 129/150 (86%), Positives = 142/150 (95%), Gaps = 0/150 (0%)
 Frame = +1

Query  94   VVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLK  273
            VVPESVLKKQKR EEWALAKKQ+L A KKK AE+RKLI+ RAKQYAKEY+ Q+KELI+LK
Sbjct  8    VVPESVLKKQKREEEWALAKKQDLEAAKKKRAESRKLIYNRAKQYAKEYDHQEKELIRLK  67

Query  274  REARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNM  453
            REA+LKGGFYV+PEAKLLFI+RIRGINAM P ++KILQLLRLRQIFNGVFLKVNKATVNM
Sbjct  68   REAKLKGGFYVDPEAKLLFIVRIRGINAMDPKSRKILQLLRLRQIFNGVFLKVNKATVNM  127

Query  454  LHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LH+VEPYVTYGYPNLKSVRELIYKRGYGK+
Sbjct  128  LHRVEPYVTYGYPNLKSVRELIYKRGYGKL  157



>ref|XP_011033034.1| PREDICTED: 60S ribosomal protein L7-4-like [Populus euphratica]
 ref|XP_011033035.1| PREDICTED: 60S ribosomal protein L7-4-like [Populus euphratica]
Length=243

 Score =   239 bits (610),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 132/150 (88%), Positives = 142/150 (95%), Gaps = 0/150 (0%)
 Frame = +1

Query  94   VVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLK  273
             VPESVLKK+KR EEWALAKKQELAA KKKNAENRK+IF RAKQY+KEYEEQ K+L+QLK
Sbjct  8    AVPESVLKKRKREEEWALAKKQELAATKKKNAENRKIIFNRAKQYSKEYEEQGKQLVQLK  67

Query  274  REARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNM  453
            REARLKGGFYV+PEAKLLFIIRIRGINAMHP T+ ILQLLRLRQIFNGVFLKVNKATVNM
Sbjct  68   REARLKGGFYVDPEAKLLFIIRIRGINAMHPKTRSILQLLRLRQIFNGVFLKVNKATVNM  127

Query  454  LHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            L +VEPYVTYGYPNLKSVRELIYKRG+GK+
Sbjct  128  LRRVEPYVTYGYPNLKSVRELIYKRGFGKL  157



>gb|ABK95515.1| unknown [Populus trichocarpa]
Length=243

 Score =   239 bits (610),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 132/150 (88%), Positives = 142/150 (95%), Gaps = 0/150 (0%)
 Frame = +1

Query  94   VVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLK  273
             VPESVLKK+KR EEWALAKKQELAA KKKNAENRK+IF RAKQY+KEYEEQ K+L+QLK
Sbjct  8    AVPESVLKKRKREEEWALAKKQELAATKKKNAENRKIIFKRAKQYSKEYEEQGKQLVQLK  67

Query  274  REARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNM  453
            REARLKGGFYV+PEAKLLFIIRIRGINAMHP T+ ILQLLRLRQIFNGVFLKVNKATVNM
Sbjct  68   REARLKGGFYVDPEAKLLFIIRIRGINAMHPKTRSILQLLRLRQIFNGVFLKVNKATVNM  127

Query  454  LHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            L +VEPYVTYGYPNLKSVRELIYKRG+GK+
Sbjct  128  LRRVEPYVTYGYPNLKSVRELIYKRGFGKL  157



>ref|XP_002310943.1| 60S ribosomal protein L7-2 [Populus trichocarpa]
 ref|XP_006379397.1| hypothetical protein POPTR_0008s00840g [Populus trichocarpa]
 gb|EEE88310.1| 60S ribosomal protein L7-2 [Populus trichocarpa]
 gb|ERP57194.1| hypothetical protein POPTR_0008s00840g [Populus trichocarpa]
Length=243

 Score =   239 bits (610),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 132/150 (88%), Positives = 142/150 (95%), Gaps = 0/150 (0%)
 Frame = +1

Query  94   VVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLK  273
             VPESVLKK+KR EEWALAKKQELAA KKKNAENRK+IF RAKQY+KEYEEQ K+L+QLK
Sbjct  8    AVPESVLKKRKREEEWALAKKQELAATKKKNAENRKIIFKRAKQYSKEYEEQGKQLVQLK  67

Query  274  REARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNM  453
            REARLKGGFYV+PEAKLLFIIRIRGINAMHP T+ ILQLLRLRQIFNGVFLKVNKATVNM
Sbjct  68   REARLKGGFYVDPEAKLLFIIRIRGINAMHPKTRSILQLLRLRQIFNGVFLKVNKATVNM  127

Query  454  LHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            L +VEPYVTYGYPNLKSVRELIYKRG+GK+
Sbjct  128  LRRVEPYVTYGYPNLKSVRELIYKRGFGKL  157



>gb|KCW45520.1| hypothetical protein EUGRSUZ_L00752 [Eucalyptus grandis]
Length=303

 Score =   241 bits (615),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 132/150 (88%), Positives = 144/150 (96%), Gaps = 0/150 (0%)
 Frame = +1

Query  94   VVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLK  273
            +VPESVLKKQKRNEEWALAKKQEL + K+KNAENRKLI+ RAKQYAKEY EQ+KELIQLK
Sbjct  68   IVPESVLKKQKRNEEWALAKKQELESAKQKNAENRKLIYNRAKQYAKEYAEQEKELIQLK  127

Query  274  REARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNM  453
            REA+L+GGFYV+PEAKLLFIIRIRGINAMHP T+ ILQLLRLRQIFNGVFLKVNKATVNM
Sbjct  128  REAKLRGGFYVDPEAKLLFIIRIRGINAMHPKTRTILQLLRLRQIFNGVFLKVNKATVNM  187

Query  454  LHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LH+VEPYVT+GYPNLKSVRELIYKRGYGK+
Sbjct  188  LHRVEPYVTFGYPNLKSVRELIYKRGYGKL  217



>ref|XP_010040056.1| PREDICTED: 60S ribosomal protein L7-2-like [Eucalyptus grandis]
Length=244

 Score =   239 bits (609),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 130/150 (87%), Positives = 144/150 (96%), Gaps = 0/150 (0%)
 Frame = +1

Query  94   VVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLK  273
            +VPESVLKKQKRNEEWALAKKQEL + K+KNAENRKLI+ RAKQYAKEY EQ+KELIQLK
Sbjct  9    IVPESVLKKQKRNEEWALAKKQELESAKQKNAENRKLIYDRAKQYAKEYAEQEKELIQLK  68

Query  274  REARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNM  453
            REA+L+GGFYV+PEAKLLFIIRIRGINAMHP T+ ILQLLRLRQIFNGVFLKVNKATVN+
Sbjct  69   REAKLRGGFYVDPEAKLLFIIRIRGINAMHPKTRTILQLLRLRQIFNGVFLKVNKATVNI  128

Query  454  LHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LH+VEPYVT+GYPNLK+VRELIYKRGYGK+
Sbjct  129  LHRVEPYVTFGYPNLKNVRELIYKRGYGKL  158



>gb|KCW70888.1| hypothetical protein EUGRSUZ_F04018 [Eucalyptus grandis]
Length=301

 Score =   241 bits (614),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 133/161 (83%), Positives = 148/161 (92%), Gaps = 4/161 (2%)
 Frame = +1

Query  61   QMAEAQTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakey  240
            +MAE +     VVPESVLKK+KRNEEWALAK QE+ A KKKN ENRKLI+ RAKQY++EY
Sbjct  59   EMAEVKA----VVPESVLKKRKRNEEWALAKNQEIEATKKKNVENRKLIYIRAKQYSQEY  114

Query  241  eeqqkeLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGV  420
            EEQ+KELI LKREA+LKGGFYV+PEAKLLFIIRIRGINAMHP T+KILQLLRLRQIFNGV
Sbjct  115  EEQEKELIHLKREAKLKGGFYVDPEAKLLFIIRIRGINAMHPKTRKILQLLRLRQIFNGV  174

Query  421  FLKVNKATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            FLKVNKATVNMLH+VEPYVT+GYPNLKSVRELIYKRG+GK+
Sbjct  175  FLKVNKATVNMLHRVEPYVTFGYPNLKSVRELIYKRGFGKL  215



>ref|XP_010104963.1| 60S ribosomal protein L7-2 [Morus notabilis]
 gb|EXC02652.1| 60S ribosomal protein L7-2 [Morus notabilis]
Length=243

 Score =   239 bits (609),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 126/150 (84%), Positives = 142/150 (95%), Gaps = 0/150 (0%)
 Frame = +1

Query  94   VVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLK  273
            ++PESVLKK+KR EEWALAKKQE+ A+KKKNAENRKLIF RA QY KEY +++KE+IQLK
Sbjct  8    IIPESVLKKRKREEEWALAKKQEIEALKKKNAENRKLIFNRANQYYKEYADKEKEVIQLK  67

Query  274  REARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNM  453
            REA+LKGGFYV PEAKLLFI+RIRGINAMHP T+KILQLLRLRQIFNGVFLKVNKAT+NM
Sbjct  68   REAKLKGGFYVEPEAKLLFIVRIRGINAMHPKTRKILQLLRLRQIFNGVFLKVNKATMNM  127

Query  454  LHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LH+VEPYVTYGYPNLKSV+ELIYKRGYGK+
Sbjct  128  LHRVEPYVTYGYPNLKSVKELIYKRGYGKL  157



>ref|XP_009782941.1| PREDICTED: 60S ribosomal protein L7-4 [Nicotiana sylvestris]
 ref|XP_009782943.1| PREDICTED: 60S ribosomal protein L7-4 [Nicotiana sylvestris]
Length=240

 Score =   238 bits (607),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 134/153 (88%), Positives = 143/153 (93%), Gaps = 0/153 (0%)
 Frame = +1

Query  85   GGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLI  264
            G   VPESVLKKQKR+EEWAL  KQEL A KKKNAENRKLI+ RAKQY+KEYEEQ+KELI
Sbjct  2    GETPVPESVLKKQKRSEEWALLNKQELEAAKKKNAENRKLIYNRAKQYSKEYEEQEKELI  61

Query  265  QLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKAT  444
            +LKREARLKGGFYV+PEAKLLFIIRIRGINAM P TKKILQLLRLRQIFNGVFLKVNKAT
Sbjct  62   RLKREARLKGGFYVDPEAKLLFIIRIRGINAMAPQTKKILQLLRLRQIFNGVFLKVNKAT  121

Query  445  VNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            VNMLH+VEPYVTYGYPNLKS+RELIYKRGYGK+
Sbjct  122  VNMLHRVEPYVTYGYPNLKSIRELIYKRGYGKL  154



>ref|XP_007223754.1| hypothetical protein PRUPE_ppa010542mg [Prunus persica]
 ref|XP_008223860.1| PREDICTED: 60S ribosomal protein L7-2-like [Prunus mume]
 gb|EMJ24953.1| hypothetical protein PRUPE_ppa010542mg [Prunus persica]
Length=245

 Score =   238 bits (608),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 132/156 (85%), Positives = 146/156 (94%), Gaps = 0/156 (0%)
 Frame = +1

Query  76   QTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqk  255
            + K GPVVPESVLKK+KR E+WALAKKQ L + KKKN+ENRKLI+ RAKQYAKEY+EQQK
Sbjct  4    EVKAGPVVPESVLKKRKREEQWALAKKQGLESAKKKNSENRKLIYNRAKQYAKEYDEQQK  63

Query  256  eLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVN  435
            ELI LKREA+LKGGFYVNPEAKLLFI+RIRGINA+ P TKKILQLLRLRQIFNGVFLKVN
Sbjct  64   ELISLKREAKLKGGFYVNPEAKLLFIVRIRGINAIDPKTKKILQLLRLRQIFNGVFLKVN  123

Query  436  KATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            KAT+NMLH+VEPYVTYGYPNLKSV+ELIYKRGYGK+
Sbjct  124  KATLNMLHRVEPYVTYGYPNLKSVKELIYKRGYGKL  159



>emb|CBI17892.3| unnamed protein product [Vitis vinifera]
Length=305

 Score =   240 bits (612),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 134/152 (88%), Positives = 144/152 (95%), Gaps = 0/152 (0%)
 Frame = +1

Query  88   GPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQ  267
            G VVPESVLKK+KR+EEWALAKKQEL   KKKNA NR LI+ RAKQYAKEY+EQQKELIQ
Sbjct  8    GVVVPESVLKKRKRSEEWALAKKQELECTKKKNATNRTLIYVRAKQYAKEYDEQQKELIQ  67

Query  268  LKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATV  447
            LKREA+LKGGFYV+PEAKLLFIIRIRGINAMHP T+KILQLLRLRQIFNGVFLKVNKAT+
Sbjct  68   LKREAKLKGGFYVSPEAKLLFIIRIRGINAMHPKTRKILQLLRLRQIFNGVFLKVNKATM  127

Query  448  NMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            NMLH+VEPYVTYGYPNLKSVRELIYKRGYGK+
Sbjct  128  NMLHRVEPYVTYGYPNLKSVRELIYKRGYGKL  159



>gb|KDO61963.1| hypothetical protein CISIN_1g026136mg [Citrus sinensis]
 gb|KDO61964.1| hypothetical protein CISIN_1g026136mg [Citrus sinensis]
Length=243

 Score =   237 bits (604),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 135/160 (84%), Positives = 145/160 (91%), Gaps = 3/160 (2%)
 Frame = +1

Query  64   MAEAQTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeye  243
            MAEA      VVPESVLKK+KR EEWALAKKQEL A KKK AE RKLI+ R KQYAKEY+
Sbjct  1    MAEA---AAVVVPESVLKKKKREEEWALAKKQELEAAKKKKAETRKLIYNRTKQYAKEYD  57

Query  244  eqqkeLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVF  423
            E+QKELI+LKREA+LKGGFYVNPEAKLLFIIRIRGINA+ P TKKILQLLRLRQIFNGVF
Sbjct  58   EEQKELIRLKREAKLKGGFYVNPEAKLLFIIRIRGINAVDPKTKKILQLLRLRQIFNGVF  117

Query  424  LKVNKATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LKVNKAT+NMLH+VEPYVTYGYPNLKSVRELIYKRGYGK+
Sbjct  118  LKVNKATLNMLHRVEPYVTYGYPNLKSVRELIYKRGYGKL  157



>ref|XP_004507013.1| PREDICTED: 60S ribosomal protein L7-4-like isoform X1 [Cicer 
arietinum]
 ref|XP_004507014.1| PREDICTED: 60S ribosomal protein L7-4-like isoform X2 [Cicer 
arietinum]
Length=243

 Score =   236 bits (603),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 129/150 (86%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = +1

Query  94   VVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLK  273
            +VPESVLKKQKR EEWALAKKQE  A KKK AENRKLI+ RAKQY++EYEEQ KELIQLK
Sbjct  8    IVPESVLKKQKREEEWALAKKQESEAAKKKRAENRKLIYSRAKQYSQEYEEQDKELIQLK  67

Query  274  REARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNM  453
            REA+LKGGFYV+PEAKL+FIIRIRGINAM P T+KILQL RLRQIFNGVFLKVNKAT+NM
Sbjct  68   REAKLKGGFYVDPEAKLVFIIRIRGINAMDPKTRKILQLFRLRQIFNGVFLKVNKATMNM  127

Query  454  LHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LH+VEPYVTYGYPNLKSVRELIYKRGYGK+
Sbjct  128  LHRVEPYVTYGYPNLKSVRELIYKRGYGKL  157



>gb|ACV83305.2| hypothetical protein UP-4 [Dimocarpus longan]
Length=244

 Score =   236 bits (602),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 132/157 (84%), Positives = 143/157 (91%), Gaps = 0/157 (0%)
 Frame = +1

Query  73   AQTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqq  252
            AQ +   VVPESVLKK+KR EEWA AKKQEL A KKK + NRKLI+ RAKQY+KEYE+Q+
Sbjct  2    AQVEAKVVVPESVLKKRKREEEWAFAKKQELEAAKKKRSANRKLIYNRAKQYSKEYEQQE  61

Query  253  keLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKV  432
            KELIQLKREA+LKGGFYV PEAKLLFIIRIRGINAM P T+KILQLLRLRQIFNGVFLKV
Sbjct  62   KELIQLKREAKLKGGFYVEPEAKLLFIIRIRGINAMDPKTRKILQLLRLRQIFNGVFLKV  121

Query  433  NKATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            NKATVNMLH+VEPYVTYGYPNLKSVRELIYKRGYGK+
Sbjct  122  NKATVNMLHRVEPYVTYGYPNLKSVRELIYKRGYGKL  158



>gb|KHG17811.1| 60S ribosomal L7-4 -like protein [Gossypium arboreum]
Length=243

 Score =   236 bits (602),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 130/150 (87%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = +1

Query  94   VVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLK  273
            +VPES+LKK KRNEEW LAKKQEL A KKKN ENRKLIF RAKQYAKEYE Q+KELIQLK
Sbjct  8    LVPESLLKKNKRNEEWELAKKQELEAAKKKNVENRKLIFNRAKQYAKEYEAQEKELIQLK  67

Query  274  REARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNM  453
            REA+LKGGFYV+PEAKLLFI+RIRGINAMHP T+KILQLLRLRQIFNGVFLKVNKAT+NM
Sbjct  68   REAKLKGGFYVDPEAKLLFIVRIRGINAMHPRTRKILQLLRLRQIFNGVFLKVNKATMNM  127

Query  454  LHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LH VEPYVTYGYPNLKSVREL+YKRG+GK+
Sbjct  128  LHLVEPYVTYGYPNLKSVRELVYKRGFGKL  157



>gb|KDP35522.1| hypothetical protein JCGZ_08960 [Jatropha curcas]
Length=245

 Score =   236 bits (602),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 128/160 (80%), Positives = 146/160 (91%), Gaps = 1/160 (1%)
 Frame = +1

Query  64   MAEAQTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeye  243
            MAE QTK G +VPESVLKK+KR+EEWALAK QEL   K+KNAE+RK+I+ RA++Y KEY 
Sbjct  1    MAE-QTKAGAIVPESVLKKRKRSEEWALAKSQELKIKKEKNAESRKIIYKRAEKYVKEYS  59

Query  244  eqqkeLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVF  423
            E+++ELI LKREA+LKGGFYV PEAKLLFIIRIRGINAM P T+KILQLLRLRQIFNGVF
Sbjct  60   EKERELITLKREAKLKGGFYVEPEAKLLFIIRIRGINAMDPKTRKILQLLRLRQIFNGVF  119

Query  424  LKVNKATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LKVNKAT++MLH+VEPYVTYGYPNLKSVRELIYKRGYGK+
Sbjct  120  LKVNKATMSMLHRVEPYVTYGYPNLKSVRELIYKRGYGKL  159



>ref|XP_002517516.1| 60S ribosomal protein L7, putative [Ricinus communis]
 gb|EEF45058.1| 60S ribosomal protein L7, putative [Ricinus communis]
Length=243

 Score =   236 bits (602),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 132/150 (88%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = +1

Query  94   VVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLK  273
            +VPESVLKK KRNEEWALAKKQEL A KKK  E+RKLIF RAK YAKEY++QQKELIQLK
Sbjct  8    MVPESVLKKTKRNEEWALAKKQELEASKKKAKESRKLIFNRAKLYAKEYDQQQKELIQLK  67

Query  274  REARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNM  453
            REA+LKGGFYVNPEAKLLFIIRIRGINA+ P T+KILQLLRLRQIFNGVFLKVNKATVNM
Sbjct  68   REAKLKGGFYVNPEAKLLFIIRIRGINAIDPKTRKILQLLRLRQIFNGVFLKVNKATVNM  127

Query  454  LHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LH+VEPYVTYGYPNLKSV+ELIYKRGYGKV
Sbjct  128  LHRVEPYVTYGYPNLKSVKELIYKRGYGKV  157



>ref|XP_007015363.1| Ribosomal protein L30/L7 family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007015364.1| Ribosomal protein L30/L7 family protein isoform 1 [Theobroma 
cacao]
 gb|EOY32982.1| Ribosomal protein L30/L7 family protein isoform 1 [Theobroma 
cacao]
 gb|EOY32983.1| Ribosomal protein L30/L7 family protein isoform 1 [Theobroma 
cacao]
Length=243

 Score =   236 bits (602),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 129/150 (86%), Positives = 142/150 (95%), Gaps = 0/150 (0%)
 Frame = +1

Query  94   VVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLK  273
            V+PES+LKK+KRNEEW LAKKQEL A KKK  E+RKLI+ RAKQYAKEYE Q+KELIQLK
Sbjct  8    VIPESLLKKRKRNEEWELAKKQELEAAKKKKVESRKLIYNRAKQYAKEYEAQEKELIQLK  67

Query  274  REARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNM  453
            REA+LKGGFYV+PEAKLLFI+RIRGINAMHP T+KILQLLRLRQIFNGVFLKVNKAT+NM
Sbjct  68   REAKLKGGFYVDPEAKLLFIVRIRGINAMHPRTRKILQLLRLRQIFNGVFLKVNKATMNM  127

Query  454  LHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LH+VEPYVTYGYPNLKSVRELIYKRGYGK+
Sbjct  128  LHRVEPYVTYGYPNLKSVRELIYKRGYGKL  157



>ref|NP_187967.1| 60S ribosomal protein L7-4 [Arabidopsis thaliana]
 ref|NP_974304.1| 60S ribosomal protein L7-4 [Arabidopsis thaliana]
 ref|NP_974305.1| 60S ribosomal protein L7-4 [Arabidopsis thaliana]
 sp|Q9LHP1.1|RL74_ARATH RecName: Full=60S ribosomal protein L7-4 [Arabidopsis thaliana]
 dbj|BAB02600.1| 60S ribosomal protein L7 [Arabidopsis thaliana]
 gb|AAK64004.1| AT3g13580/K20M4_2 [Arabidopsis thaliana]
 gb|AAL06999.1| AT3g13580/K20M4_2 [Arabidopsis thaliana]
 gb|AAL76153.1| AT3g13580/K20M4_2 [Arabidopsis thaliana]
 gb|AEE75376.1| 60S ribosomal protein L7-4 [Arabidopsis thaliana]
 gb|AEE75377.1| 60S ribosomal protein L7-4 [Arabidopsis thaliana]
 gb|AEE75378.1| 60S ribosomal protein L7-4 [Arabidopsis thaliana]
Length=244

 Score =   236 bits (602),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 131/160 (82%), Positives = 148/160 (93%), Gaps = 2/160 (1%)
 Frame = +1

Query  64   MAEAQTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeye  243
            M EA++K   VVPESVLKK+KR EEWALAKKQEL A KK+NAE RKLIF RAKQY+KEY+
Sbjct  1    MTEAESK--TVVPESVLKKRKREEEWALAKKQELEAAKKQNAEKRKLIFNRAKQYSKEYQ  58

Query  244  eqqkeLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVF  423
            E+++ELIQLKREA+LKGGFYV+PEAKLLFIIRIRGINA+ P TKKILQLLRLRQIFNGVF
Sbjct  59   EKERELIQLKREAKLKGGFYVDPEAKLLFIIRIRGINAIDPKTKKILQLLRLRQIFNGVF  118

Query  424  LKVNKATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LKVNKAT+NML +VEPYVTYGYPNLKSV+ELIYKRG+GK+
Sbjct  119  LKVNKATINMLRRVEPYVTYGYPNLKSVKELIYKRGFGKL  158



>ref|XP_004144427.1| PREDICTED: 60S ribosomal protein L7-4-like isoform 2 [Cucumis 
sativus]
 gb|KGN58435.1| hypothetical protein Csa_3G643750 [Cucumis sativus]
Length=243

 Score =   236 bits (601),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 142/150 (95%), Gaps = 0/150 (0%)
 Frame = +1

Query  94   VVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLK  273
            + PESVLKK+KRNEEW LAK+QEL A KKKNAENRKLI+ RAK Y+KEYEEQ+KELI+LK
Sbjct  8    LTPESVLKKRKRNEEWTLAKQQELEAAKKKNAENRKLIYNRAKLYSKEYEEQEKELIRLK  67

Query  274  REARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNM  453
            REA+LKGGFYV+PEAKLLFI RIRGINAMHP T+KILQLLRLRQIFNGVFLKVNKAT+NM
Sbjct  68   REAKLKGGFYVDPEAKLLFITRIRGINAMHPKTRKILQLLRLRQIFNGVFLKVNKATLNM  127

Query  454  LHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LH+VEPYVTYGYPNLKSV+ELIYKRGYGK+
Sbjct  128  LHRVEPYVTYGYPNLKSVKELIYKRGYGKL  157



>ref|XP_004488017.1| PREDICTED: 60S ribosomal protein L7-4-like [Cicer arietinum]
Length=244

 Score =   236 bits (601),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 129/150 (86%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = +1

Query  94   VVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLK  273
            VVPESVLKKQKR+EEWALAKKQEL + KKK +E RKLI+ RAKQYAKEY++ QKELI LK
Sbjct  9    VVPESVLKKQKRSEEWALAKKQELESAKKKRSETRKLIWSRAKQYAKEYDDAQKELISLK  68

Query  274  REARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNM  453
            REA+LKGGFYV+PEAKLLFIIRIRGINAM P ++KILQLLRLRQIFNGVFLKVNKATVNM
Sbjct  69   REAKLKGGFYVDPEAKLLFIIRIRGINAMDPKSRKILQLLRLRQIFNGVFLKVNKATVNM  128

Query  454  LHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LH+VEPYVT+GYPNLKSVRELIYKRGYGKV
Sbjct  129  LHRVEPYVTFGYPNLKSVRELIYKRGYGKV  158



>ref|XP_006582827.1| PREDICTED: uncharacterized protein LOC100305682 isoform X1 [Glycine 
max]
 gb|KHN04208.1| 60S ribosomal protein L7-4 [Glycine soja]
Length=246

 Score =   236 bits (601),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 132/160 (83%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = +1

Query  64   MAEAQTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeye  243
            M E   +   VVPESVLKK+KR EEWALAKKQEL A KKK AE+RKLI+ RAKQYAKEY+
Sbjct  1    MTEMGEEVKVVVPESVLKKRKREEEWALAKKQELDAAKKKRAESRKLIYNRAKQYAKEYD  60

Query  244  eqqkeLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVF  423
             Q+KELI+LKREA+LKGGFYV+PEAKLLFIIRIRGINAM P ++KILQLLRLRQIFNGVF
Sbjct  61   HQEKELIRLKREAKLKGGFYVDPEAKLLFIIRIRGINAMDPKSRKILQLLRLRQIFNGVF  120

Query  424  LKVNKATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LKVNKATVNMLH+VEPYVTYGYPNLKSVRELIYKRGYGK+
Sbjct  121  LKVNKATVNMLHRVEPYVTYGYPNLKSVRELIYKRGYGKL  160



>gb|AFK47136.1| unknown [Lotus japonicus]
Length=243

 Score =   236 bits (601),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 129/149 (87%), Positives = 143/149 (96%), Gaps = 0/149 (0%)
 Frame = +1

Query  97   VPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLKR  276
            VPESVLKK++R EEWALAKKQE+ A KKK AE+RKLI+ RAKQYAKEY+EQ+KELI+LKR
Sbjct  9    VPESVLKKRRREEEWALAKKQEVEAAKKKRAESRKLIYSRAKQYAKEYDEQEKELIRLKR  68

Query  277  EARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNML  456
            EA+LKGGFYV+PEAKLLFIIRIRGINAMHP T+KILQLLRLRQIFNGVFLKVNKATVNML
Sbjct  69   EAKLKGGFYVDPEAKLLFIIRIRGINAMHPKTRKILQLLRLRQIFNGVFLKVNKATVNML  128

Query  457  HKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            H+VEPYVT+GYPNLKSVRELIYKRGYGK+
Sbjct  129  HRVEPYVTFGYPNLKSVRELIYKRGYGKL  157



>ref|XP_006585662.1| PREDICTED: 60S ribosomal protein L7-4-like [Glycine max]
 gb|KHN38077.1| 60S ribosomal protein L7-4 [Glycine soja]
Length=243

 Score =   236 bits (601),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 129/150 (86%), Positives = 142/150 (95%), Gaps = 0/150 (0%)
 Frame = +1

Query  94   VVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLK  273
            VVPESVLKKQKR EEWALAKKQ+L A KKK AE+RKLI+ RAKQYAKEY+ Q+KELI+LK
Sbjct  8    VVPESVLKKQKREEEWALAKKQDLEAAKKKRAESRKLIYNRAKQYAKEYDHQEKELIRLK  67

Query  274  REARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNM  453
            REA+LKGGFYV+PEAKLLFI+RIRGINAM P ++KILQLLRLRQIFNGVFLKVNKATVNM
Sbjct  68   REAKLKGGFYVDPEAKLLFIVRIRGINAMDPKSRKILQLLRLRQIFNGVFLKVNKATVNM  127

Query  454  LHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LH+VEPYVTYGYPNLKSVRELIYKRGYGK+
Sbjct  128  LHRVEPYVTYGYPNLKSVRELIYKRGYGKL  157



>ref|XP_008460306.1| PREDICTED: 60S ribosomal protein L7-2-like isoform X1 [Cucumis 
melo]
Length=243

 Score =   235 bits (600),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 143/150 (95%), Gaps = 0/150 (0%)
 Frame = +1

Query  94   VVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLK  273
            ++P+SVLKK+KRNEEW LAK+QEL A KKKNAENRKLI+ RAK Y+KEYEEQ+KELI+LK
Sbjct  8    LIPDSVLKKRKRNEEWTLAKQQELEAAKKKNAENRKLIYNRAKLYSKEYEEQEKELIRLK  67

Query  274  REARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNM  453
            REA+LKGGFYV+PEAKLLFI RIRGINAMHP T+KILQLLRLRQIFNGVFLKVNKAT+NM
Sbjct  68   REAKLKGGFYVDPEAKLLFITRIRGINAMHPKTRKILQLLRLRQIFNGVFLKVNKATLNM  127

Query  454  LHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LH+VEPYVTYGYPNLKSV+ELIYKRGYGK+
Sbjct  128  LHRVEPYVTYGYPNLKSVKELIYKRGYGKL  157



>gb|AGV54399.1| 60S ribosomal protein L7-4-like protein [Phaseolus vulgaris]
Length=243

 Score =   235 bits (600),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 129/150 (86%), Positives = 143/150 (95%), Gaps = 0/150 (0%)
 Frame = +1

Query  94   VVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLK  273
            +VPESVLKK+KR EEWALAKKQEL A KKK AE+RKLI+ RAKQYAKEY++Q+KELIQLK
Sbjct  8    IVPESVLKKRKREEEWALAKKQELEAAKKKRAESRKLIYNRAKQYAKEYDQQEKELIQLK  67

Query  274  REARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNM  453
            REA+LKGGFYV+PEAKLLFIIRIRGINAM P ++KILQLLRLRQIFNGVFLKVNKATVNM
Sbjct  68   REAKLKGGFYVDPEAKLLFIIRIRGINAMDPKSRKILQLLRLRQIFNGVFLKVNKATVNM  127

Query  454  LHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LH+VEPYVTYGYPNLKSV+ELIYKRGYGK+
Sbjct  128  LHRVEPYVTYGYPNLKSVKELIYKRGYGKL  157



>ref|XP_002263512.2| PREDICTED: LOW QUALITY PROTEIN: 60S ribosomal protein L7-2 [Vitis 
vinifera]
Length=246

 Score =   235 bits (600),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 132/160 (83%), Positives = 144/160 (90%), Gaps = 0/160 (0%)
 Frame = +1

Query  64   MAEAQTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeye  243
            M E + KGGPV+PESVLKKQKR+EEW L KKQE+ A KKKNAEN KLI+ RAKQYAKEYE
Sbjct  1    MGEEEAKGGPVLPESVLKKQKRSEEWTLXKKQEVEAKKKKNAENGKLIYSRAKQYAKEYE  60

Query  244  eqqkeLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVF  423
            EQQKELIQLK EA+LKGGFYV+PE KLLF+IRIRGINAMHP  +KILQLLRLRQIFNGVF
Sbjct  61   EQQKELIQLKHEAKLKGGFYVDPEVKLLFVIRIRGINAMHPKMRKILQLLRLRQIFNGVF  120

Query  424  LKVNKATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LKVNKAT+N LH+VEPYVTYGYPNLKSV ELIYKRGY K+
Sbjct  121  LKVNKATMNKLHRVEPYVTYGYPNLKSVXELIYKRGYRKL  160



>ref|XP_006582828.1| PREDICTED: uncharacterized protein LOC100305682 isoform X2 [Glycine 
max]
Length=243

 Score =   235 bits (600),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 130/150 (87%), Positives = 142/150 (95%), Gaps = 0/150 (0%)
 Frame = +1

Query  94   VVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLK  273
            VVPESVLKK+KR EEWALAKKQEL A KKK AE+RKLI+ RAKQYAKEY+ Q+KELI+LK
Sbjct  8    VVPESVLKKRKREEEWALAKKQELDAAKKKRAESRKLIYNRAKQYAKEYDHQEKELIRLK  67

Query  274  REARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNM  453
            REA+LKGGFYV+PEAKLLFIIRIRGINAM P ++KILQLLRLRQIFNGVFLKVNKATVNM
Sbjct  68   REAKLKGGFYVDPEAKLLFIIRIRGINAMDPKSRKILQLLRLRQIFNGVFLKVNKATVNM  127

Query  454  LHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LH+VEPYVTYGYPNLKSVRELIYKRGYGK+
Sbjct  128  LHRVEPYVTYGYPNLKSVRELIYKRGYGKL  157



>ref|XP_010678597.1| PREDICTED: 60S ribosomal protein L7-2 [Beta vulgaris subsp. vulgaris]
Length=244

 Score =   235 bits (600),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 132/160 (83%), Positives = 143/160 (89%), Gaps = 2/160 (1%)
 Frame = +1

Query  64   MAEAQTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeye  243
            M E  TK   VVPESVLKKQKR EEWALAKKQEL A KK+ AENRK+IF RA+QY+KEYE
Sbjct  1    MGEEATK--VVVPESVLKKQKREEEWALAKKQELDAQKKQRAENRKIIFKRAQQYSKEYE  58

Query  244  eqqkeLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVF  423
             Q+KE I L+REA+LKGGFYV PEAKLLFIIRIRGINAMHP T+ ILQLLRLRQIFNGVF
Sbjct  59   NQEKEAISLRREAKLKGGFYVEPEAKLLFIIRIRGINAMHPKTRSILQLLRLRQIFNGVF  118

Query  424  LKVNKATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LKVNKAT+NMLH+VEP+VTYGYPNLKSVRELIYKRGYGKV
Sbjct  119  LKVNKATLNMLHRVEPFVTYGYPNLKSVRELIYKRGYGKV  158



>ref|XP_007023816.1| Ribosomal protein L30/L7 family protein [Theobroma cacao]
 gb|EOY26438.1| Ribosomal protein L30/L7 family protein [Theobroma cacao]
Length=243

 Score =   235 bits (600),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 130/150 (87%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = +1

Query  94   VVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLK  273
            V+PES+LKKQKRNEEW LAKKQEL A KKK AE+RK+I+ RAKQYAKEYE Q+KELIQLK
Sbjct  8    VIPESLLKKQKRNEEWELAKKQELEAAKKKKAEDRKVIYNRAKQYAKEYETQEKELIQLK  67

Query  274  REARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNM  453
            REA+LKGGFYV+PEAKLLFIIRIRGINAMHP T+KILQLLRLRQIFNGVFLKVNKAT+NM
Sbjct  68   REAKLKGGFYVDPEAKLLFIIRIRGINAMHPRTRKILQLLRLRQIFNGVFLKVNKATMNM  127

Query  454  LHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LH VEPYVTYGYPN KSVRELIYKRGYGK+
Sbjct  128  LHLVEPYVTYGYPNHKSVRELIYKRGYGKL  157



>ref|XP_006453224.1| hypothetical protein CICLE_v10009162mg [Citrus clementina]
 ref|XP_006453225.1| hypothetical protein CICLE_v10009162mg [Citrus clementina]
 ref|XP_006474288.1| PREDICTED: 60S ribosomal protein L7-4-like isoform X1 [Citrus 
sinensis]
 ref|XP_006474289.1| PREDICTED: 60S ribosomal protein L7-4-like isoform X2 [Citrus 
sinensis]
 gb|ESR66464.1| hypothetical protein CICLE_v10009162mg [Citrus clementina]
 gb|ESR66465.1| hypothetical protein CICLE_v10009162mg [Citrus clementina]
Length=243

 Score =   235 bits (600),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 134/160 (84%), Positives = 145/160 (91%), Gaps = 3/160 (2%)
 Frame = +1

Query  64   MAEAQTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeye  243
            MAEA      VVPESVLKK+KR EEWALAKKQEL A KKK AE RKLI+ R KQYAKEY+
Sbjct  1    MAEA---AAVVVPESVLKKKKREEEWALAKKQELEAAKKKKAETRKLIYNRTKQYAKEYD  57

Query  244  eqqkeLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVF  423
            E+QKELI+LKREA+LKGGFYVNPEAKLLFIIRIRGINA+ P TKKILQLLRLRQIFNGVF
Sbjct  58   EEQKELIRLKREAKLKGGFYVNPEAKLLFIIRIRGINAVDPKTKKILQLLRLRQIFNGVF  117

Query  424  LKVNKATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LKVNKAT+NMLH+VEPYVTYGYPNLKSV+ELIYKRGYGK+
Sbjct  118  LKVNKATLNMLHRVEPYVTYGYPNLKSVKELIYKRGYGKL  157



>gb|AFK37004.1| unknown [Lotus japonicus]
Length=245

 Score =   235 bits (600),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 130/150 (87%), Positives = 142/150 (95%), Gaps = 0/150 (0%)
 Frame = +1

Query  94   VVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLK  273
            VVPESVLKKQKRNEEWALA KQ+L A KKK A +RKLI+ RA+QYAKEY+EQQKEL++LK
Sbjct  10   VVPESVLKKQKRNEEWALATKQQLEAAKKKRAVSRKLIWSRAQQYAKEYDEQQKELVRLK  69

Query  274  REARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNM  453
            REA+LKGGFYVNPEAKLLFI+RIRGINAMHP T+KILQLLRLRQIFNGVFLKVNKATVNM
Sbjct  70   REAKLKGGFYVNPEAKLLFIVRIRGINAMHPKTRKILQLLRLRQIFNGVFLKVNKATVNM  129

Query  454  LHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            L +VEPYVTYGYPNLKS+RELIYKRGYGKV
Sbjct  130  LQRVEPYVTYGYPNLKSIRELIYKRGYGKV  159



>ref|XP_002882831.1| hypothetical protein ARALYDRAFT_478749 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59090.1| hypothetical protein ARALYDRAFT_478749 [Arabidopsis lyrata subsp. 
lyrata]
Length=244

 Score =   235 bits (599),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 131/160 (82%), Positives = 147/160 (92%), Gaps = 2/160 (1%)
 Frame = +1

Query  64   MAEAQTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeye  243
            M EA++K   VVPESVLKK+KR EEWALAKKQEL A KK+NAE RKLIF RAKQY+KEY+
Sbjct  1    MTEAESK--TVVPESVLKKRKREEEWALAKKQELEAAKKQNAEKRKLIFNRAKQYSKEYQ  58

Query  244  eqqkeLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVF  423
            E+++ELIQLKREA+LKGGFYV+PEAKLLFIIRIRGINA+ P TKKILQLLRLRQIFNGVF
Sbjct  59   EKERELIQLKREAKLKGGFYVDPEAKLLFIIRIRGINAIDPKTKKILQLLRLRQIFNGVF  118

Query  424  LKVNKATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LKVNKAT+NML +VEPYVTYGYPNLKSV ELIYKRG+GK+
Sbjct  119  LKVNKATINMLRRVEPYVTYGYPNLKSVTELIYKRGFGKL  158



>gb|KJB35653.1| hypothetical protein B456_006G122600 [Gossypium raimondii]
Length=240

 Score =   235 bits (599),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 130/150 (87%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = +1

Query  94   VVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLK  273
            VVPES+LKK KRNEEW LAKKQEL   KKK  ENRKLI+ RAKQYAKEY  Q+KELIQLK
Sbjct  8    VVPESLLKKNKRNEEWELAKKQELEVAKKKKVENRKLIYSRAKQYAKEYGAQEKELIQLK  67

Query  274  REARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNM  453
            REARLKGGFYV+PEAKLLFIIRIRGINAMHP T+KILQLLRLRQIFNGVFLKVNKAT+NM
Sbjct  68   REARLKGGFYVDPEAKLLFIIRIRGINAMHPRTRKILQLLRLRQIFNGVFLKVNKATMNM  127

Query  454  LHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LH VEPYVTYGYPNLKSVRELIYKRG+GK+
Sbjct  128  LHLVEPYVTYGYPNLKSVRELIYKRGFGKL  157



>ref|XP_010465202.1| PREDICTED: 60S ribosomal protein L7-4 [Camelina sativa]
Length=244

 Score =   235 bits (599),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 129/160 (81%), Positives = 147/160 (92%), Gaps = 2/160 (1%)
 Frame = +1

Query  64   MAEAQTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeye  243
            M EA++K   VVPESVLKK+KR EEWALAKKQEL A KK+NA+ RKLIF RAKQY+KEY+
Sbjct  1    MTEAESK--TVVPESVLKKRKREEEWALAKKQELEAAKKQNADKRKLIFNRAKQYSKEYQ  58

Query  244  eqqkeLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVF  423
            E++ ELIQLKREA+LKGGFYV+PEAKLLFIIRIRGINA+ P TKKILQLLRLRQIFNGVF
Sbjct  59   EKEMELIQLKREAKLKGGFYVDPEAKLLFIIRIRGINAIDPKTKKILQLLRLRQIFNGVF  118

Query  424  LKVNKATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LKVNKAT+NML +VEPYVTYGYPNLKSV+EL+YKRG+GK+
Sbjct  119  LKVNKATINMLRRVEPYVTYGYPNLKSVKELVYKRGFGKL  158



>gb|KJB35652.1| hypothetical protein B456_006G122600 [Gossypium raimondii]
Length=243

 Score =   234 bits (598),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 130/150 (87%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = +1

Query  94   VVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLK  273
            VVPES+LKK KRNEEW LAKKQEL   KKK  ENRKLI+ RAKQYAKEY  Q+KELIQLK
Sbjct  8    VVPESLLKKNKRNEEWELAKKQELEVAKKKKVENRKLIYSRAKQYAKEYGAQEKELIQLK  67

Query  274  REARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNM  453
            REARLKGGFYV+PEAKLLFIIRIRGINAMHP T+KILQLLRLRQIFNGVFLKVNKAT+NM
Sbjct  68   REARLKGGFYVDPEAKLLFIIRIRGINAMHPRTRKILQLLRLRQIFNGVFLKVNKATMNM  127

Query  454  LHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LH VEPYVTYGYPNLKSVRELIYKRG+GK+
Sbjct  128  LHLVEPYVTYGYPNLKSVRELIYKRGFGKL  157



>gb|EPS63412.1| hypothetical protein M569_11371 [Genlisea aurea]
Length=245

 Score =   235 bits (599),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 132/160 (83%), Positives = 144/160 (90%), Gaps = 1/160 (1%)
 Frame = +1

Query  64   MAEAQTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeye  243
            MAE    G  +VPES LKKQKR+EEWALAK +EL   KKK A +RKLIF RAKQYA+EYE
Sbjct  1    MAEVAA-GNAIVPESFLKKQKRSEEWALAKAEELKEAKKKRALSRKLIFSRAKQYAEEYE  59

Query  244  eqqkeLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVF  423
            +Q++ELIQLKREARLKGGFYV+PE KLLFIIRIRGINA+HP TKKILQLLRLRQIFNGVF
Sbjct  60   KQERELIQLKREARLKGGFYVSPEPKLLFIIRIRGINALHPRTKKILQLLRLRQIFNGVF  119

Query  424  LKVNKATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LKVNKAT+NMLHKVEPYVT+GYPNLKSVRELIYKRGYGKV
Sbjct  120  LKVNKATLNMLHKVEPYVTFGYPNLKSVRELIYKRGYGKV  159



>ref|XP_010534880.1| PREDICTED: 60S ribosomal protein L7-2 [Tarenaya hassleriana]
Length=242

 Score =   234 bits (598),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 128/155 (83%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = +1

Query  79   TKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqke  258
            T+   VVPESVLKK+KR EEW LAKKQEL A KKKN+ENRKLI+ RAKQY++EYEE++KE
Sbjct  2    TESKVVVPESVLKKRKRQEEWELAKKQELEAAKKKNSENRKLIYNRAKQYSREYEEKEKE  61

Query  259  LIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNK  438
            LIQLKREA+LKGGFYV+PEAKLLFI+RIRGINA+ P T+KILQLLRLRQIFNGVFLKVNK
Sbjct  62   LIQLKREAKLKGGFYVDPEAKLLFIVRIRGINAIDPKTRKILQLLRLRQIFNGVFLKVNK  121

Query  439  ATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            AT+NMLH+VEPYVTYGYPNLKSV+ELIYKRGYGK+
Sbjct  122  ATMNMLHRVEPYVTYGYPNLKSVKELIYKRGYGKL  156



>ref|NP_001235225.1| uncharacterized protein LOC100305682 [Glycine max]
 gb|ACU13493.1| unknown [Glycine max]
Length=241

 Score =   234 bits (597),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 129/150 (86%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = +1

Query  94   VVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLK  273
            VVPESVLKK+KR EEWALAKKQEL A KKK AE+RKLI+ RAKQYAKEY+ Q+KELI+LK
Sbjct  8    VVPESVLKKRKREEEWALAKKQELDAAKKKRAESRKLIYNRAKQYAKEYDHQEKELIRLK  67

Query  274  REARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNM  453
            REA+LKGGFYV+PEAKLLFIIRIRGINAM P ++KILQLLRLRQIFNGVFLKVNKATVNM
Sbjct  68   REAKLKGGFYVDPEAKLLFIIRIRGINAMDPKSRKILQLLRLRQIFNGVFLKVNKATVNM  127

Query  454  LHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LH+VEPYVTYGYPNLKSVREL YKRGYGK+
Sbjct  128  LHRVEPYVTYGYPNLKSVRELFYKRGYGKL  157



>ref|XP_006427756.1| hypothetical protein CICLE_v10026360mg [Citrus clementina]
 gb|ESR40996.1| hypothetical protein CICLE_v10026360mg [Citrus clementina]
 gb|KDO41411.1| hypothetical protein CISIN_1g026027mg [Citrus sinensis]
 gb|KDO41412.1| hypothetical protein CISIN_1g026027mg [Citrus sinensis]
Length=244

 Score =   234 bits (597),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 132/160 (83%), Positives = 143/160 (89%), Gaps = 2/160 (1%)
 Frame = +1

Query  64   MAEAQTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeye  243
            MAE + K    VPESVLKKQKRNEEWALAKKQEL   KK   E+RKLI+ RAKQYAKE+ 
Sbjct  1    MAEVEAKAP--VPESVLKKQKRNEEWALAKKQELETSKKNKLESRKLIYNRAKQYAKEFA  58

Query  244  eqqkeLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVF  423
            EQ+K LIQLKREA+LKGGFYV+PEAKLLFIIRIRGINA+ P TKKILQLLRLRQIFNGVF
Sbjct  59   EQEKVLIQLKREAKLKGGFYVDPEAKLLFIIRIRGINAIDPKTKKILQLLRLRQIFNGVF  118

Query  424  LKVNKATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LKVNKAT+NMLH+VEPYVTYGYPNLKSVRELIYKRGYGK+
Sbjct  119  LKVNKATMNMLHRVEPYVTYGYPNLKSVRELIYKRGYGKL  158



>gb|KJB83614.1| hypothetical protein B456_013G255000 [Gossypium raimondii]
Length=243

 Score =   234 bits (597),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 130/150 (87%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = +1

Query  94   VVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLK  273
            +VPES+LKK KRNEEW LAKKQEL A KKK  ENRKLIF RAKQYAKEYE Q+KELIQLK
Sbjct  8    LVPESLLKKNKRNEEWELAKKQELEAAKKKKVENRKLIFNRAKQYAKEYEAQEKELIQLK  67

Query  274  REARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNM  453
            REA+LKGGFYV+PEAKLLFI+RIRGINAMHP T+KILQLLRLRQIFNGVFLKVNKAT+NM
Sbjct  68   REAKLKGGFYVDPEAKLLFIVRIRGINAMHPRTRKILQLLRLRQIFNGVFLKVNKATMNM  127

Query  454  LHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LH VEPYVTYGYPNLKSVRELIYKRG+GK+
Sbjct  128  LHLVEPYVTYGYPNLKSVRELIYKRGFGKL  157



>ref|NP_001235578.1| uncharacterized protein LOC100500011 [Glycine max]
 gb|ACU14587.1| unknown [Glycine max]
Length=242

 Score =   234 bits (596),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 134/160 (84%), Positives = 144/160 (90%), Gaps = 4/160 (3%)
 Frame = +1

Query  64   MAEAQTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeye  243
            M EA+     +VPESV+KK+KRNEEWALAKKQEL A KK   E RKLIF RAKQY+KEY+
Sbjct  1    MGEAKA----LVPESVVKKEKRNEEWALAKKQELDAAKKMRFETRKLIFNRAKQYSKEYD  56

Query  244  eqqkeLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVF  423
            EQQKELI+LKREA+LKGGFYV PEAKLLFIIRIRGINAM P T+KILQLLRLRQIFNGVF
Sbjct  57   EQQKELIRLKREAKLKGGFYVEPEAKLLFIIRIRGINAMDPKTRKILQLLRLRQIFNGVF  116

Query  424  LKVNKATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LKVNKATVNMLH+VEPYVTYGYPNLKSVRELIYKRGYGKV
Sbjct  117  LKVNKATVNMLHRVEPYVTYGYPNLKSVRELIYKRGYGKV  156



>ref|XP_008799461.1| PREDICTED: 60S ribosomal protein L7-4-like [Phoenix dactylifera]
Length=244

 Score =   234 bits (596),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 130/160 (81%), Positives = 144/160 (90%), Gaps = 2/160 (1%)
 Frame = +1

Query  64   MAEAQTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeye  243
            MAE + K   V+PESVLKK+KR EEWALAKK  L A KKK+ ENRK+IF RA+QYAK+YE
Sbjct  1    MAEGEAKA--VIPESVLKKRKREEEWALAKKTALEASKKKDRENRKVIFTRAQQYAKDYE  58

Query  244  eqqkeLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVF  423
             Q+KELI+LKREARLKGGFYV+PE KLLFIIRIRGINAMHP T+KILQLLRLRQIFNGVF
Sbjct  59   SQEKELIRLKREARLKGGFYVSPEPKLLFIIRIRGINAMHPKTRKILQLLRLRQIFNGVF  118

Query  424  LKVNKATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LKVNKAT+NML +VEPYVTYGYPNLKSVRELIYKRGYGK+
Sbjct  119  LKVNKATINMLRRVEPYVTYGYPNLKSVRELIYKRGYGKL  158



>ref|XP_007142128.1| hypothetical protein PHAVU_008G255000g [Phaseolus vulgaris]
 gb|ESW14122.1| hypothetical protein PHAVU_008G255000g [Phaseolus vulgaris]
Length=243

 Score =   234 bits (596),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 143/150 (95%), Gaps = 0/150 (0%)
 Frame = +1

Query  94   VVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLK  273
            +VPESVLKK+KR EEWALAKKQEL A KKK AE+RKLI+ RAKQYAKEY++Q+K+LI+LK
Sbjct  8    IVPESVLKKRKREEEWALAKKQELEAAKKKRAESRKLIYNRAKQYAKEYDQQEKDLIRLK  67

Query  274  REARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNM  453
            REA+LKGGFYV+PEAKLLFIIRIRGINAM P ++KILQLLRLRQIFNGVFLKVNKATVNM
Sbjct  68   REAKLKGGFYVDPEAKLLFIIRIRGINAMDPKSRKILQLLRLRQIFNGVFLKVNKATVNM  127

Query  454  LHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LH+VEPYVTYGYPNLKSV+ELIYKRGYGK+
Sbjct  128  LHRVEPYVTYGYPNLKSVKELIYKRGYGKL  157



>ref|XP_009382840.1| PREDICTED: 60S ribosomal protein L7-2-like [Musa acuminata subsp. 
malaccensis]
Length=244

 Score =   234 bits (596),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 133/160 (83%), Positives = 145/160 (91%), Gaps = 2/160 (1%)
 Frame = +1

Query  64   MAEAQTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeye  243
            MA  + K   VVPESVLKK+KR E+WALAKKQEL A KKK  ENRKLIF RA+QYAKEYE
Sbjct  1    MATEEAKA--VVPESVLKKRKREEQWALAKKQELDARKKKARENRKLIFGRAQQYAKEYE  58

Query  244  eqqkeLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVF  423
             Q+KELI+LKREAR+KGGFYV+PEAKLLFIIRIRGINAMHP T+KILQLLRLRQIFNGVF
Sbjct  59   SQEKELIRLKREARMKGGFYVSPEAKLLFIIRIRGINAMHPKTRKILQLLRLRQIFNGVF  118

Query  424  LKVNKATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LKVNKAT+NML +VEPYVTYGYPNLKSVRELIYKRGYGK+
Sbjct  119  LKVNKATMNMLQRVEPYVTYGYPNLKSVRELIYKRGYGKL  158



>gb|KEH40165.1| 60S ribosomal protein L7 [Medicago truncatula]
Length=275

 Score =   235 bits (599),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 130/150 (87%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = +1

Query  94   VVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLK  273
            VVPESVLKKQKRNEEWAL KKQE  + KKK A+ RKLI+ RAKQYAKEY++QQKELI LK
Sbjct  40   VVPESVLKKQKRNEEWALVKKQEQESAKKKRAQTRKLIWSRAKQYAKEYDDQQKELISLK  99

Query  274  REARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNM  453
            REA+LKGGFYV+PEAKLLFIIRIRGINAM P ++KILQLLRLRQIFNGVFLKVNKATVNM
Sbjct  100  REAKLKGGFYVDPEAKLLFIIRIRGINAMDPKSRKILQLLRLRQIFNGVFLKVNKATVNM  159

Query  454  LHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LH+VEPYVTYGYPNLKSVRELIYKRGYGKV
Sbjct  160  LHRVEPYVTYGYPNLKSVRELIYKRGYGKV  189



>ref|XP_007015365.1| Ribosomal protein L30/L7 family protein isoform 3 [Theobroma 
cacao]
 ref|XP_007015366.1| Ribosomal protein L30/L7 family protein isoform 3 [Theobroma 
cacao]
 gb|EOY32984.1| Ribosomal protein L30/L7 family protein isoform 3 [Theobroma 
cacao]
 gb|EOY32985.1| Ribosomal protein L30/L7 family protein isoform 3 [Theobroma 
cacao]
Length=276

 Score =   235 bits (599),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 129/150 (86%), Positives = 142/150 (95%), Gaps = 0/150 (0%)
 Frame = +1

Query  94   VVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLK  273
            V+PES+LKK+KRNEEW LAKKQEL A KKK  E+RKLI+ RAKQYAKEYE Q+KELIQLK
Sbjct  8    VIPESLLKKRKRNEEWELAKKQELEAAKKKKVESRKLIYNRAKQYAKEYEAQEKELIQLK  67

Query  274  REARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNM  453
            REA+LKGGFYV+PEAKLLFI+RIRGINAMHP T+KILQLLRLRQIFNGVFLKVNKAT+NM
Sbjct  68   REAKLKGGFYVDPEAKLLFIVRIRGINAMHPRTRKILQLLRLRQIFNGVFLKVNKATMNM  127

Query  454  LHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LH+VEPYVTYGYPNLKSVRELIYKRGYGK+
Sbjct  128  LHRVEPYVTYGYPNLKSVRELIYKRGYGKL  157



>ref|XP_010543980.1| PREDICTED: 60S ribosomal protein L7-2-like [Tarenaya hassleriana]
 ref|XP_010543981.1| PREDICTED: 60S ribosomal protein L7-2-like [Tarenaya hassleriana]
Length=242

 Score =   233 bits (595),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 126/155 (81%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = +1

Query  79   TKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqke  258
            T+   VVPESVLKK+KR EEW LAKKQEL A KKK+AENRKLI+ RAK Y KEY+E++KE
Sbjct  2    TESKVVVPESVLKKRKRQEEWELAKKQELEAAKKKSAENRKLIYNRAKNYDKEYQEKEKE  61

Query  259  LIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNK  438
            LIQLKREA+LKGGFYV+PEAKLLFI+RIRGINA+ P T+KILQLLRLRQIFNGVFLKVNK
Sbjct  62   LIQLKREAKLKGGFYVDPEAKLLFIVRIRGINAIDPKTRKILQLLRLRQIFNGVFLKVNK  121

Query  439  ATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            AT+NMLH+VEPYVTYGYPNLKSV+EL+YKRGYGK+
Sbjct  122  ATMNMLHRVEPYVTYGYPNLKSVKELVYKRGYGKL  156



>gb|KHG30088.1| 60S ribosomal L7-4 -like protein [Gossypium arboreum]
Length=243

 Score =   233 bits (595),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 130/150 (87%), Positives = 139/150 (93%), Gaps = 0/150 (0%)
 Frame = +1

Query  94   VVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLK  273
            VVPES+LKKQKR EEW LAKKQEL   KKK  ENRKLI+ RAKQYAKEYE Q+KELIQLK
Sbjct  8    VVPESLLKKQKRAEEWELAKKQELEVAKKKKVENRKLIYTRAKQYAKEYEAQEKELIQLK  67

Query  274  REARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNM  453
            REA+LKGGFYV+PEAKLLFIIRIRGINAMHP T+KILQLLRLRQIFNGVFLKVNKAT+NM
Sbjct  68   REAKLKGGFYVDPEAKLLFIIRIRGINAMHPRTRKILQLLRLRQIFNGVFLKVNKATMNM  127

Query  454  LHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LH VEPYVTYGYPNLKSVRELIYKRG+GK+
Sbjct  128  LHLVEPYVTYGYPNLKSVRELIYKRGFGKL  157



>ref|XP_004144426.1| PREDICTED: 60S ribosomal protein L7-4-like isoform 1 [Cucumis 
sativus]
Length=309

 Score =   236 bits (601),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 142/150 (95%), Gaps = 0/150 (0%)
 Frame = +1

Query  94   VVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLK  273
            + PESVLKK+KRNEEW LAK+QEL A KKKNAENRKLI+ RAK Y+KEYEEQ+KELI+LK
Sbjct  74   LTPESVLKKRKRNEEWTLAKQQELEAAKKKNAENRKLIYNRAKLYSKEYEEQEKELIRLK  133

Query  274  REARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNM  453
            REA+LKGGFYV+PEAKLLFI RIRGINAMHP T+KILQLLRLRQIFNGVFLKVNKAT+NM
Sbjct  134  REAKLKGGFYVDPEAKLLFITRIRGINAMHPKTRKILQLLRLRQIFNGVFLKVNKATLNM  193

Query  454  LHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LH+VEPYVTYGYPNLKSV+ELIYKRGYGK+
Sbjct  194  LHRVEPYVTYGYPNLKSVKELIYKRGYGKL  223



>ref|XP_008227948.1| PREDICTED: 60S ribosomal protein L7-2 [Prunus mume]
Length=243

 Score =   233 bits (595),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 129/150 (86%), Positives = 143/150 (95%), Gaps = 0/150 (0%)
 Frame = +1

Query  94   VVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLK  273
            VVPESVLKK+KR EEWALAKKQ L A KKKNAENRKLI+ RAKQY++EY+EQ+KELI+LK
Sbjct  8    VVPESVLKKRKREEEWALAKKQGLEAAKKKNAENRKLIYNRAKQYSEEYKEQEKELIRLK  67

Query  274  REARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNM  453
            REA+LKGGFYV+PEAKLLFIIRIRGINA+ P TKKILQLLRLRQIFNGVFLKVNKAT+NM
Sbjct  68   REAKLKGGFYVDPEAKLLFIIRIRGINAIDPKTKKILQLLRLRQIFNGVFLKVNKATLNM  127

Query  454  LHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LH+VEPYVTYGYPNLKSV+ELIYKRGYGK+
Sbjct  128  LHRVEPYVTYGYPNLKSVKELIYKRGYGKL  157



>ref|XP_009420403.1| PREDICTED: 60S ribosomal protein L7-2 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009420404.1| PREDICTED: 60S ribosomal protein L7-2 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009420406.1| PREDICTED: 60S ribosomal protein L7-2 [Musa acuminata subsp. 
malaccensis]
Length=244

 Score =   233 bits (595),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 132/154 (86%), Positives = 142/154 (92%), Gaps = 2/154 (1%)
 Frame = +1

Query  88   GP--VVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeL  261
            GP  VVPESVLKK+KR E+WALAKKQEL A KKK  ENRKLIF RA+QYAKEY  Q+KEL
Sbjct  5    GPKAVVPESVLKKRKREEQWALAKKQELDAKKKKARENRKLIFGRAQQYAKEYGSQEKEL  64

Query  262  IQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKA  441
            I+LKREARLKGGFYV+PEAKLLFIIRIRGINAMHP T+KILQLLRLRQIFNGVFLKVNKA
Sbjct  65   IRLKREARLKGGFYVSPEAKLLFIIRIRGINAMHPKTRKILQLLRLRQIFNGVFLKVNKA  124

Query  442  TVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            T+NML +VEPYVTYGYPNLKSVRELIYKRGYGK+
Sbjct  125  TMNMLQRVEPYVTYGYPNLKSVRELIYKRGYGKL  158



>ref|XP_006407195.1| hypothetical protein EUTSA_v10021411mg [Eutrema salsugineum]
 gb|ESQ48648.1| hypothetical protein EUTSA_v10021411mg [Eutrema salsugineum]
Length=244

 Score =   233 bits (595),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 130/160 (81%), Positives = 146/160 (91%), Gaps = 2/160 (1%)
 Frame = +1

Query  64   MAEAQTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeye  243
            M EA+ K   VVPESVLKK+KR EEWALAKKQEL A KK+NAE RKLI+ RAKQY+KEYE
Sbjct  1    MTEAEAK--TVVPESVLKKRKREEEWALAKKQELEATKKQNAEKRKLIYNRAKQYSKEYE  58

Query  244  eqqkeLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVF  423
             ++KELIQLKREA+LKGGFYV+PEAKLLFIIRIRGINA+ P TKKILQLLRLRQIFNGVF
Sbjct  59   GKEKELIQLKREAKLKGGFYVDPEAKLLFIIRIRGINAIDPKTKKILQLLRLRQIFNGVF  118

Query  424  LKVNKATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LKVNKAT+NML +VEPYVTYGYPNLKSV+EL+YKRG+GK+
Sbjct  119  LKVNKATINMLRRVEPYVTYGYPNLKSVKELVYKRGFGKL  158



>ref|XP_004488015.1| PREDICTED: 60S ribosomal protein L7-4-like [Cicer arietinum]
Length=244

 Score =   233 bits (594),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = +1

Query  94   VVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLK  273
            VVPESVLKKQKR+EEWAL KKQEL + KKK +E RKLI+ RAKQYAKEY++ QKELI LK
Sbjct  9    VVPESVLKKQKRSEEWALVKKQELESEKKKRSETRKLIWSRAKQYAKEYDDAQKELISLK  68

Query  274  REARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNM  453
            REA+LKGGFYV+PEAKLLFIIRIRGINAM P ++KILQLLRLRQIFNGVFLKVNKATVNM
Sbjct  69   REAKLKGGFYVDPEAKLLFIIRIRGINAMDPKSRKILQLLRLRQIFNGVFLKVNKATVNM  128

Query  454  LHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LH+VEPYVT+GYPNLKSVRELIYKRGYGKV
Sbjct  129  LHRVEPYVTFGYPNLKSVRELIYKRGYGKV  158



>ref|XP_009348620.1| PREDICTED: 60S ribosomal protein L7-2-like [Pyrus x bretschneideri]
Length=245

 Score =   233 bits (594),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 128/156 (82%), Positives = 146/156 (94%), Gaps = 0/156 (0%)
 Frame = +1

Query  76   QTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqk  255
            + K  P VPESVLKK+KR E+WALAKKQ+L + KKK++ENRKLI+ RAKQYAKEY+E+QK
Sbjct  4    EVKAAPEVPESVLKKRKREEQWALAKKQDLESAKKKSSENRKLIYNRAKQYAKEYDEEQK  63

Query  256  eLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVN  435
            ELI+LKREA+LKGGF+VNPEAKLLFIIRIRGINA+ P TKKILQLLRLRQIFNGVFLKVN
Sbjct  64   ELIRLKREAKLKGGFHVNPEAKLLFIIRIRGINAIDPKTKKILQLLRLRQIFNGVFLKVN  123

Query  436  KATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            KAT+NMLH+VEPYVTYGYPNLKSV+ELIYKRGYGK+
Sbjct  124  KATLNMLHRVEPYVTYGYPNLKSVKELIYKRGYGKL  159



>ref|XP_002524137.1| 60S ribosomal protein L7, putative [Ricinus communis]
 gb|EEF38248.1| 60S ribosomal protein L7, putative [Ricinus communis]
Length=243

 Score =   233 bits (594),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 131/150 (87%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = +1

Query  94   VVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLK  273
            +VPESVLKK KRNEEWALAKKQEL A KK   E+RKLIF RAKQYAKEY++QQKE+IQLK
Sbjct  8    IVPESVLKKTKRNEEWALAKKQELEASKKIAKESRKLIFNRAKQYAKEYDQQQKEVIQLK  67

Query  274  REARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNM  453
            REA+LKGGFYVNPEAKLLFIIRIRGINA+ P T+KILQLLRLRQIFNGVFLKVNKATVNM
Sbjct  68   REAKLKGGFYVNPEAKLLFIIRIRGINAIDPKTRKILQLLRLRQIFNGVFLKVNKATVNM  127

Query  454  LHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LH+VEPYVTYGYPNLKSV+ELIYKRGYGKV
Sbjct  128  LHRVEPYVTYGYPNLKSVKELIYKRGYGKV  157



>gb|KJB35651.1| hypothetical protein B456_006G122600 [Gossypium raimondii]
Length=285

 Score =   234 bits (598),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 130/150 (87%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = +1

Query  94   VVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLK  273
            VVPES+LKK KRNEEW LAKKQEL   KKK  ENRKLI+ RAKQYAKEY  Q+KELIQLK
Sbjct  50   VVPESLLKKNKRNEEWELAKKQELEVAKKKKVENRKLIYSRAKQYAKEYGAQEKELIQLK  109

Query  274  REARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNM  453
            REARLKGGFYV+PEAKLLFIIRIRGINAMHP T+KILQLLRLRQIFNGVFLKVNKAT+NM
Sbjct  110  REARLKGGFYVDPEAKLLFIIRIRGINAMHPRTRKILQLLRLRQIFNGVFLKVNKATMNM  169

Query  454  LHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LH VEPYVTYGYPNLKSVRELIYKRG+GK+
Sbjct  170  LHLVEPYVTYGYPNLKSVRELIYKRGFGKL  199



>ref|XP_004168560.1| PREDICTED: 60S ribosomal protein L7-4-like isoform 2 [Cucumis 
sativus]
Length=243

 Score =   233 bits (594),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = +1

Query  94   VVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLK  273
            + PESVLKK+KRNEEW LAK+QE  A KKKNAENRKLI+ RAK Y+KEYEEQ+KELI+LK
Sbjct  8    LTPESVLKKRKRNEEWTLAKQQEHEAAKKKNAENRKLIYNRAKLYSKEYEEQEKELIRLK  67

Query  274  REARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNM  453
            REA+LKGGFYV+PEAKLLFI RIRGINAMHP T+KILQLLRLRQIFNGVFLKVNKAT+NM
Sbjct  68   REAKLKGGFYVDPEAKLLFITRIRGINAMHPKTRKILQLLRLRQIFNGVFLKVNKATLNM  127

Query  454  LHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LH+VEPYVTYGYPNLKSV+ELIYKRGYGK+
Sbjct  128  LHRVEPYVTYGYPNLKSVKELIYKRGYGKL  157



>gb|KJB09280.1| hypothetical protein B456_001G132600 [Gossypium raimondii]
Length=243

 Score =   233 bits (594),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 130/150 (87%), Positives = 139/150 (93%), Gaps = 0/150 (0%)
 Frame = +1

Query  94   VVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLK  273
            VVPES+LKKQKR EEW LAKKQEL   KKK  ENRKLI+ RAKQYAKEYE Q+KELIQLK
Sbjct  8    VVPESLLKKQKRAEEWELAKKQELEVSKKKKVENRKLIYTRAKQYAKEYEAQEKELIQLK  67

Query  274  REARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNM  453
            REA+LKGGFYV+PEAKLLFIIRIRGINAMHP T+KILQLLRLRQIFNGVFLKVNKAT+NM
Sbjct  68   REAKLKGGFYVDPEAKLLFIIRIRGINAMHPRTRKILQLLRLRQIFNGVFLKVNKATMNM  127

Query  454  LHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LH VEPYVTYGYPNLKSVRELIYKRG+GK+
Sbjct  128  LHLVEPYVTYGYPNLKSVRELIYKRGFGKL  157



>ref|XP_009359955.1| PREDICTED: 60S ribosomal protein L7-2-like [Pyrus x bretschneideri]
Length=245

 Score =   233 bits (593),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 128/156 (82%), Positives = 145/156 (93%), Gaps = 0/156 (0%)
 Frame = +1

Query  76   QTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqk  255
            +    PVVPESVL K+KR E+WALAKKQ+L + KKK++ENRKLI+ RAKQYAKEY+E+QK
Sbjct  4    EVNAAPVVPESVLMKRKREEQWALAKKQDLESAKKKSSENRKLIYNRAKQYAKEYDEEQK  63

Query  256  eLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVN  435
            ELI+LKREA+LKGGFYVNPEAKLLFIIRIRGINA+ P TKKILQLLRLRQIFNGVFLKVN
Sbjct  64   ELIRLKREAKLKGGFYVNPEAKLLFIIRIRGINAIDPKTKKILQLLRLRQIFNGVFLKVN  123

Query  436  KATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            KAT+NMLH+VEPYVTYGYPNLKSV+ELIYKRGYGK+
Sbjct  124  KATLNMLHRVEPYVTYGYPNLKSVKELIYKRGYGKL  159



>ref|XP_010692954.1| PREDICTED: 60S ribosomal protein L7-2-like [Beta vulgaris subsp. 
vulgaris]
Length=244

 Score =   233 bits (593),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 130/160 (81%), Positives = 142/160 (89%), Gaps = 2/160 (1%)
 Frame = +1

Query  64   MAEAQTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeye  243
            M E  TK   +VPESVLKKQKR EEWALAKKQEL   KK+ AENRK+IF RA+QY+KEYE
Sbjct  1    MGEEATK--VIVPESVLKKQKREEEWALAKKQELDVQKKQRAENRKIIFKRAQQYSKEYE  58

Query  244  eqqkeLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVF  423
             Q+KE I L+REA+LKGGFYV PEAKLLFIIRIRGINAMHP T+ ILQLLRLRQIFNGVF
Sbjct  59   NQEKEAISLRREAKLKGGFYVEPEAKLLFIIRIRGINAMHPKTRSILQLLRLRQIFNGVF  118

Query  424  LKVNKATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LKVNKAT+NMLH+VEP+VTYGYPNLKSVRELIYKRGYGKV
Sbjct  119  LKVNKATLNMLHRVEPFVTYGYPNLKSVRELIYKRGYGKV  158



>ref|XP_007217754.1| hypothetical protein PRUPE_ppa010610mg [Prunus persica]
 gb|EMJ18953.1| hypothetical protein PRUPE_ppa010610mg [Prunus persica]
Length=243

 Score =   233 bits (593),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 143/150 (95%), Gaps = 0/150 (0%)
 Frame = +1

Query  94   VVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLK  273
            VVPESVLKK+KR EEWALAKKQ L A KKKNA+NRKLI+ RAKQY++EY+EQ+KELI+LK
Sbjct  8    VVPESVLKKRKREEEWALAKKQGLEAAKKKNADNRKLIYNRAKQYSEEYKEQEKELIRLK  67

Query  274  REARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNM  453
            REA+LKGGFYV+PEAKLLFIIRIRGINA+ P TKKILQLLRLRQIFNGVFLKVNKAT+NM
Sbjct  68   REAKLKGGFYVDPEAKLLFIIRIRGINAIDPKTKKILQLLRLRQIFNGVFLKVNKATLNM  127

Query  454  LHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LH+VEPYVTYGYPNLKSV+ELIYKRGYGK+
Sbjct  128  LHRVEPYVTYGYPNLKSVKELIYKRGYGKL  157



>ref|XP_007138756.1| hypothetical protein PHAVU_009G234700g [Phaseolus vulgaris]
 gb|ESW10750.1| hypothetical protein PHAVU_009G234700g [Phaseolus vulgaris]
Length=244

 Score =   232 bits (592),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 133/160 (83%), Positives = 144/160 (90%), Gaps = 2/160 (1%)
 Frame = +1

Query  64   MAEAQTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeye  243
            M E + K   +VPESVLKK+KRNEEWALAKKQ L A KKK  E RKLIF RAKQYAKEYE
Sbjct  1    MGEGEAKA--MVPESVLKKEKRNEEWALAKKQNLEAAKKKRFETRKLIFSRAKQYAKEYE  58

Query  244  eqqkeLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVF  423
            EQQKELI+LKREA+LKGGFYV+PE KLLFIIRIRGINAM P T+KILQLLRLRQIFNGVF
Sbjct  59   EQQKELIRLKREAKLKGGFYVDPETKLLFIIRIRGINAMDPKTRKILQLLRLRQIFNGVF  118

Query  424  LKVNKATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LKVNKAT+NMLH+VEPYVTYGYPNLKSV+ELIYKRG+GKV
Sbjct  119  LKVNKATLNMLHRVEPYVTYGYPNLKSVKELIYKRGFGKV  158



>ref|XP_006586618.1| PREDICTED: uncharacterized protein LOC100306213 isoform X1 [Glycine 
max]
 gb|KHN35826.1| 60S ribosomal protein L7-2 [Glycine soja]
Length=242

 Score =   232 bits (592),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 133/160 (83%), Positives = 144/160 (90%), Gaps = 4/160 (3%)
 Frame = +1

Query  64   MAEAQTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeye  243
            M EA+     +VPESV+KK+KRNEEWAL KKQEL A KKK  E RKLIF RAKQY+KEY+
Sbjct  1    MGEAKA----LVPESVVKKEKRNEEWALEKKQELDAAKKKRFETRKLIFNRAKQYSKEYD  56

Query  244  eqqkeLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVF  423
            EQQKELI+LKREA+LKGGFYV PEAKLLFIIRIRGINAM P T+KILQLLRLRQIFNGVF
Sbjct  57   EQQKELIRLKREAKLKGGFYVEPEAKLLFIIRIRGINAMDPKTRKILQLLRLRQIFNGVF  116

Query  424  LKVNKATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LKVNKATVNMLH+VEPYVTYGYPNLKSV+ELIYKRGYGKV
Sbjct  117  LKVNKATVNMLHRVEPYVTYGYPNLKSVKELIYKRGYGKV  156



>ref|XP_010542455.1| PREDICTED: 60S ribosomal protein L7-2-like [Tarenaya hassleriana]
 ref|XP_010542456.1| PREDICTED: 60S ribosomal protein L7-2-like [Tarenaya hassleriana]
 ref|XP_010542457.1| PREDICTED: 60S ribosomal protein L7-2-like [Tarenaya hassleriana]
Length=240

 Score =   232 bits (592),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 124/150 (83%), Positives = 139/150 (93%), Gaps = 0/150 (0%)
 Frame = +1

Query  94   VVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLK  273
            +VPESVLKKQKR  +W LAKKQEL A KKKNAENRKLIF RA  Y KEY+E+++ELIQLK
Sbjct  5    IVPESVLKKQKRQGQWELAKKQELEADKKKNAENRKLIFNRAMNYDKEYKEKERELIQLK  64

Query  274  REARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNM  453
            REA+LKGGFYV+PEAKLLFI+RIRGINA+ P T+KILQLLRLRQIFNGVFLKVNKAT+NM
Sbjct  65   REAKLKGGFYVDPEAKLLFIVRIRGINAIDPKTRKILQLLRLRQIFNGVFLKVNKATMNM  124

Query  454  LHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LH+VEPYVTYGYPNLKSV+ELIYKRGYGK+
Sbjct  125  LHRVEPYVTYGYPNLKSVKELIYKRGYGKL  154



>ref|NP_001077863.1| 60S ribosomal protein L7-2 [Arabidopsis thaliana]
 dbj|BAH19718.1| AT2G01250 [Arabidopsis thaliana]
 gb|AEC05421.1| 60S ribosomal protein L7-2 [Arabidopsis thaliana]
Length=184

 Score =   230 bits (586),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 125/150 (83%), Positives = 139/150 (93%), Gaps = 0/150 (0%)
 Frame = +1

Query  94   VVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLK  273
            VVPESVLKK+KR EEWAL KKQ + A KKKNAENRKLIF RA+QY+KEY E++KELI LK
Sbjct  7    VVPESVLKKRKREEEWALEKKQNVEAAKKKNAENRKLIFKRAEQYSKEYAEKEKELISLK  66

Query  274  REARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNM  453
            REA+LKGGFYV+PEAKLLFIIRIRGINA+ P TKKILQLLRLRQIFNGVFLKVNKAT+NM
Sbjct  67   REAKLKGGFYVDPEAKLLFIIRIRGINAIDPKTKKILQLLRLRQIFNGVFLKVNKATMNM  126

Query  454  LHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            L +VEPYVTYG+PNLKSV+ELIYKRGYGK+
Sbjct  127  LRRVEPYVTYGFPNLKSVKELIYKRGYGKL  156



>ref|XP_004168559.1| PREDICTED: 60S ribosomal protein L7-4-like isoform 1 [Cucumis 
sativus]
Length=282

 Score =   233 bits (595),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = +1

Query  94   VVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLK  273
            + PESVLKK+KRNEEW LAK+QE  A KKKNAENRKLI+ RAK Y+KEYEEQ+KELI+LK
Sbjct  47   LTPESVLKKRKRNEEWTLAKQQEHEAAKKKNAENRKLIYNRAKLYSKEYEEQEKELIRLK  106

Query  274  REARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNM  453
            REA+LKGGFYV+PEAKLLFI RIRGINAMHP T+KILQLLRLRQIFNGVFLKVNKAT+NM
Sbjct  107  REAKLKGGFYVDPEAKLLFITRIRGINAMHPKTRKILQLLRLRQIFNGVFLKVNKATLNM  166

Query  454  LHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LH+VEPYVTYGYPNLKSV+ELIYKRGYGK+
Sbjct  167  LHRVEPYVTYGYPNLKSVKELIYKRGYGKL  196



>gb|ACJ84111.1| unknown [Medicago truncatula]
Length=244

 Score =   232 bits (591),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 131/160 (82%), Positives = 143/160 (89%), Gaps = 2/160 (1%)
 Frame = +1

Query  64   MAEAQTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeye  243
            MA+ + K   VVPESVLKKQKRNEEWAL KKQE  + KKK +E RKLI+ RAKQYAKEY+
Sbjct  1    MAKEEVK--TVVPESVLKKQKRNEEWALVKKQEQESAKKKRSETRKLIWSRAKQYAKEYD  58

Query  244  eqqkeLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVF  423
            + QKELI LKREA+LKGGFYV+PEAKLLFIIRIRGINAM P ++KILQLLRLRQI NGVF
Sbjct  59   DSQKELIALKREAKLKGGFYVDPEAKLLFIIRIRGINAMDPKSRKILQLLRLRQICNGVF  118

Query  424  LKVNKATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LKVNKATVNMLH+VEPYVTYGYPNLKSVRELIYKRGYGKV
Sbjct  119  LKVNKATVNMLHRVEPYVTYGYPNLKSVRELIYKRGYGKV  158



>gb|KHG06940.1| 60S ribosomal L7-4 -like protein [Gossypium arboreum]
 gb|KJB21784.1| hypothetical protein B456_004G013500 [Gossypium raimondii]
Length=243

 Score =   231 bits (590),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = +1

Query  94   VVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLK  273
            V+PES+LKK KRNEEW LAKKQEL A KKK  ENRKLIF RAKQYAKEYE Q+KELI+LK
Sbjct  8    VIPESLLKKNKRNEEWELAKKQELEAAKKKKVENRKLIFNRAKQYAKEYEAQEKELIRLK  67

Query  274  REARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNM  453
            REA+LKGGFYV+PEAKLLFI+RIRGINAMHP T+KILQLLRLRQIFNGVFLKVNKAT+NM
Sbjct  68   REAKLKGGFYVDPEAKLLFIVRIRGINAMHPRTRKILQLLRLRQIFNGVFLKVNKATMNM  127

Query  454  LHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LH VEPYVTYGYPNLKSV+ELIYKRG+GK+
Sbjct  128  LHLVEPYVTYGYPNLKSVKELIYKRGFGKL  157



>ref|XP_003595099.1| 60S ribosomal protein L7-4 [Medicago truncatula]
 gb|ABD28464.1| Ribosomal protein L30 [Medicago truncatula]
 gb|AES65350.1| 60S ribosomal protein L7 [Medicago truncatula]
Length=244

 Score =   231 bits (590),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 131/160 (82%), Positives = 143/160 (89%), Gaps = 2/160 (1%)
 Frame = +1

Query  64   MAEAQTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeye  243
            MA+ + K   VVPESVLKKQKRNEEWAL KKQE  + KKK +E RKLI+ RAKQYAKEY+
Sbjct  1    MAKEEVK--TVVPESVLKKQKRNEEWALVKKQEQESAKKKRSETRKLIWSRAKQYAKEYD  58

Query  244  eqqkeLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVF  423
            + QKELI LKREA+LKGGFYV+PEAKLLFIIRIRGINAM P ++KILQLLRLRQI NGVF
Sbjct  59   DSQKELIALKREAKLKGGFYVDPEAKLLFIIRIRGINAMDPKSRKILQLLRLRQICNGVF  118

Query  424  LKVNKATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LKVNKATVNMLH+VEPYVTYGYPNLKSVRELIYKRGYGKV
Sbjct  119  LKVNKATVNMLHRVEPYVTYGYPNLKSVRELIYKRGYGKV  158



>ref|XP_009395464.1| PREDICTED: 60S ribosomal protein L7-2-like [Musa acuminata subsp. 
malaccensis]
Length=244

 Score =   231 bits (588),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 126/150 (84%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = +1

Query  94   VVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLK  273
            V+PESVLKK+KR E+WALAKKQE  A KKK  ENRK+IF RA+QYAKEY+ Q+KELI+LK
Sbjct  9    VIPESVLKKRKREEQWALAKKQEADAKKKKARENRKVIFARAEQYAKEYDSQEKELIRLK  68

Query  274  REARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNM  453
            REAR+KGGFYV+PEAKLLFIIRIRGINAMHP T+KILQLLRLRQIFNGVFLKVNKAT+NM
Sbjct  69   REARMKGGFYVSPEAKLLFIIRIRGINAMHPKTRKILQLLRLRQIFNGVFLKVNKATMNM  128

Query  454  LHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            L +VEPYVTYGYPNLKSVRELIYKRGYGK+
Sbjct  129  LQRVEPYVTYGYPNLKSVRELIYKRGYGKL  158



>ref|XP_008462217.1| PREDICTED: 60S ribosomal protein L7-4 [Cucumis melo]
 ref|XP_008462218.1| PREDICTED: 60S ribosomal protein L7-4 [Cucumis melo]
Length=243

 Score =   231 bits (588),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 126/150 (84%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = +1

Query  94   VVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLK  273
            +VPESVLKK KRNEEW+LA KQEL A KKK AE RKLI+ RAK Y+KEYEEQ+KELI+LK
Sbjct  8    IVPESVLKKAKRNEEWSLASKQELEAAKKKRAETRKLIYNRAKSYSKEYEEQEKELIRLK  67

Query  274  REARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNM  453
            REARLKGGFYV+PEAKLLFIIRIRGINA+ P T+KILQLLRLRQIFNGVFLKVNKAT+NM
Sbjct  68   REARLKGGFYVDPEAKLLFIIRIRGINAIDPKTRKILQLLRLRQIFNGVFLKVNKATLNM  127

Query  454  LHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LH+VEPYVTYGYPNLKSV+ELIYKRG+GK+
Sbjct  128  LHRVEPYVTYGYPNLKSVKELIYKRGFGKL  157



>gb|ACJ84153.1| unknown [Medicago truncatula]
Length=244

 Score =   230 bits (587),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 130/160 (81%), Positives = 142/160 (89%), Gaps = 2/160 (1%)
 Frame = +1

Query  64   MAEAQTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeye  243
            MA+ + K   VVPESVLKKQKRNEEWAL KKQE  + KKK +E RKLI+ RAKQYAKEY+
Sbjct  1    MAKEEVK--TVVPESVLKKQKRNEEWALVKKQEQESAKKKRSETRKLIWSRAKQYAKEYD  58

Query  244  eqqkeLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVF  423
            + QKELI LKREA+LKGGFYV+PEAKLLFIIRIRGINAM P ++KILQLLRLRQI NG F
Sbjct  59   DSQKELIALKREAKLKGGFYVDPEAKLLFIIRIRGINAMDPKSRKILQLLRLRQICNGAF  118

Query  424  LKVNKATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LKVNKATVNMLH+VEPYVTYGYPNLKSVRELIYKRGYGKV
Sbjct  119  LKVNKATVNMLHRVEPYVTYGYPNLKSVRELIYKRGYGKV  158



>ref|XP_008342419.1| PREDICTED: 60S ribosomal protein L7-2 [Malus domestica]
Length=243

 Score =   230 bits (587),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = +1

Query  94   VVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLK  273
            VVPESVLKK+KR EEWALAK+QE  A  KK AENRKLI+ RAKQY++EYE+Q+KELIQLK
Sbjct  8    VVPESVLKKRKREEEWALAKEQERVAANKKKAENRKLIYNRAKQYSEEYEQQEKELIQLK  67

Query  274  REARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNM  453
            REA+LKGGFYV+PEAKLLFIIRIRGINA+ P TKKILQLLRLRQIFNGVFLKVNKAT+NM
Sbjct  68   REAKLKGGFYVDPEAKLLFIIRIRGINAIDPKTKKILQLLRLRQIFNGVFLKVNKATLNM  127

Query  454  LHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LH+VEPYVTYGYPNLKSV+ELIYKRGYGK+
Sbjct  128  LHRVEPYVTYGYPNLKSVKELIYKRGYGKL  157



>gb|KHG19979.1| 60S ribosomal L7-4 -like protein [Gossypium arboreum]
Length=412

 Score =   236 bits (601),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 131/150 (87%), Positives = 139/150 (93%), Gaps = 0/150 (0%)
 Frame = +1

Query  94   VVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLK  273
            VVPES+LKK KRNEEW LAKKQEL   KKK  ENRKLIF RAKQYAKEYE Q+KELIQLK
Sbjct  177  VVPESLLKKNKRNEEWELAKKQELEVAKKKKVENRKLIFSRAKQYAKEYEAQEKELIQLK  236

Query  274  REARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNM  453
            REA+LKGGFYV+PEAKLLFIIRIRGINAMHP T+KILQLLRLRQIFNGVFLKVNKAT+NM
Sbjct  237  REAKLKGGFYVDPEAKLLFIIRIRGINAMHPRTRKILQLLRLRQIFNGVFLKVNKATMNM  296

Query  454  LHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LH VEPYVTYGYPNLKSVRELIYKRG+GK+
Sbjct  297  LHLVEPYVTYGYPNLKSVRELIYKRGFGKL  326


 Score =   165 bits (417),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 80/95 (84%), Positives = 87/95 (92%), Gaps = 0/95 (0%)
 Frame = +1

Query  259  LIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNK  438
            LIQLKRE +LKGGFYVNPE+KLLFIIR+RGINAM P T+KILQLLRLRQIFNG FLKVNK
Sbjct  14   LIQLKREEKLKGGFYVNPESKLLFIIRVRGINAMRPRTRKILQLLRLRQIFNGAFLKVNK  73

Query  439  ATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            AT+NMLH VEP+VTYGYPN K VRELIYKR YGK+
Sbjct  74   ATMNMLHLVEPHVTYGYPNPKIVRELIYKRSYGKL  108



>gb|KDP40134.1| hypothetical protein JCGZ_02132 [Jatropha curcas]
Length=245

 Score =   230 bits (587),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 124/156 (79%), Positives = 140/156 (90%), Gaps = 0/156 (0%)
 Frame = +1

Query  76   QTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqk  255
            +TK    +PESVLKK+KR++EWALAK QEL   K+KNAENR +I+ RA++Y  EY EQ++
Sbjct  4    ETKAAAFIPESVLKKRKRSDEWALAKSQELKLRKQKNAENRVVIYKRAEKYVNEYREQER  63

Query  256  eLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVN  435
            ELI LKREA+LKGGFYV PEAKLLFIIRIRGINAM+P T+KILQLLRLRQIFNGVFLKVN
Sbjct  64   ELIALKREAKLKGGFYVEPEAKLLFIIRIRGINAMNPMTRKILQLLRLRQIFNGVFLKVN  123

Query  436  KATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            KATVNMLH+VEPYVTYGYPNLKSVRELIYKRGYGKV
Sbjct  124  KATVNMLHRVEPYVTYGYPNLKSVRELIYKRGYGKV  159



>gb|AFK45232.1| unknown [Medicago truncatula]
Length=243

 Score =   230 bits (587),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 123/150 (82%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = +1

Query  94   VVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLK  273
            +VPESVLKKQ R E+WALAK QE  A KKK AENRKLI+ RAKQY++EYE++++ELI LK
Sbjct  8    IVPESVLKKQNREEQWALAKTQESEASKKKRAENRKLIYSRAKQYSQEYEDKERELISLK  67

Query  274  REARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNM  453
            REA+LKGGFYV+PEAKLLFIIRIRGINAM P T+KILQL RLRQIFNGVFLKVNKAT+NM
Sbjct  68   REAKLKGGFYVDPEAKLLFIIRIRGINAMDPKTRKILQLFRLRQIFNGVFLKVNKATMNM  127

Query  454  LHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LH+VEPYVTYGYPNLKSVRELIYKRGYGK+
Sbjct  128  LHRVEPYVTYGYPNLKSVRELIYKRGYGKL  157



>gb|AFK34881.1| unknown [Medicago truncatula]
Length=244

 Score =   230 bits (586),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 130/160 (81%), Positives = 142/160 (89%), Gaps = 2/160 (1%)
 Frame = +1

Query  64   MAEAQTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeye  243
            MA+ + K   VVPESVLKKQKRNEEWAL KKQE  + KKK +E RKLI+ RAKQYAKEY+
Sbjct  1    MAKEEVK--TVVPESVLKKQKRNEEWALVKKQEQESAKKKRSETRKLIWSRAKQYAKEYD  58

Query  244  eqqkeLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVF  423
            + QKELI LKRE +LKGGFYV+PEAKLLFIIRIRGINAM P ++KILQLLRLRQI NGVF
Sbjct  59   DSQKELIALKRETKLKGGFYVDPEAKLLFIIRIRGINAMDPKSRKILQLLRLRQICNGVF  118

Query  424  LKVNKATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LKVNKATVNMLH+VEPYVTYGYPNLKSVRELIYKRGYGKV
Sbjct  119  LKVNKATVNMLHRVEPYVTYGYPNLKSVRELIYKRGYGKV  158



>gb|KEH28610.1| 60S ribosomal protein L7 [Medicago truncatula]
Length=243

 Score =   230 bits (586),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 123/150 (82%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = +1

Query  94   VVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLK  273
            +VPESVLKKQ R E+WALAK QE  A KKK AENRKLI+ RAKQY++EYE++++ELI LK
Sbjct  8    IVPESVLKKQNREEQWALAKTQESEASKKKRAENRKLIYSRAKQYSQEYEDKERELISLK  67

Query  274  REARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNM  453
            REA+LKGGFYV+PEAKLLFIIRIRGINAM P T+KILQL RLRQIFNGVFLKVNKAT+NM
Sbjct  68   REAKLKGGFYVDPEAKLLFIIRIRGINAMDPKTRKILQLFRLRQIFNGVFLKVNKATMNM  127

Query  454  LHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LH+VEPYVTYGYPNLKSVRELIYKRGYGK+
Sbjct  128  LHRVEPYVTYGYPNLKSVRELIYKRGYGKL  157



>ref|XP_009396236.1| PREDICTED: 60S ribosomal protein L7-2-like [Musa acuminata subsp. 
malaccensis]
Length=244

 Score =   230 bits (586),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 129/160 (81%), Positives = 144/160 (90%), Gaps = 2/160 (1%)
 Frame = +1

Query  64   MAEAQTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeye  243
            MA  + K   VVPESVLKK+KR E+WA+AKKQ + A KKK+  NRKLIF RA+QYAKEYE
Sbjct  1    MATEEAKA--VVPESVLKKRKREEQWAVAKKQAVDAKKKKDRTNRKLIFTRAQQYAKEYE  58

Query  244  eqqkeLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVF  423
             Q+KELI+LKREAR+KGGFYV+PEAKLLFIIRIRGINAMHP T+KILQLLRLRQIFNGVF
Sbjct  59   SQEKELIRLKREARMKGGFYVSPEAKLLFIIRIRGINAMHPKTRKILQLLRLRQIFNGVF  118

Query  424  LKVNKATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LKVNKAT+NML +VEPYVTYGYPNLKSVRELIYKRGYGK+
Sbjct  119  LKVNKATMNMLQRVEPYVTYGYPNLKSVRELIYKRGYGKL  158



>ref|XP_008781795.1| PREDICTED: 60S ribosomal protein L7-2-like [Phoenix dactylifera]
Length=244

 Score =   229 bits (585),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 129/160 (81%), Positives = 143/160 (89%), Gaps = 2/160 (1%)
 Frame = +1

Query  64   MAEAQTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeye  243
            MA  + K   V+PESVLKK+KR EEW +AKK+ L A K K+ ENRKLIF RA+QYAKEYE
Sbjct  1    MATEEAKA--VIPESVLKKRKREEEWVIAKKKNLDAKKNKDRENRKLIFSRAQQYAKEYE  58

Query  244  eqqkeLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVF  423
            +Q+KELI LKREAR+KGGFYV+PEAKLLFIIRIRGINAMHP T+KILQLLRLRQIFNGVF
Sbjct  59   DQEKELIHLKREARMKGGFYVSPEAKLLFIIRIRGINAMHPKTRKILQLLRLRQIFNGVF  118

Query  424  LKVNKATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LKVNKATVNML +VEPYVTYGYPNLKSVRELIYKRGYGK+
Sbjct  119  LKVNKATVNMLRRVEPYVTYGYPNLKSVRELIYKRGYGKL  158



>gb|EYU38737.1| hypothetical protein MIMGU_mgv1a012615mg [Erythranthe guttata]
Length=245

 Score =   229 bits (585),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 128/156 (82%), Positives = 139/156 (89%), Gaps = 0/156 (0%)
 Frame = +1

Query  76   QTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqk  255
            + K G +VPESVLKKQKR +EWALAK  ELA  K K   +RKLI  +A+QYA+EYE+Q K
Sbjct  4    EVKTGVLVPESVLKKQKRADEWALAKVNELALAKTKKVADRKLICKKARQYAEEYEKQAK  63

Query  256  eLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVN  435
            ELI LKREARLKGGFYVNPEAKLLFIIRIRGINAMHP TKKILQLLRLRQIFNGVFLKVN
Sbjct  64   ELIDLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPTTKKILQLLRLRQIFNGVFLKVN  123

Query  436  KATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            KAT+NMLH+VEPYVTYGYPNLKSV+ELIYKRGYGKV
Sbjct  124  KATMNMLHRVEPYVTYGYPNLKSVKELIYKRGYGKV  159



>gb|ACN40686.1| unknown [Picea sitchensis]
Length=246

 Score =   229 bits (584),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 122/160 (76%), Positives = 141/160 (88%), Gaps = 0/160 (0%)
 Frame = +1

Query  64   MAEAQTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeye  243
            M E + K   VVPESVLKK+KRNEEW   KK++L A K K A+NRKLIF RA++Y KEY 
Sbjct  1    MGEEEAKAVAVVPESVLKKRKRNEEWEKNKKEQLDAAKLKRAQNRKLIFKRAEKYIKEYR  60

Query  244  eqqkeLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVF  423
            +Q+++LI+LKR+A+L+GGFYV+PEAKLLFIIRIRGIN MHP T+KILQLLRLRQIFNGVF
Sbjct  61   DQERDLIRLKRDAKLRGGFYVDPEAKLLFIIRIRGINDMHPKTRKILQLLRLRQIFNGVF  120

Query  424  LKVNKATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LKVNKATVNML +VEPYVTYGYPNLKS+RELIYKRGYGKV
Sbjct  121  LKVNKATVNMLQRVEPYVTYGYPNLKSIRELIYKRGYGKV  160



>gb|ABK26757.1| unknown [Picea sitchensis]
 gb|ACN40856.1| unknown [Picea sitchensis]
Length=246

 Score =   229 bits (584),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 122/160 (76%), Positives = 141/160 (88%), Gaps = 0/160 (0%)
 Frame = +1

Query  64   MAEAQTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeye  243
            M E + K   VVPESVLKK+KRNEEW   KK++L A K K A+NRKLIF RA++Y KEY 
Sbjct  1    MGEEEAKAVAVVPESVLKKRKRNEEWEKNKKEQLDAAKLKRAQNRKLIFKRAEKYIKEYR  60

Query  244  eqqkeLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVF  423
            +Q+++LI+LKR+A+L+GGFYV+PEAKLLFIIRIRGIN MHP T+KILQLLRLRQIFNGVF
Sbjct  61   DQERDLIRLKRDAKLRGGFYVDPEAKLLFIIRIRGINDMHPKTRKILQLLRLRQIFNGVF  120

Query  424  LKVNKATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LKVNKATVNML +VEPYVTYGYPNLKS+RELIYKRGYGKV
Sbjct  121  LKVNKATVNMLQRVEPYVTYGYPNLKSIRELIYKRGYGKV  160



>ref|XP_009333969.1| PREDICTED: 60S ribosomal protein L7-2 [Pyrus x bretschneideri]
Length=243

 Score =   229 bits (583),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 126/150 (84%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = +1

Query  94   VVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLK  273
            VVPESVLKK+KR E+WALAK+QE  A  KK AENRKLI+ RAKQY++EYE+Q+KELIQLK
Sbjct  8    VVPESVLKKRKREEQWALAKEQERVAANKKKAENRKLIYNRAKQYSEEYEQQEKELIQLK  67

Query  274  REARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNM  453
            REA+LKGGFYV+PEAKLLFIIRIRGINA+ P TKKILQLLRLRQIFNGVFLKVNKAT+NM
Sbjct  68   REAKLKGGFYVDPEAKLLFIIRIRGINAIDPKTKKILQLLRLRQIFNGVFLKVNKATLNM  127

Query  454  LHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LH+VEPYVTYGYPNLKSV+ELIYKRGYGK+
Sbjct  128  LHRVEPYVTYGYPNLKSVKELIYKRGYGKL  157



>ref|XP_004141745.1| PREDICTED: 60S ribosomal protein L7-4-like [Cucumis sativus]
 ref|XP_004159009.1| PREDICTED: 60S ribosomal protein L7-4-like [Cucumis sativus]
 gb|KGN45421.1| hypothetical protein Csa_7G447830 [Cucumis sativus]
Length=243

 Score =   229 bits (583),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 124/150 (83%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = +1

Query  94   VVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLK  273
            +VPESVLKK KRNEEW+LA KQEL A KKK AE RKLI+ RAK Y+KEYEEQ+KEL++LK
Sbjct  8    IVPESVLKKAKRNEEWSLASKQELEAAKKKRAETRKLIYNRAKLYSKEYEEQEKELVRLK  67

Query  274  REARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNM  453
            REARLKGGFYV+PEAKLLFI+RIRGINA+ P T+KILQLLRLRQIFNGVFLKVNKAT+NM
Sbjct  68   REARLKGGFYVDPEAKLLFIVRIRGINAIDPKTRKILQLLRLRQIFNGVFLKVNKATLNM  127

Query  454  LHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LH+VEPYVTYGYPNLKSV+ELIYKRG+GK+
Sbjct  128  LHRVEPYVTYGYPNLKSVKELIYKRGFGKL  157



>ref|XP_010520183.1| PREDICTED: 60S ribosomal protein L7-2-like [Tarenaya hassleriana]
Length=242

 Score =   228 bits (582),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 129/160 (81%), Positives = 142/160 (89%), Gaps = 4/160 (3%)
 Frame = +1

Query  64   MAEAQTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeye  243
            MAEA+     VVPESVLKK KR EEW  AK +E  A KKKN ENR+LIF RA+QYAKEY 
Sbjct  1    MAEAKA----VVPESVLKKMKREEEWQSAKMKEAEATKKKNVENRRLIFKRAQQYAKEYA  56

Query  244  eqqkeLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVF  423
            E++KELIQLKREA+LKGGFYV+PEAKLLFIIRIRGINA+ P TKKILQLLRLRQIFNGVF
Sbjct  57   EKEKELIQLKREAKLKGGFYVDPEAKLLFIIRIRGINAIDPKTKKILQLLRLRQIFNGVF  116

Query  424  LKVNKATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LKVNKAT+NMLH+VEPYVTYGYPNLKSV+ELIYKRGYGK+
Sbjct  117  LKVNKATMNMLHRVEPYVTYGYPNLKSVKELIYKRGYGKL  156



>gb|KDP23476.1| hypothetical protein JCGZ_23309 [Jatropha curcas]
Length=245

 Score =   228 bits (582),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 125/160 (78%), Positives = 143/160 (89%), Gaps = 1/160 (1%)
 Frame = +1

Query  64   MAEAQTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeye  243
            MAE +TK    +PESVLKKQKR+EEWALAK QEL   K+KNAENR +I+ RA++YAKEY+
Sbjct  1    MAE-ETKAAAFIPESVLKKQKRSEEWALAKTQELKLRKQKNAENRSVIYKRAEKYAKEYQ  59

Query  244  eqqkeLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVF  423
            E ++ELI LKREA+LKGGFYV PEAKLLFIIRIRGINAM P T+KILQLLRLRQIFNGVF
Sbjct  60   EHERELISLKREAKLKGGFYVEPEAKLLFIIRIRGINAMDPKTRKILQLLRLRQIFNGVF  119

Query  424  LKVNKATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LKVNKAT++ML +VEPYVTYGYPNLKSVRELIYKRG+GK+
Sbjct  120  LKVNKATISMLRRVEPYVTYGYPNLKSVRELIYKRGFGKL  159



>ref|XP_009345996.1| PREDICTED: 60S ribosomal protein L7-2-like [Pyrus x bretschneideri]
Length=243

 Score =   228 bits (581),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 139/150 (93%), Gaps = 0/150 (0%)
 Frame = +1

Query  94   VVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLK  273
            VVPESVLKK+KR EEWALAK+QE     KK AENRKLI+ RAKQY+KEYE Q+KELIQLK
Sbjct  8    VVPESVLKKRKREEEWALAKEQERVTANKKKAENRKLIYNRAKQYSKEYERQEKELIQLK  67

Query  274  REARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNM  453
            REA+LKGGFYV+PEAKLLFIIRIRGINA+ P TKKILQLLRLRQIFNGVFLKVNKAT+NM
Sbjct  68   REAKLKGGFYVDPEAKLLFIIRIRGINAIDPKTKKILQLLRLRQIFNGVFLKVNKATLNM  127

Query  454  LHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LH+VEPYVTYGYPNLKSV+ELIYKRGYGK+
Sbjct  128  LHRVEPYVTYGYPNLKSVKELIYKRGYGKL  157



>ref|XP_010424860.1| PREDICTED: 60S ribosomal protein L7-2 [Camelina sativa]
Length=242

 Score =   228 bits (581),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 128/160 (80%), Positives = 143/160 (89%), Gaps = 4/160 (3%)
 Frame = +1

Query  64   MAEAQTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeye  243
            MAE++     VVPESVLKK+KR EEWAL KKQ   A KKKNAENRKLIF RA+QY+KEY 
Sbjct  1    MAESKV----VVPESVLKKRKREEEWALEKKQNAEAAKKKNAENRKLIFKRAEQYSKEYA  56

Query  244  eqqkeLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVF  423
            E++KELI LKREA+LKGGFYV+PEAKLLFIIRIRGINA+ P TKKILQLLRLRQIFNGVF
Sbjct  57   EKEKELISLKREAKLKGGFYVDPEAKLLFIIRIRGINAIDPKTKKILQLLRLRQIFNGVF  116

Query  424  LKVNKATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LKVNKAT+NML +VEPYVTYG+PNLKSV+ELIYKRGYGK+
Sbjct  117  LKVNKATMNMLRRVEPYVTYGFPNLKSVKELIYKRGYGKL  156



>gb|ABK22465.1| unknown [Picea sitchensis]
 gb|ABK26616.1| unknown [Picea sitchensis]
Length=246

 Score =   228 bits (580),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 122/160 (76%), Positives = 141/160 (88%), Gaps = 0/160 (0%)
 Frame = +1

Query  64   MAEAQTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeye  243
            M E + K   VVPESVLKK+KRNEEW   KK++L A K K A+NRKLIF RA++Y KEY 
Sbjct  1    MGEEEAKVVAVVPESVLKKRKRNEEWEKNKKEQLDAAKLKRAQNRKLIFKRAEKYIKEYR  60

Query  244  eqqkeLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVF  423
            +Q+++LI+LKR+A+L+GGFYV+PEAKLLFIIRIRGIN MHP T+KILQLLRLRQIFNGVF
Sbjct  61   DQERDLIRLKRDAKLRGGFYVDPEAKLLFIIRIRGINDMHPKTRKILQLLRLRQIFNGVF  120

Query  424  LKVNKATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LKVNKATVNML +VEPYVTYGYPNLKS+RELIYKRGYGKV
Sbjct  121  LKVNKATVNMLQRVEPYVTYGYPNLKSIRELIYKRGYGKV  160



>ref|NP_178234.1| 60S ribosomal protein L7-2 [Arabidopsis thaliana]
 sp|P60040.1|RL72_ARATH RecName: Full=60S ribosomal protein L7-2 [Arabidopsis thaliana]
 gb|AAK43861.1|AF370484_1 60S ribosomal protein L7 [Arabidopsis thaliana]
 gb|AAD14525.1| putative ribosomal protein L7 [Arabidopsis thaliana]
 gb|AAK76668.1| putative ribosomal protein L7 [Arabidopsis thaliana]
 gb|AAL85059.1| putative ribosomal protein L7 [Arabidopsis thaliana]
 gb|AAM10260.1| 60S ribosomal protein L7 [Arabidopsis thaliana]
 gb|AAM61692.1| putative ribosomal protein L7 [Arabidopsis thaliana]
 gb|AEC05420.1| 60S ribosomal protein L7-2 [Arabidopsis thaliana]
Length=242

 Score =   227 bits (579),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 125/150 (83%), Positives = 139/150 (93%), Gaps = 0/150 (0%)
 Frame = +1

Query  94   VVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLK  273
            VVPESVLKK+KR EEWAL KKQ + A KKKNAENRKLIF RA+QY+KEY E++KELI LK
Sbjct  7    VVPESVLKKRKREEEWALEKKQNVEAAKKKNAENRKLIFKRAEQYSKEYAEKEKELISLK  66

Query  274  REARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNM  453
            REA+LKGGFYV+PEAKLLFIIRIRGINA+ P TKKILQLLRLRQIFNGVFLKVNKAT+NM
Sbjct  67   REAKLKGGFYVDPEAKLLFIIRIRGINAIDPKTKKILQLLRLRQIFNGVFLKVNKATMNM  126

Query  454  LHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            L +VEPYVTYG+PNLKSV+ELIYKRGYGK+
Sbjct  127  LRRVEPYVTYGFPNLKSVKELIYKRGYGKL  156



>ref|XP_002876738.1| 60S ribosomal protein L7 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52997.1| 60S ribosomal protein L7 [Arabidopsis lyrata subsp. lyrata]
Length=242

 Score =   227 bits (578),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 125/150 (83%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = +1

Query  94   VVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLK  273
            VVPESVLKK+KR EEWAL KKQ   A KKKNAENRKLIF RA+QY+KEY E++KELI LK
Sbjct  7    VVPESVLKKRKREEEWALEKKQNAEAAKKKNAENRKLIFKRAEQYSKEYAEKEKELISLK  66

Query  274  REARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNM  453
            REA+LKGGFYV+PEAKLLFIIRIRGINA+ P TKKILQLLRLRQIFNGVFLKVNKAT+NM
Sbjct  67   REAKLKGGFYVDPEAKLLFIIRIRGINAIDPKTKKILQLLRLRQIFNGVFLKVNKATMNM  126

Query  454  LHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            L +VEPYVTYG+PNLKSV+ELIYKRGYGK+
Sbjct  127  LRRVEPYVTYGFPNLKSVKELIYKRGYGKL  156



>ref|XP_009340520.1| PREDICTED: 60S ribosomal protein L7-2-like [Pyrus x bretschneideri]
Length=243

 Score =   227 bits (578),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 125/150 (83%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = +1

Query  94   VVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLK  273
            VVPESVLKK+KR E+WALAK+QE  A  KK AENRKLI+ RAKQY++EYE+Q+KELIQLK
Sbjct  8    VVPESVLKKRKREEQWALAKEQERVAANKKKAENRKLIYNRAKQYSEEYEQQEKELIQLK  67

Query  274  REARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNM  453
            REA+LKGGFYV+PEAKLLFIIRIRGINA+ P TKKILQLLRLRQIFNGVFLKVNKAT+NM
Sbjct  68   REAKLKGGFYVDPEAKLLFIIRIRGINAIDPKTKKILQLLRLRQIFNGVFLKVNKATLNM  127

Query  454  LHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LH+VEPYVTYGYPNLK V+ELIYKRGYGK+
Sbjct  128  LHRVEPYVTYGYPNLKGVKELIYKRGYGKL  157



>ref|XP_008789605.1| PREDICTED: 60S ribosomal protein L7-2 [Phoenix dactylifera]
Length=244

 Score =   227 bits (578),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 127/160 (79%), Positives = 144/160 (90%), Gaps = 2/160 (1%)
 Frame = +1

Query  64   MAEAQTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeye  243
            MA  + K   V+PESVLKK+KR EEWALAKK+ L A KKK+ ENRKLIF RA+QYAKEYE
Sbjct  1    MATEEAKA--VIPESVLKKRKREEEWALAKKKALEAQKKKDRENRKLIFNRAQQYAKEYE  58

Query  244  eqqkeLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVF  423
             ++KELI+LKREAR+KGGFYV+PE+KLLFIIRIRGINA+ P T+KILQLLRLRQIFNGVF
Sbjct  59   TREKELIRLKREARMKGGFYVSPESKLLFIIRIRGINAIDPKTRKILQLLRLRQIFNGVF  118

Query  424  LKVNKATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LKVNKAT+NML +VEPYVTYGYPNLKSVRELIYKRGYGK+
Sbjct  119  LKVNKATINMLRRVEPYVTYGYPNLKSVRELIYKRGYGKL  158



>ref|XP_002862275.1| 60S ribosomal protein L7 [Arabidopsis lyrata subsp. lyrata]
 ref|XP_006294893.1| hypothetical protein CARUB_v10023943mg [Capsella rubella]
 ref|XP_010506317.1| PREDICTED: 60S ribosomal protein L7-3 [Camelina sativa]
 ref|XP_010506318.1| PREDICTED: 60S ribosomal protein L7-3 [Camelina sativa]
 ref|XP_010517998.1| PREDICTED: 60S ribosomal protein L7-3 [Camelina sativa]
 ref|XP_010518000.1| PREDICTED: 60S ribosomal protein L7-3 [Camelina sativa]
 gb|EFH38533.1| 60S ribosomal protein L7 [Arabidopsis lyrata subsp. lyrata]
 gb|EOA27791.1| hypothetical protein CARUB_v10023943mg [Capsella rubella]
Length=242

 Score =   226 bits (577),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 128/160 (80%), Positives = 141/160 (88%), Gaps = 4/160 (3%)
 Frame = +1

Query  64   MAEAQTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeye  243
            MAE++     VVPESVLKK KR EEWALAKK+E  A KKK+ E RKLIF RA+QYAKEY 
Sbjct  1    MAESKV----VVPESVLKKIKRQEEWALAKKEETVAAKKKSVETRKLIFKRAEQYAKEYA  56

Query  244  eqqkeLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVF  423
            E+  ELI+LKREA+LKGGFYV+PEAKLLFIIRIRGINA+ P TKKILQLLRLRQIFNGVF
Sbjct  57   EKDNELIRLKREAKLKGGFYVDPEAKLLFIIRIRGINAIDPKTKKILQLLRLRQIFNGVF  116

Query  424  LKVNKATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LKVNKATVNML +VEPYVTYGYPNLKSV+ELIYKRGYGK+
Sbjct  117  LKVNKATVNMLRRVEPYVTYGYPNLKSVKELIYKRGYGKL  156



>gb|KCW45526.1| hypothetical protein EUGRSUZ_L00756 [Eucalyptus grandis]
Length=241

 Score =   226 bits (577),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 140/150 (93%), Gaps = 3/150 (2%)
 Frame = +1

Query  94   VVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLK  273
            +VPESVLKKQKRNEEWALAKKQEL + K+KNAENRKLI+ RAKQYAKEY EQ+KELIQLK
Sbjct  9    IVPESVLKKQKRNEEWALAKKQELESAKQKNAENRKLIYDRAKQYAKEYAEQEKELIQLK  68

Query  274  REARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNM  453
            REA+L+GGFYV+PEAKLLFIIRIRGINAMHP T+ ILQLLRLRQIFNGVFLKVNKATVN+
Sbjct  69   REAKLRGGFYVDPEAKLLFIIRIRGINAMHPKTRTILQLLRLRQIFNGVFLKVNKATVNI  128

Query  454  LHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LH+VEPYVT+GY N   VRELIYKRGYGK+
Sbjct  129  LHRVEPYVTFGYVN---VRELIYKRGYGKL  155



>emb|CDY30456.1| BnaA04g25570D [Brassica napus]
Length=257

 Score =   227 bits (578),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 141/166 (85%), Gaps = 0/166 (0%)
 Frame = +1

Query  46   SIAQLQMAEAQTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakq  225
            S   L + E   +   VVPESVLKK KR EEWALAKKQE  A KKK+ E RKLIF RA+Q
Sbjct  6    SFNYLPLKEEMAESKVVVPESVLKKIKREEEWALAKKQEAEAAKKKSVETRKLIFKRAEQ  65

Query  226  yakeyeeqqkeLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQ  405
            YAKEY E+  ELI+LKREA+LKGGFYV+PEAKLLFIIRIRGINA+ P TKKILQLLRLRQ
Sbjct  66   YAKEYAEKDNELIRLKREAKLKGGFYVDPEAKLLFIIRIRGINAIDPKTKKILQLLRLRQ  125

Query  406  IFNGVFLKVNKATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            IFNGVFLKVNKAT+NML +VEPYVTYGYPNLK+V+ELIYKRGYGK+
Sbjct  126  IFNGVFLKVNKATINMLRRVEPYVTYGYPNLKTVKELIYKRGYGKL  171



>ref|XP_004303828.1| PREDICTED: 60S ribosomal protein L7-2 [Fragaria vesca subsp. 
vesca]
 ref|XP_011467555.1| PREDICTED: 60S ribosomal protein L7-2 [Fragaria vesca subsp. 
vesca]
Length=243

 Score =   226 bits (575),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 122/150 (81%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = +1

Query  94   VVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLK  273
            VVPESVLKK+KR +EWALAKKQ L A KKKNA NRKLI+ +AKQY KEY ++  EL+ LK
Sbjct  8    VVPESVLKKRKREDEWALAKKQALEAAKKKNAANRKLIYNKAKQYTKEYADKDNELVCLK  67

Query  274  REARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNM  453
            REARLKGGFYV PE+KLLFIIRIRGINA+ P TKKILQLLRLRQ+FNGVFLKVNKAT+NM
Sbjct  68   REARLKGGFYVEPESKLLFIIRIRGINAIDPKTKKILQLLRLRQVFNGVFLKVNKATLNM  127

Query  454  LHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LH+VEPYVTYGYPNLKSV+ELIYKRGYGK+
Sbjct  128  LHRVEPYVTYGYPNLKSVKELIYKRGYGKL  157



>ref|XP_002880084.1| 60S ribosomal protein L7 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56343.1| 60S ribosomal protein L7 [Arabidopsis lyrata subsp. lyrata]
Length=242

 Score =   226 bits (575),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 127/160 (79%), Positives = 141/160 (88%), Gaps = 4/160 (3%)
 Frame = +1

Query  64   MAEAQTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeye  243
            MAE++     VVPESVLKK KR EEWALAKK+E  A KKK+ + RKLIF RA+QYAKEY 
Sbjct  1    MAESKV----VVPESVLKKIKRQEEWALAKKEETVAAKKKSVDTRKLIFKRAEQYAKEYA  56

Query  244  eqqkeLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVF  423
            E+  ELI+LKREA+LKGGFYV+PEAKLLFIIRIRGINA+ P TKKILQLLRLRQIFNGVF
Sbjct  57   EKDNELIRLKREAKLKGGFYVDPEAKLLFIIRIRGINAIDPKTKKILQLLRLRQIFNGVF  116

Query  424  LKVNKATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LKVNKATVNML +VEPYVTYGYPNLKSV+ELIYKRGYGK+
Sbjct  117  LKVNKATVNMLRRVEPYVTYGYPNLKSVKELIYKRGYGKL  156



>ref|NP_850411.1| 60S ribosomal protein L7-3 [Arabidopsis thaliana]
 gb|AAC23430.1| 60S ribosomal protein L7 [Arabidopsis thaliana]
 gb|AEC10379.1| 60S ribosomal protein L7-3 [Arabidopsis thaliana]
Length=247

 Score =   226 bits (575),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 128/161 (80%), Positives = 141/161 (88%), Gaps = 4/161 (2%)
 Frame = +1

Query  61   QMAEAQTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakey  240
            +MAE++     VVPESVLKK KR EEWALAKK E  A KKK+ E RKLIF RA+QYAKEY
Sbjct  5    EMAESKV----VVPESVLKKIKRQEEWALAKKDEAVAAKKKSVEARKLIFKRAEQYAKEY  60

Query  241  eeqqkeLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGV  420
             E+  ELI+LKREA+LKGGFYV+PEAKLLFIIRIRGINA+ P TKKILQLLRLRQIFNGV
Sbjct  61   AEKDNELIRLKREAKLKGGFYVDPEAKLLFIIRIRGINAIDPKTKKILQLLRLRQIFNGV  120

Query  421  FLKVNKATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            FLKVNKATVNML +VEPYVTYGYPNLKSV+ELIYKRGYGK+
Sbjct  121  FLKVNKATVNMLRRVEPYVTYGYPNLKSVKELIYKRGYGKL  161



>ref|XP_009101359.1| PREDICTED: 60S ribosomal protein L7-2-like [Brassica rapa]
Length=242

 Score =   226 bits (575),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 127/157 (81%), Positives = 142/157 (90%), Gaps = 2/157 (1%)
 Frame = +1

Query  73   AQTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqq  252
            A++KG  VVPESVLKK+KR EEWALAKKQ   A KK NA NRKLI+ RA+QYAKEY E++
Sbjct  2    AESKG--VVPESVLKKRKREEEWALAKKQSTEAAKKTNAANRKLIYKRAEQYAKEYAEKE  59

Query  253  keLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKV  432
            KELI LKREA+LKGGFYV+PEAKLLFIIRIRGINA+ P TKKILQLLRLRQIFNGVFLKV
Sbjct  60   KELISLKREAKLKGGFYVDPEAKLLFIIRIRGINAIDPKTKKILQLLRLRQIFNGVFLKV  119

Query  433  NKATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            NKAT+NML +VEPYVTYG+PNLKSV+ELIYKRGYGK+
Sbjct  120  NKATMNMLRRVEPYVTYGFPNLKSVKELIYKRGYGKL  156



>ref|NP_850410.1| 60S ribosomal protein L7-3 [Arabidopsis thaliana]
 sp|P60039.1|RL73_ARATH RecName: Full=60S ribosomal protein L7-3 [Arabidopsis thaliana]
 gb|AAL38617.1|AF446884_1 At2g44120/F6E13.25 [Arabidopsis thaliana]
 gb|AAK96628.1| At2g44120/F6E13.25 [Arabidopsis thaliana]
 gb|AAL38372.1| 60S ribosomal protein L7 [Arabidopsis thaliana]
 gb|AAM10036.1| 60S ribosomal protein L7 [Arabidopsis thaliana]
 gb|AAM65125.1| 60S ribosomal protein L7 [Arabidopsis thaliana]
 gb|AEC10378.1| 60S ribosomal protein L7-3 [Arabidopsis thaliana]
Length=242

 Score =   225 bits (574),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 128/160 (80%), Positives = 140/160 (88%), Gaps = 4/160 (3%)
 Frame = +1

Query  64   MAEAQTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeye  243
            MAE++     VVPESVLKK KR EEWALAKK E  A KKK+ E RKLIF RA+QYAKEY 
Sbjct  1    MAESKV----VVPESVLKKIKRQEEWALAKKDEAVAAKKKSVEARKLIFKRAEQYAKEYA  56

Query  244  eqqkeLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVF  423
            E+  ELI+LKREA+LKGGFYV+PEAKLLFIIRIRGINA+ P TKKILQLLRLRQIFNGVF
Sbjct  57   EKDNELIRLKREAKLKGGFYVDPEAKLLFIIRIRGINAIDPKTKKILQLLRLRQIFNGVF  116

Query  424  LKVNKATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LKVNKATVNML +VEPYVTYGYPNLKSV+ELIYKRGYGK+
Sbjct  117  LKVNKATVNMLRRVEPYVTYGYPNLKSVKELIYKRGYGKL  156



>ref|XP_009133658.1| PREDICTED: 60S ribosomal protein L7-3-like [Brassica rapa]
Length=242

 Score =   225 bits (574),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 126/160 (79%), Positives = 140/160 (88%), Gaps = 4/160 (3%)
 Frame = +1

Query  64   MAEAQTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeye  243
            MA+++     VVPESVLKK KR EEWALAKKQE  A KKK+ E RKLIF RA+QYAKEY 
Sbjct  1    MADSKV----VVPESVLKKIKREEEWALAKKQEAEAAKKKSVETRKLIFKRAEQYAKEYA  56

Query  244  eqqkeLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVF  423
            ++  ELI+LKREA+LKGGFYV+PEAKLLFIIRIRGINA+ P TKKILQLLRL QIFNGVF
Sbjct  57   QKDNELIRLKREAKLKGGFYVDPEAKLLFIIRIRGINAIDPKTKKILQLLRLSQIFNGVF  116

Query  424  LKVNKATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LKVNKAT+NML +VEPYVTYGYPNLKSVRELIYKRGYGK+
Sbjct  117  LKVNKATINMLRRVEPYVTYGYPNLKSVRELIYKRGYGKL  156



>gb|AAO00739.1| Unknown protein [Arabidopsis thaliana]
Length=242

 Score =   225 bits (574),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 128/160 (80%), Positives = 140/160 (88%), Gaps = 4/160 (3%)
 Frame = +1

Query  64   MAEAQTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeye  243
            MAE++     VVPESVLKK KR EEWALAKK E  A KKK+ E RKLIF RA+QYAKEY 
Sbjct  1    MAESKV----VVPESVLKKIKRQEEWALAKKDEAVAAKKKSVEARKLIFKRAEQYAKEYA  56

Query  244  eqqkeLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVF  423
            E+  ELI+LKREA+LKGGFYV+PEAKLLFIIRIRGINA+ P TKKILQLLRLRQIFNGVF
Sbjct  57   EKDNELIRLKREAKLKGGFYVDPEAKLLFIIRIRGINAIDPKTKKILQLLRLRQIFNGVF  116

Query  424  LKVNKATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LKVNKATVNML +VEPYVTYGYPNLKSV+ELIYKRGYGK+
Sbjct  117  LKVNKATVNMLRRVEPYVTYGYPNLKSVKELIYKRGYGKL  156



>ref|XP_009142247.1| PREDICTED: 60S ribosomal protein L7-3-like [Brassica rapa]
Length=242

 Score =   225 bits (574),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 126/160 (79%), Positives = 140/160 (88%), Gaps = 4/160 (3%)
 Frame = +1

Query  64   MAEAQTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeye  243
            MAE++     VVPESVLKK KR EEWALAKKQE  A KKK+ E RKLIF RA+ YAKEY 
Sbjct  1    MAESKV----VVPESVLKKIKREEEWALAKKQEAEAAKKKSVETRKLIFKRAEHYAKEYA  56

Query  244  eqqkeLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVF  423
            E+  ELI+LKREA+LKGGFYV+PEAKLLFIIRIRGINA+ P TKKILQLLRLRQIFNGVF
Sbjct  57   EKDNELIRLKREAKLKGGFYVDPEAKLLFIIRIRGINAIDPKTKKILQLLRLRQIFNGVF  116

Query  424  LKVNKATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LKVNKAT+NML +VEPYVTYGYPNLK+V+ELIYKRGYGK+
Sbjct  117  LKVNKATINMLRRVEPYVTYGYPNLKTVKELIYKRGYGKL  156



>emb|CDY17686.1| BnaA06g35050D [Brassica napus]
 emb|CDX77810.1| BnaC07g20640D [Brassica napus]
Length=242

 Score =   224 bits (572),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 127/160 (79%), Positives = 142/160 (89%), Gaps = 4/160 (3%)
 Frame = +1

Query  64   MAEAQTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeye  243
            MAE++     VVPESVLKK+KR EEWALAKKQ   A KK NA NRKLI+ RA+QYAKEY 
Sbjct  1    MAESKV----VVPESVLKKRKREEEWALAKKQSAEAAKKTNAANRKLIYKRAEQYAKEYA  56

Query  244  eqqkeLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVF  423
            E++KELI LKREA+LKGGFYV+PEAKLLFIIRIRGINA+ P TKKILQLLRLRQIFNGVF
Sbjct  57   EKEKELISLKREAKLKGGFYVDPEAKLLFIIRIRGINAIDPKTKKILQLLRLRQIFNGVF  116

Query  424  LKVNKATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LKVNKAT+NML +VEPYVTYG+PNLKSV+ELIYKRGYGK+
Sbjct  117  LKVNKATMNMLRRVEPYVTYGFPNLKSVKELIYKRGYGKL  156



>ref|XP_009107124.1| PREDICTED: 60S ribosomal protein L7-2 [Brassica rapa]
 emb|CDY40393.1| BnaA02g27070D [Brassica napus]
Length=242

 Score =   224 bits (571),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 127/160 (79%), Positives = 142/160 (89%), Gaps = 4/160 (3%)
 Frame = +1

Query  64   MAEAQTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeye  243
            MAE++     VVPESVLKK+KR EEWALAKKQ   A KK NA NRKLI+ RA+QYAKEY 
Sbjct  1    MAESKV----VVPESVLKKRKREEEWALAKKQTAEAAKKTNAANRKLIYKRAEQYAKEYA  56

Query  244  eqqkeLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVF  423
            E++KELI LKREA+LKGGFYV+PEAKLLFIIRIRGINA+ P TKKILQLLRLRQIFNGVF
Sbjct  57   EKEKELISLKREAKLKGGFYVDPEAKLLFIIRIRGINAIDPKTKKILQLLRLRQIFNGVF  116

Query  424  LKVNKATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LKVNKAT+NML +VEPYVTYG+PNLKSV+ELIYKRGYGK+
Sbjct  117  LKVNKATMNMLRRVEPYVTYGFPNLKSVKELIYKRGYGKL  156



>emb|CDY41074.1| BnaA09g18530D [Brassica napus]
Length=242

 Score =   224 bits (571),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 125/155 (81%), Positives = 139/155 (90%), Gaps = 0/155 (0%)
 Frame = +1

Query  79   TKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqke  258
            T+   VVPESVLKK+KR EEWALAKKQ   A KK NA NRKLI+ RA+QYAKEY E++KE
Sbjct  2    TESKVVVPESVLKKRKREEEWALAKKQNAEAAKKTNAANRKLIYKRAEQYAKEYAEKEKE  61

Query  259  LIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNK  438
            LI LKREA+LKGGFYV+PEAKLLFIIRIRGINA+ P TKKILQLLRLRQIFNGVFLKVNK
Sbjct  62   LISLKREAKLKGGFYVDPEAKLLFIIRIRGINAIDPKTKKILQLLRLRQIFNGVFLKVNK  121

Query  439  ATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            AT+NML +VEPYVTYG+PNLKSV+ELIYKRGYGK+
Sbjct  122  ATMNMLRRVEPYVTYGFPNLKSVKELIYKRGYGKL  156



>emb|CDY25941.1| BnaC09g20460D [Brassica napus]
Length=242

 Score =   224 bits (571),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 125/155 (81%), Positives = 139/155 (90%), Gaps = 0/155 (0%)
 Frame = +1

Query  79   TKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqke  258
            T+   VVPESVLKK+KR EEWALAKKQ   A KK NA NRKLI+ RA+QYAKEY E++KE
Sbjct  2    TESKVVVPESVLKKRKREEEWALAKKQNAEAAKKTNAANRKLIYKRAEQYAKEYAEKEKE  61

Query  259  LIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNK  438
            LI LKREA+LKGGFYV+PEAKLLFIIRIRGINA+ P TKKILQLLRLRQIFNGVFLKVNK
Sbjct  62   LISLKREAKLKGGFYVDPEAKLLFIIRIRGINAIDPKTKKILQLLRLRQIFNGVFLKVNK  121

Query  439  ATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            AT+NML +VEPYVTYG+PNLKSV+ELIYKRGYGK+
Sbjct  122  ATMNMLRRVEPYVTYGFPNLKSVKELIYKRGYGKL  156



>ref|XP_006397587.1| hypothetical protein EUTSA_v10001606mg [Eutrema salsugineum]
 ref|XP_006397588.1| hypothetical protein EUTSA_v10001606mg [Eutrema salsugineum]
 gb|ESQ39040.1| hypothetical protein EUTSA_v10001606mg [Eutrema salsugineum]
 gb|ESQ39041.1| hypothetical protein EUTSA_v10001606mg [Eutrema salsugineum]
Length=242

 Score =   224 bits (570),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 125/160 (78%), Positives = 140/160 (88%), Gaps = 4/160 (3%)
 Frame = +1

Query  64   MAEAQTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeye  243
            MA+++     VVPESVLKK KR EEWALAK QE  A KKK+ E RKL+F RA+QYAKEY 
Sbjct  1    MADSKV----VVPESVLKKIKRQEEWALAKNQEAEAAKKKSVETRKLVFKRAEQYAKEYA  56

Query  244  eqqkeLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVF  423
            E+  ELI+LKREA+LKGGFYV+PEAKLLFIIRIRGINA+ P TKKILQLLRLRQIFNGVF
Sbjct  57   EKDNELIRLKREAKLKGGFYVDPEAKLLFIIRIRGINAIDPKTKKILQLLRLRQIFNGVF  116

Query  424  LKVNKATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LKVNKAT+NML +VEPYVTYGYPNLKSV+ELIYKRGYGK+
Sbjct  117  LKVNKATINMLRRVEPYVTYGYPNLKSVKELIYKRGYGKL  156



>ref|XP_009114246.1| PREDICTED: 60S ribosomal protein L7-2-like [Brassica rapa]
Length=242

 Score =   224 bits (570),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 125/155 (81%), Positives = 139/155 (90%), Gaps = 0/155 (0%)
 Frame = +1

Query  79   TKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqke  258
            T+   VVPESVLKK+KR EEWALAKKQ   A KK NA NRKLI+ RA+QYAKEY E++KE
Sbjct  2    TESKVVVPESVLKKRKREEEWALAKKQNAEAAKKTNAANRKLIYKRAEQYAKEYAEKEKE  61

Query  259  LIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNK  438
            LI LKREA+LKGGFYV+PEAKLLFIIRIRGINA+ P TKKILQLLRLRQIFNGVFLKVNK
Sbjct  62   LISLKREAKLKGGFYVDPEAKLLFIIRIRGINAIDPKTKKILQLLRLRQIFNGVFLKVNK  121

Query  439  ATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            AT+NML +VEPYVTYG+PNLKSV+ELIYKRGYGK+
Sbjct  122  ATMNMLRRVEPYVTYGFPNLKSVKELIYKRGYGKL  156



>gb|ABK23069.1| unknown [Picea sitchensis]
Length=246

 Score =   223 bits (569),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +1

Query  100  PESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLKRE  279
            PESVLKK+KRNEEW   KKQ+L A K K+A+NRKLIF RA++Y KEY +Q+ +LI+LKRE
Sbjct  13   PESVLKKRKRNEEWEKNKKQQLEAAKAKSAQNRKLIFKRAEKYIKEYRDQELDLIRLKRE  72

Query  280  ARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNMLH  459
            A+L+GGFYV+PEAKLLFIIRIRGIN MHP T+KILQLLRLRQIFNGVFLKVNKAT+NML 
Sbjct  73   AKLRGGFYVDPEAKLLFIIRIRGINDMHPKTRKILQLLRLRQIFNGVFLKVNKATINMLQ  132

Query  460  KVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            +VEPYVTYGYPNLKS+RELIYKRGYGKV
Sbjct  133  RVEPYVTYGYPNLKSIRELIYKRGYGKV  160



>emb|CDY37358.1| BnaC02g33760D [Brassica napus]
Length=242

 Score =   223 bits (568),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 126/160 (79%), Positives = 141/160 (88%), Gaps = 4/160 (3%)
 Frame = +1

Query  64   MAEAQTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeye  243
            MAE++      VPESVLKK+KR EEWALAKKQ   A KK NA NRKLI+ RA+QYAKEY 
Sbjct  1    MAESKV----AVPESVLKKRKREEEWALAKKQSAEAAKKTNAANRKLIYKRAEQYAKEYA  56

Query  244  eqqkeLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVF  423
            E++KELI LKREA+LKGGFYV+PEAKLLFIIRIRGINA+ P TKKILQLLRLRQIFNGVF
Sbjct  57   EKEKELISLKREAKLKGGFYVDPEAKLLFIIRIRGINAIDPKTKKILQLLRLRQIFNGVF  116

Query  424  LKVNKATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LKVNKAT+NML +VEPYVTYG+PNLKSV+ELIYKRGYGK+
Sbjct  117  LKVNKATMNMLRRVEPYVTYGFPNLKSVKELIYKRGYGKL  156



>emb|CDY23419.1| BnaC04g49470D [Brassica napus]
Length=300

 Score =   224 bits (571),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 126/161 (78%), Positives = 142/161 (88%), Gaps = 4/161 (2%)
 Frame = +1

Query  61   QMAEAQTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakey  240
            +MAE++     VVPESVLKK KR EEWALAKKQE  A KKK+ E RKLIF RA+QYAKEY
Sbjct  58   EMAESKV----VVPESVLKKIKREEEWALAKKQEAEAAKKKSVETRKLIFKRAEQYAKEY  113

Query  241  eeqqkeLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGV  420
             E+  ELI+LKREA+LKGGFYV+PEAKLLFIIRIRGINA+ P TKKILQLLRLRQIFNGV
Sbjct  114  AEKDNELIRLKREAKLKGGFYVDPEAKLLFIIRIRGINAIDPKTKKILQLLRLRQIFNGV  173

Query  421  FLKVNKATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            FLKVNKAT+NML +VEPYVTYGYPNLK+V+ELIYKRG+GK+
Sbjct  174  FLKVNKATINMLRRVEPYVTYGYPNLKTVKELIYKRGFGKL  214



>ref|XP_011094120.1| PREDICTED: 60S ribosomal protein L7-2-like [Sesamum indicum]
 ref|XP_011094121.1| PREDICTED: 60S ribosomal protein L7-2-like [Sesamum indicum]
Length=244

 Score =   222 bits (565),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 133/157 (85%), Positives = 143/157 (91%), Gaps = 0/157 (0%)
 Frame = +1

Query  73   AQTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqq  252
            A+ KG  VVPESVLKKQKR EEWALAK +E+   KKK AE RKLI  +A+ YAKEYE+Q+
Sbjct  2    AEAKGNVVVPESVLKKQKRAEEWALAKSKEVEEAKKKKAETRKLICKKARVYAKEYEQQE  61

Query  253  keLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKV  432
            KELIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHP TKKILQLLRLRQIFNGVFLKV
Sbjct  62   KELIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPRTKKILQLLRLRQIFNGVFLKV  121

Query  433  NKATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            NKAT+NMLH+VEPYVTYGYPNLKSV+ELIYKRGYGKV
Sbjct  122  NKATMNMLHRVEPYVTYGYPNLKSVKELIYKRGYGKV  158



>ref|XP_004972521.1| PREDICTED: 60S ribosomal protein L7-4-like [Setaria italica]
Length=245

 Score =   222 bits (565),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 122/160 (76%), Positives = 142/160 (89%), Gaps = 1/160 (1%)
 Frame = +1

Query  64   MAEAQTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeye  243
            M+ A+ K   VVPESVL+K+KR E+WA  KK++  A +KK  E+RK+IF RAKQYA+EY+
Sbjct  1    MSAAEAKAA-VVPESVLRKRKREEQWAADKKEKALADRKKALESRKIIFARAKQYAQEYD  59

Query  244  eqqkeLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVF  423
             Q+KEL+QLKREARLKGGFYV+PEAKLLF+IRIRGINAMHP T+KILQLLRLRQIFNGVF
Sbjct  60   AQEKELVQLKREARLKGGFYVSPEAKLLFVIRIRGINAMHPKTRKILQLLRLRQIFNGVF  119

Query  424  LKVNKATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LKVNKAT+NML +VEPYV YGYPNLKSVRELIYKRGYGK+
Sbjct  120  LKVNKATINMLRRVEPYVAYGYPNLKSVRELIYKRGYGKL  159



>ref|XP_006465164.1| PREDICTED: 60S ribosomal protein L7-4-like [Citrus sinensis]
Length=244

 Score =   221 bits (564),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 133/160 (83%), Positives = 144/160 (90%), Gaps = 2/160 (1%)
 Frame = +1

Query  64   MAEAQTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeye  243
            MAE + K    VPESVLKKQKRNEEWALAKKQEL   KKK  ++RKLI+ RAKQYAKEY 
Sbjct  1    MAEVEAKAP--VPESVLKKQKRNEEWALAKKQELETSKKKKLKSRKLIYNRAKQYAKEYA  58

Query  244  eqqkeLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVF  423
            EQ+K LIQLKREA+LKGGFYV+PEAKLLFIIRIRGINA+ P TKKILQLLRLRQIFNGVF
Sbjct  59   EQEKVLIQLKREAKLKGGFYVDPEAKLLFIIRIRGINAIDPKTKKILQLLRLRQIFNGVF  118

Query  424  LKVNKATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LKVNKAT+NMLH+VEPYVTYGYPNLKSVRELIYKRGYGK+
Sbjct  119  LKVNKATMNMLHRVEPYVTYGYPNLKSVRELIYKRGYGKL  158



>ref|NP_001130274.1| uncharacterized protein LOC100191368 [Zea mays]
 ref|XP_008667023.1| PREDICTED: uncharacterized protein LOC100191368 isoform X1 [Zea 
mays]
 gb|ACF78444.1| unknown [Zea mays]
 gb|ACG36847.1| 60S ribosomal protein L7-2 [Zea mays]
 tpg|DAA36127.1| TPA: 60S ribosomal protein L7-2 isoform 1 [Zea mays]
 tpg|DAA36128.1| TPA: 60S ribosomal protein L7-2 isoform 2 [Zea mays]
 tpg|DAA36129.1| TPA: 60S ribosomal protein L7-2 isoform 3 [Zea mays]
Length=244

 Score =   221 bits (563),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 120/150 (80%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = +1

Query  94   VVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLK  273
             VPESVL+K+KR E+WA  KK++  A +KK+ ENRKLIF RAKQYA+EY+ Q+KEL+QLK
Sbjct  9    AVPESVLRKRKREEQWAAEKKEKSLAERKKSIENRKLIFTRAKQYAEEYDAQEKELVQLK  68

Query  274  REARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNM  453
            REARLKGGFYV+PEAKLLF+IRIRGINAMHP T+KILQLLRLRQIFNGVFLKVNKAT+NM
Sbjct  69   REARLKGGFYVSPEAKLLFVIRIRGINAMHPKTRKILQLLRLRQIFNGVFLKVNKATINM  128

Query  454  LHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            L +VEPYV YGYPNLKSVRELIYKRGYGK+
Sbjct  129  LRRVEPYVAYGYPNLKSVRELIYKRGYGKL  158



>ref|XP_004952153.1| PREDICTED: 60S ribosomal protein L7-4-like isoform X1 [Setaria 
italica]
 ref|XP_004952154.1| PREDICTED: 60S ribosomal protein L7-4-like isoform X2 [Setaria 
italica]
Length=245

 Score =   221 bits (563),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 122/160 (76%), Positives = 141/160 (88%), Gaps = 1/160 (1%)
 Frame = +1

Query  64   MAEAQTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeye  243
            M+ A+ K   VVPESVL+K+KR E+WA  KK++  A +KK  E+RK IF RAKQYA+EY+
Sbjct  1    MSAAEAKAA-VVPESVLRKRKREEQWAADKKEKALADRKKALESRKTIFARAKQYAQEYD  59

Query  244  eqqkeLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVF  423
             Q+KEL+QLKREARLKGGFYV+PEAKLLF+IRIRGINAMHP T+KILQLLRLRQIFNGVF
Sbjct  60   AQEKELVQLKREARLKGGFYVSPEAKLLFVIRIRGINAMHPKTRKILQLLRLRQIFNGVF  119

Query  424  LKVNKATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LKVNKAT+NML +VEPYV YGYPNLKSVRELIYKRGYGK+
Sbjct  120  LKVNKATINMLRRVEPYVAYGYPNLKSVRELIYKRGYGKL  159



>ref|XP_006398510.1| hypothetical protein EUTSA_v10001008mg [Eutrema salsugineum]
 gb|ESQ39963.1| hypothetical protein EUTSA_v10001008mg [Eutrema salsugineum]
Length=242

 Score =   221 bits (562),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 124/160 (78%), Positives = 141/160 (88%), Gaps = 4/160 (3%)
 Frame = +1

Query  64   MAEAQTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeye  243
            MAE++     VVPESVLKK+KR  EW L KKQ   A KKKNAENRKLI+ RA+QY+KEY 
Sbjct  1    MAESKV----VVPESVLKKRKREAEWDLEKKQNAEAAKKKNAENRKLIYKRAEQYSKEYA  56

Query  244  eqqkeLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVF  423
            E++KELI LKR+A+LKGGFYV+PEAKLLFIIRIRGINA+ P TKKILQLLRLRQIFNGVF
Sbjct  57   EKEKELISLKRQAKLKGGFYVDPEAKLLFIIRIRGINAIDPKTKKILQLLRLRQIFNGVF  116

Query  424  LKVNKATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LKVNKAT+NML +VEPYVTYG+PNLKSV+ELIYKRGYGK+
Sbjct  117  LKVNKATMNMLRRVEPYVTYGFPNLKSVKELIYKRGYGKL  156



>ref|XP_011020071.1| PREDICTED: 60S ribosomal protein L7-3-like [Populus euphratica]
 ref|XP_011020073.1| PREDICTED: 60S ribosomal protein L7-3-like [Populus euphratica]
Length=244

 Score =   220 bits (561),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 131/150 (87%), Positives = 144/150 (96%), Gaps = 0/150 (0%)
 Frame = +1

Query  94   VVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLK  273
             VPESVLKKQKRNEEWALAKK+E  A+KKKNAENRKLI+ RAKQYA++Y+E+QKELI+LK
Sbjct  9    AVPESVLKKQKRNEEWALAKKEEKLALKKKNAENRKLIYSRAKQYAQKYDEEQKELIRLK  68

Query  274  REARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNM  453
            REARLKGGFYVNPEAKLLFIIRIRGINAMHP T+ ILQLLRLRQIFNGVFLKVNKATVNM
Sbjct  69   REARLKGGFYVNPEAKLLFIIRIRGINAMHPKTRSILQLLRLRQIFNGVFLKVNKATVNM  128

Query  454  LHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LH+VEPYVT+GYPNLKSV+ELIYKRGYGK+
Sbjct  129  LHRVEPYVTFGYPNLKSVKELIYKRGYGKL  158



>gb|ACR37625.1| unknown [Zea mays]
Length=193

 Score =   218 bits (556),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 117/149 (79%), Positives = 135/149 (91%), Gaps = 0/149 (0%)
 Frame = +1

Query  97   VPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLKR  276
            VPESVL+K+KR E+WA  KK++  A +KK  E+RK+IF RAKQYA+EY  Q+KEL+QLKR
Sbjct  11   VPESVLRKRKREEQWAADKKEKALADRKKALESRKIIFARAKQYAEEYHAQEKELVQLKR  70

Query  277  EARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNML  456
            EARLKGGFYV+PEAKLLF++RIRGINAMHP T+KILQLLRLRQIFNGVFLKVNKAT+NML
Sbjct  71   EARLKGGFYVSPEAKLLFVVRIRGINAMHPKTRKILQLLRLRQIFNGVFLKVNKATINML  130

Query  457  HKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
             +VEPYV YGYPNLKSVRELIYKRGYGK+
Sbjct  131  RRVEPYVAYGYPNLKSVRELIYKRGYGKL  159



>ref|XP_011077741.1| PREDICTED: 60S ribosomal protein L7-2-like [Sesamum indicum]
 ref|XP_011077742.1| PREDICTED: 60S ribosomal protein L7-2-like [Sesamum indicum]
 ref|XP_011077743.1| PREDICTED: 60S ribosomal protein L7-2-like [Sesamum indicum]
Length=245

 Score =   219 bits (559),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 130/156 (83%), Positives = 141/156 (90%), Gaps = 0/156 (0%)
 Frame = +1

Query  76   QTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqk  255
            + KG  +VPESVLKKQKR +EWAL K +E+   KKK  E RKLI  +A+QYAKEYEEQ+K
Sbjct  4    EVKGSVIVPESVLKKQKRADEWALVKSKEVEVAKKKKVETRKLICQKARQYAKEYEEQEK  63

Query  256  eLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVN  435
            ELI+LKREARLKGGFYVNPEAKLLFIIRIRGINAMHP TKKILQLLRLRQIFNGVFLKVN
Sbjct  64   ELIRLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPRTKKILQLLRLRQIFNGVFLKVN  123

Query  436  KATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            KAT+NMLH+VEPYVTYGYPNLKSVRELIYKRGYGKV
Sbjct  124  KATMNMLHRVEPYVTYGYPNLKSVRELIYKRGYGKV  159



>ref|XP_003564261.1| PREDICTED: 60S ribosomal protein L7-2-like [Brachypodium distachyon]
 ref|XP_010228147.1| PREDICTED: 60S ribosomal protein L7-2-like [Brachypodium distachyon]
Length=244

 Score =   219 bits (558),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 119/150 (79%), Positives = 135/150 (90%), Gaps = 0/150 (0%)
 Frame = +1

Query  94   VVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLK  273
            VVPESVL+K+KR E WA  KK +    KKK++ENRK+IF RAKQYA+EY+ Q KEL+QLK
Sbjct  9    VVPESVLRKRKREELWAAEKKTKAVEEKKKSSENRKVIFARAKQYAEEYDAQDKELVQLK  68

Query  274  REARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNM  453
            REARLKGGFYV+PEAKLLF++RIRGINAMHP T+KILQLLRLRQIFNGVFLKVNKAT+NM
Sbjct  69   REARLKGGFYVSPEAKLLFVVRIRGINAMHPKTRKILQLLRLRQIFNGVFLKVNKATINM  128

Query  454  LHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            L +VEPYV YGYPNLKSVRELIYKRGYGK+
Sbjct  129  LRRVEPYVAYGYPNLKSVRELIYKRGYGKL  158



>tpg|DAA36126.1| TPA: hypothetical protein ZEAMMB73_294867 [Zea mays]
Length=275

 Score =   220 bits (560),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 120/149 (81%), Positives = 137/149 (92%), Gaps = 0/149 (0%)
 Frame = +1

Query  97   VPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLKR  276
            VPESVL+K+KR E+WA  KK++  A +KK+ ENRKLIF RAKQYA+EY+ Q+KEL+QLKR
Sbjct  10   VPESVLRKRKREEQWAAEKKEKSLAERKKSIENRKLIFTRAKQYAEEYDAQEKELVQLKR  69

Query  277  EARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNML  456
            EARLKGGFYV+PEAKLLF+IRIRGINAMHP T+KILQLLRLRQIFNGVFLKVNKAT+NML
Sbjct  70   EARLKGGFYVSPEAKLLFVIRIRGINAMHPKTRKILQLLRLRQIFNGVFLKVNKATINML  129

Query  457  HKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
             +VEPYV YGYPNLKSVRELIYKRGYGK+
Sbjct  130  RRVEPYVAYGYPNLKSVRELIYKRGYGKL  158



>ref|XP_006453223.1| hypothetical protein CICLE_v10009162mg [Citrus clementina]
 gb|ESR66463.1| hypothetical protein CICLE_v10009162mg [Citrus clementina]
Length=274

 Score =   219 bits (559),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 134/191 (70%), Positives = 145/191 (76%), Gaps = 34/191 (18%)
 Frame = +1

Query  64   MAEAQTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeye  243
            MAEA      VVPESVLKK+KR EEWALAKKQEL A KKK AE RKLI+ R KQYAKEY+
Sbjct  1    MAEA---AAVVVPESVLKKKKREEEWALAKKQELEAAKKKKAETRKLIYNRTKQYAKEYD  57

Query  244  eqqkeLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVF  423
            E+QKELI+LKREA+LKGGFYVNPEAKLLFIIRIRGINA+ P TKKILQLLRLRQIFNGVF
Sbjct  58   EEQKELIRLKREAKLKGGFYVNPEAKLLFIIRIRGINAVDPKTKKILQLLRLRQIFNGVF  117

Query  424  LKVNKATVNMLHKVEPYVTYG-------------------------------YPNLKSVR  510
            LKVNKAT+NMLH+VEPYVTYG                               YPNLKSV+
Sbjct  118  LKVNKATLNMLHRVEPYVTYGYAFDLLLLIWVSSKNLSSAQLVLKFSVDDFRYPNLKSVK  177

Query  511  ELIYKRGYGKV  543
            ELIYKRGYGK+
Sbjct  178  ELIYKRGYGKL  188



>ref|XP_002324681.1| hypothetical protein POPTR_0018s13700g [Populus trichocarpa]
 gb|EEF03246.1| hypothetical protein POPTR_0018s13700g [Populus trichocarpa]
Length=288

 Score =   220 bits (560),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 131/150 (87%), Positives = 144/150 (96%), Gaps = 0/150 (0%)
 Frame = +1

Query  94   VVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLK  273
             VPESVLKKQKRNEEWALAKK+E  A+KKKNAENRKLI+ RAKQYAKEY+++QKELI+LK
Sbjct  53   AVPESVLKKQKRNEEWALAKKEEKLALKKKNAENRKLIYNRAKQYAKEYDDEQKELIRLK  112

Query  274  REARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNM  453
            REARLKGGFYVNPEAKLLFIIRIRGINAMHP T+ ILQLLRLRQIFNGVFLKVNKATVNM
Sbjct  113  REARLKGGFYVNPEAKLLFIIRIRGINAMHPKTRSILQLLRLRQIFNGVFLKVNKATVNM  172

Query  454  LHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LH+VEPYVT+GYPNLKSV+ELIYKRG+GK+
Sbjct  173  LHRVEPYVTFGYPNLKSVKELIYKRGFGKL  202



>ref|NP_001148262.1| 60S ribosomal protein L7-2 [Zea mays]
 ref|XP_008661908.1| PREDICTED: 60S ribosomal protein L7-2 isoform X1 [Zea mays]
 gb|ACF84196.1| unknown [Zea mays]
 gb|ACG30340.1| 60S ribosomal protein L7-2 [Zea mays]
 gb|AFW59363.1| 60S ribosomal protein L7-2 isoform 1 [Zea mays]
 gb|AFW59364.1| 60S ribosomal protein L7-2 isoform 2 [Zea mays]
 gb|AFW59365.1| 60S ribosomal protein L7-2 isoform 3 [Zea mays]
Length=244

 Score =   218 bits (556),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 118/149 (79%), Positives = 136/149 (91%), Gaps = 0/149 (0%)
 Frame = +1

Query  97   VPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLKR  276
            VPESVL+K+KR E+WA  KK++    KKK+ E+RKLIF RAKQYA+EY+ Q+KEL+QLKR
Sbjct  10   VPESVLRKRKREEQWATEKKEKALVEKKKSIESRKLIFTRAKQYAEEYDAQEKELVQLKR  69

Query  277  EARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNML  456
            EARLKGGFYV+PEAKLLF++RIRGINAMHP T+KILQLLRLRQIFNGVFLKVNKAT+NML
Sbjct  70   EARLKGGFYVSPEAKLLFVVRIRGINAMHPKTRKILQLLRLRQIFNGVFLKVNKATINML  129

Query  457  HKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
             +VEPYV YGYPNLKSVRELIYKRGYGK+
Sbjct  130  RRVEPYVAYGYPNLKSVRELIYKRGYGKL  158



>ref|XP_011017700.1| PREDICTED: 60S ribosomal protein L7-2-like [Populus euphratica]
 ref|XP_011017701.1| PREDICTED: 60S ribosomal protein L7-2-like [Populus euphratica]
 gb|ABK93172.1| unknown [Populus trichocarpa]
Length=244

 Score =   218 bits (555),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 131/150 (87%), Positives = 144/150 (96%), Gaps = 0/150 (0%)
 Frame = +1

Query  94   VVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLK  273
             VPESVLKKQKRNEEWALAKK+E  A+KKKNAENRKLI+ RAKQYAKEY+++QKELI+LK
Sbjct  9    AVPESVLKKQKRNEEWALAKKEEKLALKKKNAENRKLIYNRAKQYAKEYDDEQKELIRLK  68

Query  274  REARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNM  453
            REARLKGGFYVNPEAKLLFIIRIRGINAMHP T+ ILQLLRLRQIFNGVFLKVNKATVNM
Sbjct  69   REARLKGGFYVNPEAKLLFIIRIRGINAMHPKTRSILQLLRLRQIFNGVFLKVNKATVNM  128

Query  454  LHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LH+VEPYVT+GYPNLKSV+ELIYKRG+GK+
Sbjct  129  LHRVEPYVTFGYPNLKSVKELIYKRGFGKL  158



>emb|CDX83440.1| BnaA03g20660D [Brassica napus]
Length=243

 Score =   217 bits (553),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 124/161 (77%), Positives = 139/161 (86%), Gaps = 5/161 (3%)
 Frame = +1

Query  64   MAEAQTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeye  243
            MA+++     VVPESVLKK KR EEWALA KQE  A KKK+ E RKLIF RA+QYAKEY 
Sbjct  1    MADSKV----VVPESVLKKIKREEEWALAMKQEAEAAKKKSVETRKLIFKRAEQYAKEYA  56

Query  244  eqqkeLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQ-IFNGV  420
            ++  ELI+LKREA+LKGGFYV+PE KLLFIIRIRGINA+ P TKKILQLLRL+Q IFNGV
Sbjct  57   QKDNELIRLKREAKLKGGFYVDPEGKLLFIIRIRGINAIDPKTKKILQLLRLKQKIFNGV  116

Query  421  FLKVNKATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            FLKVNKAT+NML +VEPYVTYGYPNLKSVRELIYKRGYGK+
Sbjct  117  FLKVNKATINMLRRVEPYVTYGYPNLKSVRELIYKRGYGKL  157



>dbj|BAJ88948.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=244

 Score =   217 bits (553),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 119/150 (79%), Positives = 133/150 (89%), Gaps = 0/150 (0%)
 Frame = +1

Query  94   VVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLK  273
            VVPESVL K+KR E WA  KK +    KKK+ ENRK+IF RAKQYA+EY+ Q KEL+QLK
Sbjct  9    VVPESVLLKRKREELWAAEKKTKAVEEKKKSTENRKVIFARAKQYAEEYDAQDKELVQLK  68

Query  274  REARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNM  453
            REAR+KGGFYV+PEAKLLF++RIRGINAMHP TKKILQLLRLRQIFNGVFLKVNKAT+NM
Sbjct  69   REARMKGGFYVSPEAKLLFVVRIRGINAMHPKTKKILQLLRLRQIFNGVFLKVNKATINM  128

Query  454  LHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            L +VEPYV YGYPNLKSVRELIYKRGYGK+
Sbjct  129  LRRVEPYVAYGYPNLKSVRELIYKRGYGKL  158



>gb|AFW57062.1| hypothetical protein ZEAMMB73_288685 [Zea mays]
Length=212

 Score =   216 bits (550),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 136/149 (91%), Gaps = 0/149 (0%)
 Frame = +1

Query  97   VPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLKR  276
            VPESVL+K+KR E+WA  KK++  A +K+  ++RK+IF RAKQYA+EY+ Q+KEL+QLKR
Sbjct  13   VPESVLRKRKREEQWAADKKEKALADRKEALDSRKIIFARAKQYAQEYDAQEKELVQLKR  72

Query  277  EARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNML  456
            EARLKGGFYV+PEAKLLF++RIRGINAMHP T+KILQLLRLRQIFNGVFLKVNKAT+NML
Sbjct  73   EARLKGGFYVSPEAKLLFVVRIRGINAMHPKTRKILQLLRLRQIFNGVFLKVNKATINML  132

Query  457  HKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
             +VEPYV YGYPNLKSVRELIYKRGYGK+
Sbjct  133  RRVEPYVAYGYPNLKSVRELIYKRGYGKL  161



>ref|XP_006853664.1| hypothetical protein AMTR_s00056p00107780 [Amborella trichopoda]
 gb|ERN15131.1| hypothetical protein AMTR_s00056p00107780 [Amborella trichopoda]
Length=276

 Score =   218 bits (555),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 127/160 (79%), Positives = 147/160 (92%), Gaps = 0/160 (0%)
 Frame = +1

Query  64   MAEAQTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeye  243
            M E + K G +VP SVLKK+KR+EEW LAKK+ L A KKKNA+NRK++F RA++YAKEY+
Sbjct  31   MDEEEVKTGAIVPASVLKKRKRSEEWVLAKKKALQAKKKKNADNRKVMFKRAQEYAKEYQ  90

Query  244  eqqkeLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVF  423
            EQ+ EL++LKREA+LKGGFYV+PEAKLLFIIRIRGINAMHP T+KILQLLRLRQIFNGVF
Sbjct  91   EQELELVRLKREAKLKGGFYVSPEAKLLFIIRIRGINAMHPKTRKILQLLRLRQIFNGVF  150

Query  424  LKVNKATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LKVNKAT+NMLH+VEPYVTYGYPNLKSVRELIYKRGYGK+
Sbjct  151  LKVNKATMNMLHRVEPYVTYGYPNLKSVRELIYKRGYGKL  190



>ref|XP_002975494.1| hypothetical protein SELMODRAFT_103994 [Selaginella moellendorffii]
 gb|EFJ23123.1| hypothetical protein SELMODRAFT_103994 [Selaginella moellendorffii]
Length=245

 Score =   216 bits (551),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 113/150 (75%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = +1

Query  94   VVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLK  273
            VVPESVLKK++R+E+W++ +K+ LA  +KKN  NR+LIF RA+QY KEY +Q+++LI+LK
Sbjct  10   VVPESVLKKRRRDEQWSVERKERLALAQKKNKSNRRLIFKRAEQYVKEYRDQEQDLIRLK  69

Query  274  REARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNM  453
            REA+ KGGFYV PEAKL+F+IRIRGIN MHP T+KILQLLRLRQIFNGVF+KVNKAT+NM
Sbjct  70   REAKRKGGFYVEPEAKLMFVIRIRGINDMHPKTRKILQLLRLRQIFNGVFMKVNKATMNM  129

Query  454  LHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            L +VEPYVTYGYPNLKSVRELIYKRGYGKV
Sbjct  130  LKRVEPYVTYGYPNLKSVRELIYKRGYGKV  159



>ref|NP_001148714.1| 60S ribosomal protein L7-1 [Zea mays]
 gb|ACF85558.1| unknown [Zea mays]
 gb|ACG32628.1| 60S ribosomal protein L7-1 [Zea mays]
 gb|ACG43080.1| 60S ribosomal protein L7-1 [Zea mays]
 gb|AFW62020.1| 60S ribosomal protein L7-1 isoform 1 [Zea mays]
 gb|AFW62021.1| 60S ribosomal protein L7-1 isoform 2 [Zea mays]
Length=245

 Score =   216 bits (551),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 117/149 (79%), Positives = 135/149 (91%), Gaps = 0/149 (0%)
 Frame = +1

Query  97   VPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLKR  276
            VPESVL+K+KR E+WA  KK++  A +KK  E+RK+IF RAKQYA+EY  Q+KEL+QLKR
Sbjct  11   VPESVLRKRKREEQWAADKKEKALADRKKALESRKIIFARAKQYAEEYHAQEKELVQLKR  70

Query  277  EARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNML  456
            EARLKGGFYV+PEAKLLF++RIRGINAMHP T+KILQLLRLRQIFNGVFLKVNKAT+NML
Sbjct  71   EARLKGGFYVSPEAKLLFVVRIRGINAMHPKTRKILQLLRLRQIFNGVFLKVNKATINML  130

Query  457  HKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
             +VEPYV YGYPNLKSVRELIYKRGYGK+
Sbjct  131  RRVEPYVAYGYPNLKSVRELIYKRGYGKL  159



>gb|EPS59863.1| hypothetical protein M569_14942, partial [Genlisea aurea]
Length=162

 Score =   213 bits (543),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 139/150 (93%), Gaps = 0/150 (0%)
 Frame = +1

Query  94   VVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLK  273
            +VPES LKKQKR+EEWALAK +EL   KKK A +RKLIF RAKQYA+EYE+Q++ELIQLK
Sbjct  1    IVPESFLKKQKRSEEWALAKAKELKEAKKKRALSRKLIFSRAKQYAEEYEKQERELIQLK  60

Query  274  REARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNM  453
            REARLKGGFYV PE KLLFIIRIRGINA+HP TKKILQLLRLRQIFNGVFLKVNKAT+NM
Sbjct  61   REARLKGGFYVTPEPKLLFIIRIRGINALHPRTKKILQLLRLRQIFNGVFLKVNKATLNM  120

Query  454  LHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LHKVEPYVT+GYPNLKSVREL+YKRGYGKV
Sbjct  121  LHKVEPYVTFGYPNLKSVRELVYKRGYGKV  150



>gb|EMS66993.1| 60S ribosomal protein L7-4 [Triticum urartu]
Length=347

 Score =   219 bits (558),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 125/179 (70%), Positives = 144/179 (80%), Gaps = 0/179 (0%)
 Frame = +1

Query  7    GLRLQGKRNCPVVSIAQLQMAEAQTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKN  186
            G RL G+    +  + ++    A       VPESV  K+KR E WA AKKQ++A  KKK+
Sbjct  83   GSRLSGEVEICLHRLTKVTPCMASEAAKVPVPESVNFKRKRGEVWAAAKKQKVADEKKKD  142

Query  187  AENRKLIFCRakqyakeyeeqqkeLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHP  366
            AEN K+I+ RAKQYA EYE Q KEL+QLKREAR+KGGFYV+PEAKLLF++RIRGINAMHP
Sbjct  143  AENTKVIYARAKQYAGEYEAQDKELVQLKREARMKGGFYVSPEAKLLFVVRIRGINAMHP  202

Query  367  NTKKILQLLRLRQIFNGVFLKVNKATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
             TKKILQLLRLRQIFNGVFLKVNKAT+NML +VEPYV YGYPNLKSVRELIYKRGYGK+
Sbjct  203  KTKKILQLLRLRQIFNGVFLKVNKATINMLRRVEPYVAYGYPNLKSVRELIYKRGYGKL  261



>dbj|BAK00792.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=244

 Score =   216 bits (549),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 117/149 (79%), Positives = 133/149 (89%), Gaps = 0/149 (0%)
 Frame = +1

Query  97   VPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLKR  276
            VPESV  K+KR E WA  K+Q++A  KKK+AEN K+I+ RA+QYA EYE Q KEL+QLKR
Sbjct  10   VPESVKMKRKREEVWATEKRQKVADEKKKDAENTKVIYARAQQYAGEYEAQDKELVQLKR  69

Query  277  EARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNML  456
            EAR+KGGFYV+PEAKLLF++RIRGINAMHP TKKILQLLRLRQIFNGVFLKVNKAT+NML
Sbjct  70   EARMKGGFYVSPEAKLLFVVRIRGINAMHPKTKKILQLLRLRQIFNGVFLKVNKATINML  129

Query  457  HKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
             +VEPYV YGYPNLKSVRELIYKRGYGK+
Sbjct  130  RRVEPYVAYGYPNLKSVRELIYKRGYGKL  158



>ref|XP_001753162.1| predicted protein [Physcomitrella patens]
 gb|EDQ82203.1| predicted protein [Physcomitrella patens]
Length=244

 Score =   215 bits (548),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 112/150 (75%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = +1

Query  94   VVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLK  273
            VVPE++LKK+KR+E+WA AK  +LAA K +NA+NR LIF RA+QY +EY+ Q+KELI LK
Sbjct  9    VVPETLLKKRKRDEQWAAAKSSQLAAAKSRNAKNRTLIFKRAQQYQEEYQRQEKELISLK  68

Query  274  REARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNM  453
            REA+LKGGFYV PE KL+F++RIRGIN MHP  +KI+QLLRLRQIFNGVF+KVNKATVNM
Sbjct  69   REAKLKGGFYVEPEPKLMFVVRIRGINDMHPKVRKIMQLLRLRQIFNGVFMKVNKATVNM  128

Query  454  LHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            L +VEPYVTYGYPNLK+VRELIYKRGYGK+
Sbjct  129  LRRVEPYVTYGYPNLKTVRELIYKRGYGKL  158



>ref|XP_001773467.1| predicted protein [Physcomitrella patens]
 gb|EDQ61667.1| predicted protein [Physcomitrella patens]
Length=244

 Score =   214 bits (546),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 113/150 (75%), Positives = 135/150 (90%), Gaps = 0/150 (0%)
 Frame = +1

Query  94   VVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLK  273
            VVPE++LKK+KR+E+WA AK  EL+A K +NA+NR LIF RA+QY +EYE+Q+KE+I LK
Sbjct  9    VVPETLLKKRKRDEQWAAAKSAELSAAKTRNAKNRTLIFKRAQQYQEEYEKQEKEIISLK  68

Query  274  REARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNM  453
            REA+LKGGFYV PE KL+F+IRIRGIN MHP  +KI+QLLRLRQIFNGVF+KVNKATVNM
Sbjct  69   REAKLKGGFYVEPEPKLMFVIRIRGINDMHPKVRKIMQLLRLRQIFNGVFMKVNKATVNM  128

Query  454  LHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            L +VEPYVTYGYPNLK+VRELIYKRGYGK+
Sbjct  129  LRRVEPYVTYGYPNLKTVRELIYKRGYGKL  158



>ref|NP_001148360.1| 60S ribosomal protein L7-1 [Zea mays]
 gb|ACF85056.1| unknown [Zea mays]
 gb|ACG31082.1| 60S ribosomal protein L7-1 [Zea mays]
 gb|AFW57061.1| 60S ribosomal protein L7-1 [Zea mays]
Length=247

 Score =   214 bits (546),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 136/149 (91%), Gaps = 0/149 (0%)
 Frame = +1

Query  97   VPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLKR  276
            VPESVL+K+KR E+WA  KK++  A +K+  ++RK+IF RAKQYA+EY+ Q+KEL+QLKR
Sbjct  13   VPESVLRKRKREEQWAADKKEKALADRKEALDSRKIIFARAKQYAQEYDAQEKELVQLKR  72

Query  277  EARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNML  456
            EARLKGGFYV+PEAKLLF++RIRGINAMHP T+KILQLLRLRQIFNGVFLKVNKAT+NML
Sbjct  73   EARLKGGFYVSPEAKLLFVVRIRGINAMHPKTRKILQLLRLRQIFNGVFLKVNKATINML  132

Query  457  HKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
             +VEPYV YGYPNLKSVRELIYKRGYGK+
Sbjct  133  RRVEPYVAYGYPNLKSVRELIYKRGYGKL  161



>ref|XP_002978735.1| hypothetical protein SELMODRAFT_109549 [Selaginella moellendorffii]
 gb|EFJ20182.1| hypothetical protein SELMODRAFT_109549 [Selaginella moellendorffii]
Length=245

 Score =   214 bits (545),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 112/150 (75%), Positives = 135/150 (90%), Gaps = 0/150 (0%)
 Frame = +1

Query  94   VVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLK  273
            VVPESVLKK++R+E+W++ +K+ LA  +KKN  NR+LIF RA+QY KEY +Q+++LI+LK
Sbjct  10   VVPESVLKKRRRDEQWSVERKERLALAQKKNKSNRRLIFKRAEQYVKEYRDQEQDLIRLK  69

Query  274  REARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNM  453
            REA+ KGGFYV PEAKL+F+IRIRGIN MHP T+KILQLLRLRQIFNGVF+KVNKAT+NM
Sbjct  70   REAKRKGGFYVEPEAKLMFVIRIRGINDMHPKTRKILQLLRLRQIFNGVFMKVNKATMNM  129

Query  454  LHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            L +VEPYVTYGYPN KSVRELIYKRGYGKV
Sbjct  130  LKRVEPYVTYGYPNHKSVRELIYKRGYGKV  159



>gb|EMS55671.1| 60S ribosomal protein L7-2 [Triticum urartu]
Length=244

 Score =   213 bits (542),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 117/150 (78%), Positives = 133/150 (89%), Gaps = 0/150 (0%)
 Frame = +1

Query  94   VVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLK  273
            VVPESVL K+KR E WA  KK +    KKK++EN K+I+ RAKQYA+EY+ Q KEL+QLK
Sbjct  9    VVPESVLLKRKREELWAAEKKTKAVEEKKKSSENVKVIYARAKQYAEEYDAQDKELVQLK  68

Query  274  REARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNM  453
            REAR+KGGFYV+PEAKLLF++RIRGINAMHP TKKILQLLRLRQIFNGVFLKVNKAT+NM
Sbjct  69   REARMKGGFYVSPEAKLLFVVRIRGINAMHPKTKKILQLLRLRQIFNGVFLKVNKATINM  128

Query  454  LHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            L +VEPYV YGYPNLKSVRELIYKRGYGK+
Sbjct  129  LRRVEPYVAYGYPNLKSVRELIYKRGYGKL  158



>gb|EMT21799.1| 60S ribosomal protein L7-2 [Aegilops tauschii]
Length=244

 Score =   212 bits (540),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 116/149 (78%), Positives = 132/149 (89%), Gaps = 0/149 (0%)
 Frame = +1

Query  97   VPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLKR  276
            VPE V+ K++R E WA  KKQ++AA K K AEN K+I+ RA+QYA EYE Q KEL+QLKR
Sbjct  10   VPEKVILKRRREEVWAAEKKQKVAAEKIKAAENTKVIYARAEQYAGEYEAQDKELVQLKR  69

Query  277  EARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNML  456
            EAR+KGGFYV+PEAKLLF++RIRGINAMHP TKKILQLLRLRQIFNGVFLKVNKAT+NML
Sbjct  70   EARMKGGFYVSPEAKLLFVVRIRGINAMHPKTKKILQLLRLRQIFNGVFLKVNKATINML  129

Query  457  HKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
             +VEPYV YGYPNLKSVRELIYKRGYGK+
Sbjct  130  RRVEPYVAYGYPNLKSVRELIYKRGYGKL  158



>ref|XP_010928704.1| PREDICTED: 60S ribosomal protein L7-2-like [Elaeis guineensis]
Length=244

 Score =   212 bits (539),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 130/160 (81%), Positives = 144/160 (90%), Gaps = 2/160 (1%)
 Frame = +1

Query  64   MAEAQTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeye  243
            MA  + K   V+PESVLKK+KR EEWALAKK+ L A KKK+ ENRKLIF RA+QYAKEYE
Sbjct  1    MATEEAKA--VIPESVLKKRKREEEWALAKKKALEAKKKKDRENRKLIFSRAQQYAKEYE  58

Query  244  eqqkeLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVF  423
             Q+KELI+LKR+AR+KGGFYV PEAKLLFIIRIRGINAMHP T+KILQLLRLRQIFNGVF
Sbjct  59   TQEKELIRLKRDARMKGGFYVCPEAKLLFIIRIRGINAMHPKTRKILQLLRLRQIFNGVF  118

Query  424  LKVNKATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LKVNKAT+NML +VEPYVTYGYPNLKSVRELIYKRGYGK+
Sbjct  119  LKVNKATINMLRRVEPYVTYGYPNLKSVRELIYKRGYGKL  158



>ref|XP_009796889.1| PREDICTED: 60S ribosomal protein L7-4-like [Nicotiana sylvestris]
Length=240

 Score =   211 bits (537),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 133/153 (87%), Positives = 141/153 (92%), Gaps = 0/153 (0%)
 Frame = +1

Query  85   GGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLI  264
            G   VPESVLKKQKR+EEWALAKKQEL A KKKNAENRKLI+ R KQY+KEYEEQ+KELI
Sbjct  2    GETPVPESVLKKQKRSEEWALAKKQELEAAKKKNAENRKLIYNREKQYSKEYEEQEKELI  61

Query  265  QLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKAT  444
            +LK EA LKGGFYV+PEAKLLFIIRIRGINAM P TKKILQLLRLRQI NGVFLKVNKAT
Sbjct  62   RLKCEAILKGGFYVDPEAKLLFIIRIRGINAMAPQTKKILQLLRLRQILNGVFLKVNKAT  121

Query  445  VNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            VNMLH+VEPYVTYGYPNLKSVRELIYKRGYGK+
Sbjct  122  VNMLHRVEPYVTYGYPNLKSVRELIYKRGYGKL  154



>pdb|3J61|F Chain F, Localization Of The Large Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
 gb|AAW50989.1| ribosomal protein L7 [Triticum aestivum]
Length=244

 Score =   211 bits (537),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 116/149 (78%), Positives = 132/149 (89%), Gaps = 0/149 (0%)
 Frame = +1

Query  97   VPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLKR  276
            VPE V+ K++R E WA  KKQ++AA K K AEN K+I+ RA+QYA EYE Q KEL+QLKR
Sbjct  10   VPEKVILKRRREEVWAAEKKQKVAAEKIKAAENTKVIYARAEQYAGEYEAQDKELVQLKR  69

Query  277  EARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNML  456
            EAR+KGGFYV+PEAK LF++RIRGINAMHP TKKILQLLRLRQIFNGVFLKVNKAT+NML
Sbjct  70   EARMKGGFYVSPEAKPLFVVRIRGINAMHPKTKKILQLLRLRQIFNGVFLKVNKATINML  129

Query  457  HKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
             +VEPYVTYGYPNLKSVRELIYKRGYGK+
Sbjct  130  RRVEPYVTYGYPNLKSVRELIYKRGYGKL  158



>ref|XP_004976724.1| PREDICTED: 60S ribosomal protein L7-3-like isoform X1 [Setaria 
italica]
 ref|XP_004976725.1| PREDICTED: 60S ribosomal protein L7-3-like isoform X2 [Setaria 
italica]
Length=244

 Score =   209 bits (531),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 120/150 (80%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = +1

Query  94   VVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLK  273
             VPESVL+K+KR E+WA  KK++  A KKK+ E+RKLIF RAKQYA+EY+ Q+KEL+QLK
Sbjct  9    AVPESVLRKRKREEQWAADKKEKALAEKKKSIESRKLIFTRAKQYAEEYDAQEKELVQLK  68

Query  274  REARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNM  453
            REARLKGGFYV+PEAKLLF+IRIRGINAMHP T+KILQLLRLRQIFNGVFLKVNKAT+NM
Sbjct  69   REARLKGGFYVSPEAKLLFVIRIRGINAMHPKTRKILQLLRLRQIFNGVFLKVNKATINM  128

Query  454  LHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            L +VEPYV YGYPNLKSVRELIYKRGYGK+
Sbjct  129  LRRVEPYVAYGYPNLKSVRELIYKRGYGKL  158



>ref|XP_003580434.1| PREDICTED: 60S ribosomal protein L7-2-like [Brachypodium distachyon]
Length=244

 Score =   209 bits (531),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 121/150 (81%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = +1

Query  94   VVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLK  273
            VVPESVL+K+KR E WA  KK++  A KKK +ENRK+IF RAKQYA+EYE Q KEL+QLK
Sbjct  9    VVPESVLRKRKREELWAADKKEKAVAEKKKASENRKVIFARAKQYAEEYESQDKELVQLK  68

Query  274  REARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNM  453
            REARLKGGFYV+PEAKLLF++RIRGINAMHP T+KILQLLRLRQIFNGVFLKVNKAT+NM
Sbjct  69   REARLKGGFYVSPEAKLLFVVRIRGINAMHPKTRKILQLLRLRQIFNGVFLKVNKATINM  128

Query  454  LHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            L +VEPYV YGYPNLKSVRELIYKRGYGK+
Sbjct  129  LRRVEPYVAYGYPNLKSVRELIYKRGYGKL  158



>ref|XP_006652781.1| PREDICTED: 60S ribosomal protein L7-3-like [Oryza brachyantha]
Length=244

 Score =   209 bits (531),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 121/150 (81%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = +1

Query  94   VVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLK  273
            VVPESVL+K+KR E WA A K++  A KKK+ E+RKLIF RAKQYA+EYE Q+KEL+QLK
Sbjct  9    VVPESVLRKRKREELWAAASKEKAVAEKKKSIESRKLIFARAKQYAEEYESQEKELVQLK  68

Query  274  REARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNM  453
            REAR+KGGFYV+PE KLLF+IRIRGINAMHP T+KILQLLRLRQIFNGVFLKVNKATVNM
Sbjct  69   REARMKGGFYVSPEEKLLFVIRIRGINAMHPKTRKILQLLRLRQIFNGVFLKVNKATVNM  128

Query  454  LHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            L +VEPYV YGYPNLKSVRELIYKRGYGK+
Sbjct  129  LRRVEPYVAYGYPNLKSVRELIYKRGYGKL  158



>ref|XP_010913723.1| PREDICTED: 60S ribosomal protein L7-2 [Elaeis guineensis]
 ref|XP_010913724.1| PREDICTED: 60S ribosomal protein L7-2 [Elaeis guineensis]
Length=244

 Score =   208 bits (530),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = +1

Query  94   VVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLK  273
            VVPESVLKK+KR EEWALAKK++L A KKK+  NRKLI  RA+QYAKEYEEQ+KELI+LK
Sbjct  9    VVPESVLKKRKREEEWALAKKKQLDAKKKKDRANRKLICSRAQQYAKEYEEQEKELIRLK  68

Query  274  REARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNM  453
            REAR+KGGFYV+PEAKLLFIIRIRGINAMHP T+KILQLLRLRQIFNGVFLKVNKAT+NM
Sbjct  69   REARMKGGFYVSPEAKLLFIIRIRGINAMHPKTRKILQLLRLRQIFNGVFLKVNKATINM  128

Query  454  LHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            L +VEPYVTYGYPNLKSV+ELIYKRGYGK+
Sbjct  129  LRRVEPYVTYGYPNLKSVKELIYKRGYGKL  158



>ref|XP_006387691.1| hypothetical protein POPTR_0672s00220g, partial [Populus trichocarpa]
 gb|ERP46605.1| hypothetical protein POPTR_0672s00220g, partial [Populus trichocarpa]
Length=137

 Score =   204 bits (520),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 114/129 (88%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = +1

Query  97   VPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLKR  276
            VPESVLKK+KR EEWALAKKQELAA KKKNAENRK+IF RAKQY+KEYEEQ K+L+QLKR
Sbjct  9    VPESVLKKRKREEEWALAKKQELAATKKKNAENRKIIFKRAKQYSKEYEEQGKQLVQLKR  68

Query  277  EARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNML  456
            EARLKGGFYV+PEAKLLFIIRIRGINAMHP T+ ILQLLRLRQIFNGVFLKVNKATVNML
Sbjct  69   EARLKGGFYVDPEAKLLFIIRIRGINAMHPKTRSILQLLRLRQIFNGVFLKVNKATVNML  128

Query  457  HKVEPYVTY  483
             +VEPYVTY
Sbjct  129  RRVEPYVTY  137



>ref|XP_006652782.1| PREDICTED: 60S ribosomal protein L7-3-like [Oryza brachyantha]
Length=244

 Score =   207 bits (528),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 119/150 (79%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = +1

Query  94   VVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLK  273
            VVPESVL+K+KR E WA A K++  A KKK+ E+RKLIF RAKQYA+EYE Q+KEL+QLK
Sbjct  9    VVPESVLRKRKREELWAAASKEKAVAEKKKSIESRKLIFARAKQYAEEYESQEKELVQLK  68

Query  274  REARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNM  453
            REAR+KGGFYV+PE KLLF++RIRGINAMHP T+KILQLLRLRQIFNGVFLKVNKAT+NM
Sbjct  69   REARMKGGFYVSPEEKLLFVVRIRGINAMHPKTRKILQLLRLRQIFNGVFLKVNKATINM  128

Query  454  LHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            L +VEPYV YGYPNLKSVRELIYKRGYGK+
Sbjct  129  LRRVEPYVAYGYPNLKSVRELIYKRGYGKL  158



>ref|NP_001053797.1| Os04g0605900 [Oryza sativa Japonica Group]
 dbj|BAF15711.1| Os04g0605900 [Oryza sativa Japonica Group]
 dbj|BAG93471.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC77945.1| hypothetical protein OsI_17293 [Oryza sativa Indica Group]
 gb|EEE61632.1| hypothetical protein OsJ_16070 [Oryza sativa Japonica Group]
Length=244

 Score =   207 bits (528),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 119/150 (79%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = +1

Query  94   VVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLK  273
            VVPESVL+K+KR E WA A K++  A KKK+ E+RKLIF RAKQYA+EYE Q+KEL+QLK
Sbjct  9    VVPESVLRKRKREEVWAAASKEKAVAEKKKSIESRKLIFSRAKQYAEEYEAQEKELVQLK  68

Query  274  REARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNM  453
            REAR+KGGFYV+PE KLLF++RIRGINAMHP T+KILQLLRLRQIFNGVFLKVNKAT+NM
Sbjct  69   REARMKGGFYVSPEEKLLFVVRIRGINAMHPKTRKILQLLRLRQIFNGVFLKVNKATINM  128

Query  454  LHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            L +VEPYV YGYPNLKSVRELIYKRGYGK+
Sbjct  129  LRRVEPYVAYGYPNLKSVRELIYKRGYGKL  158



>ref|XP_009784717.1| PREDICTED: 60S ribosomal protein L7-4-like, partial [Nicotiana 
sylvestris]
Length=259

 Score =   208 bits (529),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 130/156 (83%), Positives = 142/156 (91%), Gaps = 0/156 (0%)
 Frame = +1

Query  76   QTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqk  255
            Q  G   VPESVLKKQKR+EEW LAKKQEL A KKKNA+NRKLI+ RAKQY+KEYEEQ+K
Sbjct  18   QVIGETPVPESVLKKQKRSEEWDLAKKQELEAAKKKNAKNRKLIYNRAKQYSKEYEEQEK  77

Query  256  eLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVN  435
            ELI+LKREARLKGGFYV+ EAKLLFII+I+GINAM P TKKILQ LRLRQIFNGVFLKVN
Sbjct  78   ELIRLKREARLKGGFYVDAEAKLLFIIKIQGINAMAPQTKKILQYLRLRQIFNGVFLKVN  137

Query  436  KATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            KATVNMLH++EPYVTYGYPNLK VRELIYKRGYGK+
Sbjct  138  KATVNMLHRIEPYVTYGYPNLKIVRELIYKRGYGKL  173



>ref|XP_006652780.1| PREDICTED: 60S ribosomal protein L7-3-like [Oryza brachyantha]
Length=244

 Score =   207 bits (527),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 119/150 (79%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = +1

Query  94   VVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLK  273
            VVPESVL+K+KR E WA A K++  A KKK+ E+RKLIF RAKQYA+EYE Q+KEL+QLK
Sbjct  9    VVPESVLRKRKREELWAAASKEKAVAEKKKSIESRKLIFARAKQYAEEYEAQEKELVQLK  68

Query  274  REARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNM  453
            REAR+KGGFYV+PE KLLF++RIRGINAMHP T+KILQLLRLRQIFNGVFLKVNKAT+NM
Sbjct  69   REARMKGGFYVSPEEKLLFVVRIRGINAMHPKTRKILQLLRLRQIFNGVFLKVNKATINM  128

Query  454  LHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            L +VEPYV YGYPNLKSVRELIYKRGYGK+
Sbjct  129  LRRVEPYVAYGYPNLKSVRELIYKRGYGKL  158



>ref|NP_001061310.1| Os08g0234000 [Oryza sativa Japonica Group]
 dbj|BAD03800.1| putative 60S ribosomal protein L7 [Oryza sativa Japonica Group]
 dbj|BAF23224.1| Os08g0234000 [Oryza sativa Japonica Group]
 gb|EAZ06100.1| hypothetical protein OsI_28337 [Oryza sativa Indica Group]
 dbj|BAG95760.1| unnamed protein product [Oryza sativa Japonica Group]
Length=245

 Score =   207 bits (527),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +1

Query  100  PESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLKRE  279
            PESVLKK+KR E+WA  +K++  A KKK  E+RKLIF RAKQYA+EY+ Q+KEL+QLKRE
Sbjct  12   PESVLKKRKREEQWAADRKEKALAEKKKAVESRKLIFARAKQYAQEYDAQEKELVQLKRE  71

Query  280  ARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNMLH  459
            AR+KGGFYV+PEAKLLF++RIRGINAMHP T+KILQLLRLRQIFNGVFLKVNKAT+NML 
Sbjct  72   ARMKGGFYVSPEAKLLFVVRIRGINAMHPKTRKILQLLRLRQIFNGVFLKVNKATINMLR  131

Query  460  KVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            +VEPYV YGYPNLKSVRELIYKRGYGK+
Sbjct  132  RVEPYVAYGYPNLKSVRELIYKRGYGKL  159



>emb|CAE02124.2| OSJNBa0035M09.3 [Oryza sativa Japonica Group]
 emb|CAE03885.2| OSJNBb0015N08.13 [Oryza sativa Japonica Group]
Length=250

 Score =   207 bits (527),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 119/150 (79%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = +1

Query  94   VVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLK  273
            VVPESVL+K+KR E WA A K++  A KKK+ E+RKLIF RAKQYA+EYE Q+KEL+QLK
Sbjct  9    VVPESVLRKRKREEVWAAASKEKAVAEKKKSIESRKLIFSRAKQYAEEYEAQEKELVQLK  68

Query  274  REARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNM  453
            REAR+KGGFYV+PE KLLF++RIRGINAMHP T+KILQLLRLRQIFNGVFLKVNKAT+NM
Sbjct  69   REARMKGGFYVSPEEKLLFVVRIRGINAMHPKTRKILQLLRLRQIFNGVFLKVNKATINM  128

Query  454  LHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            L +VEPYV YGYPNLKSVRELIYKRGYGK+
Sbjct  129  LRRVEPYVAYGYPNLKSVRELIYKRGYGKL  158



>gb|EPS65773.1| hypothetical protein M569_09004, partial [Genlisea aurea]
Length=155

 Score =   203 bits (516),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 114/133 (86%), Positives = 124/133 (93%), Gaps = 0/133 (0%)
 Frame = +1

Query  145  LAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLKREARLKGGFYVNPEAKL  324
            LAK +EL   KKK A +RKLIF RAKQYA+EYE+Q++ELIQLKREARLKGGFYV+PE KL
Sbjct  11   LAKAEELKEAKKKRALSRKLIFSRAKQYAEEYEKQERELIQLKREARLKGGFYVSPEPKL  70

Query  325  LFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNMLHKVEPYVTYGYPNLKS  504
            LFIIRIRGINA+HP TKKILQLLRLRQIFNGVFLKVNKAT+NMLHKVEPYVT+GYPNLKS
Sbjct  71   LFIIRIRGINALHPRTKKILQLLRLRQIFNGVFLKVNKATLNMLHKVEPYVTFGYPNLKS  130

Query  505  VRELIYKRGYGKV  543
            VRELIYKRGYGKV
Sbjct  131  VRELIYKRGYGKV  143



>gb|EAZ41966.1| hypothetical protein OsJ_26511 [Oryza sativa Japonica Group]
Length=275

 Score =   207 bits (527),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +1

Query  100  PESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLKRE  279
            PESVLKK+KR E+WA  +K++  A KKK  E+RKLIF RAKQYA+EY+ Q+KEL+QLKRE
Sbjct  42   PESVLKKRKREEQWAADRKEKALAEKKKAVESRKLIFARAKQYAQEYDAQEKELVQLKRE  101

Query  280  ARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNMLH  459
            AR+KGGFYV+PEAKLLF++RIRGINAMHP T+KILQLLRLRQIFNGVFLKVNKAT+NML 
Sbjct  102  ARMKGGFYVSPEAKLLFVVRIRGINAMHPKTRKILQLLRLRQIFNGVFLKVNKATINMLR  161

Query  460  KVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            +VEPYV YGYPNLKSVRELIYKRGYGK+
Sbjct  162  RVEPYVAYGYPNLKSVRELIYKRGYGKL  189



>ref|XP_009142992.1| PREDICTED: 60S ribosomal protein L7-3 [Brassica rapa]
 ref|XP_009142993.1| PREDICTED: 60S ribosomal protein L7-3 [Brassica rapa]
 emb|CDY17884.1| BnaC04g03350D [Brassica napus]
Length=242

 Score =   205 bits (521),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 129/160 (81%), Positives = 143/160 (89%), Gaps = 4/160 (3%)
 Frame = +1

Query  64   MAEAQTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeye  243
            MAE++     VVPESVLKK KR EEWALAKKQE AA KKK+ ENRKLIF RA+QYAKEY 
Sbjct  1    MAESKV----VVPESVLKKIKREEEWALAKKQEAAAAKKKSVENRKLIFKRAEQYAKEYA  56

Query  244  eqqkeLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVF  423
            E+  ELI+LKREA+LKGGFYV+PEAKLLFIIRIRGINA+ P TKKILQLLRLRQIFNGVF
Sbjct  57   EKDNELIRLKREAKLKGGFYVDPEAKLLFIIRIRGINAIDPKTKKILQLLRLRQIFNGVF  116

Query  424  LKVNKATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LKVNKAT+NML +VEPYVTYGYPNLKSV+ELIYKRG+GK+
Sbjct  117  LKVNKATINMLRRVEPYVTYGYPNLKSVKELIYKRGFGKL  156



>ref|XP_001752042.1| predicted protein [Physcomitrella patens]
 gb|EDQ83477.1| predicted protein [Physcomitrella patens]
Length=248

 Score =   204 bits (518),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 108/160 (68%), Positives = 133/160 (83%), Gaps = 10/160 (6%)
 Frame = +1

Query  94   VVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyake----------ye  243
            VVP+++LKK+KR+E WA+ + Q L + K +N+ENRKLIF  A+Q+ KE            
Sbjct  3    VVPKTLLKKRKRDELWAINRMQHLESSKSRNSENRKLIFKSAEQFIKEYRVWTDGWFLDV  62

Query  244  eqqkeLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVF  423
            EQ+ +LI+LKREA+LKGGFYV PEAKL+F+IRIRG+N MHP T+KI+QLLRLRQIFNGVF
Sbjct  63   EQESDLIRLKREAKLKGGFYVEPEAKLMFVIRIRGVNDMHPKTRKIMQLLRLRQIFNGVF  122

Query  424  LKVNKATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            +KVNKAT+NML +VEPYVTYGYPNLKSVRELIYKRG+GKV
Sbjct  123  MKVNKATMNMLSRVEPYVTYGYPNLKSVRELIYKRGHGKV  162



>ref|XP_001778687.1| predicted protein [Physcomitrella patens]
 gb|EDQ56480.1| predicted protein [Physcomitrella patens]
Length=244

 Score =   203 bits (517),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 114/149 (77%), Positives = 133/149 (89%), Gaps = 0/149 (0%)
 Frame = +1

Query  94   VVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLK  273
            VVPES+LKK+KR+E+W  AK  ELAA K +NA+NR LIF RA+QY +EYE+Q+K+LI LK
Sbjct  9    VVPESLLKKRKRDEQWTAAKSAELAAAKTRNAKNRTLIFKRAQQYQEEYEKQEKDLINLK  68

Query  274  REARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNM  453
            REA+LKGGFYV PE KL+F+IRIRGIN MHP  +KI+QLLRLRQIFNGVF+KVNKATVNM
Sbjct  69   REAKLKGGFYVEPEPKLMFVIRIRGINDMHPKVRKIMQLLRLRQIFNGVFMKVNKATVNM  128

Query  454  LHKVEPYVTYGYPNLKSVRELIYKRGYGK  540
            L +VEPYVTYGYPNLK+VRELIYKRGYGK
Sbjct  129  LRRVEPYVTYGYPNLKTVRELIYKRGYGK  157



>ref|XP_010927261.1| PREDICTED: 60S ribosomal protein L7-4 isoform X2 [Elaeis guineensis]
Length=244

 Score =   203 bits (517),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 132/160 (83%), Positives = 143/160 (89%), Gaps = 2/160 (1%)
 Frame = +1

Query  64   MAEAQTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeye  243
            M E + K   V+PESVLKK+KR EEWALAKK+ L A KKKN ENRKLIF RA+QYAKEYE
Sbjct  1    MVEGEAKA--VIPESVLKKRKREEEWALAKKKALEAKKKKNRENRKLIFTRAQQYAKEYE  58

Query  244  eqqkeLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVF  423
             Q KELI+LKREARLKGGFYV+PE KLLFIIRIRGINAMHP T+KILQLLRLRQIFNGVF
Sbjct  59   SQAKELIRLKREARLKGGFYVSPEPKLLFIIRIRGINAMHPKTRKILQLLRLRQIFNGVF  118

Query  424  LKVNKATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LKVNKAT+NML +VEPYVTYGYPNLKSVRELIYKRGYGK+
Sbjct  119  LKVNKATINMLRRVEPYVTYGYPNLKSVRELIYKRGYGKL  158



>ref|XP_001757460.1| predicted protein [Physcomitrella patens]
 gb|EDQ77517.1| predicted protein [Physcomitrella patens]
Length=244

 Score =   202 bits (514),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 114/150 (76%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = +1

Query  91   PVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQL  270
            P VPE++LKK+KR+E+WA AK  EL+A K +NA+NR LIF RA+QY +EYE+Q+KELI L
Sbjct  8    PAVPETLLKKRKRDEQWAAAKAAELSAAKSRNAKNRTLIFKRAQQYQEEYEKQEKELITL  67

Query  271  KREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVN  450
            KREA+LKGGFYV PE KL+F+IRIRGIN MHP  +KI+QLLRLRQIFNGVF+KVNKATVN
Sbjct  68   KREAKLKGGFYVEPEPKLMFVIRIRGINDMHPKVRKIMQLLRLRQIFNGVFMKVNKATVN  127

Query  451  MLHKVEPYVTYGYPNLKSVRELIYKRGYGK  540
            ML +VEPYVTYGYPNLK+VRELIYKRGYGK
Sbjct  128  MLRRVEPYVTYGYPNLKTVRELIYKRGYGK  157



>ref|XP_010927260.1| PREDICTED: 60S ribosomal protein L7-4 isoform X1 [Elaeis guineensis]
Length=294

 Score =   203 bits (517),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 132/161 (82%), Positives = 144/161 (89%), Gaps = 2/161 (1%)
 Frame = +1

Query  61   QMAEAQTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakey  240
            +M E + K   V+PESVLKK+KR EEWALAKK+ L A KKKN ENRKLIF RA+QYAKEY
Sbjct  50   KMVEGEAKA--VIPESVLKKRKREEEWALAKKKALEAKKKKNRENRKLIFTRAQQYAKEY  107

Query  241  eeqqkeLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGV  420
            E Q KELI+LKREARLKGGFYV+PE KLLFIIRIRGINAMHP T+KILQLLRLRQIFNGV
Sbjct  108  ESQAKELIRLKREARLKGGFYVSPEPKLLFIIRIRGINAMHPKTRKILQLLRLRQIFNGV  167

Query  421  FLKVNKATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            FLKVNKAT+NML +VEPYVTYGYPNLKSVRELIYKRGYGK+
Sbjct  168  FLKVNKATINMLRRVEPYVTYGYPNLKSVRELIYKRGYGKL  208



>tpg|DAA46492.1| TPA: hypothetical protein ZEAMMB73_274894 [Zea mays]
Length=245

 Score =   201 bits (511),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 113/150 (75%), Positives = 133/150 (89%), Gaps = 0/150 (0%)
 Frame = +1

Query  94   VVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLK  273
             VPESVL+K+KR E+WA  KK++    KKK+ E+RKLIF RAKQYA+EY+ Q+KEL+QLK
Sbjct  10   AVPESVLRKRKREEQWATEKKEKALVKKKKSIESRKLIFTRAKQYAEEYDAQEKELVQLK  69

Query  274  REARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNM  453
            REARLKGGFYV+PEAKLLF++RIRGINAMHP T+KILQLLRLRQIFNGVFLKVNKAT++M
Sbjct  70   REARLKGGFYVSPEAKLLFVVRIRGINAMHPKTRKILQLLRLRQIFNGVFLKVNKATIDM  129

Query  454  LHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            L +V+PY  YGYPNL SVRELIYKRGYG +
Sbjct  130  LRRVDPYDAYGYPNLNSVRELIYKRGYGNL  159



>ref|XP_002448479.1| hypothetical protein SORBIDRAFT_06g027740 [Sorghum bicolor]
 gb|EES12807.1| hypothetical protein SORBIDRAFT_06g027740 [Sorghum bicolor]
Length=244

 Score =   200 bits (509),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 116/149 (78%), Positives = 134/149 (90%), Gaps = 0/149 (0%)
 Frame = +1

Query  97   VPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLKR  276
            VPESVL+KQKR E+WA+ KK++  A KKK+ ++RKLIF RAKQYAKEY+ Q+KEL+QLKR
Sbjct  10   VPESVLRKQKREEQWAVEKKEKALAEKKKSIKSRKLIFTRAKQYAKEYDAQEKELVQLKR  69

Query  277  EARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNML  456
            EARLKGGFYV+PE KLLF++RIRGINAMHP  +KILQLLRLRQIFNGVFLKVNKAT+NML
Sbjct  70   EARLKGGFYVSPEVKLLFVVRIRGINAMHPKIRKILQLLRLRQIFNGVFLKVNKATINML  129

Query  457  HKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
             +VEPY  YGYPNLKSVRELIYK GYGK+
Sbjct  130  RRVEPYAAYGYPNLKSVRELIYKMGYGKL  158



>emb|CBI18484.3| unnamed protein product [Vitis vinifera]
Length=149

 Score =   197 bits (500),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 112/133 (84%), Positives = 121/133 (91%), Gaps = 0/133 (0%)
 Frame = +1

Query  145  LAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLKREARLKGGFYVNPEAKL  324
            + KKQE+ A KKKNAENRKLI+ RAKQYAKEY+EQQKELIQLK EA+LKGGFYV+PE KL
Sbjct  3    IGKKQEVEAKKKKNAENRKLIYSRAKQYAKEYDEQQKELIQLKHEAKLKGGFYVDPEVKL  62

Query  325  LFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNMLHKVEPYVTYGYPNLKS  504
            LFIIRIRGINAMH    KILQLLRLRQIFNGVFLKVNKAT+NMLH+ EP VTYGYPNLKS
Sbjct  63   LFIIRIRGINAMHSKMTKILQLLRLRQIFNGVFLKVNKATMNMLHRDEPCVTYGYPNLKS  122

Query  505  VRELIYKRGYGKV  543
            VRELIYKRGYGK+
Sbjct  123  VRELIYKRGYGKL  135



>ref|XP_005643653.1| 60S ribosomal protein L7 [Coccomyxa subellipsoidea C-169]
 gb|EIE19109.1| 60S ribosomal protein L7 [Coccomyxa subellipsoidea C-169]
Length=248

 Score =   196 bits (498),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 102/157 (65%), Positives = 127/157 (81%), Gaps = 0/157 (0%)
 Frame = +1

Query  73   AQTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqq  252
            A  K    VPESVLKK+KR+E+WA  K       KKK+ + RK IF RA+ Y KEY +Q+
Sbjct  6    ATAKPAGTVPESVLKKRKRDEDWAAKKAATAGDAKKKSRDQRKEIFKRAESYVKEYRDQE  65

Query  253  keLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKV  432
            K+LI+LKREA+  GGFYV PEAK+ F++RIRGIN MHP T+KILQLLRLRQI NG+F+++
Sbjct  66   KDLIRLKREAKSNGGFYVEPEAKVAFVVRIRGINDMHPKTRKILQLLRLRQIHNGIFIRM  125

Query  433  NKATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            NKAT+NML +VEPY+T+GYPNLK+V+ELIYKRGYGKV
Sbjct  126  NKATINMLRRVEPYITWGYPNLKTVKELIYKRGYGKV  162



>ref|XP_008658767.1| PREDICTED: 60S ribosomal protein L7-3-like [Zea mays]
Length=252

 Score =   196 bits (497),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 116/168 (69%), Positives = 139/168 (83%), Gaps = 8/168 (5%)
 Frame = +1

Query  58   LQMAEAQTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyake  237
            +QM+   +K    VPESVL+K+KR E+WA  KK++    KKK+ E+RKLIF RAKQYA+E
Sbjct  1    MQMSSEASK--VAVPESVLRKRKREEQWATEKKEKALVKKKKSIESRKLIFTRAKQYAEE  58

Query  238  yeeqqkeLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQ----  405
            Y+ Q+KEL+QLKREARLKGGFYV+PEAKLLF++RIRGINAMHP T+KILQLLRLRQ    
Sbjct  59   YDAQEKELVQLKREARLKGGFYVSPEAKLLFVVRIRGINAMHPKTRKILQLLRLRQMCSL  118

Query  406  --IFNGVFLKVNKATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
              IFNGVFLKVNKAT++ML +V+PY  YGYPNL SVRELIYKRGYG +
Sbjct  119  MYIFNGVFLKVNKATIDMLRRVDPYDAYGYPNLNSVRELIYKRGYGNL  166



>gb|KJB35649.1| hypothetical protein B456_006G122500 [Gossypium raimondii]
Length=286

 Score =   194 bits (493),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 115/180 (64%), Positives = 130/180 (72%), Gaps = 30/180 (17%)
 Frame = +1

Query  94   VVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLK  273
            V+P+S LKK +RNE+W LAKKQE  A K+KN ENRKLI+ R  QYAKE E Q+KE IQLK
Sbjct  33   VIPDSKLKKNERNEKWELAKKQEFEAAKRKNVENRKLIYSRTMQYAKESEGQEKEPIQLK  92

Query  274  REARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNM  453
            REA+LKGGFYVNPE+KLLFIIRIRGINA HP+T+KILQLLRLRQIFNGVFLKVNKA +N+
Sbjct  93   REAKLKGGFYVNPESKLLFIIRIRGINAKHPSTRKILQLLRLRQIFNGVFLKVNKAKMNV  152

Query  454  LHKVEPYVTYG------------------------------YPNLKSVRELIYKRGYGKV  543
            LH VEPYVTY                               YPN K VRELI+KR YGK+
Sbjct  153  LHLVEPYVTYWYLLPFWLPRFFFHQFYIVAMAYFFLMYASRYPNPKIVRELIFKRSYGKL  212



>emb|CBI18496.3| unnamed protein product [Vitis vinifera]
Length=185

 Score =   190 bits (482),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 110/133 (83%), Positives = 122/133 (92%), Gaps = 0/133 (0%)
 Frame = +1

Query  145  LAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLKREARLKGGFYVNPEAKL  324
            + KKQE+ A KKKNAEN KLI+ RAKQYAKEYEEQQKEL+QLK EA+LKGGFYV+PE KL
Sbjct  3    IGKKQEVEAKKKKNAENGKLIYSRAKQYAKEYEEQQKELMQLKHEAKLKGGFYVDPEVKL  62

Query  325  LFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNMLHKVEPYVTYGYPNLKS  504
            LFIIRI GINAMH  T++ILQLL LRQIFNGVFLKVN+AT+NMLH+VEPYVTYGYPNLKS
Sbjct  63   LFIIRICGINAMHLKTRRILQLLCLRQIFNGVFLKVNEATMNMLHRVEPYVTYGYPNLKS  122

Query  505  VRELIYKRGYGKV  543
            VRELIYKRGYGK+
Sbjct  123  VRELIYKRGYGKL  135



>gb|EMT07499.1| 60S ribosomal protein L7-2 [Aegilops tauschii]
Length=288

 Score =   192 bits (487),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 117/194 (60%), Positives = 133/194 (69%), Gaps = 44/194 (23%)
 Frame = +1

Query  94   VVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLK  273
            VVPESVL K+KR E WA  KK +    KKK++EN K+I+ RAKQYA+EY+ Q KEL+QLK
Sbjct  9    VVPESVLLKRKREELWAAEKKTKAVEEKKKSSENIKVIYARAKQYAEEYDAQDKELVQLK  68

Query  274  REARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNM  453
            REAR+KGGFYV+PEAKLLF++RIRGINAMHP TKKILQLLRLRQIFNGVFLKVNKAT+NM
Sbjct  69   REARMKGGFYVSPEAKLLFVVRIRGINAMHPKTKKILQLLRLRQIFNGVFLKVNKATINM  128

Query  454  LHKVEPYVTYG--------------------------------------------YPNLK  501
            L +VEPYV YG                                            YPNLK
Sbjct  129  LRRVEPYVAYGYVTNGVCAMNVCTTLGQLLKDMGSASRVLMFHLYLNGSNHYICRYPNLK  188

Query  502  SVRELIYKRGYGKV  543
            SVRELIYKRGYGK+
Sbjct  189  SVRELIYKRGYGKL  202



>gb|AFW59366.1| hypothetical protein ZEAMMB73_437813 [Zea mays]
 gb|AFW59367.1| hypothetical protein ZEAMMB73_437813 [Zea mays]
Length=139

 Score =   186 bits (471),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 100/130 (77%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = +1

Query  97   VPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLKR  276
            VPESVL+K+KR E+WA  KK++    KKK+ E+RKLIF RAKQYA+EY+ Q+KEL+QLKR
Sbjct  10   VPESVLRKRKREEQWATEKKEKALVEKKKSIESRKLIFTRAKQYAEEYDAQEKELVQLKR  69

Query  277  EARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNML  456
            EARLKGGFYV+PEAKLLF++RIRGINAMHP T+KILQLLRLRQIFNGVFLKVNKAT+NML
Sbjct  70   EARLKGGFYVSPEAKLLFVVRIRGINAMHPKTRKILQLLRLRQIFNGVFLKVNKATINML  129

Query  457  HKVEPYVTYG  486
             +VEPYV YG
Sbjct  130  RRVEPYVAYG  139



>ref|NP_001235500.1| uncharacterized protein LOC100306213 [Glycine max]
 gb|ACU14284.1| unknown [Glycine max]
Length=224

 Score =   188 bits (478),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 116/160 (73%), Positives = 128/160 (80%), Gaps = 22/160 (14%)
 Frame = +1

Query  64   MAEAQTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeye  243
            M EA+     +VPESV+KK+KRNEEWAL KKQEL A KKK  E RKLIF RAKQY+KEY+
Sbjct  1    MGEAKA----LVPESVVKKEKRNEEWALEKKQELDAAKKKRFETRKLIFNRAKQYSKEYD  56

Query  244  eqqkeLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVF  423
            EQQKELI+LKREA+LKGGFYV P+                  T+KILQLLRLRQIFNGVF
Sbjct  57   EQQKELIRLKREAKLKGGFYVEPK------------------TRKILQLLRLRQIFNGVF  98

Query  424  LKVNKATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LKVNKATVNMLH+VEPYVTYGYPNLKSV+ELIYKRGYGKV
Sbjct  99   LKVNKATVNMLHRVEPYVTYGYPNLKSVKELIYKRGYGKV  138



>gb|EYU18200.1| hypothetical protein MIMGU_mgv1a026225mg [Erythranthe guttata]
Length=233

 Score =   185 bits (469),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 102/117 (87%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = +1

Query  193  NRKLIFCRakqyakeyeeqqkeLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNT  372
             RKLI  +A+ YA+EYE Q KELIQLKREARLKGGFYV+PEAKLLFI+RIRGINAMHP T
Sbjct  31   TRKLICKKARDYAQEYENQDKELIQLKREARLKGGFYVSPEAKLLFIVRIRGINAMHPTT  90

Query  373  KKILQLLRLRQIFNGVFLKVNKATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            KKILQLLRLRQIFNGVFLKVNKAT+NMLH+VEPYVTYGYPNLKSVRELIYKRGYGK+
Sbjct  91   KKILQLLRLRQIFNGVFLKVNKATMNMLHRVEPYVTYGYPNLKSVRELIYKRGYGKL  147



>ref|XP_011396691.1| 60S ribosomal protein L7-2 [Auxenochlorella protothecoides]
 gb|KFM23813.1| 60S ribosomal protein L7-2 [Auxenochlorella protothecoides]
Length=240

 Score =   183 bits (464),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 101/149 (68%), Positives = 121/149 (81%), Gaps = 0/149 (0%)
 Frame = +1

Query  97   VPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLKR  276
            VPES+LKK+KR+E+WA  K     A +KK   NR  IF RA+QY KEY  Q+++LI+LKR
Sbjct  6    VPESILKKRKRDEQWAEKKAAATVAAQKKARANRSEIFKRAEQYVKEYRSQERDLIRLKR  65

Query  277  EARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNML  456
            EA+ K GFYV PEAKLL ++RIRG+N + P TKKILQLLRLRQI N VFLKVNKAT++ML
Sbjct  66   EAKAKSGFYVEPEAKLLLVVRIRGVNDIAPKTKKILQLLRLRQINNAVFLKVNKATLSML  125

Query  457  HKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
             +VEPYV +GYPNLKSVRELIYKRG+GKV
Sbjct  126  QRVEPYVAFGYPNLKSVRELIYKRGHGKV  154



>ref|XP_007509794.1| 60S ribosomal protein L7 [Bathycoccus prasinos]
 emb|CCO18909.1| 60S ribosomal protein L7 [Bathycoccus prasinos]
Length=299

 Score =   182 bits (463),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 97/150 (65%), Positives = 123/150 (82%), Gaps = 0/150 (0%)
 Frame = +1

Query  94   VVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLK  273
              PESVLK++KR+E+WA  K +  A  KK   + R+ +F RA++Y KEYE Q+K+LI+LK
Sbjct  64   AAPESVLKRRKRDEQWAAQKAKADAESKKAQEKKREEVFKRAEKYVKEYESQEKDLIRLK  123

Query  274  REARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNM  453
            REAR KGGFYV PE KL+F++R+RG+N MHP T+ ILQLLRLRQI NGVF+KVNKATVN 
Sbjct  124  REARAKGGFYVEPEQKLIFVMRLRGLNDMHPKTRHILQLLRLRQIHNGVFMKVNKATVNA  183

Query  454  LHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            L KVEPY+ +GYPNLK+V++LIYKRG+GKV
Sbjct  184  LRKVEPYIMWGYPNLKTVKDLIYKRGHGKV  213



>ref|XP_001416891.1| Ribosomal protein L7, component of cytosolic 80S ribosome and 
60S large subunit [Ostreococcus lucimarinus CCE9901]
 gb|ABO95184.1| Ribosomal protein L7, component of cytosolic 80S ribosome and 
60S large subunit [Ostreococcus lucimarinus CCE9901]
Length=239

 Score =   181 bits (458),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 99/150 (66%), Positives = 123/150 (82%), Gaps = 0/150 (0%)
 Frame = +1

Query  94   VVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLK  273
             VPESVLKK+KR+E+WA  K    A  KK   + R+ IF RA++Y KEY +Q+ +L++LK
Sbjct  4    TVPESVLKKRKRDEQWASQKAAAAAEAKKAGEKKREEIFKRAEKYVKEYRDQEADLVRLK  63

Query  274  REARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNM  453
            REAR KGGFYV PE KL+F++R+RG+N +HP TKKILQLLRLRQI NG+F+KVNKAT+N 
Sbjct  64   REARAKGGFYVEPEEKLMFVMRLRGLNDIHPKTKKILQLLRLRQIHNGIFMKVNKATLNQ  123

Query  454  LHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            L KVEPY+ +GYPNLK+VRELIYKRGYGKV
Sbjct  124  LRKVEPYIMFGYPNLKTVRELIYKRGYGKV  153



>emb|CBI18494.3| unnamed protein product [Vitis vinifera]
Length=123

 Score =   176 bits (447),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 102/121 (84%), Positives = 111/121 (92%), Gaps = 0/121 (0%)
 Frame = +1

Query  145  LAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLKREARLKGGFYVNPEAKL  324
            + KKQE+ A KKKNAEN KLI+ RAKQYAKEYEEQQKELIQLK EA+LKGGFYV+PE KL
Sbjct  3    IGKKQEVEAKKKKNAENGKLIYSRAKQYAKEYEEQQKELIQLKHEAKLKGGFYVDPEVKL  62

Query  325  LFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNMLHKVEPYVTYGYPNLKS  504
            LF+IRIRGINAMHP  +KILQLLRLRQIFNGVFLKVNKAT+N LH+VEPYVTYGYPNLKS
Sbjct  63   LFVIRIRGINAMHPKMRKILQLLRLRQIFNGVFLKVNKATMNKLHRVEPYVTYGYPNLKS  122

Query  505  V  507
            V
Sbjct  123  V  123



>emb|CEF97056.1| Ribosomal protein L30, ferredoxin-like fold domain [Ostreococcus 
tauri]
Length=237

 Score =   177 bits (449),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 98/149 (66%), Positives = 121/149 (81%), Gaps = 0/149 (0%)
 Frame = +1

Query  97   VPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLKR  276
            +PES+LKK+KR+ +WA  K    A  KK     R  IF RA++Y KEY +Q+ +L++LKR
Sbjct  3    IPESILKKRKRDTQWAAQKAAAAAEAKKAQEAKRDEIFKRAEKYVKEYRDQETDLVRLKR  62

Query  277  EARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNML  456
            EAR KGGFYV PEAKL+F++R+RG+N +HP TKKILQLLRLRQI NG+F+KVNKAT+N L
Sbjct  63   EARAKGGFYVEPEAKLMFVMRLRGLNDIHPKTKKILQLLRLRQIHNGIFMKVNKATLNQL  122

Query  457  HKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
             KVEPY+ +GYPNLKSVRELIYKRGYGKV
Sbjct  123  RKVEPYIMFGYPNLKSVRELIYKRGYGKV  151



>ref|XP_005843719.1| hypothetical protein CHLNCDRAFT_49213 [Chlorella variabilis]
 gb|EFN51617.1| hypothetical protein CHLNCDRAFT_49213 [Chlorella variabilis]
Length=241

 Score =   177 bits (449),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 103/149 (69%), Positives = 123/149 (83%), Gaps = 0/149 (0%)
 Frame = +1

Query  97   VPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLKR  276
            VPESVLKK+KR+E+WA  K    A  K+K+   RK IF RA+QY KEY  Q+ +LI+LKR
Sbjct  7    VPESVLKKRKRDEDWATKKAAAAAEAKQKSVATRKEIFKRAEQYVKEYRTQELDLIRLKR  66

Query  277  EARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNML  456
            EA+ KGGFYV PEAKL+F+IRIRGIN + P TKKILQLLRLR+I  GVFLKVNKAT++ML
Sbjct  67   EAKAKGGFYVEPEAKLVFVIRIRGINDVAPKTKKILQLLRLRRINTGVFLKVNKATMSML  126

Query  457  HKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
             +VEPYV YGYPNLK+V+ELIYKRG+GKV
Sbjct  127  QRVEPYVAYGYPNLKTVKELIYKRGFGKV  155



>ref|XP_002489001.1| hypothetical protein SORBIDRAFT_0541s002010 [Sorghum bicolor]
 gb|EES20507.1| hypothetical protein SORBIDRAFT_0541s002010 [Sorghum bicolor]
Length=184

 Score =   175 bits (444),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/95 (88%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = +1

Query  259  LIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNK  438
            L+QLKREARLKGGFYV+PEAKLLF++RIRGINAMHP T+KILQLLRLRQIFNGVFLKVNK
Sbjct  4    LVQLKREARLKGGFYVSPEAKLLFVVRIRGINAMHPKTRKILQLLRLRQIFNGVFLKVNK  63

Query  439  ATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            AT+NML +VEPYV YGYPNLKSVRELIYKRGYGK+
Sbjct  64   ATINMLRRVEPYVAYGYPNLKSVRELIYKRGYGKL  98



>gb|KDD75837.1| hypothetical protein H632_c477p1 [Helicosporidium sp. ATCC 50920]
Length=240

 Score =   177 bits (448),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 95/149 (64%), Positives = 120/149 (81%), Gaps = 0/149 (0%)
 Frame = +1

Query  97   VPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLKR  276
            VPE++LK +KRNEEW   +       +KKNA  R  IF RA+QY KEY +Q+ + I+++R
Sbjct  6    VPETLLKARKRNEEWEAKRVALRTEARKKNAAKRVEIFKRAEQYVKEYRDQEADTIRMRR  65

Query  277  EARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNML  456
            EAR +GGFYV PEAKL+ ++RIRGIN + P ++KILQLLRLRQI N VFL+VNKAT+NML
Sbjct  66   EARAQGGFYVEPEAKLMLVVRIRGINDIAPKSRKILQLLRLRQINNAVFLRVNKATLNML  125

Query  457  HKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
             +VEPYVT+GYPNLK+VREL+YKRGYGKV
Sbjct  126  QRVEPYVTFGYPNLKTVRELVYKRGYGKV  154



>emb|CDP13837.1| unnamed protein product [Coffea canephora]
Length=145

 Score =   172 bits (437),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 108/129 (84%), Positives = 112/129 (87%), Gaps = 3/129 (2%)
 Frame = +1

Query  64   MAEAQTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeye  243
            MAE Q     VVPE VLKKQKRNEEWALAKKQEL A KKKN  N KLI+ RAKQYAKEYE
Sbjct  1    MAEEQ---ATVVPEPVLKKQKRNEEWALAKKQELDAAKKKNLANHKLIYNRAKQYAKEYE  57

Query  244  eqqkeLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVF  423
            EQQKELI+LKR ARLKGGFYVNPEAKL+FI+ IRGINAMHP TKKILQLLRLRQIFNGVF
Sbjct  58   EQQKELIKLKRGARLKGGFYVNPEAKLVFIVPIRGINAMHPRTKKILQLLRLRQIFNGVF  117

Query  424  LKVNKATVN  450
            LKVNKATV 
Sbjct  118  LKVNKATVT  126



>emb|CBI18486.3| unnamed protein product [Vitis vinifera]
Length=186

 Score =   172 bits (436),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/93 (89%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = +1

Query  265  QLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKAT  444
            QLK EA+LKGGFYV+PE KLLFIIRIRGINAMHP T+KILQLL LRQIFNGVFLKVNKAT
Sbjct  8    QLKHEAKLKGGFYVDPEVKLLFIIRIRGINAMHPKTRKILQLLCLRQIFNGVFLKVNKAT  67

Query  445  VNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            +NMLH+VEPYVTYGYPNLKSVRELIYKRGYGK+
Sbjct  68   MNMLHRVEPYVTYGYPNLKSVRELIYKRGYGKL  100



>ref|XP_001753880.1| predicted protein [Physcomitrella patens]
 gb|EDQ81202.1| predicted protein [Physcomitrella patens]
Length=237

 Score =   173 bits (439),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 90/150 (60%), Positives = 123/150 (82%), Gaps = 0/150 (0%)
 Frame = +1

Query  94   VVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLK  273
             VPE++LKK+KR+E+WA+ +KQ L + K KN+++RK+IF RA+Q+ +EY  Q+ + I+LK
Sbjct  3    TVPETLLKKRKRDEQWAINRKQLLESGKNKNSQSRKVIFKRAEQFIREYRGQEADFIRLK  62

Query  274  REARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNM  453
            +E ++K    V PE KL+FIIRIRG+N MHP T+K +QLLRL+Q F+GVFLKVN++T+++
Sbjct  63   KELKVKSRSNVLPEGKLMFIIRIRGVNNMHPKTRKTMQLLRLKQTFDGVFLKVNESTMSL  122

Query  454  LHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            L +VEPYV YG PNLKSVRELIYKRGYG V
Sbjct  123  LRRVEPYVIYGNPNLKSVRELIYKRGYGNV  152



>ref|XP_003056478.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH59854.1| predicted protein [Micromonas pusilla CCMP1545]
Length=238

 Score =   173 bits (438),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 96/151 (64%), Positives = 123/151 (81%), Gaps = 0/151 (0%)
 Frame = +1

Query  91   PVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQL  270
            P VPE+ LKK+KR+E WA  K    A  K    +N K IF RA++Y KEY +Q+ +L++L
Sbjct  2    PAVPETALKKRKRDEAWAAKKAAAAAEAKAHAEKNSKEIFKRAEKYVKEYRDQEADLVRL  61

Query  271  KREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVN  450
            KR+AR KGGFYV PEAKL+F++R+RG+N +HP T+K+LQL+RLRQI NG+FL+VNKAT+N
Sbjct  62   KRDARAKGGFYVEPEAKLMFVMRLRGLNDLHPQTRKVLQLMRLRQIHNGIFLRVNKATIN  121

Query  451  MLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            ML KVEPYV +GYPNLK+V+ELIYKRGYGKV
Sbjct  122  MLKKVEPYVMFGYPNLKTVKELIYKRGYGKV  152



>ref|XP_002500935.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO62193.1| predicted protein [Micromonas sp. RCC299]
Length=238

 Score =   172 bits (435),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 100/151 (66%), Positives = 125/151 (83%), Gaps = 0/151 (0%)
 Frame = +1

Query  91   PVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQL  270
            P VPE+ LK++KR+E WA  K +  A  K K   N+K IF RA++Y KEY +Q+ +L++L
Sbjct  2    PAVPETALKRRKRDEAWAANKAKAAAEAKAKAEANKKEIFNRAEKYVKEYRDQEADLVRL  61

Query  271  KREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVN  450
            KREAR KGGFYV PEAK++F++R+RGIN MHP T+KI+QLLRLRQI NGVF++VNKAT+N
Sbjct  62   KREARAKGGFYVEPEAKVMFVMRLRGINDMHPKTRKIMQLLRLRQIHNGVFMRVNKATIN  121

Query  451  MLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            ML KVEPYV +GYPNLKSV+ELIYKRGYGKV
Sbjct  122  MLRKVEPYVMFGYPNLKSVKELIYKRGYGKV  152



>ref|XP_002452034.1| hypothetical protein SORBIDRAFT_04g017103 [Sorghum bicolor]
 gb|EES05010.1| hypothetical protein SORBIDRAFT_04g017103 [Sorghum bicolor]
Length=105

 Score =   165 bits (417),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 78/89 (88%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +1

Query  277  EARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNML  456
            EARLKGGFYV+PEAKLLF++RIRGINA+HPNT+KILQLL LRQIFNGVFLKVNKAT+NML
Sbjct  2    EARLKGGFYVSPEAKLLFVVRIRGINAIHPNTRKILQLLHLRQIFNGVFLKVNKATINML  61

Query  457  HKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
             +VEPYV YGYPNLKSVRELIYKRGYGK+
Sbjct  62   CRVEPYVAYGYPNLKSVRELIYKRGYGKL  90



>ref|XP_006841172.1| hypothetical protein AMTR_s00086p00164400 [Amborella trichopoda]
 gb|ERN02847.1| hypothetical protein AMTR_s00086p00164400 [Amborella trichopoda]
Length=247

 Score =   168 bits (426),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 84/161 (52%), Positives = 124/161 (77%), Gaps = 1/161 (1%)
 Frame = +1

Query  64   MAEAQTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeye  243
            MA+ ++K    VPE+VLKK+K++ EWA+ K+ +L + K++  ENR L+F +A+ + +E+ 
Sbjct  1    MADEESKPLAFVPETVLKKRKQSSEWAIRKRAQLESRKQRTKENRALVFKKAENFIQEHR  60

Query  244  eqqkeLIQLKR-EARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGV  420
             ++ +LI++KR   +L+  F VNP+A+LLF+IRI G N MHP TKKIL LL+L  IF+GV
Sbjct  61   NKELDLIRMKRVTKKLRRSFSVNPDAQLLFVIRISGTNDMHPKTKKILYLLKLSNIFDGV  120

Query  421  FLKVNKATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            F+KVN A + ML  VEPY+TYGYPN+KSV+EL+YK+G+G+V
Sbjct  121  FIKVNDAMMKMLKMVEPYITYGYPNMKSVQELVYKKGFGRV  161



>ref|XP_002447060.1| hypothetical protein SORBIDRAFT_06g027780 [Sorghum bicolor]
 gb|EES11388.1| hypothetical protein SORBIDRAFT_06g027780 [Sorghum bicolor]
Length=190

 Score =   166 bits (421),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 81/95 (85%), Positives = 88/95 (93%), Gaps = 0/95 (0%)
 Frame = +1

Query  259  LIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNK  438
            L+QLKREA LKGGFYV PEA LLF++RIRGINAMH  T+KILQLLRLRQIFNGVFLKVNK
Sbjct  11   LVQLKREALLKGGFYVTPEANLLFVVRIRGINAMHLKTRKILQLLRLRQIFNGVFLKVNK  70

Query  439  ATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            AT+NML +VEPYV YGYPNLKSVRELIYKRGYGK+
Sbjct  71   ATINMLRRVEPYVAYGYPNLKSVRELIYKRGYGKL  105



>ref|XP_005763901.1| hypothetical protein EMIHUDRAFT_446099 [Emiliania huxleyi CCMP1516]
 ref|XP_005793598.1| hypothetical protein EMIHUDRAFT_433254 [Emiliania huxleyi CCMP1516]
 gb|EOD11472.1| hypothetical protein EMIHUDRAFT_446099 [Emiliania huxleyi CCMP1516]
 gb|EOD41169.1| hypothetical protein EMIHUDRAFT_433254 [Emiliania huxleyi CCMP1516]
Length=241

 Score =   167 bits (424),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 91/149 (61%), Positives = 115/149 (77%), Gaps = 0/149 (0%)
 Frame = +1

Query  97   VPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLKR  276
            VPESVLKK+KR E+WA  K    +A + K A  RK IF RA+ Y  EY   +++L+ +KR
Sbjct  4    VPESVLKKRKRQEKWAADKAAATSAAETKAAAKRKDIFKRAEAYVAEYRSAEQQLVTMKR  63

Query  277  EARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNML  456
             AR  G FYV PE KLLF++R+RGIN MHP T+KI+Q+LRL QI NGVF+KVNKAT+NML
Sbjct  64   AARKAGTFYVEPEHKLLFVMRLRGINGMHPKTRKIMQVLRLLQINNGVFMKVNKATMNML  123

Query  457  HKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
             KV+PY+ YGYPNLK+V+EL+YKRG+ KV
Sbjct  124  VKVDPYIMYGYPNLKTVKELVYKRGHAKV  152



>gb|KIZ06280.1| 60S ribosomal protein L7-3 [Monoraphidium neglectum]
Length=238

 Score =   167 bits (423),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 90/149 (60%), Positives = 112/149 (75%), Gaps = 0/149 (0%)
 Frame = +1

Query  97   VPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLKR  276
            VPE   KK KR E WA  K  +    +KK  E R++IF +A  Y +E+ +Q+K+LI+LKR
Sbjct  4    VPELAAKKAKREEAWATQKAADALEARKKAKETRRVIFKKAAAYVEEFRQQEKDLIRLKR  63

Query  277  EARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNML  456
            EA+   GFYV PEAKL F+IRIRG+N +HP TKKILQLLRLRQI N VF+++NKAT  +L
Sbjct  64   EAKAAKGFYVEPEAKLAFVIRIRGLNKIHPKTKKILQLLRLRQIGNAVFVRINKATQGLL  123

Query  457  HKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
             +VEPY+ YGYPNLKSVREL+ KRGY KV
Sbjct  124  TRVEPYIAYGYPNLKSVRELVLKRGYAKV  152



>gb|KIZ06126.1| 60S ribosomal protein L7-3 [Monoraphidium neglectum]
Length=238

 Score =   167 bits (423),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 91/149 (61%), Positives = 112/149 (75%), Gaps = 0/149 (0%)
 Frame = +1

Query  97   VPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLKR  276
            VPE   KK KR E WA  K  +    +KK  E R++IF +A QY  E+ +Q+K+LI+LKR
Sbjct  4    VPELAAKKAKREEAWATQKAADALEARKKAKETRRVIFKKAAQYVSEFRQQEKDLIRLKR  63

Query  277  EARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNML  456
            EA+   GFYV PEAKL F+IRIRG+N +HP TKKILQLLRLRQI N VF+++NKAT  +L
Sbjct  64   EAKAAKGFYVEPEAKLAFVIRIRGLNKIHPKTKKILQLLRLRQIGNAVFVRINKATQGLL  123

Query  457  HKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
             +VEPY+ YGYPNLKSVREL+ KRGY KV
Sbjct  124  TRVEPYIAYGYPNLKSVRELVLKRGYAKV  152



>ref|XP_010506874.1| PREDICTED: 60S ribosomal protein L7-2-like [Camelina sativa]
Length=236

 Score =   167 bits (423),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 105/160 (66%), Positives = 124/160 (78%), Gaps = 10/160 (6%)
 Frame = +1

Query  64   MAEAQTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeye  243
            MAE++     VVPESVLKK+KR EEWAL KKQ   A KKKNAENRKLIF RA+QY+KEY 
Sbjct  1    MAESKV----VVPESVLKKRKREEEWALEKKQNAEAAKKKNAENRKLIFKRAEQYSKEYA  56

Query  244  eqqkeLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVF  423
            E+   +I + ++  L+    +N    LLF+     INA+ P TKKILQLLRLRQIFNGVF
Sbjct  57   EKCA-IITISKDL-LRCCCPLN----LLFLELFCSINAIDPKTKKILQLLRLRQIFNGVF  110

Query  424  LKVNKATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LKVNKAT+NML +VEPYVTYG+PNLKSV+ELIYKRGYGK+
Sbjct  111  LKVNKATMNMLRRVEPYVTYGFPNLKSVKELIYKRGYGKL  150



>gb|ABW90388.1| putative ribosomal protein L7 [Barentsia elongata]
Length=240

 Score =   162 bits (409),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 86/151 (57%), Positives = 117/151 (77%), Gaps = 0/151 (0%)
 Frame = +1

Query  91   PVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQL  270
            P VPE++LKK+K NEE    + + +  +KKK    R+L+F RA+ Y KEY  ++++LI+L
Sbjct  4    PQVPETLLKKRKENEERRAKRSKTMLMLKKKQKSKRQLMFKRAEAYVKEYRNKERDLIRL  63

Query  271  KREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVN  450
            KREA+    +YV+ E +L F++RIRGIN +HP  +K+LQLLRLRQI NG F+++NKAT++
Sbjct  64   KREAKKHKNYYVDDEPRLAFVMRIRGINGVHPRPRKVLQLLRLRQINNGTFVRLNKATIH  123

Query  451  MLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            ML   EPY+T+GYPNLKSVRELIYKRGYGKV
Sbjct  124  MLRIAEPYITWGYPNLKSVRELIYKRGYGKV  154



>gb|AIY85430.1| 60S ribosomal protein L7, partial [Elaeagnus umbellata]
Length=166

 Score =   157 bits (397),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 75/84 (89%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = +1

Query  292  GGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNMLHKVEP  471
            GGFYV+PEAKLLFIIRIRGINA+ P T+KILQLLRLRQIFNGVFLKVNKAT+NMLH+VEP
Sbjct  2    GGFYVDPEAKLLFIIRIRGINAVGPKTRKILQLLRLRQIFNGVFLKVNKATINMLHRVEP  61

Query  472  YVTYGYPNLKSVRELIYKRGYGKV  543
            YVTYGYPNLKSV+ELIYKRGYGK+
Sbjct  62   YVTYGYPNLKSVKELIYKRGYGKL  85



>gb|ABW23162.1| ribosomal protein rpl7 [Arenicola marina]
Length=243

 Score =   159 bits (402),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 86/160 (54%), Positives = 121/160 (76%), Gaps = 1/160 (1%)
 Frame = +1

Query  64   MAEAQTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeye  243
            MA++Q K  P VPE++LKK+K+NEE    K       K++  E R+++F RA+QY +EY 
Sbjct  1    MADSQKKL-PQVPETLLKKRKKNEESRARKAASAVDAKRQRKEKRQVMFKRAEQYVREYR  59

Query  244  eqqkeLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVF  423
             ++++ I++ R+A+ K  FYV  EAK+ F++RIRGIN +HP  +K++QL RLRQI NG F
Sbjct  60   VKERDEIRMSRQAKKKDNFYVPAEAKMAFVMRIRGINGIHPRPRKVMQLFRLRQINNGTF  119

Query  424  LKVNKATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            LK+NKAT++ML   +PY+T+GYPNLKSVRELIYKRGYGK+
Sbjct  120  LKLNKATLHMLRLADPYITWGYPNLKSVRELIYKRGYGKL  159



>ref|XP_003078067.1| putative 60S ribosomal protein L7 (ISS) [Ostreococcus tauri]
Length=276

 Score =   160 bits (405),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 74/95 (78%), Positives = 87/95 (92%), Gaps = 0/95 (0%)
 Frame = +1

Query  259  LIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNK  438
            L++LKREAR KGGFYV PEAKL+F++R+RG+N +HP TKKILQLLRLRQI NG+F+KVNK
Sbjct  96   LVRLKREARAKGGFYVEPEAKLMFVMRLRGLNDIHPKTKKILQLLRLRQIHNGIFMKVNK  155

Query  439  ATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            AT+N L KVEPY+ +GYPNLKSVRELIYKRGYGKV
Sbjct  156  ATLNQLRKVEPYIMFGYPNLKSVRELIYKRGYGKV  190



>ref|XP_005510285.1| PREDICTED: 60S ribosomal protein L7 isoform X1 [Columba livia]
 ref|XP_005510286.1| PREDICTED: 60S ribosomal protein L7 isoform X2 [Columba livia]
Length=246

 Score =   158 bits (400),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 86/160 (54%), Positives = 114/160 (71%), Gaps = 0/160 (0%)
 Frame = +1

Query  64   MAEAQTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeye  243
            MAE + K  P VPES+LKK++        +++++ A+KK     RKLI+ RA+ Y KEY 
Sbjct  1    MAEKEAKKVPSVPESLLKKRQAYAAMKAKRQKKILAIKKARKAQRKLIYARAQAYHKEYR  60

Query  244  eqqkeLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVF  423
               ++ I++ R AR  G +YV  E KL F+IRIRG N + P  +K+LQLLRLRQIFNG F
Sbjct  61   HMYRQEIRMARMARKAGNYYVPAEPKLAFVIRIRGTNGVSPKVRKVLQLLRLRQIFNGTF  120

Query  424  LKVNKATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            +K+NKA++NML  VEPY+ +GYPNLKSV ELIYKRGYGK+
Sbjct  121  VKLNKASINMLRIVEPYIAWGYPNLKSVHELIYKRGYGKI  160



>dbj|BAF98652.1| Ribosomal protein L7 [Solea senegalensis]
Length=245

 Score =   158 bits (399),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 90/160 (56%), Positives = 117/160 (73%), Gaps = 1/160 (1%)
 Frame = +1

Query  64   MAEAQTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeye  243
            MA+A+ K  P VPES+LK++K       A+ +++ A KK     RKLIF RA++Y KEY 
Sbjct  1    MADAEKKV-PAVPESLLKRRKAFASMKAARIKKMLAEKKARKSTRKLIFKRAEKYHKEYR  59

Query  244  eqqkeLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVF  423
            +  +  I+L R AR  G FYV  E KL F+IRIRGIN + P  +K+LQLLRLRQIFNGVF
Sbjct  60   QMYRREIRLGRTARKVGNFYVPAEPKLAFVIRIRGINGVSPKVRKVLQLLRLRQIFNGVF  119

Query  424  LKVNKATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            +K+NKA++NML   EPY+ +GYPNLKSVRELIYKRG+G++
Sbjct  120  VKLNKASINMLRIAEPYIAWGYPNLKSVRELIYKRGHGRI  159



>ref|XP_009270925.1| PREDICTED: 60S ribosomal protein L7 [Aptenodytes forsteri]
Length=246

 Score =   158 bits (399),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 86/160 (54%), Positives = 113/160 (71%), Gaps = 0/160 (0%)
 Frame = +1

Query  64   MAEAQTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeye  243
            MAE + K  P VPES+LKK++        +++ + A+KK     RKLI+ RA+ Y KEY 
Sbjct  1    MAEKEAKKVPSVPESLLKKRQAYAAVKAKRQKRMLAIKKSRKAQRKLIYARAQAYHKEYR  60

Query  244  eqqkeLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVF  423
               ++ I++ R AR  G +YV  E KL F+IRIRG N + P  +K+LQLLRLRQIFNG F
Sbjct  61   HMYRQEIRMARMARKAGNYYVPAEPKLAFVIRIRGTNGVSPKVRKVLQLLRLRQIFNGTF  120

Query  424  LKVNKATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            +K+NKA++NML  VEPY+ +GYPNLKSV ELIYKRGYGK+
Sbjct  121  VKLNKASINMLRIVEPYIAWGYPNLKSVHELIYKRGYGKI  160



>ref|XP_002950779.1| component of cytosolic 80S ribosome and 60S large subunit [Volvox 
carteri f. nagariensis]
 gb|EFJ48094.1| component of cytosolic 80S ribosome and 60S large subunit [Volvox 
carteri f. nagariensis]
Length=239

 Score =   157 bits (398),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 88/150 (59%), Positives = 116/150 (77%), Gaps = 0/150 (0%)
 Frame = +1

Query  94   VVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeyeeqqkeLIQLK  273
            VVPE + KK+KR+E+ A  +       +KK+   RK IF RA++Y  EY  Q+K++++LK
Sbjct  4    VVPELLAKKRKRDEQAAAERAAAALESRKKSRATRKEIFKRAEKYVSEYRSQEKDIVRLK  63

Query  274  REARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVFLKVNKATVNM  453
            R A+ KGGFYV PEAK++F++RIRG+N + P TKKILQLLRL+Q+  GVFLKV+K  +NM
Sbjct  64   RAAKAKGGFYVPPEAKVIFVVRIRGLNKIAPKTKKILQLLRLKQLNMGVFLKVSKPVLNM  123

Query  454  LHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            L +VEPYV +GYPNLKSVRELIYKRGY K+
Sbjct  124  LQRVEPYVAFGYPNLKSVRELIYKRGYAKI  153



>ref|XP_010184556.1| PREDICTED: 60S ribosomal protein L7 [Mesitornis unicolor]
Length=246

 Score =   157 bits (398),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 86/160 (54%), Positives = 114/160 (71%), Gaps = 0/160 (0%)
 Frame = +1

Query  64   MAEAQTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeye  243
            MAE + K  P VPES+LKK++        +++++ A+KK     RKLI+ RA+ Y KEY 
Sbjct  1    MAEKEAKKVPSVPESLLKKRQAYAAMKAKRQKKILAIKKFRKAQRKLIYARAQAYHKEYR  60

Query  244  eqqkeLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVF  423
               ++ I++ R AR  G +YV  E KL F+IRIRG N + P  +K+LQLLRLRQIFNG F
Sbjct  61   HMYRQEIRMARMARKAGNYYVPAEPKLAFVIRIRGTNGVSPKVRKVLQLLRLRQIFNGTF  120

Query  424  LKVNKATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            +K+NKA++NML  VEPY+ +GYPNLKSV ELIYKRGYGK+
Sbjct  121  VKLNKASINMLRIVEPYIAWGYPNLKSVHELIYKRGYGKI  160



>ref|XP_005150859.1| PREDICTED: 60S ribosomal protein L7 [Melopsittacus undulatus]
Length=246

 Score =   157 bits (397),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 86/160 (54%), Positives = 114/160 (71%), Gaps = 0/160 (0%)
 Frame = +1

Query  64   MAEAQTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeye  243
            MAE + K  P VPES+LKK++        +++++ A+KK     RKLI+ RA+ Y KEY 
Sbjct  1    MAEKEAKKVPSVPESLLKKRQAYAALKAKRQKKILAIKKFRKAQRKLIYARAQAYHKEYR  60

Query  244  eqqkeLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVF  423
               ++ I++ R AR  G +YV  E KL F+IRIRG N + P  +K+LQLLRLRQIFNG F
Sbjct  61   HMYRQEIRMARMARKAGNYYVPAEPKLAFVIRIRGTNGVSPKVRKVLQLLRLRQIFNGTF  120

Query  424  LKVNKATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            +K+NKA++NML  VEPY+ +GYPNLKSV ELIYKRGYGK+
Sbjct  121  VKLNKASINMLRIVEPYIAWGYPNLKSVHELIYKRGYGKI  160



>ref|XP_009467280.1| PREDICTED: 60S ribosomal protein L7 [Nipponia nippon]
 ref|XP_009467281.1| PREDICTED: 60S ribosomal protein L7 [Nipponia nippon]
 ref|XP_009467282.1| PREDICTED: 60S ribosomal protein L7 [Nipponia nippon]
Length=246

 Score =   157 bits (396),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 86/160 (54%), Positives = 114/160 (71%), Gaps = 0/160 (0%)
 Frame = +1

Query  64   MAEAQTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeye  243
            MAE + K  P VPES+LKK++        +++++ A+KK     RKLI+ RA+ Y KEY 
Sbjct  1    MAEKEAKKVPSVPESLLKKRQAYAAIKAKRQKKILAIKKFRKAQRKLIYARAQAYHKEYR  60

Query  244  eqqkeLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVF  423
               ++ I++ R AR  G +YV  E KL F+IRIRG N + P  +K+LQLLRLRQIFNG F
Sbjct  61   HMYRQEIRMARMARKAGNYYVPAEPKLAFVIRIRGTNGVSPKVRKVLQLLRLRQIFNGTF  120

Query  424  LKVNKATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            +K+NKA++NML  VEPY+ +GYPNLKSV ELIYKRGYGK+
Sbjct  121  VKLNKASINMLRIVEPYIAWGYPNLKSVHELIYKRGYGKI  160



>ref|XP_010574186.1| PREDICTED: 60S ribosomal protein L7 [Haliaeetus leucocephalus]
 ref|XP_010574187.1| PREDICTED: 60S ribosomal protein L7 [Haliaeetus leucocephalus]
Length=246

 Score =   157 bits (396),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 86/160 (54%), Positives = 113/160 (71%), Gaps = 0/160 (0%)
 Frame = +1

Query  64   MAEAQTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeye  243
            MAE   K  P VPES+LKK++        +++++ A+KK     RKLI+ RA+ Y KEY 
Sbjct  1    MAEKDAKKVPSVPESLLKKRQAYAAIKAKRQKKMLAIKKFRKTQRKLIYARAQAYHKEYR  60

Query  244  eqqkeLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVF  423
               ++ I++ R AR  G +YV  E KL F+IRIRG N + P  +K+LQLLRLRQIFNG F
Sbjct  61   HMYRQEIRMARMARKAGNYYVPAEPKLAFVIRIRGTNGVSPKVRKVLQLLRLRQIFNGTF  120

Query  424  LKVNKATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            +K+NKA++NML  VEPY+ +GYPNLKSV ELIYKRGYGK+
Sbjct  121  VKLNKASINMLRIVEPYIAWGYPNLKSVHELIYKRGYGKI  160



>ref|XP_010155588.1| PREDICTED: 60S ribosomal protein L7 [Eurypyga helias]
 ref|XP_010155589.1| PREDICTED: 60S ribosomal protein L7 [Eurypyga helias]
Length=246

 Score =   156 bits (395),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 86/160 (54%), Positives = 114/160 (71%), Gaps = 0/160 (0%)
 Frame = +1

Query  64   MAEAQTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeye  243
            MAE + K  P VPES+LKK++        +++++ A+KK     RKLI+ RA+ Y KEY 
Sbjct  1    MAEKEAKKLPSVPESLLKKRQAYAAIKAKRQKKILAIKKFRKAQRKLIYARAQAYHKEYR  60

Query  244  eqqkeLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVF  423
               ++ I++ R AR  G +YV  E KL F+IRIRG N + P  +K+LQLLRLRQIFNG F
Sbjct  61   HMYRQEIRMARMARKAGNYYVPAEPKLAFVIRIRGTNGVSPKVRKVLQLLRLRQIFNGTF  120

Query  424  LKVNKATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            +K+NKA++NML  VEPY+ +GYPNLKSV ELIYKRGYGK+
Sbjct  121  VKLNKASINMLRIVEPYIAWGYPNLKSVHELIYKRGYGKI  160



>ref|XP_009084291.1| PREDICTED: 60S ribosomal protein L7 [Serinus canaria]
Length=246

 Score =   156 bits (395),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 85/160 (53%), Positives = 114/160 (71%), Gaps = 0/160 (0%)
 Frame = +1

Query  64   MAEAQTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeye  243
            MA+ + K  P VPES+LKK++        +++++ A+KK     RKLI+ RA+ Y KEY 
Sbjct  1    MADKEVKKVPSVPESLLKKRQAYAVMKAKRQKKILAIKKYRKTQRKLIYARAQAYHKEYR  60

Query  244  eqqkeLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVF  423
               ++ I++ R AR  G +YV  E KL F+IRIRG N + P  +K+LQLLRLRQIFNG F
Sbjct  61   HMYRQEIRMARMARKAGNYYVPAEPKLAFVIRIRGTNGVSPKVRKVLQLLRLRQIFNGTF  120

Query  424  LKVNKATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            +K+NKA++NML  VEPY+ +GYPNLKSV ELIYKRGYGK+
Sbjct  121  VKLNKASINMLRIVEPYIAWGYPNLKSVHELIYKRGYGKI  160



>ref|XP_002587985.1| hypothetical protein BRAFLDRAFT_125387 [Branchiostoma floridae]
 gb|EEN43996.1| hypothetical protein BRAFLDRAFT_125387 [Branchiostoma floridae]
Length=245

 Score =   156 bits (394),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 93/160 (58%), Positives = 123/160 (77%), Gaps = 1/160 (1%)
 Frame = +1

Query  64   MAEAQTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeye  243
            MA+A+ K  P VPES+LKK+KR E+    + +     KKK+ E RK+IF RA+ Y +EY 
Sbjct  1    MADAEAKL-PKVPESLLKKRKRFEQLKAQRAKAAILQKKKSKEKRKIIFKRAESYVREYR  59

Query  244  eqqkeLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVF  423
             ++++ I+LKREA+  G FYV PEAKL F++RIRGIN + P  +K+LQLLRLRQIFNG F
Sbjct  60   RKERDEIRLKREAKKHGNFYVPPEAKLAFVVRIRGINGVSPKVRKVLQLLRLRQIFNGTF  119

Query  424  LKVNKATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            +K+NKA++NML   EPY+ +GYPNLK+VRELIYKRGYGK+
Sbjct  120  VKLNKASLNMLKIAEPYIAWGYPNLKTVRELIYKRGYGKI  159



>ref|XP_005042240.1| PREDICTED: 60S ribosomal protein L7 [Ficedula albicollis]
Length=246

 Score =   156 bits (394),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 85/160 (53%), Positives = 114/160 (71%), Gaps = 0/160 (0%)
 Frame = +1

Query  64   MAEAQTKGGPVVPESVLKKQKRNEEWALAKKQELAAVKKKNAENRKLIFCRakqyakeye  243
            MA+ + K  P VPES+LKK++        +++++ A+KK     RKLI+ RA+ Y KEY 
Sbjct  1    MADKEAKKVPSVPESLLKKRQAYAVMKAKRQKKILAIKKYRKAQRKLIYARAQAYHKEYR  60

Query  244  eqqkeLIQLKREARLKGGFYVNPEAKLLFIIRIRGINAMHPNTKKILQLLRLRQIFNGVF  423
               ++ I++ R AR  G +YV  E KL F+IRIRG N + P  +K+LQLLRLRQIFNG F
Sbjct  61   HMYRQEIRMARMARKAGNYYVPAEPKLAFVIRIRGTNGVSPKVRKVLQLLRLRQIFNGTF  120

Query  424  LKVNKATVNMLHKVEPYVTYGYPNLKSVRELIYKRGYGKV  543
            +K+NKA++NML  VEPY+ +GYPNLKSV ELIYKRGYGK+
Sbjct  121  VKLNKASINMLRIVEPYIAWGYPNLKSVHELIYKRGYGKI  160



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 579015689490