BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002C20

Length=232
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KEH40624.1|  40S ribosomal protein S2-4                            69.3    2e-12   Medicago truncatula
gb|KEH21389.1|  40S ribosomal protein S2-4                            68.9    3e-12   Medicago truncatula
gb|AFK38691.1|  unknown                                               68.9    3e-12   Medicago truncatula
ref|XP_003630949.1|  40S ribosomal protein S2                         68.9    3e-12   Medicago truncatula
ref|XP_003525227.1|  PREDICTED: 40S ribosomal protein S2-4-like       68.9    3e-12   Glycine max [soybeans]
gb|KDP22104.1|  hypothetical protein JCGZ_25935                       68.9    3e-12   Jatropha curcas
ref|XP_008361610.1|  PREDICTED: 40S ribosomal protein S2-4-like       68.9    3e-12   Malus domestica [apple tree]
gb|KDP22105.1|  hypothetical protein JCGZ_25936                       68.9    3e-12   Jatropha curcas
emb|CDP18531.1|  unnamed protein product                              68.9    3e-12   Coffea canephora [robusta coffee]
ref|XP_009369694.1|  PREDICTED: 40S ribosomal protein S2-4-like       68.9    3e-12   Pyrus x bretschneideri [bai li]
ref|XP_008385732.1|  PREDICTED: 40S ribosomal protein S2-4-like       68.9    3e-12   
ref|XP_002513481.1|  40S ribosomal protein S2, putative               68.9    3e-12   Ricinus communis
ref|XP_009366094.1|  PREDICTED: 40S ribosomal protein S2-4-like       68.9    3e-12   Pyrus x bretschneideri [bai li]
ref|XP_002513493.1|  40S ribosomal protein S2, putative               68.6    4e-12   Ricinus communis
ref|XP_007160431.1|  hypothetical protein PHAVU_002G321400g           68.2    6e-12   Phaseolus vulgaris [French bean]
ref|XP_007153237.1|  hypothetical protein PHAVU_003G018300g           68.2    6e-12   Phaseolus vulgaris [French bean]
ref|XP_003538262.1|  PREDICTED: 40S ribosomal protein S2-4-like       68.2    7e-12   Glycine max [soybeans]
ref|XP_003538244.1|  PREDICTED: 40S ribosomal protein S2-4-like       68.2    7e-12   Glycine max [soybeans]
gb|KDO53682.1|  hypothetical protein CISIN_1g024105mg                 67.8    7e-12   Citrus sinensis [apfelsine]
ref|XP_006421416.1|  hypothetical protein CICLE_v10005613mg           67.8    8e-12   Citrus clementina [clementine]
ref|XP_007211807.1|  hypothetical protein PRUPE_ppa009890mg           67.4    1e-11   Prunus persica
gb|KHN16531.1|  40S ribosomal protein S2-4                            67.0    1e-11   Glycine soja [wild soybean]
ref|XP_010555023.1|  PREDICTED: 40S ribosomal protein S2-4-like       67.4    1e-11   Tarenaya hassleriana [spider flower]
ref|XP_008460763.1|  PREDICTED: 40S ribosomal protein S2-4-like       67.0    1e-11   Cucumis melo [Oriental melon]
ref|XP_010536089.1|  PREDICTED: 40S ribosomal protein S2-3-like       67.4    1e-11   Tarenaya hassleriana [spider flower]
ref|XP_004149390.1|  PREDICTED: 40S ribosomal protein S2-4-like       67.0    1e-11   
ref|XP_010519760.1|  PREDICTED: 40S ribosomal protein S2-3-like       67.4    1e-11   Tarenaya hassleriana [spider flower]
ref|XP_004168599.1|  PREDICTED: 40S ribosomal protein S2-3-like       67.0    1e-11   
ref|XP_004162177.1|  PREDICTED: 40S ribosomal protein S2-4-like       67.0    1e-11   
ref|XP_004503350.1|  PREDICTED: 40S ribosomal protein S2-3-like       67.0    2e-11   Cicer arietinum [garbanzo]
ref|XP_008231962.1|  PREDICTED: 40S ribosomal protein S2-like         67.8    2e-11   
ref|XP_011069984.1|  PREDICTED: 40S ribosomal protein S2-4-like       66.6    2e-11   Sesamum indicum [beniseed]
ref|XP_010057233.1|  PREDICTED: 40S ribosomal protein S2-4            66.6    2e-11   Eucalyptus grandis [rose gum]
ref|XP_010057240.1|  PREDICTED: 40S ribosomal protein S2-4-like       66.6    2e-11   Eucalyptus grandis [rose gum]
ref|XP_011079131.1|  PREDICTED: 40S ribosomal protein S2-4-like       66.6    2e-11   Sesamum indicum [beniseed]
ref|XP_004136761.1|  PREDICTED: 40S ribosomal protein S2-3-like       67.0    2e-11   
ref|XP_002298397.2|  hypothetical protein POPTR_0001s26400g           67.4    3e-11   
gb|EPS60317.1|  hypothetical protein M569_14488                       66.2    3e-11   Genlisea aurea
ref|XP_006838579.1|  hypothetical protein AMTR_s00002p00212950        66.2    3e-11   Amborella trichopoda
ref|XP_008443195.1|  PREDICTED: 40S ribosomal protein S2-3-like       66.2    3e-11   Cucumis melo [Oriental melon]
ref|XP_009403825.1|  PREDICTED: 40S ribosomal protein S2-4-like       66.2    4e-11   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009407563.1|  PREDICTED: 40S ribosomal protein S2-2-like       66.2    4e-11   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010937193.1|  PREDICTED: 40S ribosomal protein S2-3-like       65.9    4e-11   Elaeis guineensis
ref|XP_009386449.1|  PREDICTED: 40S ribosomal protein S2-2-like       65.9    4e-11   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010923421.1|  PREDICTED: 40S ribosomal protein S2-3-like       65.9    4e-11   Elaeis guineensis
ref|XP_004302961.1|  PREDICTED: 40S ribosomal protein S2-1-like       65.9    4e-11   Fragaria vesca subsp. vesca
ref|XP_010906118.1|  PREDICTED: 40S ribosomal protein S2-2-like       65.9    5e-11   Elaeis guineensis
ref|XP_002963234.1|  hypothetical protein SELMODRAFT_67484            65.1    6e-11   
ref|XP_002878157.1|  40S ribosomal protein S2                         65.1    9e-11   Arabidopsis lyrata subsp. lyrata
ref|XP_002974537.1|  hypothetical protein SELMODRAFT_149893           65.1    9e-11   Selaginella moellendorffii
ref|XP_011048036.1|  PREDICTED: 40S ribosomal protein S2-3            64.7    9e-11   Populus euphratica
ref|XP_006411454.1|  hypothetical protein EUTSA_v10017049mg           64.7    1e-10   Eutrema salsugineum [saltwater cress]
gb|KHG13084.1|  40S ribosomal S2-2 -like protein                      64.7    1e-10   Gossypium arboreum [tree cotton]
ref|XP_002308954.1|  40S ribosomal protein S2                         64.7    1e-10   Populus trichocarpa [western balsam poplar]
gb|KJB08358.1|  hypothetical protein B456_001G078600                  64.7    1e-10   Gossypium raimondii
gb|KHG28265.1|  40S ribosomal S2-2 -like protein                      64.3    1e-10   Gossypium arboreum [tree cotton]
ref|XP_007015077.1|  Ribosomal protein S5 family protein isoform 1    64.3    1e-10   Theobroma cacao [chocolate]
ref|XP_007015080.1|  Ribosomal protein S5 family protein              64.3    2e-10   
ref|XP_006291534.1|  hypothetical protein CARUB_v10017690mg           64.7    2e-10   
ref|XP_002322713.1|  40S ribosomal protein S2                         64.3    2e-10   Populus trichocarpa [western balsam poplar]
ref|XP_009389539.1|  PREDICTED: 40S ribosomal protein S2-4-like       64.3    2e-10   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_001784315.1|  predicted protein                                64.3    2e-10   
ref|XP_006392282.1|  hypothetical protein EUTSA_v10023633mg           64.3    2e-10   Eutrema salsugineum [saltwater cress]
ref|XP_001784592.1|  predicted protein                                64.3    2e-10   
emb|CDY45881.1|  BnaC01g28170D                                        63.9    2e-10   Brassica napus [oilseed rape]
gb|ABK22135.1|  unknown                                               62.8    2e-10   Picea sitchensis
ref|XP_009102893.1|  PREDICTED: 40S ribosomal protein S2-2            63.9    2e-10   Brassica rapa
gb|KFK34998.1|  hypothetical protein AALP_AA5G220900                  63.5    3e-10   Arabis alpina [alpine rockcress]
ref|XP_001753770.1|  predicted protein                                63.5    4e-10   
ref|XP_001780194.1|  predicted protein                                63.5    4e-10   
ref|XP_010241237.1|  PREDICTED: 40S ribosomal protein S2-3-like       63.2    5e-10   Nelumbo nucifera [Indian lotus]
ref|XP_008784865.1|  PREDICTED: 40S ribosomal protein S2-3-like       63.2    5e-10   Phoenix dactylifera
ref|XP_010257189.1|  PREDICTED: 40S ribosomal protein S2-3-like       63.2    5e-10   Nelumbo nucifera [Indian lotus]
ref|XP_009602518.1|  PREDICTED: 40S ribosomal protein S2-3-like i...  62.8    6e-10   Nicotiana tomentosiformis
ref|XP_006356337.1|  PREDICTED: 40S ribosomal protein S2-3-like       62.8    6e-10   Solanum tuberosum [potatoes]
ref|XP_004237924.1|  PREDICTED: 40S ribosomal protein S2-4-like       62.8    6e-10   Solanum lycopersicum
ref|XP_004237705.1|  PREDICTED: 40S ribosomal protein S2-3-like       62.8    6e-10   Solanum lycopersicum
gb|AFW90641.1|  40S ribosomal protein S2                              62.4    6e-10   Solanum tuberosum [potatoes]
ref|NP_191308.1|  40S ribosomal protein S2-4                          62.8    6e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006574815.1|  PREDICTED: 40S ribosomal protein S2-4-like       62.8    7e-10   Glycine max [soybeans]
ref|XP_007015082.1|  Myosin-related isoform 1                         64.7    7e-10   
ref|XP_006303259.1|  hypothetical protein CARUB_v10009962mg           62.4    8e-10   Capsella rubella
ref|XP_003564096.1|  PREDICTED: 40S ribosomal protein S2-3-like       62.4    8e-10   Brachypodium distachyon [annual false brome]
emb|CDY06903.1|  BnaA04g24120D                                        62.0    8e-10   
ref|XP_006302652.1|  hypothetical protein CARUB_v10020756mg           62.4    8e-10   Capsella rubella
ref|XP_008231963.1|  PREDICTED: 40S ribosomal protein S2-4-like       62.4    8e-10   Prunus mume [ume]
ref|XP_010427628.1|  PREDICTED: 40S ribosomal protein S2-4            62.4    9e-10   Camelina sativa [gold-of-pleasure]
gb|ABK21813.1|  unknown                                               62.4    9e-10   Picea sitchensis
ref|XP_010504675.1|  PREDICTED: 40S ribosomal protein S2-4-like       62.4    9e-10   Camelina sativa [gold-of-pleasure]
emb|CDY22542.1|  BnaC03g23520D                                        62.4    1e-09   Brassica napus [oilseed rape]
gb|ABK25823.1|  unknown                                               62.4    1e-09   Picea sitchensis
ref|XP_009133513.1|  PREDICTED: 40S ribosomal protein S2-2-like       62.4    1e-09   Brassica rapa
ref|XP_010412819.1|  PREDICTED: 40S ribosomal protein S2-4-like       62.4    1e-09   Camelina sativa [gold-of-pleasure]
ref|XP_011020354.1|  PREDICTED: 40S ribosomal protein S2-3-like       62.0    1e-09   Populus euphratica
gb|KFK40885.1|  hypothetical protein AALP_AA2G055200                  62.0    1e-09   Arabis alpina [alpine rockcress]
ref|XP_009142017.1|  PREDICTED: 40S ribosomal protein S2-2-like i...  62.0    1e-09   Brassica rapa
ref|XP_004955795.1|  PREDICTED: 40S ribosomal protein S2-3-like       62.0    1e-09   Setaria italica
emb|CDY35397.1|  BnaA03g19630D                                        62.4    1e-09   Brassica napus [oilseed rape]
ref|XP_006294755.1|  hypothetical protein CARUB_v10023800mg           62.0    1e-09   Capsella rubella
emb|CDX79908.1|  BnaA05g02480D                                        62.0    1e-09   
emb|CDY48767.1|  BnaC04g02200D                                        63.9    1e-09   Brassica napus [oilseed rape]
ref|XP_009142781.1|  PREDICTED: 40S ribosomal protein S2-3-like       62.0    1e-09   Brassica rapa
ref|XP_004498248.1|  PREDICTED: 40S ribosomal protein S2-4-like       61.6    2e-09   Cicer arietinum [garbanzo]
ref|XP_003557397.1|  PREDICTED: 40S ribosomal protein S2-4-like       61.6    2e-09   Brachypodium distachyon [annual false brome]
gb|KFK37024.1|  hypothetical protein AALP_AA4G202400                  61.6    2e-09   Arabis alpina [alpine rockcress]
ref|XP_002881803.1|  40S ribosomal protein S2                         61.6    2e-09   
gb|ABF72884.1|  ribosomal protein S2-like                             58.5    3e-09   Belgica antarctica
ref|XP_010508673.1|  PREDICTED: 40S ribosomal protein S2-3            61.2    3e-09   Camelina sativa [gold-of-pleasure]
emb|CDK26979.1|  unnamed protein product                              60.5    3e-09   Kuraishia capsulata CBS 1993
ref|XP_006402872.1|  hypothetical protein EUTSA_v10006149mg           60.8    3e-09   Eutrema salsugineum [saltwater cress]
gb|EYU20868.1|  hypothetical protein MIMGU_mgv1a011569mg              60.5    3e-09   Erythranthe guttata [common monkey flower]
ref|XP_006417498.1|  hypothetical protein EUTSA_v10008441mg           60.8    4e-09   Eutrema salsugineum [saltwater cress]
ref|XP_006431702.1|  hypothetical protein CICLE_v10003471mg           60.5    4e-09   
ref|XP_009777712.1|  PREDICTED: 40S ribosomal protein S2-3-like       60.5    4e-09   Nicotiana sylvestris
gb|EYU20867.1|  hypothetical protein MIMGU_mgv1a011569mg              60.5    5e-09   Erythranthe guttata [common monkey flower]
ref|XP_001745849.1|  hypothetical protein                             62.4    5e-09   Monosiga brevicollis MX1
ref|XP_009602513.1|  PREDICTED: 40S ribosomal protein S2-3-like       60.5    5e-09   Nicotiana tomentosiformis
ref|XP_009630221.1|  PREDICTED: 40S ribosomal protein S2-3-like       60.5    5e-09   Nicotiana tomentosiformis
ref|XP_008801692.1|  PREDICTED: 40S ribosomal protein S2-3-like       60.5    5e-09   Phoenix dactylifera
ref|XP_010554839.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...  60.5    5e-09   Tarenaya hassleriana [spider flower]
ref|XP_010094236.1|  40S ribosomal protein S2-4                       60.5    5e-09   Morus notabilis
gb|EEE66778.1|  hypothetical protein OsJ_23506                        58.9    5e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010517670.1|  PREDICTED: 40S ribosomal protein S2-3-like       60.5    6e-09   Camelina sativa [gold-of-pleasure]
gb|KHJ36005.1|  putative 40s ribosomal protein s2                     59.7    8e-09   Erysiphe necator
gb|EPQ65642.1|  Protein component of the small (40S) subunit          59.7    9e-09   Blumeria graminis f. sp. tritici 96224
ref|XP_010505968.1|  PREDICTED: 40S ribosomal protein S2-3-like       59.7    9e-09   Camelina sativa [gold-of-pleasure]
emb|CCU81829.1|  ribosomal protein                                    59.7    9e-09   Blumeria graminis f. sp. hordei DH14
ref|XP_007736876.1|  30S ribosomal protein S5                         59.3    9e-09   Capronia epimyces CBS 606.96
ref|XP_661017.1|  hypothetical protein AN3413.2                       59.3    9e-09   Aspergillus nidulans FGSC A4
ref|XP_002014372.1|  GL18987                                          60.5    1e-08   
ref|XP_007366828.1|  40S ribosomal protein S2                         59.3    1e-08   Dichomitus squalens LYAD-421 SS1
pdb|3J60|C  Chain C, Localization Of The Small Subunit Ribosomal ...  59.3    1e-08   Triticum aestivum [Canadian hard winter wheat]
ref|XP_007777949.1|  40S ribosomal protein S2                         59.3    1e-08   Coniosporium apollinis CBS 100218
gb|KIV78267.1|  40S ribosomal protein S2                              59.3    1e-08   Exophiala sideris
gb|EYU35640.1|  hypothetical protein MIMGU_mgv1a011526mg              59.3    1e-08   Erythranthe guttata [common monkey flower]
ref|XP_009152387.1|  40S ribosomal protein S2                         59.3    1e-08   Exophiala dermatitidis NIH/UT8656
ref|XP_009785188.1|  PREDICTED: 40S ribosomal protein S2-3-like       59.3    1e-08   Nicotiana sylvestris
gb|KIX00263.1|  40S ribosomal protein S2                              59.3    1e-08   Rhinocladiella mackenziei CBS 650.93
ref|XP_002466245.1|  hypothetical protein SORBIDRAFT_01g004260        59.3    1e-08   Sorghum bicolor [broomcorn]
ref|XP_007720587.1|  40S ribosomal protein S2                         59.3    1e-08   Capronia coronata CBS 617.96
gb|EEE60147.1|  hypothetical protein OsJ_13042                        59.7    1e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002466244.1|  hypothetical protein SORBIDRAFT_01g004250        59.3    1e-08   Sorghum bicolor [broomcorn]
gb|KIV94521.1|  40S ribosomal protein S2                              59.3    1e-08   Exophiala mesophila
ref|NP_001051645.1|  Os03g0807800                                     59.3    1e-08   
dbj|BAJ89869.1|  predicted protein                                    59.3    1e-08   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KIY74311.1|  ribosomal protein S5                                  58.9    1e-08   Cylindrobasidium torrendii FP15055 ss-10
emb|CCA16359.1|  40S ribosomal protein S2 putative                    58.9    1e-08   Albugo laibachii Nc14
ref|NP_181715.1|  40S ribosomal protein S2-3                          59.3    1e-08   Arabidopsis thaliana [mouse-ear cress]
emb|CCI49151.1|  unnamed protein product                              58.9    1e-08   Albugo candida
ref|XP_008718886.1|  40S ribosomal protein S2                         58.9    1e-08   Cyphellophora europaea CBS 101466
gb|KJB35778.1|  hypothetical protein B456_006G128000                  58.9    1e-08   Gossypium raimondii
gb|KHG06565.1|  40S ribosomal S2-2 -like protein                      58.9    1e-08   Gossypium arboreum [tree cotton]
ref|XP_446276.1|  40S ribosomal protein S2                            58.9    1e-08   [Candida] glabrata
ref|XP_003015927.1|  hypothetical protein ARB_06239                   58.9    1e-08   Trichophyton benhamiae CBS 112371
dbj|BAO38726.1|  40S ribosomal protein S2                             58.9    1e-08   Kluyveromyces marxianus DMKU3-1042
ref|XP_741113.1|  ribosomal protein S2                                57.4    1e-08   
ref|XP_003838290.1|  similar to 40S ribosomal protein S2              58.9    2e-08   Leptosphaeria maculans JN3
emb|CDM84780.1|  unnamed protein product                              58.9    2e-08   Triticum aestivum [Canadian hard winter wheat]
gb|EDZ72239.1|  YGL123Wp-like protein                                 57.4    2e-08   Saccharomyces cerevisiae AWRI1631
ref|XP_008644418.1|  PREDICTED: 40S ribosomal protein S2-3-like       58.9    2e-08   Zea mays [maize]
ref|XP_002283793.1|  PREDICTED: 40S ribosomal protein S2-3            58.9    2e-08   Vitis vinifera
emb|CDO95773.1|  unnamed protein product                              58.5    2e-08   Kluyveromyces dobzhanskii CBS 2104
dbj|BAC83243.1|  putative 40S ribosomal protein S2                    58.9    2e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007292650.1|  ribosomal protein S5                             58.9    2e-08   Marssonina brunnea f. sp. 'multigermtubi' MB_m1
ref|XP_001240931.1|  40S ribosomal protein S2                         58.5    2e-08   Coccidioides immitis RS
gb|KIM97433.1|  hypothetical protein OIDMADRAFT_204192                58.5    2e-08   Oidiodendron maius Zn
gb|EUD71344.1|  30S ribosomal protein S2e                             58.9    2e-08   Plasmodium vinckei petteri
ref|XP_727402.1|  ribosomal protein S5                                58.5    2e-08   
ref|XP_008085023.1|  Ribosomal protein S5 2-like protein              58.5    2e-08   Glarea lozoyensis ATCC 20868
ref|XP_675613.1|  ribosomal protein S2                                58.5    2e-08   
gb|EYE94995.1|  ribosomal protein S5                                  58.5    2e-08   Aspergillus ruber CBS 135680
ref|XP_002542854.1|  40S ribosomal protein S2                         58.5    2e-08   Uncinocarpus reesii 1704
gb|ETW58431.1|  40S ribosomal protein S2                              58.2    2e-08   Plasmodium falciparum CAMP/Malaysia
ref|XP_003381255.1|  40S ribosomal protein S2                         60.5    2e-08   Trichinella spiralis
ref|XP_001827253.1|  40S ribosomal protein S2                         58.5    2e-08   Aspergillus oryzae RIB40
gb|ETB56236.1|  40S ribosomal protein S2                              58.5    2e-08   Plasmodium yoelii 17X
gb|KIW30178.1|  40S ribosomal protein S2                              58.5    2e-08   Cladophialophora immunda
gb|KIW61682.1|  40S ribosomal protein S2                              58.5    2e-08   Exophiala xenobiotica
ref|XP_007739256.1|  40S ribosomal protein S2                         58.5    2e-08   Cladophialophora psammophila CBS 110553
ref|XP_007787578.1|  40S ribosomal protein S2                         58.5    2e-08   Endocarpon pusillum Z07020
ref|XP_003345130.1|  40S ribosomal protein S2                         58.5    2e-08   Sordaria macrospora k-hell
ref|XP_008622022.1|  30S ribosomal protein S2e                        58.5    2e-08   Plasmodium vinckei vinckei
gb|KIW17782.1|  40S ribosomal protein S2                              58.2    2e-08   Exophiala spinifera
gb|KIW37164.1|  40S ribosomal protein S2                              58.2    3e-08   Exophiala oligosperma
ref|XP_959810.1|  40S ribosomal protein S2                            58.2    3e-08   Neurospora crassa OR74A
ref|XP_007753563.1|  40S ribosomal protein S2                         58.2    3e-08   Cladophialophora yegresii CBS 114405
gb|ETW39797.1|  40S ribosomal protein S2                              58.5    3e-08   Plasmodium falciparum NF135/5.C10
gb|KHE84595.1|  hypothetical protein GE21DRAFT_10182                  58.2    3e-08   Neurospora crassa
gb|ADV40174.1|  40S ribosomal protein S2/30S                          58.5    3e-08   Latrodectus hesperus [black widow]
ref|XP_718427.1|  likely cytosolic ribosomal protein S2               58.2    3e-08   
ref|XP_007872721.1|  30S ribosomal protein S5                         58.2    3e-08   Pneumocystis murina B123
gb|KDN49652.1|  hypothetical protein RSAG8_01717                      58.5    3e-08   Rhizoctonia solani AG-8 WAC10335
ref|XP_005651594.1|  ribosomal protein S2 component of cytosolic ...  58.2    3e-08   Coccomyxa subellipsoidea C-169
gb|EMD37605.1|  hypothetical protein CERSUDRAFT_114253                58.2    3e-08   Gelatoporia subvermispora B
gb|EHL01894.1|  putative 40S ribosomal protein S2                     59.3    3e-08   Glarea lozoyensis 74030
ref|XP_007282026.1|  40s ribosomal protein s2                         57.8    3e-08   
ref|XP_003852754.1|  40S ribosomal protein S2                         58.2    3e-08   Zymoseptoria tritici IPO323
ref|XP_001536852.1|  40S ribosomal protein S2                         58.2    3e-08   Histoplasma capsulatum NAm1
ref|XP_009040480.1|  hypothetical protein AURANDRAFT_31983            58.2    3e-08   Aureococcus anophagefferens
dbj|GAD96311.1|  40S ribosomal protein S2                             58.2    3e-08   Byssochlamys spectabilis No. 5
gb|KIY44352.1|  ribosomal protein S5                                  58.2    3e-08   Fistulina hepatica ATCC 64428
ref|XP_008030878.1|  hypothetical protein SETTUDRAFT_165887           58.2    3e-08   Exserohilum turcica Et28A
gb|KIM91906.1|  hypothetical protein PILCRDRAFT_809897                58.2    3e-08   Piloderma croceum F 1598
ref|XP_002143231.1|  40S ribosomal protein S2                         58.2    3e-08   Talaromyces marneffei ATCC 18224
ref|XP_007686418.1|  hypothetical protein COCMIDRAFT_35376            58.2    3e-08   Bipolaris oryzae ATCC 44560
ref|XP_003671972.1|  ribosomal protein S2                             57.8    3e-08   Naumovozyma dairenensis CBS 421
gb|KEF51408.1|  40S ribosomal protein S2                              58.2    3e-08   Exophiala aquamarina CBS 119918
ref|XP_002459531.1|  hypothetical protein SORBIDRAFT_02g006200        58.2    3e-08   Sorghum bicolor [broomcorn]
gb|AAF82250.1|AC008051_1  Identical to gene XW6 from Arabidopsis ...  57.4    3e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009547175.1|  hypothetical protein HETIRDRAFT_384925           57.8    3e-08   Heterobasidion irregulare TC 32-1
emb|CCX13683.1|  Similar to 40S ribosomal protein S2; acc. no. P2...  58.2    3e-08   Pyronema omphalodes CBS 100304
gb|KIK67075.1|  hypothetical protein GYMLUDRAFT_257028                57.8    3e-08   Gymnopus luxurians FD-317 M1
gb|KEQ91049.1|  hypothetical protein AUEXF2481DRAFT_70415             58.2    3e-08   Aureobasidium subglaciale EXF-2481
ref|XP_002620842.1|  40S ribosomal protein S2                         57.8    3e-08   Blastomyces gilchristii SLH14081
ref|NP_588435.1|  40S ribosomal protein S2                            57.8    3e-08   Schizosaccharomyces pombe
gb|KDQ27811.1|  hypothetical protein PLEOSDRAFT_1089478               57.8    3e-08   Pleurotus ostreatus PC15
gb|EPZ33474.1|  40S ribosomal protein S2                              57.8    3e-08   Rozella allomycis CSF55
ref|XP_007813951.1|  40S ribosomal protein S2                         57.8    3e-08   Metarhizium acridum CQMa 102
gb|KIK47138.1|  hypothetical protein CY34DRAFT_799679                 57.8    3e-08   Suillus luteus UH-Slu-Lm8-n1
ref|NP_001169209.1|  uncharacterized protein LOC100383062             58.2    3e-08   Zea mays [maize]
gb|KEQ70646.1|  40S ribosomal protein S2                              57.8    3e-08   Aureobasidium namibiae CBS 147.97
gb|EUC60357.1|  40S ribosomal protein S2                              57.8    3e-08   Rhizoctonia solani AG-3 Rhs1AP
gb|KFY07760.1|  hypothetical protein V492_06845                       57.8    3e-08   Pseudogymnoascus sp. VKM F-4246
ref|XP_002954017.1|  component of cytosolic 80S ribosome and 40S ...  58.2    3e-08   Volvox carteri f. nagariensis
gb|KEQ83956.1|  40S ribosomal protein S2                              57.8    3e-08   Aureobasidium pullulans EXF-150
ref|XP_003029996.1|  40S ribosomal protein S2                         57.8    4e-08   Schizophyllum commune H4-8
ref|XP_002568379.1|  Pc21g13620                                       57.8    4e-08   Penicillium rubens Wisconsin 54-1255
ref|XP_008034088.1|  40S ribosomal protein S2                         57.8    4e-08   Trametes versicolor FP-101664 SS1
ref|XP_002470227.1|  40S ribosomal protein S2                         57.8    4e-08   
gb|KIJ49476.1|  hypothetical protein M422DRAFT_27842                  57.8    4e-08   Sphaerobolus stellatus SS14
emb|CCE35217.1|  probable 40S ribosomal protein S5                    57.8    4e-08   Claviceps purpurea 20.1
ref|XP_002052442.1|  GJ21626                                          57.8    4e-08   Drosophila virilis
gb|KJA19966.1|  hypothetical protein HYPSUDRAFT_43874                 57.8    4e-08   Hypholoma sublateritium FD-334 SS-4
gb|KEQ63253.1|  40S ribosomal protein S2                              57.8    4e-08   Aureobasidium melanogenum CBS 110374
gb|KIJ18666.1|  hypothetical protein PAXINDRAFT_167242                57.8    4e-08   Paxillus involutus ATCC 200175
gb|KHN96863.1|  40S ribosomal protein S2                              57.8    4e-08   Metarhizium album ARSEF 1941
gb|EPS31029.1|  hypothetical protein PDE_05983                        57.8    4e-08   Penicillium oxalicum 114-2
gb|EKV11645.1|  hypothetical protein PDIP_55350                       57.8    4e-08   Penicillium digitatum Pd1
ref|XP_001226125.1|  40S ribosomal protein S2                         58.2    4e-08   Chaetomium globosum CBS 148.51
gb|KDR75932.1|  hypothetical protein GALMADRAFT_68985                 57.8    4e-08   Galerina marginata CBS 339.88
gb|KFD57288.1|  hypothetical protein M513_01799                       58.2    4e-08   Trichuris suis
ref|XP_002175572.1|  40S ribosomal protein S2                         57.8    4e-08   Schizosaccharomyces japonicus yFS275
emb|CCF38653.1|  40S ribosomal protein S2                             57.8    4e-08   Colletotrichum higginsianum
gb|KII92074.1|  hypothetical protein PLICRDRAFT_36850                 57.8    4e-08   Plicaturopsis crispa FD-325 SS-3
emb|CEL60671.1|  40S ribosomal protein S2 OS=Ictalurus punctatus ...  57.8    4e-08   Rhizoctonia solani AG-1 IB
ref|XP_007816707.1|  Ribosomal protein S5                             57.8    4e-08   Metarhizium robertsii ARSEF 23
gb|KIK97747.1|  hypothetical protein PAXRUDRAFT_824617                57.8    4e-08   Paxillus rubicundulus Ve08.2h10
emb|CCM05701.1|  predicted protein                                    57.8    4e-08   Fibroporia radiculosa
ref|XP_007317645.1|  hypothetical protein SERLADRAFT_387604           57.8    4e-08   Serpula lacrymans var. lacrymans S7.9
gb|KDB15720.1|  40S ribosomal protein S2                              57.8    4e-08   Ustilaginoidea virens
ref|XP_007381326.1|  ribosomal protein S5                             57.8    4e-08   Punctularia strigosozonata HHB-11173 SS5
gb|KIM40050.1|  hypothetical protein M413DRAFT_19292                  57.8    4e-08   Hebeloma cylindrosporum h7
ref|XP_007767110.1|  40S ribosomal protein S2                         57.8    4e-08   Coniophora puteana RWD-64-598 SS2
emb|CDO74317.1|  hypothetical protein BN946_scf184449.g2              57.8    4e-08   Trametes cinnabarina
gb|ENH82760.1|  ribosomal protein s5                                  57.8    4e-08   
ref|XP_001348622.1|  40S ribosomal protein S2, putative               57.8    4e-08   Plasmodium falciparum 3D7
gb|KIM69732.1|  hypothetical protein SCLCIDRAFT_13115                 57.8    4e-08   Scleroderma citrinum Foug A
gb|EFQ30825.1|  ribosomal protein S5                                  57.8    4e-08   Colletotrichum graminicola M1.001
emb|CDW51820.1|  Ribosomal S5 and Ribosomal S5 C domain containin...  58.2    4e-08   Trichuris trichiura
ref|XP_007864606.1|  ribosomal protein S5                             57.8    4e-08   Gloeophyllum trabeum ATCC 11539
ref|XP_007005358.1|  hypothetical protein TREMEDRAFT_44425            57.8    4e-08   Tremella mesenterica DSM 1558
pdb|4UJF|D  Chain D, Crystal Structure Of Narciclasine Bound To T...  57.8    4e-08   Saccharomyces cerevisiae S288C
ref|XP_002003073.1|  GI24366                                          57.8    4e-08   Drosophila mojavensis
ref|XP_001961962.1|  GF15233                                          57.8    4e-08   Drosophila ananassae
ref|XP_001356343.1|  GA19229                                          57.8    4e-08   Drosophila pseudoobscura pseudoobscura
ref|XP_002036389.1|  GM12203                                          57.8    4e-08   Drosophila sechellia
gb|EKG09795.1|  Ribosomal protein S5                                  57.8    4e-08   Macrophomina phaseolina MS6
gb|KFX88923.1|  hypothetical protein V490_07336                       57.8    4e-08   Pseudogymnoascus sp. VKM F-3557
gb|EJT49535.1|  ribosomal protein S2                                  57.4    4e-08   Trichosporon asahii var. asahii CBS 2479
ref|XP_001969358.1|  GG24001                                          57.8    4e-08   Drosophila erecta
ref|XP_001645417.1|  hypothetical protein Kpol_534p40                 57.8    4e-08   Vanderwaltozyma polyspora DSM 70294
ref|XP_007579654.1|  putative 40s ribosomal protein s2 protein        57.8    4e-08   
gb|EPT04951.1|  hypothetical protein FOMPIDRAFT_1021696               57.8    4e-08   Fomitopsis pinicola FP-58527 SS1
gb|KFY85265.1|  hypothetical protein V500_08564                       57.8    4e-08   Pseudogymnoascus sp. VKM F-4518 (FW-2643)
ref|XP_004981345.1|  PREDICTED: 40S ribosomal protein S2-3-like       57.8    4e-08   Setaria italica
ref|NP_011392.1|  ribosomal 40S subunit protein S2                    57.4    4e-08   Saccharomyces cerevisiae S288C
gb|KFY36879.1|  hypothetical protein V494_04955                       57.8    4e-08   Pseudogymnoascus sp. VKM F-4513 (FW-928)
gb|ELR03529.1|  small subunit ribosomal protein S2e                   57.8    4e-08   Pseudogymnoascus destructans 20631-21
gb|KEZ42406.1|  hypothetical protein SAPIO_CDS5590                    57.4    4e-08   Scedosporium apiospermum
ref|XP_007307915.1|  ribosomal protein S5                             57.8    4e-08   
gb|KIP01786.1|  hypothetical protein PHLGIDRAFT_112739                57.8    4e-08   
ref|XP_002789042.1|  40S ribosomal protein S2                         57.8    4e-08   
gb|EHK19161.1|  hypothetical protein TRIVIDRAFT_83432                 57.8    4e-08   
gb|KIO28079.1|  hypothetical protein M407DRAFT_243164                 57.8    4e-08   
ref|XP_010763914.1|  40S ribosomal protein S2                         57.8    4e-08   
gb|KFY65329.1|  hypothetical protein V496_02655                       57.8    4e-08   
gb|KFY79626.1|  hypothetical protein V499_01381                       57.8    4e-08   
gb|KFY88885.1|  hypothetical protein V498_06618                       57.8    4e-08   
ref|XP_011300908.1|  PREDICTED: 40S ribosomal protein S2-like         56.2    4e-08   
ref|XP_004224063.1|  40S ribosomal protein S2                         57.8    4e-08   
ref|XP_007409407.1|  hypothetical protein MELLADRAFT_71681            57.8    4e-08   
gb|KFY29914.1|  hypothetical protein V493_02210                       57.8    5e-08   
ref|XP_011103424.1|  rps2p                                            57.4    5e-08   
ref|XP_006965798.1|  hypothetical protein TRIREDRAFT_122036           57.4    5e-08   
ref|XP_011150333.1|  PREDICTED: 40S ribosomal protein S2-like         57.8    5e-08   
ref|XP_001937560.1|  40S ribosomal protein S2                         57.4    5e-08   
gb|KHJ46412.1|  ribosomal protein S5                                  59.3    5e-08   
ref|XP_002849583.1|  40S ribosomal protein S2                         57.4    5e-08   
ref|XP_455527.1|  40S ribosomal protein S2                            57.4    5e-08   
ref|XP_001615922.1|  40S ribosomal protein S2                         57.8    5e-08   
gb|EQK97857.1|  Ribosomal protein S5                                  57.4    5e-08   
gb|EQB53465.1|  hypothetical protein CGLO_06806                       57.4    5e-08   
gb|EUT78983.1|  40S ribosomal protein S2                              56.6    5e-08   
ref|XP_009256405.1|  hypothetical protein FPSE_05012                  57.4    5e-08   
ref|XP_001830143.1|  40S ribosomal protein S2                         57.4    5e-08   
ref|XP_002260404.1|  ribosomal protein S2                             57.8    5e-08   
ref|XP_003654145.1|  40S ribosomal protein S2                         57.4    5e-08   
gb|KDQ15292.1|  hypothetical protein BOTBODRAFT_297532                57.4    5e-08   
ref|XP_001217279.1|  40S ribosomal protein S2                         57.4    5e-08   
gb|EJU04406.1|  ribosomal protein S2                                  57.4    5e-08   
gb|KFD72672.1|  hypothetical protein M514_01798                       59.3    5e-08   
gb|EFX01898.1|  ribosomal protein s5                                  57.4    5e-08   
ref|XP_003709842.1|  30S ribosomal protein S5                         57.4    5e-08   
ref|XP_001791351.1|  hypothetical protein SNOG_00672                  57.4    5e-08   
ref|XP_003665392.1|  hypothetical protein MYCTH_2309046               57.4    5e-08   
ref|XP_008593527.1|  40S ribosomal protein S2                         57.4    5e-08   
ref|XP_005708727.1|  40S ribosomal protein S2                         57.4    5e-08   
gb|KDE07650.1|  40S ribosomal protein S2                              57.4    5e-08   
emb|CCA69698.1|  probable 40S ribosomal protein S2                    57.4    5e-08   
ref|XP_625422.1|  40S ribosomal protein S2/S5.  DSRBD RNA binding...  57.8    5e-08   
ref|XP_007920333.1|  hypothetical protein MYCFIDRAFT_71772            57.4    5e-08   
ref|XP_001689670.1|  ribosomal protein S2, component of cytosolic...  57.4    5e-08   
gb|AFR95890.1|  small subunit ribosomal protein S2                    57.4    5e-08   
ref|XP_007601802.1|  40S ribosomal protein S2                         57.4    5e-08   
ref|XP_003170268.1|  40S ribosomal protein S2                         57.4    5e-08   
ref|XP_006686832.1|  ribosomal protein S5                             57.4    5e-08   
ref|XP_007912879.1|  putative 40s ribosomal protein s2 protein        57.4    5e-08   
ref|XP_003049657.1|  40S ribosomal protein S2                         57.4    5e-08   
ref|XP_310307.5|  AGAP003768-PA                                       57.4    6e-08   
gb|AAM67061.1|  ribosomal protein S2, putative                        57.8    6e-08   
ref|XP_001905361.1|  hypothetical protein                             57.4    6e-08   
ref|XP_006650764.1|  PREDICTED: 40S ribosomal protein S2-4-like       57.4    6e-08   
gb|KGO69837.1|  Ribosomal protein S5, C-terminal                      57.8    6e-08   
gb|AGN29613.1|  40S ribosomal protein S2                              57.8    6e-08   
gb|ETW33816.1|  40S ribosomal protein S2                              57.0    6e-08   
gb|EGU88252.1|  hypothetical protein FOXB_01215                       57.4    6e-08   
emb|CAC24569.1|  ribosomal protein S2                                 57.4    6e-08   
gb|KFH46481.1|  40S ribosomal protein S2-like protein                 57.4    6e-08   
ref|XP_571691.1|  ribosomal protein S2                                57.4    6e-08   
ref|XP_003328905.1|  40S ribosomal protein S2                         57.4    6e-08   
ref|NP_176134.1|  40S ribosomal protein S2-1                          57.4    6e-08   
ref|NP_564737.1|  40S ribosomal protein S2-2                          57.4    6e-08   
gb|AAV84248.1|  ribosomal protein 2B                                  57.0    6e-08   
ref|XP_003676269.1|  hypothetical protein NCAS_0D03270                57.0    6e-08   
ref|XP_001846895.1|  ribosomal protein S2                             55.8    6e-08   
dbj|BAA88264.1|  RF12                                                 57.4    6e-08   
gb|KFB37115.1|  ribosomal protein S2                                  57.4    6e-08   
gb|AAM53281.1|  ribosomal protein S2, putative                        57.4    6e-08   
ref|XP_001988687.1|  GH10440                                          57.4    6e-08   
ref|XP_006670729.1|  ribosomal protein S5                             57.4    6e-08   
gb|KIL85620.1|  40s ribosomal protein s2                              57.0    6e-08   
ref|XP_007396572.1|  hypothetical protein PHACADRAFT_257335           57.0    6e-08   
emb|CAA48872.1|  ribosoaml protein S2                                 57.4    6e-08   
gb|AEM36341.1|  At1g58380                                             57.4    6e-08   
ref|XP_007678377.1|  hypothetical protein BAUCODRAFT_552344           57.0    6e-08   
dbj|GAM89442.1|  hypothetical protein ANO11243_074800                 57.0    7e-08   
emb|CDR38966.1|  CYFA0S02e09648g1_1                                   57.0    7e-08   
emb|CAH04312.1|  S2e ribosomal protein                                56.6    7e-08   
ref|XP_011127816.1|  hypothetical protein AOL_s00215g312              57.0    7e-08   
ref|NP_476874.1|  ribosomal protein S2, isoform A                     57.0    7e-08   
ref|XP_002088984.1|  sop                                              57.0    7e-08   
ref|XP_003194671.1|  ribosomal protein S2                             57.0    7e-08   
ref|XP_003955031.1|  hypothetical protein KAFR_0A04610                57.0    7e-08   
gb|EMF16964.1|  40S ribosomal protein S2                              57.0    7e-08   
ref|XP_005712601.1|  unnamed protein product                          57.0    7e-08   
gb|ACL38000.1|  40S ribosomal protein S2                              56.6    7e-08   
ref|XP_003684368.1|  40S ribosomal protein S2                         57.0    8e-08   
ref|XP_006695156.1|  40S ribosomal protein S2-like protein            57.0    8e-08   
ref|XP_009226592.1|  30S ribosomal protein S5                         57.0    8e-08   
gb|KGB76121.1|  40S ribosomal protein S2                              57.0    8e-08   
gb|EPE04678.1|  40s ribosomal protein s2                              57.0    8e-08   
ref|XP_002837474.1|  40S ribosomal protein S2                         57.0    8e-08   
gb|EHK39979.1|  hypothetical protein TRIATDRAFT_259826                57.0    8e-08   
gb|EMS18060.1|  40S ribosomal protein s2                              56.6    8e-08   
gb|EME48500.1|  hypothetical protein DOTSEDRAFT_67515                 57.0    8e-08   
ref|XP_005183227.1|  PREDICTED: 40S ribosomal protein S2              57.0    8e-08   
gb|KIN96196.1|  hypothetical protein M404DRAFT_1006942                57.0    8e-08   
gb|KIK27657.1|  hypothetical protein PISMIDRAFT_674553                57.0    8e-08   
gb|KIL68987.1|  hypothetical protein M378DRAFT_158139                 57.0    8e-08   
gb|EGU13642.1|  40S ribosomal protein S2                              57.0    8e-08   
ref|XP_001877707.1|  40S ribosomal protein S2                         57.0    8e-08   
ref|XP_005838889.1|  small subunit ribosomal protein S2e, cytopla...  57.0    8e-08   
gb|ERS99600.1|  40S ribosomal protein S2                              57.0    8e-08   
ref|XP_003682918.1|  40S ribosomal protein S2                         57.0    8e-08   
gb|EPX73611.1|  40S ribosomal protein S2                              56.6    8e-08   
ref|XP_007339472.1|  ribosomal protein S2                             57.0    8e-08   
gb|EPY51253.1|  40S ribosomal protein S2                              56.6    8e-08   
gb|EPQ14408.1|  40S ribosomal protein S2                              56.6    9e-08   
gb|AEG78365.1|  40S ribosomal protein S2                              57.0    9e-08   
ref|XP_006461054.1|  hypothetical protein AGABI2DRAFT_192591          56.6    9e-08   
ref|XP_503943.1|  40S ribosomal protein S2                            56.6    9e-08   
ref|XP_007241314.1|  PREDICTED: 40S ribosomal protein S2              57.0    9e-08   
ref|XP_004558416.1|  PREDICTED: 40S ribosomal protein S2-like         57.0    9e-08   
ref|XP_003452876.1|  PREDICTED: 40S ribosomal protein S2-like         57.0    9e-08   
emb|CEJ88812.1|  Putative 40S ribosomal protein S2                    56.6    9e-08   
gb|EFX77948.1|  hypothetical protein DAPPUDRAFT_92887                 57.0    9e-08   
ref|XP_001395223.1|  40S ribosomal protein S2                         56.6    9e-08   
ref|XP_010872719.1|  PREDICTED: 40S ribosomal protein S2              57.0    9e-08   
ref|XP_009045432.1|  hypothetical protein LOTGIDRAFT_212139           57.0    9e-08   
ref|XP_001272401.1|  40S ribosomal protein S2                         56.6    9e-08   
gb|KDQ53529.1|  hypothetical protein JAAARDRAFT_39218                 56.6    1e-07   
ref|NP_001133384.1|  40S ribosomal protein S2                         57.0    1e-07   
ref|XP_002135890.1|  GA22532                                          55.8    1e-07   
ref|XP_002490727.1|  40S ribosomal protein S2                         56.6    1e-07   
gb|KIJ67834.1|  hypothetical protein HYDPIDRAFT_107350                56.6    1e-07   
ref|XP_002028254.1|  GL13216                                          55.8    1e-07   
ref|XP_008814158.1|  40S ribosomal protein                            56.6    1e-07   
gb|AEE62425.1|  unknown                                               57.0    1e-07   
ref|XP_003382782.1|  PREDICTED: 40S ribosomal protein S2              56.6    1e-07   
gb|ELU38217.1|  40S ribosomal protein S2                              56.6    1e-07   
gb|AAP20146.1|  40S ribosomal protein S2                              55.8    1e-07   
ref|XP_001262782.1|  40S ribosomal protein S2                         56.6    1e-07   
gb|AAV90723.1|  ribosomal protein S2                                  56.6    1e-07   
gb|KHJ82238.1|  putative ribosomal protein S5                         55.1    1e-07   
ref|XP_975415.1|  PREDICTED: 40S ribosomal protein S2                 56.6    1e-07   
ref|XP_007799321.1|  putative 40s ribosomal protein s2 protein        58.2    1e-07   
ref|XP_001654298.1|  AAEL010168-PA                                    56.6    1e-07   
ref|XP_001486350.1|  hypothetical protein PGUG_02021                  56.2    1e-07   
ref|XP_746786.1|  ribosomal protein S5                                56.6    1e-07   
ref|XP_005081786.1|  PREDICTED: 40S ribosomal protein S2              55.1    1e-07   
gb|EWC85535.1|  40S ribosomal protein S2                              56.6    1e-07   
ref|XP_001731371.1|  hypothetical protein MGL_1554                    56.2    1e-07   
gb|AAM62944.1|  40S ribosomal protein S2                              56.6    1e-07   
ref|XP_456741.1|  40S ribosomal protein S2                            56.2    1e-07   
ref|XP_010666758.1|  PREDICTED: 40S ribosomal protein S2-2            56.6    1e-07   
gb|KGG49920.1|  40S ribosomal protein S2                              56.2    1e-07   
ref|XP_005855175.1|  small subunit ribosomal protein S2e              56.6    1e-07   
ref|XP_007266712.1|  40S ribosomal protein S2                         56.2    1e-07   
gb|ACD65094.1|  putative 40S ribosomal protein RPS2                   55.8    1e-07   
gb|KIY95239.1|  40S ribosomal protein S2-4                            56.6    1e-07   
ref|XP_003868171.1|  Rps21 predicted ribosomal protein                56.2    1e-07   
gb|ESZ94046.1|  ribosomal protein S5                                  56.2    1e-07   
ref|XP_004181316.1|  hypothetical protein TBLA_0F02580                56.2    1e-07   
ref|XP_002141661.1|  40S ribosomal protein S2                         56.2    1e-07   
gb|ETN76033.1|  ribosomal protein S5                                  55.8    1e-07   
ref|NP_982720.1|  40S ribosomal protein S2                            56.2    1e-07   
ref|XP_001526591.1|  40S ribosomal protein S2                         56.2    1e-07   
gb|ADX97205.1|  40S ribosomal protein s2                              55.8    1e-07   
ref|XP_004364327.1|  ribosomal protein S2                             56.6    1e-07   
ref|XP_001859017.1|  40S ribosomal protein S2                         56.6    1e-07   
gb|AGO10170.1|  AaceriAAR177Wp                                        56.2    1e-07   
gb|EWM24580.1|  40s ribosomal protein s2                              57.0    1e-07   
ref|XP_001555535.1|  40S ribosomal protein S2                         56.2    1e-07   
gb|KFA62097.1|  hypothetical protein S40285_06777                     57.8    1e-07   
emb|CCK70913.1|  hypothetical protein KNAG_0F02480                    56.2    1e-07   
ref|WP_034359011.1|  hypothetical protein                             55.5    1e-07   
gb|KIZ04838.1|  40S ribosomal protein S2-4                            56.2    2e-07   
ref|XP_007858282.1|  40s ribosomal protein s2                         56.2    2e-07   
gb|EFX67704.1|  hypothetical protein DAPPUDRAFT_93655                 56.2    2e-07   
ref|XP_003002770.1|  40S ribosomal protein S2                         56.2    2e-07   
ref|XP_002502265.1|  predicted protein                                56.2    2e-07   
ref|NP_001155755.1|  40S ribosomal protein S2-like                    56.2    2e-07   
ref|XP_011271164.1|  40S ribosomal protein                            55.8    2e-07   
ref|XP_011313606.1|  PREDICTED: 40S ribosomal protein S2-like         56.2    2e-07   
gb|AAV69396.1|  40S ribosomal protein S2                              56.2    2e-07   
ref|XP_010783756.1|  PREDICTED: 40S ribosomal protein S2              56.2    2e-07   
ref|XP_011108170.1|  hypothetical protein H072_2182                   55.8    2e-07   
emb|CEG70504.1|  Putative 40S ribosomal protein S2                    55.8    2e-07   
ref|XP_011297221.1|  PREDICTED: 40S ribosomal protein S2              56.2    2e-07   
dbj|BAN21161.1|  ribosomal protein S2                                 56.2    2e-07   
emb|CDF88548.1|  BN860_12816g1_1                                      55.8    2e-07   
ref|XP_008328146.1|  PREDICTED: 40S ribosomal protein S2              56.2    2e-07   
ref|XP_007878876.1|  hypothetical protein PFL1_03169                  55.8    2e-07   
gb|AAC04623.1|  ribosomal protein S2                                  54.3    2e-07   
gb|KGQ11975.1|  40S ribosomal protein S2                              57.4    2e-07   
ref|XP_011476529.1|  PREDICTED: 40S ribosomal protein S2              56.2    2e-07   
ref|XP_005054059.1|  PREDICTED: 40S ribosomal protein S2 isoform X1   56.2    2e-07   
gb|EHN02461.1|  Rps2p                                                 55.8    2e-07   
gb|EYB21215.1|  hypothetical protein FG05_01509                       55.1    2e-07   
ref|XP_010728996.1|  PREDICTED: 40S ribosomal protein S2              55.8    2e-07   
ref|XP_007833597.1|  40S ribosomal protein S2                         55.8    2e-07   
ref|NP_998444.1|  40S ribosomal protein S2                            55.8    2e-07   
gb|ABJ98604.1|  40S ribosomal protein S2                              54.3    2e-07   
ref|XP_009893229.1|  PREDICTED: 40S ribosomal protein S2              55.8    2e-07   
ref|XP_008473023.1|  PREDICTED: 40S ribosomal protein S2              55.8    2e-07   
ref|XP_004201953.1|  Piso0_001423                                     55.5    2e-07   
ref|XP_008557531.1|  PREDICTED: 40S ribosomal protein S2              55.8    2e-07   
gb|EDL40345.1|  mCG14260, isoform CRA_a                               54.3    2e-07   
ref|XP_005360777.1|  PREDICTED: 40S ribosomal protein S2-like         54.7    2e-07   
dbj|BAF45464.1|  ribosomal protein S2                                 55.8    2e-07   
emb|CEG70505.1|  Putative 40S ribosomal protein S2                    55.5    2e-07   
gb|AHA44495.1|  40S ribosomal-like protein                            55.8    2e-07   
gb|ENN71910.1|  hypothetical protein YQE_11447                        55.8    2e-07   
gb|ACD65135.1|  putative 40S ribosomal protein RPS2                   55.8    2e-07   
gb|AAM94271.1|  ribosomal protein S2                                  55.5    2e-07   
ref|XP_004527395.1|  PREDICTED: 40S ribosomal protein S2-like         55.8    2e-07   
gb|KDN48508.1|  ribosomal protein S5                                  55.8    2e-07   
ref|XP_004202581.1|  Piso0_001423                                     55.5    2e-07   
ref|XP_004821216.1|  PREDICTED: 40S ribosomal protein S2              54.3    2e-07   
gb|EYC14876.1|  hypothetical protein Y032_0039g58                     56.6    2e-07   
gb|AAX62450.1|  ribosomal protein S2                                  55.8    2e-07   
gb|KIH53427.1|  ribosomal protein S5                                  55.8    2e-07   
gb|EDL10716.1|  mCG15018, isoform CRA_a                               53.9    3e-07   
gb|EDM03866.1|  rCG34378, isoform CRA_c                               54.3    3e-07   
gb|KIW03866.1|  40S ribosomal protein S2                              55.5    3e-07   
emb|CEI97132.1|  Putative 40S ribosomal protein S2                    55.5    3e-07   
emb|CEG66298.1|  Putative 40S ribosomal protein S2                    55.5    3e-07   
ref|XP_003964600.1|  PREDICTED: 40S ribosomal protein S2-like         55.8    3e-07   
gb|EGW09505.1|  40S ribosomal protein S2                              53.5    3e-07   
gb|ACT46568.1|  ribosomal protein S2                                  53.5    3e-07   



>gb|KEH40624.1| 40S ribosomal protein S2-4 [Medicago truncatula]
Length=277

 Score = 69.3 bits (168),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI
Sbjct  43   EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  75



>gb|KEH21389.1| 40S ribosomal protein S2-4 [Medicago truncatula]
Length=270

 Score = 68.9 bits (167),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI
Sbjct  36   EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  68



>gb|AFK38691.1| unknown [Medicago truncatula]
Length=279

 Score = 68.9 bits (167),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI
Sbjct  45   EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  77



>ref|XP_003630949.1| 40S ribosomal protein S2 [Medicago truncatula]
 gb|AET05425.1| 40S ribosomal protein S2-4 [Medicago truncatula]
Length=279

 Score = 68.9 bits (167),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI
Sbjct  45   EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  77



>ref|XP_003525227.1| PREDICTED: 40S ribosomal protein S2-4-like [Glycine max]
 gb|KHN21611.1| 40S ribosomal protein S2-4 [Glycine soja]
Length=272

 Score = 68.9 bits (167),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI
Sbjct  38   EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  70



>gb|KDP22104.1| hypothetical protein JCGZ_25935 [Jatropha curcas]
Length=270

 Score = 68.9 bits (167),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI
Sbjct  37   EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  69



>ref|XP_008361610.1| PREDICTED: 40S ribosomal protein S2-4-like [Malus domestica]
 ref|XP_008368125.1| PREDICTED: 40S ribosomal protein S2-4-like [Malus domestica]
Length=275

 Score = 68.9 bits (167),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI
Sbjct  40   EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  72



>gb|KDP22105.1| hypothetical protein JCGZ_25936 [Jatropha curcas]
Length=270

 Score = 68.9 bits (167),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI
Sbjct  37   EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  69



>emb|CDP18531.1| unnamed protein product [Coffea canephora]
Length=260

 Score = 68.9 bits (167),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/34 (94%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +2

Query  131  TEEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            TEEEKWVPVTKLGRLVK+G+IRSLEQIYLHSLPI
Sbjct  21   TEEEKWVPVTKLGRLVKDGQIRSLEQIYLHSLPI  54



>ref|XP_009369694.1| PREDICTED: 40S ribosomal protein S2-4-like [Pyrus x bretschneideri]
 ref|XP_009374934.1| PREDICTED: 40S ribosomal protein S2-4-like [Pyrus x bretschneideri]
Length=275

 Score = 68.9 bits (167),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI
Sbjct  40   EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  72



>ref|XP_008385732.1| PREDICTED: 40S ribosomal protein S2-4-like [Malus domestica]
Length=275

 Score = 68.9 bits (167),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI
Sbjct  40   EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  72



>ref|XP_002513481.1| 40S ribosomal protein S2, putative [Ricinus communis]
 gb|EEF48884.1| 40S ribosomal protein S2, putative [Ricinus communis]
Length=273

 Score = 68.9 bits (167),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI
Sbjct  37   EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  69



>ref|XP_009366094.1| PREDICTED: 40S ribosomal protein S2-4-like [Pyrus x bretschneideri]
Length=275

 Score = 68.9 bits (167),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI
Sbjct  40   EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  72



>ref|XP_002513493.1| 40S ribosomal protein S2, putative [Ricinus communis]
 gb|EEF48896.1| 40S ribosomal protein S2, putative [Ricinus communis]
Length=270

 Score = 68.6 bits (166),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI
Sbjct  37   EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  69



>ref|XP_007160431.1| hypothetical protein PHAVU_002G321400g [Phaseolus vulgaris]
 gb|ESW32425.1| hypothetical protein PHAVU_002G321400g [Phaseolus vulgaris]
Length=272

 Score = 68.2 bits (165),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EEEKWVPVTKLGRLVK+GKIRSLEQIYLHSLPI
Sbjct  38   EEEKWVPVTKLGRLVKDGKIRSLEQIYLHSLPI  70



>ref|XP_007153237.1| hypothetical protein PHAVU_003G018300g [Phaseolus vulgaris]
 gb|ESW25231.1| hypothetical protein PHAVU_003G018300g [Phaseolus vulgaris]
Length=271

 Score = 68.2 bits (165),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EEEKWVPVTKLGRLVKEG+IRSLEQIYLHSLPI
Sbjct  37   EEEKWVPVTKLGRLVKEGRIRSLEQIYLHSLPI  69



>ref|XP_003538262.1| PREDICTED: 40S ribosomal protein S2-4-like [Glycine max]
Length=275

 Score = 68.2 bits (165),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EEEKWVPVTKLGRLVKEG+IRSLEQIYLHSLPI
Sbjct  41   EEEKWVPVTKLGRLVKEGRIRSLEQIYLHSLPI  73



>ref|XP_003538244.1| PREDICTED: 40S ribosomal protein S2-4-like [Glycine max]
Length=275

 Score = 68.2 bits (165),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EEEKWVPVTKLGRLVKEG+IRSLEQIYLHSLPI
Sbjct  41   EEEKWVPVTKLGRLVKEGRIRSLEQIYLHSLPI  73



>gb|KDO53682.1| hypothetical protein CISIN_1g024105mg [Citrus sinensis]
Length=272

 Score = 67.8 bits (164),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EEEKWVPVTKLGRLV+EGKIRSLEQIYLHSLPI
Sbjct  37   EEEKWVPVTKLGRLVREGKIRSLEQIYLHSLPI  69



>ref|XP_006421416.1| hypothetical protein CICLE_v10005613mg [Citrus clementina]
 gb|ESR34656.1| hypothetical protein CICLE_v10005613mg [Citrus clementina]
Length=272

 Score = 67.8 bits (164),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EEEKWVPVTKLGRLV+EGKIRSLEQIYLHSLPI
Sbjct  37   EEEKWVPVTKLGRLVREGKIRSLEQIYLHSLPI  69



>ref|XP_007211807.1| hypothetical protein PRUPE_ppa009890mg [Prunus persica]
 ref|XP_007213828.1| hypothetical protein PRUPE_ppa009892mg [Prunus persica]
 gb|EMJ13006.1| hypothetical protein PRUPE_ppa009890mg [Prunus persica]
 gb|EMJ15027.1| hypothetical protein PRUPE_ppa009892mg [Prunus persica]
Length=273

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EEEKWVPVTKLGRLVKEGKI+SLEQIYLHSLPI
Sbjct  38   EEEKWVPVTKLGRLVKEGKIKSLEQIYLHSLPI  70



>gb|KHN16531.1| 40S ribosomal protein S2-4 [Glycine soja]
Length=223

 Score = 67.0 bits (162),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EEE+WVPVTKLGRLVKEGKIRSLEQIYLHSLPI
Sbjct  34   EEEEWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  66



>ref|XP_010555023.1| PREDICTED: 40S ribosomal protein S2-4-like [Tarenaya hassleriana]
Length=275

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EEEKWVPVTKLGRLV+EGKIRS+EQIYLHSLPI
Sbjct  39   EEEKWVPVTKLGRLVREGKIRSIEQIYLHSLPI  71



>ref|XP_008460763.1| PREDICTED: 40S ribosomal protein S2-4-like [Cucumis melo]
Length=271

 Score = 67.0 bits (162),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EEEKWVPVTKLGRLVKEGKI+SLEQIYLHSLPI
Sbjct  36   EEEKWVPVTKLGRLVKEGKIQSLEQIYLHSLPI  68



>ref|XP_010536089.1| PREDICTED: 40S ribosomal protein S2-3-like [Tarenaya hassleriana]
Length=275

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EEEKWVPVTKLGRLV+EGKIRS+EQIYLHSLPI
Sbjct  39   EEEKWVPVTKLGRLVREGKIRSIEQIYLHSLPI  71



>ref|XP_004149390.1| PREDICTED: 40S ribosomal protein S2-4-like [Cucumis sativus]
Length=271

 Score = 67.0 bits (162),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EEEKWVPVTKLGRLVKEGKI+SLEQIYLHSLPI
Sbjct  36   EEEKWVPVTKLGRLVKEGKIQSLEQIYLHSLPI  68



>ref|XP_010519760.1| PREDICTED: 40S ribosomal protein S2-3-like [Tarenaya hassleriana]
Length=275

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EEEKWVPVTKLGRLV+EGKIRS+EQIYLHSLPI
Sbjct  39   EEEKWVPVTKLGRLVREGKIRSIEQIYLHSLPI  71



>ref|XP_004168599.1| PREDICTED: 40S ribosomal protein S2-3-like [Cucumis sativus]
 gb|KGN59397.1| hypothetical protein Csa_3G816100 [Cucumis sativus]
Length=269

 Score = 67.0 bits (162),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EEEKWVPVTKLGRLVKEGKI+SLEQIYLHSLPI
Sbjct  34   EEEKWVPVTKLGRLVKEGKIQSLEQIYLHSLPI  66



>ref|XP_004162177.1| PREDICTED: 40S ribosomal protein S2-4-like [Cucumis sativus]
 gb|KGN53852.1| hypothetical protein Csa_4G166960 [Cucumis sativus]
Length=271

 Score = 67.0 bits (162),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EEEKWVPVTKLGRLVKEGKI+SLEQIYLHSLPI
Sbjct  36   EEEKWVPVTKLGRLVKEGKIQSLEQIYLHSLPI  68



>ref|XP_004503350.1| PREDICTED: 40S ribosomal protein S2-3-like [Cicer arietinum]
Length=276

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EEEKWVPVTKLGRLVKEGKIRSLE IYLHSLPI
Sbjct  42   EEEKWVPVTKLGRLVKEGKIRSLEHIYLHSLPI  74



>ref|XP_008231962.1| PREDICTED: 40S ribosomal protein S2-like [Prunus mume]
Length=327

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EEEKWVPVTKLGRLVKEGKI+SLEQIYLHSLPI
Sbjct  92   EEEKWVPVTKLGRLVKEGKIKSLEQIYLHSLPI  124



>ref|XP_011069984.1| PREDICTED: 40S ribosomal protein S2-4-like [Sesamum indicum]
Length=249

 Score = 66.6 bits (161),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/34 (88%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +2

Query  131  TEEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            TEEEKWVPVTKLGRLV++GKI+S+EQIYLHSLPI
Sbjct  15   TEEEKWVPVTKLGRLVRDGKIKSVEQIYLHSLPI  48



>ref|XP_010057233.1| PREDICTED: 40S ribosomal protein S2-4 [Eucalyptus grandis]
 gb|KCW90197.1| hypothetical protein EUGRSUZ_A02370 [Eucalyptus grandis]
Length=271

 Score = 66.6 bits (161),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EEEKWVPVTKLGRLVKEGKI SLEQIYLHSLPI
Sbjct  36   EEEKWVPVTKLGRLVKEGKIHSLEQIYLHSLPI  68



>ref|XP_010057240.1| PREDICTED: 40S ribosomal protein S2-4-like [Eucalyptus grandis]
 gb|KCW90198.1| hypothetical protein EUGRSUZ_A02371 [Eucalyptus grandis]
Length=272

 Score = 66.6 bits (161),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EEEKWVPVTKLGRLVKEGKI SLEQIYLHSLPI
Sbjct  37   EEEKWVPVTKLGRLVKEGKIHSLEQIYLHSLPI  69



>ref|XP_011079131.1| PREDICTED: 40S ribosomal protein S2-4-like [Sesamum indicum]
Length=272

 Score = 66.6 bits (161),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/34 (88%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +2

Query  131  TEEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            TEEEKWVPVTKLGRLV++GKI+S+EQIYLHSLPI
Sbjct  38   TEEEKWVPVTKLGRLVRDGKIKSVEQIYLHSLPI  71



>ref|XP_004136761.1| PREDICTED: 40S ribosomal protein S2-3-like [Cucumis sativus]
Length=294

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EEEKWVPVTKLGRLVKEGKI+SLEQIYLHSLPI
Sbjct  59   EEEKWVPVTKLGRLVKEGKIQSLEQIYLHSLPI  91



>ref|XP_002298397.2| hypothetical protein POPTR_0001s26400g [Populus trichocarpa]
 gb|EEE83202.2| hypothetical protein POPTR_0001s26400g [Populus trichocarpa]
Length=339

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EEEKWVPVTKLGRLV++GKIRSLEQIYLHSLPI
Sbjct  105  EEEKWVPVTKLGRLVRDGKIRSLEQIYLHSLPI  137



>gb|EPS60317.1| hypothetical protein M569_14488, partial [Genlisea aurea]
Length=256

 Score = 66.2 bits (160),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EEEKWVPVTKLGRLVK+GKI+SLEQIYLHSLPI
Sbjct  23   EEEKWVPVTKLGRLVKDGKIKSLEQIYLHSLPI  55



>ref|XP_006838579.1| hypothetical protein AMTR_s00002p00212950 [Amborella trichopoda]
 gb|ERN01148.1| hypothetical protein AMTR_s00002p00212950 [Amborella trichopoda]
Length=278

 Score = 66.2 bits (160),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 29/33 (88%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EE+KW+PVTKLGRLVK+GKIRSLEQIYLHSLP+
Sbjct  43   EEDKWIPVTKLGRLVKDGKIRSLEQIYLHSLPV  75



>ref|XP_008443195.1| PREDICTED: 40S ribosomal protein S2-3-like [Cucumis melo]
 gb|ADN33986.1| 40S ribosomal protein s2 [Cucumis melo subsp. melo]
Length=269

 Score = 66.2 bits (160),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EEEKWVPVTKLGRLVKEG+I+SLEQIYLHSLPI
Sbjct  34   EEEKWVPVTKLGRLVKEGRIQSLEQIYLHSLPI  66



>ref|XP_009403825.1| PREDICTED: 40S ribosomal protein S2-4-like [Musa acuminata subsp. 
malaccensis]
Length=275

 Score = 66.2 bits (160),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EEEKWVPVTKLGRLVKEGKI SLEQIYLHSLP+
Sbjct  41   EEEKWVPVTKLGRLVKEGKITSLEQIYLHSLPV  73



>ref|XP_009407563.1| PREDICTED: 40S ribosomal protein S2-2-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009407569.1| PREDICTED: 40S ribosomal protein S2-2-like [Musa acuminata subsp. 
malaccensis]
Length=275

 Score = 66.2 bits (160),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EEEKWVPVTKLGRLVKEGKI SLEQIYLHSLP+
Sbjct  44   EEEKWVPVTKLGRLVKEGKITSLEQIYLHSLPV  76



>ref|XP_010937193.1| PREDICTED: 40S ribosomal protein S2-3-like [Elaeis guineensis]
Length=273

 Score = 65.9 bits (159),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EEEKWVPVTKLGRLVKEGKI SLEQIYLHSLP+
Sbjct  39   EEEKWVPVTKLGRLVKEGKIHSLEQIYLHSLPV  71



>ref|XP_009386449.1| PREDICTED: 40S ribosomal protein S2-2-like [Musa acuminata subsp. 
malaccensis]
Length=273

 Score = 65.9 bits (159),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EEEKWVPVTKLGRLVKEGKI SLEQIYLHSLP+
Sbjct  40   EEEKWVPVTKLGRLVKEGKITSLEQIYLHSLPV  72



>ref|XP_010923421.1| PREDICTED: 40S ribosomal protein S2-3-like [Elaeis guineensis]
Length=275

 Score = 65.9 bits (159),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EEEKWVPVTKLGRLVKEGKI SLEQIYLHSLP+
Sbjct  41   EEEKWVPVTKLGRLVKEGKIHSLEQIYLHSLPV  73



>ref|XP_004302961.1| PREDICTED: 40S ribosomal protein S2-1-like [Fragaria vesca subsp. 
vesca]
Length=276

 Score = 65.9 bits (159),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/34 (91%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +2

Query  131  TEEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
             EEEKWVPVTKLGRLVK+GKI SLEQIYLHSLPI
Sbjct  42   NEEEKWVPVTKLGRLVKDGKISSLEQIYLHSLPI  75



>ref|XP_010906118.1| PREDICTED: 40S ribosomal protein S2-2-like [Elaeis guineensis]
Length=274

 Score = 65.9 bits (159),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EEEKWVPVTKLGRLVKEG+I+SLEQIYLHSLP+
Sbjct  40   EEEKWVPVTKLGRLVKEGRIQSLEQIYLHSLPV  72



>ref|XP_002963234.1| hypothetical protein SELMODRAFT_67484, partial [Selaginella moellendorffii]
 gb|EFJ35105.1| hypothetical protein SELMODRAFT_67484, partial [Selaginella moellendorffii]
Length=263

 Score = 65.1 bits (157),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EEEKWVPVTKLGRLVK+GKIRSLEQIYL SLPI
Sbjct  45   EEEKWVPVTKLGRLVKDGKIRSLEQIYLFSLPI  77



>ref|XP_002878157.1| 40S ribosomal protein S2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54416.1| 40S ribosomal protein S2 [Arabidopsis lyrata subsp. lyrata]
Length=272

 Score = 65.1 bits (157),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EEEKWVPVTKLGRLVKEGKI+ LEQIYLHSLP+
Sbjct  37   EEEKWVPVTKLGRLVKEGKIKQLEQIYLHSLPV  69



>ref|XP_002974537.1| hypothetical protein SELMODRAFT_149893 [Selaginella moellendorffii]
 gb|EFJ24057.1| hypothetical protein SELMODRAFT_149893 [Selaginella moellendorffii]
Length=279

 Score = 65.1 bits (157),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EEEKWVPVTKLGRLVK+GKIRSLEQIYL SLPI
Sbjct  45   EEEKWVPVTKLGRLVKDGKIRSLEQIYLFSLPI  77



>ref|XP_011048036.1| PREDICTED: 40S ribosomal protein S2-3 [Populus euphratica]
Length=256

 Score = 64.7 bits (156),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EEEKWVPVTKLGRLVK+GKI S+EQIYLHSLPI
Sbjct  38   EEEKWVPVTKLGRLVKDGKISSVEQIYLHSLPI  70



>ref|XP_006411454.1| hypothetical protein EUTSA_v10017049mg [Eutrema salsugineum]
 gb|ESQ52907.1| hypothetical protein EUTSA_v10017049mg [Eutrema salsugineum]
Length=281

 Score = 64.7 bits (156),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/34 (88%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +2

Query  131  TEEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
             EEEKWVPVTKLGRLVKEGKI+ LEQIYLHSLP+
Sbjct  45   AEEEKWVPVTKLGRLVKEGKIQKLEQIYLHSLPV  78



>gb|KHG13084.1| 40S ribosomal S2-2 -like protein [Gossypium arboreum]
 gb|KJB39931.1| hypothetical protein B456_007G038900 [Gossypium raimondii]
Length=269

 Score = 64.7 bits (156),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EEEKWVPVTKLGRLVK GKI SLEQIYLHSLPI
Sbjct  35   EEEKWVPVTKLGRLVKSGKITSLEQIYLHSLPI  67



>ref|XP_002308954.1| 40S ribosomal protein S2 [Populus trichocarpa]
 gb|ABK94437.1| unknown [Populus trichocarpa]
 gb|EEE92477.1| 40S ribosomal protein S2 [Populus trichocarpa]
Length=270

 Score = 64.7 bits (156),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EEEKWVPVTKLGRLVK+GKI S+EQIYLHSLPI
Sbjct  38   EEEKWVPVTKLGRLVKDGKISSVEQIYLHSLPI  70



>gb|KJB08358.1| hypothetical protein B456_001G078600 [Gossypium raimondii]
Length=269

 Score = 64.7 bits (156),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EEEKWVPVTKLGRLVK GKI SLEQIYLHSLPI
Sbjct  35   EEEKWVPVTKLGRLVKSGKITSLEQIYLHSLPI  67



>gb|KHG28265.1| 40S ribosomal S2-2 -like protein [Gossypium arboreum]
 gb|KJB19381.1| hypothetical protein B456_003G099200 [Gossypium raimondii]
Length=269

 Score = 64.3 bits (155),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EEEKWVPVTKLGRLVK GKI SLEQIYLHSLPI
Sbjct  35   EEEKWVPVTKLGRLVKAGKITSLEQIYLHSLPI  67



>ref|XP_007015077.1| Ribosomal protein S5 family protein isoform 1 [Theobroma cacao]
 ref|XP_007015078.1| Ribosomal protein S5 family protein isoform 1 [Theobroma cacao]
 gb|EOY32696.1| Ribosomal protein S5 family protein isoform 1 [Theobroma cacao]
 gb|EOY32697.1| Ribosomal protein S5 family protein isoform 1 [Theobroma cacao]
Length=268

 Score = 64.3 bits (155),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EEEKWVPVTKLGRLVK GKI SLEQIYLHSLPI
Sbjct  34   EEEKWVPVTKLGRLVKAGKITSLEQIYLHSLPI  66



>ref|XP_007015080.1| Ribosomal protein S5 family protein [Theobroma cacao]
 gb|EOY32699.1| Ribosomal protein S5 family protein [Theobroma cacao]
Length=269

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EEEKWVPVTKLGRLVK GKI SLEQIYLHSLPI
Sbjct  35   EEEKWVPVTKLGRLVKAGKITSLEQIYLHSLPI  67



>ref|XP_006291534.1| hypothetical protein CARUB_v10017690mg, partial [Capsella rubella]
 gb|EOA24432.1| hypothetical protein CARUB_v10017690mg, partial [Capsella rubella]
Length=309

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EEEKWVPVTKLGRLVK+GKI+ LEQIYLHSLPI
Sbjct  73   EEEKWVPVTKLGRLVKDGKIQKLEQIYLHSLPI  105



>ref|XP_002322713.1| 40S ribosomal protein S2 [Populus trichocarpa]
 gb|EEF04474.1| 40S ribosomal protein S2 [Populus trichocarpa]
Length=276

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EEEKWVPVTKLGRLVK+GKI S+EQIYLHSLPI
Sbjct  44   EEEKWVPVTKLGRLVKDGKISSVEQIYLHSLPI  76



>ref|XP_009389539.1| PREDICTED: 40S ribosomal protein S2-4-like [Musa acuminata subsp. 
malaccensis]
Length=277

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +2

Query  137  EEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EEKWVPVTKLGRLVKEGKI SLEQIYLHSLP+
Sbjct  44   EEKWVPVTKLGRLVKEGKITSLEQIYLHSLPV  75



>ref|XP_001784315.1| predicted protein [Physcomitrella patens]
 gb|EDQ50877.1| predicted protein [Physcomitrella patens]
Length=280

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EEEKWVPVTKLGRLVKEGKI+SLEQIYL SLPI
Sbjct  45   EEEKWVPVTKLGRLVKEGKIKSLEQIYLFSLPI  77



>ref|XP_006392282.1| hypothetical protein EUTSA_v10023633mg [Eutrema salsugineum]
 gb|ESQ29568.1| hypothetical protein EUTSA_v10023633mg [Eutrema salsugineum]
Length=280

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/34 (85%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +2

Query  131  TEEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
             EEEKWVPVTKLGRLVK+GKI+ LEQIYLHSLP+
Sbjct  44   AEEEKWVPVTKLGRLVKDGKIQKLEQIYLHSLPV  77



>ref|XP_001784592.1| predicted protein [Physcomitrella patens]
 gb|EDQ50611.1| predicted protein [Physcomitrella patens]
Length=280

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EEEKWVPVTKLGRLVKEGKI+SLEQIYL SLPI
Sbjct  45   EEEKWVPVTKLGRLVKEGKIKSLEQIYLFSLPI  77



>emb|CDY45881.1| BnaC01g28170D [Brassica napus]
Length=276

 Score = 63.9 bits (154),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +2

Query  131  TEEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            TEEEKW PVTKLGRLV++GKI+ LEQIYLHSLP+
Sbjct  40   TEEEKWTPVTKLGRLVRDGKIKQLEQIYLHSLPV  73



>gb|ABK22135.1| unknown [Picea sitchensis]
Length=137

 Score = 62.8 bits (151),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EEEKWVPVTKLGRLVKEGKIRSLEQIYL SL +
Sbjct  35   EEEKWVPVTKLGRLVKEGKIRSLEQIYLFSLAV  67



>ref|XP_009102893.1| PREDICTED: 40S ribosomal protein S2-2 [Brassica rapa]
 emb|CDY44553.1| BnaA01g21860D [Brassica napus]
Length=280

 Score = 63.9 bits (154),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +2

Query  131  TEEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            TEEEKW PVTKLGRLV++GKI+ LEQIYLHSLP+
Sbjct  44   TEEEKWTPVTKLGRLVRDGKIKQLEQIYLHSLPV  77



>gb|KFK34998.1| hypothetical protein AALP_AA5G220900 [Arabis alpina]
Length=275

 Score = 63.5 bits (153),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/33 (88%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EEEKWVPVTKLGRLVKEGKI  +EQIYLHSLP+
Sbjct  41   EEEKWVPVTKLGRLVKEGKISQIEQIYLHSLPV  73



>ref|XP_001753770.1| predicted protein [Physcomitrella patens]
 gb|EDQ81522.1| predicted protein [Physcomitrella patens]
Length=280

 Score = 63.5 bits (153),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EEEKWVPVTKLGRLVK+GKI+SLEQIYL SLPI
Sbjct  45   EEEKWVPVTKLGRLVKDGKIKSLEQIYLFSLPI  77



>ref|XP_001780194.1| predicted protein [Physcomitrella patens]
 gb|EDQ54953.1| predicted protein [Physcomitrella patens]
Length=280

 Score = 63.5 bits (153),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EEEKWVPVTKLGRLVK+GKI+SLEQIYL SLPI
Sbjct  45   EEEKWVPVTKLGRLVKDGKIKSLEQIYLFSLPI  77



>ref|XP_010241237.1| PREDICTED: 40S ribosomal protein S2-3-like [Nelumbo nucifera]
Length=276

 Score = 63.2 bits (152),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/30 (97%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = +2

Query  143  KWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            KWVPVTKLGRLVKEGKIRSLEQIYLHSLP+
Sbjct  46   KWVPVTKLGRLVKEGKIRSLEQIYLHSLPV  75



>ref|XP_008784865.1| PREDICTED: 40S ribosomal protein S2-3-like [Phoenix dactylifera]
Length=273

 Score = 63.2 bits (152),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EEEKWVPVTKLGRLVKEGKI SLEQIYLHSL +
Sbjct  39   EEEKWVPVTKLGRLVKEGKIHSLEQIYLHSLAV  71



>ref|XP_010257189.1| PREDICTED: 40S ribosomal protein S2-3-like [Nelumbo nucifera]
Length=275

 Score = 63.2 bits (152),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/30 (97%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = +2

Query  143  KWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            KWVPVTKLGRLVKEGKIRSLEQIYLHSLP+
Sbjct  45   KWVPVTKLGRLVKEGKIRSLEQIYLHSLPV  74



>ref|XP_009602518.1| PREDICTED: 40S ribosomal protein S2-3-like isoform X2 [Nicotiana 
tomentosiformis]
Length=280

 Score = 62.8 bits (151),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 29/30 (97%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = +2

Query  143  KWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            KWVPVTKLGRLVK+GKIRSLEQIYLHSLPI
Sbjct  43   KWVPVTKLGRLVKDGKIRSLEQIYLHSLPI  72



>ref|XP_006356337.1| PREDICTED: 40S ribosomal protein S2-3-like [Solanum tuberosum]
Length=280

 Score = 62.8 bits (151),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 29/30 (97%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = +2

Query  143  KWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            KWVPVTKLGRLVK+GKIRSLEQIYLHSLPI
Sbjct  44   KWVPVTKLGRLVKDGKIRSLEQIYLHSLPI  73



>ref|XP_004237924.1| PREDICTED: 40S ribosomal protein S2-4-like [Solanum lycopersicum]
Length=280

 Score = 62.8 bits (151),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 29/30 (97%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = +2

Query  143  KWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            KWVPVTKLGRLVK+GKIRSLEQIYLHSLPI
Sbjct  44   KWVPVTKLGRLVKDGKIRSLEQIYLHSLPI  73



>ref|XP_004237705.1| PREDICTED: 40S ribosomal protein S2-3-like [Solanum lycopersicum]
Length=280

 Score = 62.8 bits (151),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 29/30 (97%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = +2

Query  143  KWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            KWVPVTKLGRLVK+GKIRSLEQIYLHSLPI
Sbjct  44   KWVPVTKLGRLVKDGKIRSLEQIYLHSLPI  73



>gb|AFW90641.1| 40S ribosomal protein S2 [Solanum tuberosum]
Length=255

 Score = 62.4 bits (150),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 29/30 (97%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = +2

Query  143  KWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            KWVPVTKLGRLVK+GKIRSLEQIYLHSLPI
Sbjct  44   KWVPVTKLGRLVKDGKIRSLEQIYLHSLPI  73



>ref|NP_191308.1| 40S ribosomal protein S2-4 [Arabidopsis thaliana]
 sp|Q9SCM3.1|RS24_ARATH RecName: Full=40S ribosomal protein S2-4 [Arabidopsis thaliana]
 emb|CAB66106.1| 40S ribosomal protein S2 homolog [Arabidopsis thaliana]
 gb|AAM60846.1| 40S ribosomal protein S2 homolog [Arabidopsis thaliana]
 gb|AAP12849.1| At3g57490 [Arabidopsis thaliana]
 dbj|BAF00015.1| 40S ribosomal protein S2 homolog [Arabidopsis thaliana]
 gb|AEE79662.1| 40S ribosomal protein S2-4 [Arabidopsis thaliana]
Length=276

 Score = 62.8 bits (151),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 29/33 (88%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EEEKWVPVTKLGRLVKEGKI  +EQIYLHSLP+
Sbjct  41   EEEKWVPVTKLGRLVKEGKITKIEQIYLHSLPV  73



>ref|XP_006574815.1| PREDICTED: 40S ribosomal protein S2-4-like [Glycine max]
Length=275

 Score = 62.8 bits (151),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 29/30 (97%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = +2

Query  143  KWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            KWVPVTKLGRLVKEG+IRSLEQIYLHSLPI
Sbjct  44   KWVPVTKLGRLVKEGRIRSLEQIYLHSLPI  73



>ref|XP_007015082.1| Myosin-related isoform 1 [Theobroma cacao]
 gb|EOY32701.1| Myosin-related isoform 1 [Theobroma cacao]
Length=961

 Score = 64.7 bits (156),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EEEKWVPVTKLGRLVK GKI SLEQIYLHSLPI
Sbjct  727  EEEKWVPVTKLGRLVKAGKITSLEQIYLHSLPI  759



>ref|XP_006303259.1| hypothetical protein CARUB_v10009962mg [Capsella rubella]
 gb|EOA36157.1| hypothetical protein CARUB_v10009962mg [Capsella rubella]
Length=280

 Score = 62.4 bits (150),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +2

Query  131  TEEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            TEEEKWVPVTKLGRLV++ KI+ LEQIYLHSLP+
Sbjct  44   TEEEKWVPVTKLGRLVRDNKIQKLEQIYLHSLPV  77



>ref|XP_003564096.1| PREDICTED: 40S ribosomal protein S2-3-like [Brachypodium distachyon]
Length=278

 Score = 62.4 bits (150),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 28/33 (85%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EEEKWVPVTKLGRLVKEGK + +EQIYLHSLP+
Sbjct  44   EEEKWVPVTKLGRLVKEGKFQKIEQIYLHSLPV  76



>emb|CDY06903.1| BnaA04g24120D [Brassica napus]
Length=256

 Score = 62.0 bits (149),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +2

Query  131  TEEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            TEEEKW PVTKLGRLV+ GKI+ LEQIYLHSLP+
Sbjct  19   TEEEKWTPVTKLGRLVQAGKIQKLEQIYLHSLPV  52



>ref|XP_006302652.1| hypothetical protein CARUB_v10020756mg [Capsella rubella]
 gb|EOA35550.1| hypothetical protein CARUB_v10020756mg [Capsella rubella]
Length=281

 Score = 62.4 bits (150),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 29/34 (85%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +2

Query  131  TEEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            +EEEKWVPVTKLGRLVKE KI  LEQIYLHSLP+
Sbjct  45   SEEEKWVPVTKLGRLVKENKIEKLEQIYLHSLPV  78



>ref|XP_008231963.1| PREDICTED: 40S ribosomal protein S2-4-like [Prunus mume]
Length=263

 Score = 62.4 bits (150),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 29/30 (97%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = +2

Query  143  KWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            KWVPVTKLGRLVKEGKI+SLEQIYLHSLPI
Sbjct  31   KWVPVTKLGRLVKEGKIKSLEQIYLHSLPI  60



>ref|XP_010427628.1| PREDICTED: 40S ribosomal protein S2-4 [Camelina sativa]
Length=282

 Score = 62.4 bits (150),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 29/33 (88%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EEEKWVPVTKLGRLVK GKI+ LEQIYLHSLP+
Sbjct  47   EEEKWVPVTKLGRLVKGGKIQKLEQIYLHSLPV  79



>gb|ABK21813.1| unknown [Picea sitchensis]
 gb|ACN40117.1| unknown [Picea sitchensis]
Length=270

 Score = 62.4 bits (150),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EEEKWVPVTKLGRLVKEGKIRSLEQIYL SL +
Sbjct  35   EEEKWVPVTKLGRLVKEGKIRSLEQIYLFSLAV  67



>ref|XP_010504675.1| PREDICTED: 40S ribosomal protein S2-4-like [Camelina sativa]
 ref|XP_010504677.1| PREDICTED: 40S ribosomal protein S2-4-like [Camelina sativa]
Length=282

 Score = 62.4 bits (150),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 29/33 (88%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EEEKWVPVTKLGRLVK GKI+ LEQIYLHSLP+
Sbjct  47   EEEKWVPVTKLGRLVKGGKIQKLEQIYLHSLPV  79



>emb|CDY22542.1| BnaC03g23520D [Brassica napus]
Length=282

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +2

Query  131  TEEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            TEEEKW PVTKLGRLV+ GKI+ LEQIYLHSLP+
Sbjct  45   TEEEKWTPVTKLGRLVQSGKIQKLEQIYLHSLPV  78



>gb|ABK25823.1| unknown [Picea sitchensis]
Length=280

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EEEKWVPVTKLGRLVKEGKIRSLEQIYL SL +
Sbjct  45   EEEKWVPVTKLGRLVKEGKIRSLEQIYLFSLAV  77



>ref|XP_009133513.1| PREDICTED: 40S ribosomal protein S2-2-like [Brassica rapa]
Length=282

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +2

Query  131  TEEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            TEEEKW PVTKLGRLV+ GKI+ LEQIYLHSLP+
Sbjct  45   TEEEKWTPVTKLGRLVQSGKIQKLEQIYLHSLPV  78



>ref|XP_010412819.1| PREDICTED: 40S ribosomal protein S2-4-like [Camelina sativa]
Length=288

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/33 (88%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EEEKWVPVTKLGRLVK GKI+ LEQIYLHSLP+
Sbjct  53   EEEKWVPVTKLGRLVKGGKIQKLEQIYLHSLPV  85



>ref|XP_011020354.1| PREDICTED: 40S ribosomal protein S2-3-like [Populus euphratica]
Length=270

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/33 (88%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EEEKWVPVTKL RLVK+GKI S+EQIYLHSLPI
Sbjct  38   EEEKWVPVTKLSRLVKDGKISSVEQIYLHSLPI  70



>gb|KFK40885.1| hypothetical protein AALP_AA2G055200 [Arabis alpina]
Length=282

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +2

Query  131  TEEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            TEEEKWVPVTKLGRLV+ GKI  +EQIYLHSLP+
Sbjct  46   TEEEKWVPVTKLGRLVQSGKITQIEQIYLHSLPV  79



>ref|XP_009142017.1| PREDICTED: 40S ribosomal protein S2-2-like isoform X1 [Brassica 
rapa]
 ref|XP_009142018.1| PREDICTED: 40S ribosomal protein S2-2-like isoform X2 [Brassica 
rapa]
 emb|CDY14790.1| BnaC04g47870D [Brassica napus]
Length=285

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +2

Query  131  TEEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            TEEEKW PVTKLGRLV+ GKI+ LEQIYLHSLP+
Sbjct  48   TEEEKWTPVTKLGRLVQAGKIQKLEQIYLHSLPV  81



>ref|XP_004955795.1| PREDICTED: 40S ribosomal protein S2-3-like [Setaria italica]
Length=279

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/33 (85%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EEEKWVPVTKLGRLVKEGK   +EQIYLHSLP+
Sbjct  45   EEEKWVPVTKLGRLVKEGKFHKIEQIYLHSLPV  77



>emb|CDY35397.1| BnaA03g19630D [Brassica napus]
Length=303

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +2

Query  131  TEEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            TEEEKW PVTKLGRLV+ GKI+ LEQIYLHSLP+
Sbjct  66   TEEEKWTPVTKLGRLVQSGKIQKLEQIYLHSLPV  99



>ref|XP_006294755.1| hypothetical protein CARUB_v10023800mg [Capsella rubella]
 gb|EOA27653.1| hypothetical protein CARUB_v10023800mg [Capsella rubella]
Length=283

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +2

Query  131  TEEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            TEE+KWVPVTKLGRLV+ GKI+ LEQIYLHSLP+
Sbjct  48   TEEQKWVPVTKLGRLVQGGKIQKLEQIYLHSLPV  81



>emb|CDX79908.1| BnaA05g02480D [Brassica napus]
Length=285

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +2

Query  131  TEEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            TEEEKW PVTKLGRLV+ GKI+ LEQIYLHSLP+
Sbjct  48   TEEEKWTPVTKLGRLVQAGKIQKLEQIYLHSLPV  81



>emb|CDY48767.1| BnaC04g02200D [Brassica napus]
Length=1275

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 28/34 (82%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +2

Query  131  TEEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            TEEEKW PVTKLGRLV+ GKI+ LEQIYLHSLP+
Sbjct  48   TEEEKWTPVTKLGRLVQAGKIQKLEQIYLHSLPV  81



>ref|XP_009142781.1| PREDICTED: 40S ribosomal protein S2-3-like [Brassica rapa]
Length=285

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +2

Query  131  TEEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            TEEEKW PVTKLGRLV+ GKI+ LEQIYLHSLP+
Sbjct  48   TEEEKWTPVTKLGRLVQAGKIQKLEQIYLHSLPV  81



>ref|XP_004498248.1| PREDICTED: 40S ribosomal protein S2-4-like [Cicer arietinum]
Length=275

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/30 (97%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +2

Query  143  KWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            KWVPVTKLGRLVKEGKIRSLE IYLHSLPI
Sbjct  44   KWVPVTKLGRLVKEGKIRSLEHIYLHSLPI  73



>ref|XP_003557397.1| PREDICTED: 40S ribosomal protein S2-4-like [Brachypodium distachyon]
Length=281

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EEEKWVPVTKLGRLV+EGK + +EQIYLHSLP+
Sbjct  47   EEEKWVPVTKLGRLVREGKFQKIEQIYLHSLPV  79



>gb|KFK37024.1| hypothetical protein AALP_AA4G202400 [Arabis alpina]
Length=281

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +2

Query  131  TEEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            TEEEKWVPVTKLGRLV+ GKI  +EQIYLHSLP+
Sbjct  46   TEEEKWVPVTKLGRLVQGGKITQIEQIYLHSLPV  79



>ref|XP_002881803.1| 40S ribosomal protein S2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58062.1| 40S ribosomal protein S2 [Arabidopsis lyrata subsp. lyrata]
Length=282

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +2

Query  131  TEEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            +EEEKWVPVTKLGRLV +G+I+ +EQIYLHSLP+
Sbjct  46   SEEEKWVPVTKLGRLVADGRIKQIEQIYLHSLPV  79



>gb|ABF72884.1| ribosomal protein S2-like [Belgica antarctica]
Length=73

 Score = 58.5 bits (140),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = +2

Query  131  TEEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            + +++WVPVTKLGRLV+EGKIRSLE+IYL+SLPI
Sbjct  7    SNQKEWVPVTKLGRLVREGKIRSLEEIYLYSLPI  40



>ref|XP_010508673.1| PREDICTED: 40S ribosomal protein S2-3 [Camelina sativa]
Length=286

 Score = 61.2 bits (147),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +2

Query  131  TEEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            TEE+KWVPVTKLGRLV+ G+I+ LEQIYLHSLP+
Sbjct  50   TEEQKWVPVTKLGRLVQTGEIKKLEQIYLHSLPV  83



>emb|CDK26979.1| unnamed protein product [Kuraishia capsulata CBS 1993]
Length=254

 Score = 60.5 bits (145),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +2

Query  137  EEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EEKWVPVTKLGRLV+ GKI S+EQIYLHSLP+
Sbjct  32   EEKWVPVTKLGRLVRAGKITSVEQIYLHSLPV  63



>ref|XP_006402872.1| hypothetical protein EUTSA_v10006149mg [Eutrema salsugineum]
 gb|ESQ44325.1| hypothetical protein EUTSA_v10006149mg [Eutrema salsugineum]
Length=279

 Score = 60.8 bits (146),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EE KW+PVTKLGRLV+EGKI+ LEQIYLHSLP+
Sbjct  45   EETKWIPVTKLGRLVQEGKIQKLEQIYLHSLPV  77



>gb|EYU20868.1| hypothetical protein MIMGU_mgv1a011569mg [Erythranthe guttata]
Length=252

 Score = 60.5 bits (145),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 27/30 (90%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = +2

Query  143  KWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            KWVPVTKLGRLVK+GKI+S+EQIYLHSLPI
Sbjct  48   KWVPVTKLGRLVKDGKIKSIEQIYLHSLPI  77



>ref|XP_006417498.1| hypothetical protein EUTSA_v10008441mg [Eutrema salsugineum]
 gb|ESQ35851.1| hypothetical protein EUTSA_v10008441mg [Eutrema salsugineum]
Length=277

 Score = 60.8 bits (146),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EEEKW+PVTKLGRLV+ GKI+ LEQIYLHSLP+
Sbjct  42   EEEKWIPVTKLGRLVQCGKIKQLEQIYLHSLPV  74



>ref|XP_006431702.1| hypothetical protein CICLE_v10003471mg [Citrus clementina]
 gb|ESR44942.1| hypothetical protein CICLE_v10003471mg [Citrus clementina]
Length=274

 Score = 60.5 bits (145),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 28/30 (93%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +2

Query  143  KWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            KWV VTKLGRLV+EGKIRSLEQIYLHSLPI
Sbjct  73   KWVLVTKLGRLVREGKIRSLEQIYLHSLPI  102



>ref|XP_009777712.1| PREDICTED: 40S ribosomal protein S2-3-like [Nicotiana sylvestris]
Length=275

 Score = 60.5 bits (145),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/30 (93%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +2

Query  143  KWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            KWVPVTKLGRLVK+ KIRSLEQIYLHSLPI
Sbjct  39   KWVPVTKLGRLVKDSKIRSLEQIYLHSLPI  68



>gb|EYU20867.1| hypothetical protein MIMGU_mgv1a011569mg [Erythranthe guttata]
Length=277

 Score = 60.5 bits (145),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 27/30 (90%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = +2

Query  143  KWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            KWVPVTKLGRLVK+GKI+S+EQIYLHSLPI
Sbjct  48   KWVPVTKLGRLVKDGKIKSIEQIYLHSLPI  77



>ref|XP_001745849.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ89273.1| predicted protein [Monosiga brevicollis MX1]
Length=1464

 Score = 62.4 bits (150),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 27/32 (84%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +2

Query  137  EEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            +E WVPVTKLGRLVK+GKI+SLE IYLHSLPI
Sbjct  32   KETWVPVTKLGRLVKDGKIKSLEHIYLHSLPI  63



>ref|XP_009602513.1| PREDICTED: 40S ribosomal protein S2-3-like [Nicotiana tomentosiformis]
 ref|XP_009602517.1| PREDICTED: 40S ribosomal protein S2-3-like isoform X1 [Nicotiana 
tomentosiformis]
Length=280

 Score = 60.5 bits (145),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/30 (93%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +2

Query  143  KWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            KWVPVTKLGRLVK+ KIRSLEQIYLHSLPI
Sbjct  43   KWVPVTKLGRLVKDNKIRSLEQIYLHSLPI  72



>ref|XP_009630221.1| PREDICTED: 40S ribosomal protein S2-3-like [Nicotiana tomentosiformis]
Length=275

 Score = 60.5 bits (145),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/30 (93%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +2

Query  143  KWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            KWVPVTKLGRLVK+ KIRSLEQIYLHSLPI
Sbjct  39   KWVPVTKLGRLVKDSKIRSLEQIYLHSLPI  68



>ref|XP_008801692.1| PREDICTED: 40S ribosomal protein S2-3-like [Phoenix dactylifera]
Length=275

 Score = 60.5 bits (145),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 27/30 (90%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = +2

Query  143  KWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            KWVPVTKLGRLVKEG+I+SLEQIYLHSLP+
Sbjct  43   KWVPVTKLGRLVKEGRIQSLEQIYLHSLPV  72



>ref|XP_010554839.1| PREDICTED: LOW QUALITY PROTEIN: 40S ribosomal protein S2-4-like 
[Tarenaya hassleriana]
Length=271

 Score = 60.5 bits (145),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 29/34 (85%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +2

Query  131  TEEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
             EEEK VPVTKLGRLVKEGKI+ LEQIYLHSLP+
Sbjct  36   AEEEKXVPVTKLGRLVKEGKIQKLEQIYLHSLPV  69



>ref|XP_010094236.1| 40S ribosomal protein S2-4 [Morus notabilis]
 gb|EXB55434.1| 40S ribosomal protein S2-4 [Morus notabilis]
Length=274

 Score = 60.5 bits (145),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/30 (93%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +2

Query  143  KWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            KWVPVTKLGRLVKEGKI SLEQIYLHSLP+
Sbjct  42   KWVPVTKLGRLVKEGKITSLEQIYLHSLPV  71



>gb|EEE66778.1| hypothetical protein OsJ_23506 [Oryza sativa Japonica Group]
Length=146

 Score = 58.9 bits (141),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EEEKWVPVTKLGRLVKE KI  +E+IYLHSLP+
Sbjct  43   EEEKWVPVTKLGRLVKENKIHKIEEIYLHSLPV  75



>ref|XP_010517670.1| PREDICTED: 40S ribosomal protein S2-3-like [Camelina sativa]
Length=288

 Score = 60.5 bits (145),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +2

Query  131  TEEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            +EE+KWVPVTKLGRLV+ G+I+ LEQIYLHSLP+
Sbjct  52   SEEQKWVPVTKLGRLVQTGQIKKLEQIYLHSLPV  85



>gb|KHJ36005.1| putative 40s ribosomal protein s2 [Erysiphe necator]
Length=266

 Score = 59.7 bits (143),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +2

Query  131  TEEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
             EE++W PVTKLGRLVKEGKI+S+E+IYLHSLPI
Sbjct  43   NEEKEWQPVTKLGRLVKEGKIKSMEEIYLHSLPI  76



>gb|EPQ65642.1| Protein component of the small (40S) subunit [Blumeria graminis 
f. sp. tritici 96224]
Length=265

 Score = 59.7 bits (143),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +2

Query  131  TEEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
             EE++W PVTKLGRLVKEGKI+S+E+IYLHSLPI
Sbjct  43   NEEKEWQPVTKLGRLVKEGKIKSMEEIYLHSLPI  76



>ref|XP_010505968.1| PREDICTED: 40S ribosomal protein S2-3-like [Camelina sativa]
Length=288

 Score = 59.7 bits (143),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +2

Query  131  TEEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            +EE+KWVPVTKLGRLV+ G+I+ LEQIYLHSLP+
Sbjct  52   SEEQKWVPVTKLGRLVQTGEIKKLEQIYLHSLPV  85



>emb|CCU81829.1| ribosomal protein [Blumeria graminis f. sp. hordei DH14]
Length=269

 Score = 59.7 bits (143),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +2

Query  131  TEEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
             EE++W PVTKLGRLVKEGKI+S+E+IYLHSLPI
Sbjct  47   NEEKEWQPVTKLGRLVKEGKIKSMEEIYLHSLPI  80



>ref|XP_007736876.1| 30S ribosomal protein S5 [Capronia epimyces CBS 606.96]
 gb|EXJ79088.1| 30S ribosomal protein S5 [Capronia epimyces CBS 606.96]
Length=262

 Score = 59.3 bits (142),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +2

Query  131  TEEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            +EE++W PVTKLGRLVK GKI+S+EQIYLHSLPI
Sbjct  39   SEEKEWQPVTKLGRLVKAGKIQSMEQIYLHSLPI  72



>ref|XP_661017.1| hypothetical protein AN3413.2 [Aspergillus nidulans FGSC A4]
 gb|EAA63381.1| conserved hypothetical protein [Aspergillus nidulans FGSC A4]
 tpe|CBF82758.1| TPA: ribosomal protein S5 (AFU_orthologue; AFUA_7G01460) [Aspergillus 
nidulans FGSC A4]
Length=259

 Score = 59.3 bits (142),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +2

Query  131  TEEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            TEE++W PVTKLGRLVK GKI S+EQIYLHSLP+
Sbjct  36   TEEKEWQPVTKLGRLVKAGKITSMEQIYLHSLPV  69



>ref|XP_002014372.1| GL18987 [Drosophila persimilis]
 gb|EDW28368.1| GL18987 [Drosophila persimilis]
Length=387

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            + ++WVPVTKLGRLV+EGKI+SLE+IYL+SLPI
Sbjct  40   DSKEWVPVTKLGRLVREGKIKSLEEIYLYSLPI  72



>ref|XP_007366828.1| 40S ribosomal protein S2 [Dichomitus squalens LYAD-421 SS1]
 gb|EJF60410.1| 40S ribosomal protein S2 [Dichomitus squalens LYAD-421 SS1]
Length=258

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EE++WVPVTKLGRLVK+GKIRS+E+IYL SLP+
Sbjct  33   EEKEWVPVTKLGRLVKDGKIRSMEEIYLFSLPV  65



>pdb|3J60|C Chain C, Localization Of The Small Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
Length=263

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EEEKWVPVTKLGRLVKEG+   +E+IYLHSLP+
Sbjct  40   EEEKWVPVTKLGRLVKEGRFSKIEEIYLHSLPV  72



>ref|XP_007777949.1| 40S ribosomal protein S2 [Coniosporium apollinis CBS 100218]
 gb|EON62632.1| 40S ribosomal protein S2 [Coniosporium apollinis CBS 100218]
Length=266

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +2

Query  131  TEEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            TEE++W PVTKLGRLVK GKI+S+E+IYLHSLPI
Sbjct  43   TEEKEWQPVTKLGRLVKAGKIKSMEEIYLHSLPI  76



>gb|KIV78267.1| 40S ribosomal protein S2 [Exophiala sideris]
Length=262

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +2

Query  131  TEEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            +EE++W PVTKLGRLVK GKI+S+EQIYLHSLPI
Sbjct  39   SEEKEWQPVTKLGRLVKAGKIQSMEQIYLHSLPI  72



>gb|EYU35640.1| hypothetical protein MIMGU_mgv1a011526mg [Erythranthe guttata]
Length=279

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/30 (87%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = +2

Query  143  KWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            KWVPVTKLGRLV++GKI+S+EQIYLHSLPI
Sbjct  49   KWVPVTKLGRLVRDGKIKSIEQIYLHSLPI  78



>ref|XP_009152387.1| 40S ribosomal protein S2 [Exophiala dermatitidis NIH/UT8656]
 gb|EHY51926.1| 40S ribosomal protein S2 [Exophiala dermatitidis NIH/UT8656]
Length=262

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +2

Query  131  TEEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            +EE++W PVTKLGRLVK GKI+S+EQIYLHSLPI
Sbjct  39   SEEKEWQPVTKLGRLVKAGKIQSMEQIYLHSLPI  72



>ref|XP_009785188.1| PREDICTED: 40S ribosomal protein S2-3-like [Nicotiana sylvestris]
 ref|XP_009797071.1| PREDICTED: 40S ribosomal protein S2-3-like [Nicotiana sylvestris]
Length=280

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 28/30 (93%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +2

Query  143  KWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            KWVPVTKLGRLVK+ KIRSLEQIYLHSLPI
Sbjct  43   KWVPVTKLGRLVKDNKIRSLEQIYLHSLPI  72



>gb|KIX00263.1| 40S ribosomal protein S2 [Rhinocladiella mackenziei CBS 650.93]
Length=261

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +2

Query  131  TEEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            +EE++W PVTKLGRLVK GKI+S+EQIYLHSLPI
Sbjct  38   SEEKEWQPVTKLGRLVKAGKIQSMEQIYLHSLPI  71



>ref|XP_002466245.1| hypothetical protein SORBIDRAFT_01g004260 [Sorghum bicolor]
 gb|EER93243.1| hypothetical protein SORBIDRAFT_01g004260 [Sorghum bicolor]
Length=274

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EEEKWVPVTKLGRLVKE KI  +E+IYLHSLP+
Sbjct  40   EEEKWVPVTKLGRLVKESKINKIEEIYLHSLPV  72



>ref|XP_007720587.1| 40S ribosomal protein S2 [Capronia coronata CBS 617.96]
 gb|EXJ96358.1| 40S ribosomal protein S2 [Capronia coronata CBS 617.96]
Length=262

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +2

Query  131  TEEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            +EE++W PVTKLGRLVK GKI+S+EQIYLHSLPI
Sbjct  39   SEEKEWQPVTKLGRLVKAGKIQSMEQIYLHSLPI  72



>gb|EEE60147.1| hypothetical protein OsJ_13042 [Oryza sativa Japonica Group]
Length=284

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EEEKWVPVTKLGRLVKEG+   +E+IYLHSLP+
Sbjct  40   EEEKWVPVTKLGRLVKEGRFSKIEEIYLHSLPV  72



>ref|XP_002466244.1| hypothetical protein SORBIDRAFT_01g004250 [Sorghum bicolor]
 gb|EER93242.1| hypothetical protein SORBIDRAFT_01g004250 [Sorghum bicolor]
Length=274

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EEEKWVPVTKLGRLVKE KI  +E+IYLHSLP+
Sbjct  40   EEEKWVPVTKLGRLVKESKINKIEEIYLHSLPV  72



>gb|KIV94521.1| 40S ribosomal protein S2 [Exophiala mesophila]
Length=260

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +2

Query  131  TEEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            +EE++W PVTKLGRLVK GKI+S+EQIYLHSLPI
Sbjct  37   SEEKEWQPVTKLGRLVKAGKIQSMEQIYLHSLPI  70



>ref|NP_001051645.1| Os03g0807800 [Oryza sativa Japonica Group]
 gb|AAP21434.1| putative 40S ribosomal protein S2 [Oryza sativa Japonica Group]
 gb|ABF99457.1| 40S ribosomal protein S2, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF13559.1| Os03g0807800 [Oryza sativa Japonica Group]
 gb|EAY92273.1| hypothetical protein OsI_13996 [Oryza sativa Indica Group]
 dbj|BAG89307.1| unnamed protein product [Oryza sativa Japonica Group]
Length=274

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EEEKWVPVTKLGRLVKEG+   +E+IYLHSLP+
Sbjct  40   EEEKWVPVTKLGRLVKEGRFSKIEEIYLHSLPV  72



>dbj|BAJ89869.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=278

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 26/33 (79%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EEEKWVPVTKLGRLVKEG+   +E+IYLHSLP+
Sbjct  44   EEEKWVPVTKLGRLVKEGRFTKMEEIYLHSLPV  76



>gb|KIY74311.1| ribosomal protein S5 [Cylindrobasidium torrendii FP15055 ss-10]
Length=257

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EE++WVPVTKLGRLVK+GKIRS+E+IYL SLPI
Sbjct  34   EEKEWVPVTKLGRLVKDGKIRSMEEIYLFSLPI  66



>emb|CCA16359.1| 40S ribosomal protein S2 putative [Albugo laibachii Nc14]
Length=251

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +2

Query  131  TEEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            TE ++W+PVTKLGRLVKEGKI SLE+IYL+SLPI
Sbjct  26   TETKEWIPVTKLGRLVKEGKINSLEEIYLYSLPI  59



>ref|NP_181715.1| 40S ribosomal protein S2-3 [Arabidopsis thaliana]
 sp|P49688.2|RS23_ARATH RecName: Full=40S ribosomal protein S2-3 [Arabidopsis thaliana]
 gb|AAC02764.1| 40S ribosomal protein S2 [Arabidopsis thaliana]
 gb|AAK82512.1| At2g41840/T11A7.6 [Arabidopsis thaliana]
 gb|AAM91391.1| At2g41840/T11A7.6 [Arabidopsis thaliana]
 gb|AEC10039.1| 40S ribosomal protein S2-3 [Arabidopsis thaliana]
Length=285

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +2

Query  131  TEEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            +EEEKWVPVTKLGRLV  G I+ +EQIYLHSLP+
Sbjct  49   SEEEKWVPVTKLGRLVAAGHIKQIEQIYLHSLPV  82



>emb|CCI49151.1| unnamed protein product [Albugo candida]
Length=251

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +2

Query  131  TEEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            TE ++W+PVTKLGRLVKEGKI SLE+IYL+SLPI
Sbjct  26   TETKEWIPVTKLGRLVKEGKINSLEEIYLYSLPI  59



>ref|XP_008718886.1| 40S ribosomal protein S2 [Cyphellophora europaea CBS 101466]
 gb|ETN38297.1| 40S ribosomal protein S2 [Cyphellophora europaea CBS 101466]
Length=259

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +2

Query  131  TEEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
             EE++W PVTKLGRLVK GKI+S+EQIYLHSLPI
Sbjct  36   NEEKEWQPVTKLGRLVKAGKIQSMEQIYLHSLPI  69



>gb|KJB35778.1| hypothetical protein B456_006G128000 [Gossypium raimondii]
Length=268

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/30 (93%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +2

Query  143  KWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            KWVPVTKLGRLVK GKI SLEQIYLHSLPI
Sbjct  37   KWVPVTKLGRLVKTGKITSLEQIYLHSLPI  66



>gb|KHG06565.1| 40S ribosomal S2-2 -like protein [Gossypium arboreum]
Length=268

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/30 (93%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +2

Query  143  KWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            KWVPVTKLGRLVK GKI SLEQIYLHSLPI
Sbjct  37   KWVPVTKLGRLVKTGKITSLEQIYLHSLPI  66



>ref|XP_446276.1| 40S ribosomal protein S2 [Candida glabrata CBS 138]
 emb|CAG59200.1| unnamed protein product [Candida glabrata]
Length=253

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +2

Query  131  TEEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            TEE+ WVPVTKLGRLVK GKI S+E+I+LHSLP+
Sbjct  29   TEEKGWVPVTKLGRLVKAGKISSIEEIFLHSLPV  62



>ref|XP_003015927.1| hypothetical protein ARB_06239 [Arthroderma benhamiae CBS 112371]
 ref|XP_003025008.1| hypothetical protein TRV_00813 [Trichophyton verrucosum HKI 0517]
 ref|XP_003233997.1| 40S ribosomal protein S2 [Trichophyton rubrum CBS 118892]
 gb|EFE35282.1| hypothetical protein ARB_06239 [Arthroderma benhamiae CBS 112371]
 gb|EFE44397.1| hypothetical protein TRV_00813 [Trichophyton verrucosum HKI 0517]
 gb|EGD89628.1| 40S ribosomal protein S2 [Trichophyton rubrum CBS 118892]
 gb|EGE00755.1| 40S ribosomal protein S2 [Trichophyton tonsurans CBS 112818]
 gb|EGE08820.1| 40S ribosomal protein S2 [Trichophyton equinum CBS 127.97]
 gb|EZF24181.1| 40S ribosomal protein S2 [Trichophyton rubrum MR850]
 gb|EZF28657.1| 40S ribosomal protein S2 [Trichophyton interdigitale H6]
 gb|EZF43221.1| 40S ribosomal protein S2 [Trichophyton rubrum CBS 100081]
 gb|EZF53879.1| 40S ribosomal protein S2 [Trichophyton rubrum CBS 288.86]
 gb|EZF64482.1| 40S ribosomal protein S2 [Trichophyton rubrum CBS 289.86]
 gb|EZF75110.1| 40S ribosomal protein S2 [Trichophyton soudanense CBS 452.61]
 gb|EZF85771.1| 40S ribosomal protein S2 [Trichophyton rubrum MR1448]
 gb|EZF96580.1| 40S ribosomal protein S2 [Trichophyton rubrum MR1459]
 gb|EZG07499.1| 40S ribosomal protein S2 [Trichophyton rubrum CBS 735.88]
 gb|EZG18165.1| 40S ribosomal protein S2 [Trichophyton rubrum CBS 202.88]
 gb|KDB25849.1| 40S ribosomal protein S2 [Trichophyton interdigitale MR816]
 gb|KDB34989.1| 40S ribosomal protein S2 [Trichophyton rubrum D6]
Length=256

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +2

Query  131  TEEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            +EE++W PVTKLGRLVK GKI S+EQIYLHSLPI
Sbjct  33   SEEKEWQPVTKLGRLVKAGKINSIEQIYLHSLPI  66



>dbj|BAO38726.1| 40S ribosomal protein S2 [Kluyveromyces marxianus DMKU3-1042]
 dbj|BAP70270.1| 40S ribosomal protein S2 [Kluyveromyces marxianus]
Length=257

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +2

Query  131  TEEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            TEE+ WVPVTKLGRLVK GKI S+E+I+LHSLP+
Sbjct  33   TEEKGWVPVTKLGRLVKAGKISSVEEIFLHSLPV  66



>ref|XP_741113.1| ribosomal protein S2 [Plasmodium chabaudi chabaudi]
 emb|CAH89116.1| ribosomal protein S2, putative [Plasmodium chabaudi chabaudi]
Length=130

 Score = 57.4 bits (137),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +2

Query  140  EKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            + WVPVTKLGRLVKEGKI S+E+IYLHSLPI
Sbjct  36   KNWVPVTKLGRLVKEGKISSIEEIYLHSLPI  66



>ref|XP_003838290.1| similar to 40S ribosomal protein S2 [Leptosphaeria maculans JN3]
 emb|CBX94811.1| similar to 40S ribosomal protein S2 [Leptosphaeria maculans JN3]
Length=260

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +2

Query  131  TEEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            TEE++W PVTKLGRLVK GKI+S+E+IYLHSLP+
Sbjct  37   TEEKEWQPVTKLGRLVKAGKIKSMEEIYLHSLPV  70



>emb|CDM84780.1| unnamed protein product [Triticum aestivum]
Length=278

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EEEKWVPVTKLGRLVKEG+   +E++YLHSLPI
Sbjct  44   EEEKWVPVTKLGRLVKEGRFTKMEELYLHSLPI  76



>gb|EDZ72239.1| YGL123Wp-like protein [Saccharomyces cerevisiae AWRI1631]
Length=123

 Score = 57.4 bits (137),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +2

Query  131  TEEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            TEE+ WVPVTKLGRLVK GKI ++E+I+LHSLP+
Sbjct  30   TEEKGWVPVTKLGRLVKAGKITTIEEIFLHSLPV  63



>ref|XP_008644418.1| PREDICTED: 40S ribosomal protein S2-3-like [Zea mays]
 gb|AFW67266.1| hypothetical protein ZEAMMB73_246206 [Zea mays]
Length=274

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EEEKWVPVTKLGRLVKE KI  +E+IYLHSLP+
Sbjct  40   EEEKWVPVTKLGRLVKENKITKIEEIYLHSLPV  72



>ref|XP_002283793.1| PREDICTED: 40S ribosomal protein S2-3 [Vitis vinifera]
 emb|CAN79008.1| hypothetical protein VITISV_042472 [Vitis vinifera]
Length=273

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/30 (87%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = +2

Query  143  KWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            KWVPVTKLGRLVK+GKIR++E+IYLHSLPI
Sbjct  42   KWVPVTKLGRLVKDGKIRTVEEIYLHSLPI  71



>emb|CDO95773.1| unnamed protein product [Kluyveromyces dobzhanskii CBS 2104]
Length=262

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +2

Query  131  TEEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            TEE+ WVPVTKLGRLVK GKI S+E+I+LHSLP+
Sbjct  38   TEEKGWVPVTKLGRLVKAGKISSVEEIFLHSLPV  71



>dbj|BAC83243.1| putative 40S ribosomal protein S2 [Oryza sativa Japonica Group]
Length=276

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EEEKWVPVTKLGRLVKE KI  +E+IYLHSLP+
Sbjct  43   EEEKWVPVTKLGRLVKENKIHKIEEIYLHSLPV  75



>ref|XP_007292650.1| ribosomal protein S5 [Marssonina brunnea f. sp. 'multigermtubi' 
MB_m1]
 gb|EKD17184.1| ribosomal protein S5 [Marssonina brunnea f. sp. 'multigermtubi' 
MB_m1]
Length=266

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +2

Query  131  TEEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
             EE++W PVTKLGRLVK+GKI+S+E+IYLHSLPI
Sbjct  43   NEEKEWQPVTKLGRLVKDGKIKSMEEIYLHSLPI  76



>ref|XP_001240931.1| 40S ribosomal protein S2 [Coccidioides immitis RS]
 ref|XP_003065229.1| 40S ribosomal protein S2 [Coccidioides posadasii C735 delta SOWgp]
 gb|EER23084.1| 40S ribosomal protein S2, putative [Coccidioides posadasii C735 
delta SOWgp]
 gb|EFW15790.1| 40S ribosomal protein S2 [Coccidioides posadasii str. Silveira]
 gb|EAS29348.3| 40S ribosomal protein S2 [Coccidioides immitis RS]
Length=256

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +2

Query  131  TEEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            +EE++W PVTKLGRLVK GKI S+EQIYLHSLPI
Sbjct  33   SEEKEWQPVTKLGRLVKAGKITSMEQIYLHSLPI  66



>gb|KIM97433.1| hypothetical protein OIDMADRAFT_204192 [Oidiodendron maius Zn]
Length=266

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +2

Query  131  TEEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
             EE++W PVTKLGRLVK+GKI+S+E+IYLHSLPI
Sbjct  43   NEEKEWQPVTKLGRLVKDGKIKSMEEIYLHSLPI  76



>gb|EUD71344.1| 30S ribosomal protein S2e [Plasmodium vinckei petteri]
Length=271

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/31 (84%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +2

Query  140  EKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            + WVPVTKLGRLVKEGKI S+E+IYLHSLPI
Sbjct  38   KNWVPVTKLGRLVKEGKISSIEEIYLHSLPI  68



>ref|XP_727402.1| ribosomal protein S5 [Plasmodium yoelii yoelii 17XNL]
 gb|EAA18967.1| ribosomal protein S5 [Plasmodium yoelii yoelii]
Length=262

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/31 (84%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +2

Query  140  EKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            + WVPVTKLGRLVKEGKI S+E+IYLHSLPI
Sbjct  29   KNWVPVTKLGRLVKEGKISSIEEIYLHSLPI  59



>ref|XP_008085023.1| Ribosomal protein S5 2-like protein [Glarea lozoyensis ATCC 20868]
 gb|EPE27664.1| Ribosomal protein S5 2-like protein [Glarea lozoyensis ATCC 20868]
Length=268

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +2

Query  131  TEEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
             EE++W PVTKLGRLVK+GKI+S+E+IYLHSLPI
Sbjct  45   NEEKEWQPVTKLGRLVKDGKIKSMEEIYLHSLPI  78



>ref|XP_675613.1| ribosomal protein S2 [Plasmodium berghei strain ANKA]
 emb|CAH98785.1| ribosomal protein S2, putative [Plasmodium berghei]
Length=269

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/31 (84%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +2

Query  140  EKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            + WVPVTKLGRLVKEGKI S+E+IYLHSLPI
Sbjct  36   KNWVPVTKLGRLVKEGKISSIEEIYLHSLPI  66



>gb|EYE94995.1| ribosomal protein S5 [Aspergillus ruber CBS 135680]
Length=257

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EE++W PVTKLGRLVK GKI S+EQIYLHSLPI
Sbjct  35   EEKEWQPVTKLGRLVKAGKITSMEQIYLHSLPI  67



>ref|XP_002542854.1| 40S ribosomal protein S2 [Uncinocarpus reesii 1704]
 gb|EEP77521.1| 40S ribosomal protein S2 [Uncinocarpus reesii 1704]
Length=257

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +2

Query  131  TEEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            +EE++W PVTKLGRLVK GKI S+EQIYLHSLPI
Sbjct  34   SEEKEWQPVTKLGRLVKAGKITSMEQIYLHSLPI  67



>gb|ETW58431.1| 40S ribosomal protein S2 [Plasmodium falciparum CAMP/Malaysia]
Length=244

 Score = 58.2 bits (139),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/31 (84%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +2

Query  140  EKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            + WVPVTKLGRLVKEGKI S+E+IYLHSLPI
Sbjct  39   KNWVPVTKLGRLVKEGKIVSIEEIYLHSLPI  69



>ref|XP_003381255.1| 40S ribosomal protein S2 [Trichinella spiralis]
 gb|EFV59129.1| 40S ribosomal protein S2 [Trichinella spiralis]
Length=941

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 25/31 (81%), Positives = 31/31 (100%), Gaps = 0/31 (0%)
 Frame = +2

Query  140  EKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            ++W+PVTKLGRLVK+GKI+SLE+IYLHSLPI
Sbjct  707  KEWIPVTKLGRLVKDGKIKSLEEIYLHSLPI  737



>ref|XP_001827253.1| 40S ribosomal protein S2 [Aspergillus oryzae RIB40]
 ref|XP_002384506.1| 40S ribosomal protein S2 [Aspergillus flavus NRRL3357]
 dbj|BAE66120.1| unnamed protein product [Aspergillus oryzae RIB40]
 gb|EED45570.1| ribosomal protein S5 [Aspergillus flavus NRRL3357]
 gb|EIT75723.1| 40S ribosomal protein S2/30S ribosomal protein [Aspergillus oryzae 
3.042]
 gb|KDE82070.1| 40S ribosomal protein [Aspergillus oryzae 100-8]
Length=259

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EE++W PVTKLGRLVK GKI S+EQIYLHSLPI
Sbjct  37   EEKEWQPVTKLGRLVKAGKITSMEQIYLHSLPI  69



>gb|ETB56236.1| 40S ribosomal protein S2 [Plasmodium yoelii 17X]
 emb|CDU19766.1| 40S ribosomal protein S2, putative [Plasmodium yoelii]
 emb|CDZ17199.1| 40S ribosomal protein S2, putative [Plasmodium yoelii]
Length=271

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/31 (84%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +2

Query  140  EKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            + WVPVTKLGRLVKEGKI S+E+IYLHSLPI
Sbjct  38   KNWVPVTKLGRLVKEGKISSIEEIYLHSLPI  68



>gb|KIW30178.1| 40S ribosomal protein S2 [Cladophialophora immunda]
Length=260

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +2

Query  131  TEEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            ++E++W PVTKLGRLVK GKI+S+EQIYLHSLPI
Sbjct  37   SDEKEWQPVTKLGRLVKAGKIQSMEQIYLHSLPI  70



>gb|KIW61682.1| 40S ribosomal protein S2 [Exophiala xenobiotica]
Length=261

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +2

Query  131  TEEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            ++E++W PVTKLGRLVK GKI+S+EQIYLHSLPI
Sbjct  38   SDEKEWQPVTKLGRLVKAGKIQSMEQIYLHSLPI  71



>ref|XP_007739256.1| 40S ribosomal protein S2 [Cladophialophora psammophila CBS 110553]
 gb|EXJ75939.1| 40S ribosomal protein S2 [Cladophialophora psammophila CBS 110553]
 gb|KIW80473.1| 40S ribosomal protein S2 [Fonsecaea pedrosoi CBS 271.37]
 gb|KIW98791.1| 40S ribosomal protein S2 [Cladophialophora bantiana CBS 173.52]
 gb|KIX93816.1| 40S ribosomal protein S2 [Fonsecaea multimorphosa CBS 102226]
Length=261

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +2

Query  131  TEEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            ++E++W PVTKLGRLVK GKI+S+EQIYLHSLPI
Sbjct  38   SDEKEWQPVTKLGRLVKAGKIQSMEQIYLHSLPI  71



>ref|XP_007787578.1| 40S ribosomal protein S2 [Endocarpon pusillum Z07020]
 gb|ERF75049.1| 40S ribosomal protein S2 [Endocarpon pusillum Z07020]
Length=267

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +2

Query  131  TEEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            +EE++W PVTKLGRLVK GKI S+EQIYLHSLPI
Sbjct  44   SEEKEWQPVTKLGRLVKAGKITSMEQIYLHSLPI  77



>ref|XP_003345130.1| 40S ribosomal protein S2 [Sordaria macrospora k-hell]
 emb|CCC06570.1| unnamed protein product [Sordaria macrospora k-hell]
Length=265

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +2

Query  131  TEEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            +EE++W PVTKLGRLVK GKI+S+E+IYLHSLPI
Sbjct  40   SEEKEWQPVTKLGRLVKAGKIKSMEEIYLHSLPI  73



>ref|XP_008622022.1| 30S ribosomal protein S2e [Plasmodium vinckei vinckei]
 gb|KEG04537.1| 30S ribosomal protein S2e [Plasmodium vinckei vinckei]
 emb|CDR15339.1| 40S ribosomal protein S2, putative [Plasmodium chabaudi chabaudi]
 emb|CDS50114.1| 40S ribosomal protein S2, putative [Plasmodium berghei ANKA]
Length=271

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/31 (84%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +2

Query  140  EKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            + WVPVTKLGRLVKEGKI S+E+IYLHSLPI
Sbjct  38   KNWVPVTKLGRLVKEGKISSIEEIYLHSLPI  68



>gb|KIW17782.1| 40S ribosomal protein S2 [Exophiala spinifera]
Length=261

 Score = 58.2 bits (139),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +2

Query  131  TEEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            ++E++W PVTKLGRLVK GKI+S+EQIYLHSLPI
Sbjct  38   SDEKEWQPVTKLGRLVKAGKIQSMEQIYLHSLPI  71



>gb|KIW37164.1| 40S ribosomal protein S2 [Exophiala oligosperma]
Length=260

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +2

Query  131  TEEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            ++E++W PVTKLGRLVK GKI+S+EQIYLHSLPI
Sbjct  37   SDEKEWQPVTKLGRLVKAGKIQSMEQIYLHSLPI  70



>ref|XP_959810.1| 40S ribosomal protein S2 [Neurospora crassa OR74A]
 ref|XP_009853287.1| 40S ribosomal protein S2 [Neurospora tetrasperma FGSC 2508]
 gb|EAA30574.1| 40S ribosomal protein S2 [Neurospora crassa OR74A]
 gb|EGO55454.1| 40S ribosomal protein S2 [Neurospora tetrasperma FGSC 2508]
 gb|EGZ69317.1| 40S ribosomal protein S2 [Neurospora tetrasperma FGSC 2509]
Length=265

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +2

Query  131  TEEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            +EE++W PVTKLGRLVK GKI+S+E+IYLHSLPI
Sbjct  40   SEEKEWQPVTKLGRLVKAGKIKSMEEIYLHSLPI  73



>ref|XP_007753563.1| 40S ribosomal protein S2 [Cladophialophora yegresii CBS 114405]
 ref|XP_008723025.1| 40S ribosomal protein S2 [Cladophialophora carrionii CBS 160.54]
 gb|ETI28951.1| 40S ribosomal protein S2 [Cladophialophora carrionii CBS 160.54]
 gb|EXJ64996.1| 40S ribosomal protein S2 [Cladophialophora yegresii CBS 114405]
 gb|KIW72436.1| 40S ribosomal protein S2 [Capronia semiimmersa]
Length=261

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +2

Query  131  TEEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            ++E++W PVTKLGRLVK GKI+S+EQIYLHSLPI
Sbjct  38   SDEKEWQPVTKLGRLVKAGKIQSMEQIYLHSLPI  71



>gb|ETW39797.1| 40S ribosomal protein S2 [Plasmodium falciparum NF135/5.C10]
Length=278

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/31 (84%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +2

Query  140  EKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            + WVPVTKLGRLVKEGKI S+E+IYLHSLPI
Sbjct  45   KNWVPVTKLGRLVKEGKIVSIEEIYLHSLPI  75



>gb|KHE84595.1| hypothetical protein GE21DRAFT_10182, partial [Neurospora crassa]
Length=263

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +2

Query  131  TEEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            +EE++W PVTKLGRLVK GKI+S+E+IYLHSLPI
Sbjct  40   SEEKEWQPVTKLGRLVKAGKIKSMEEIYLHSLPI  73



>gb|ADV40174.1| 40S ribosomal protein S2/30S [Latrodectus hesperus]
Length=278

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/33 (79%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EE++WVPVTKLGRLVK+GKI+SLE+IY+ SLPI
Sbjct  42   EEKEWVPVTKLGRLVKDGKIKSLEEIYMFSLPI  74



>ref|XP_718427.1| likely cytosolic ribosomal protein S2 [Candida albicans SC5314]
 ref|XP_718157.1| likely cytosolic ribosomal protein S2 [Candida albicans SC5314]
 ref|XP_002416813.1| 40S ribosomal protein S2 [Candida dubliniensis CD36]
 gb|EAK99225.1| likely cytosolic ribosomal protein S2 [Candida albicans SC5314]
 gb|EAK99501.1| likely cytosolic ribosomal protein S2 [Candida albicans SC5314]
 emb|CAX44398.1| 40s ribosomal protein S2 (S4) (YS5) (RP12), putative [Candida 
dubliniensis CD36]
 gb|EEQ43001.1| 40S ribosomal protein S2 [Candida albicans WO-1]
 gb|KGQ98546.1| 40S ribosomal protein S2 [Candida albicans P37005]
 gb|KGQ99274.1| 40S ribosomal protein S2 [Candida albicans P94015]
 gb|KGR04154.1| 40S ribosomal protein S2 [Candida albicans GC75]
 gb|KGR15287.1| 40S ribosomal protein S2 [Candida albicans P57072]
 gb|KGR21915.1| 40S ribosomal protein S2 [Candida albicans P78048]
 gb|KGR23211.1| 40S ribosomal protein S2 [Candida albicans P37037]
 gb|KGT72340.1| 40S ribosomal protein S2 [Candida albicans 12C]
 gb|KGU14497.1| 40S ribosomal protein S2 [Candida albicans P87]
 gb|KGU18401.1| 40S ribosomal protein S2 [Candida albicans L26]
 gb|KGU19886.1| 40S ribosomal protein S2 [Candida albicans 19F]
 gb|KGU33534.1| 40S ribosomal protein S2 [Candida albicans P34048]
 gb|KGU36338.1| 40S ribosomal protein S2 [Candida albicans P75063]
 gb|KGU37365.1| 40S ribosomal protein S2 [Candida albicans P57055]
 gb|KHC40197.1| 40S ribosomal protein S2 [Candida albicans P76055]
 gb|KHC42989.1| 40S ribosomal protein S2 [Candida albicans P76067]
 gb|KHC50042.1| 40S ribosomal protein S2 [Candida albicans Ca6]
 gb|KHC57115.1| 40S ribosomal protein S2 [Candida albicans P60002]
 gb|KHC61772.1| 40S ribosomal protein S2 [Candida albicans P37039]
 gb|KHC68325.1| 40S ribosomal protein S2 [Candida albicans P75010]
 gb|KHC75574.1| 40S ribosomal protein S2 [Candida albicans P75016]
 gb|KHC82933.1| 40S ribosomal protein S2 [Candida albicans SC5314]
 gb|KHC85845.1| 40S ribosomal protein S2 [Candida albicans P78042]
 gb|KHC89863.1| 40S ribosomal protein S2 [Candida albicans SC5314]
Length=249

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EE+ W PVTKLGRLVK GKI S+EQIYLHSLP+
Sbjct  26   EEKGWTPVTKLGRLVKAGKITSVEQIYLHSLPV  58



>ref|XP_007872721.1| 30S ribosomal protein S5 [Pneumocystis murina B123]
 gb|EMR11225.1| 30S ribosomal protein S5 [Pneumocystis murina B123]
Length=248

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            +E+ WVPVTKLGRLVK GKIRS+E+IYL+SLPI
Sbjct  24   KEDTWVPVTKLGRLVKAGKIRSIEEIYLYSLPI  56



>gb|KDN49652.1| hypothetical protein RSAG8_01717, partial [Rhizoctonia solani 
AG-8 WAC10335]
Length=295

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            E+++WVPVTKLGRLVK+GKI+S+E+IYL SLPI
Sbjct  36   EDKEWVPVTKLGRLVKDGKIKSMEEIYLFSLPI  68



>ref|XP_005651594.1| ribosomal protein S2 component of cytosolic 80S ribosome and 
40S small subunit [Coccomyxa subellipsoidea C-169]
 gb|EIE27050.1| ribosomal protein S2 component of cytosolic 80S ribosome and 
40S small subunit [Coccomyxa subellipsoidea C-169]
Length=266

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/33 (79%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EEEKWVP TKLGRLV++GKI+SLEQI+L SLP+
Sbjct  32   EEEKWVPCTKLGRLVQQGKIKSLEQIFLFSLPV  64



>gb|EMD37605.1| hypothetical protein CERSUDRAFT_114253 [Ceriporiopsis subvermispora 
B]
Length=257

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EE++WVPVTKLGRLVK+GKI+S+E+IYL SLP+
Sbjct  33   EEKEWVPVTKLGRLVKDGKIKSMEEIYLFSLPV  65



>gb|EHL01894.1| putative 40S ribosomal protein S2 [Glarea lozoyensis 74030]
Length=456

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +2

Query  131  TEEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
             EE++W PVTKLGRLVK+GKI+S+E+IYLHSLPI
Sbjct  45   NEEKEWQPVTKLGRLVKDGKIKSMEEIYLHSLPI  78



>ref|XP_007282026.1| 40s ribosomal protein s2 [Colletotrichum gloeosporioides Nara 
gc5]
 gb|ELA28909.1| 40s ribosomal protein s2 [Colletotrichum gloeosporioides Nara 
gc5]
Length=233

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +2

Query  131  TEEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            +EE++W PVTKLGRLVK GKI S+E+IYLHSLPI
Sbjct  36   SEEKEWQPVTKLGRLVKAGKINSMEEIYLHSLPI  69



>ref|XP_003852754.1| 40S ribosomal protein S2 [Zymoseptoria tritici IPO323]
 gb|EGP87730.1| hypothetical protein MYCGRDRAFT_104360 [Zymoseptoria tritici 
IPO323]
Length=269

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +2

Query  131  TEEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            ++E++W PVTKLGRLVK GKI+S+E+IYLHSLPI
Sbjct  46   SDEKEWAPVTKLGRLVKAGKIKSMEEIYLHSLPI  79



>ref|XP_001536852.1| 40S ribosomal protein S2 [Histoplasma capsulatum NAm1]
 gb|EDN04295.1| ribosomal protein S5 [Histoplasma capsulatum NAm1]
 gb|EEH04668.1| ribosomal protein S5 [Histoplasma capsulatum G186AR]
 gb|EER40100.1| ribosomal protein S5 [Histoplasma capsulatum H143]
 gb|EGC48675.1| ribosomal protein S2 [Histoplasma capsulatum H88]
Length=258

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +2

Query  131  TEEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            ++E++W PVTKLGRLVK GKI S+EQIYLHSLPI
Sbjct  35   SDEKEWQPVTKLGRLVKAGKISSMEQIYLHSLPI  68



>ref|XP_009040480.1| hypothetical protein AURANDRAFT_31983 [Aureococcus anophagefferens]
 gb|EGB04743.1| hypothetical protein AURANDRAFT_31983 [Aureococcus anophagefferens]
Length=275

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 25/32 (78%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +2

Query  137  EEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            +E+WVPVTKLGRLVKEGKI+SLE+I+L+S+PI
Sbjct  43   KEEWVPVTKLGRLVKEGKIKSLEEIFLYSMPI  74



>dbj|GAD96311.1| 40S ribosomal protein S2 [Byssochlamys spectabilis No. 5]
Length=259

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +2

Query  131  TEEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            +EE++W PVTKLGRLVK GKI S+EQIYLHSLP+
Sbjct  36   SEEKEWQPVTKLGRLVKAGKITSMEQIYLHSLPV  69



>gb|KIY44352.1| ribosomal protein S5 [Fistulina hepatica ATCC 64428]
Length=253

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EE++WVPVTKLGRLVK+GKI+S+E+IYL SLP+
Sbjct  31   EEKEWVPVTKLGRLVKDGKIKSMEEIYLFSLPV  63



>ref|XP_008030878.1| hypothetical protein SETTUDRAFT_165887 [Setosphaeria turcica 
Et28A]
 gb|EOA81397.1| hypothetical protein SETTUDRAFT_165887 [Setosphaeria turcica 
Et28A]
Length=260

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +2

Query  131  TEEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            +EE++W PVTKLGRLVK GKI+S+E+IYLHSLPI
Sbjct  37   SEEKEWQPVTKLGRLVKAGKIKSMEEIYLHSLPI  70



>gb|KIM91906.1| hypothetical protein PILCRDRAFT_809897 [Piloderma croceum F 1598]
Length=255

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EE++WVPVTKLGRLVK+GKI+S+E+IYL SLP+
Sbjct  33   EEKEWVPVTKLGRLVKDGKIKSMEEIYLFSLPV  65



>ref|XP_002143231.1| 40S ribosomal protein S2 [Talaromyces marneffei ATCC 18224]
 ref|XP_002479529.1| 40S ribosomal protein S2 [Talaromyces stipitatus ATCC 10500]
 gb|EEA26716.1| ribosomal protein S5 [Talaromyces marneffei ATCC 18224]
 gb|EED19095.1| ribosomal protein S5 [Talaromyces stipitatus ATCC 10500]
 gb|KFX42495.1| 40S ribosomal protein S2 [Talaromyces marneffei PM1]
 dbj|GAM40034.1| protein component of the small 40S ribosomal subunit [Talaromyces 
cellulolyticus]
Length=259

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +2

Query  131  TEEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            +EE++W PVTKLGRLVK GKI S+EQIYLHSLP+
Sbjct  36   SEEKEWQPVTKLGRLVKAGKITSMEQIYLHSLPV  69



>ref|XP_007686418.1| hypothetical protein COCMIDRAFT_35376 [Bipolaris oryzae ATCC 
44560]
 ref|XP_007698825.1| hypothetical protein COCSADRAFT_309533 [Bipolaris sorokiniana 
ND90Pr]
 ref|XP_007711510.1| hypothetical protein COCCADRAFT_4428 [Bipolaris zeicola 26-R-13]
 gb|EMD65770.1| hypothetical protein COCSADRAFT_309533 [Bipolaris sorokiniana 
ND90Pr]
 gb|EMD89667.1| hypothetical protein COCHEDRAFT_1195009 [Bipolaris maydis C5]
 gb|ENI10121.1| hypothetical protein COCC4DRAFT_47131 [Bipolaris maydis ATCC 
48331]
 gb|EUC34192.1| hypothetical protein COCCADRAFT_4428 [Bipolaris zeicola 26-R-13]
 gb|EUC47081.1| hypothetical protein COCMIDRAFT_35376 [Bipolaris oryzae ATCC 
44560]
 gb|EUN29664.1| hypothetical protein COCVIDRAFT_24439 [Bipolaris victoriae FI3]
Length=260

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +2

Query  131  TEEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            +EE++W PVTKLGRLVK GKI+S+E+IYLHSLPI
Sbjct  37   SEEKEWQPVTKLGRLVKAGKIKSMEEIYLHSLPI  70



>ref|XP_003671972.1| ribosomal protein S2 [Naumovozyma dairenensis CBS 421]
 emb|CCD26729.1| hypothetical protein NDAI_0I01600 [Naumovozyma dairenensis CBS 
421]
Length=250

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +2

Query  131  TEEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            TEE+ WVPVTKLGRLVK GKI ++E+I+LHSLP+
Sbjct  31   TEEKGWVPVTKLGRLVKAGKITTIEEIFLHSLPV  64



>gb|KEF51408.1| 40S ribosomal protein S2 [Exophiala aquamarina CBS 119918]
Length=260

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +2

Query  131  TEEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            +EE++W PVTKLGRLVK GKI+++EQIYLHSLPI
Sbjct  37   SEEKEWQPVTKLGRLVKAGKIQNMEQIYLHSLPI  70



>ref|XP_002459531.1| hypothetical protein SORBIDRAFT_02g006200 [Sorghum bicolor]
 gb|EER96052.1| hypothetical protein SORBIDRAFT_02g006200 [Sorghum bicolor]
Length=279

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EEEKWVPVTKLGRLVKE +I  +E+IYLHSLP+
Sbjct  45   EEEKWVPVTKLGRLVKENRIHKIEEIYLHSLPV  77



>gb|AAF82250.1|AC008051_1 Identical to gene XW6 from Arabidopsis thaliana gb|AB008016 and 
contains a Ribosomal protein S5 PF|00333 domain. ESTs gb|T22200, 
gb|N38541, gb|T45263 come from this gene. This gene 
is cut off, partial [Arabidopsis thaliana]
Length=231

 Score = 57.4 bits (137),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +2

Query  131  TEEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            +EE KWVPVTKLGRLV + KI  LEQIYLHSLP+
Sbjct  48   SEETKWVPVTKLGRLVADNKITKLEQIYLHSLPV  81



>ref|XP_009547175.1| hypothetical protein HETIRDRAFT_384925 [Heterobasidion irregulare 
TC 32-1]
 gb|ETW80418.1| hypothetical protein HETIRDRAFT_384925 [Heterobasidion irregulare 
TC 32-1]
Length=257

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EE++WVPVTKLGRLVK+GKI+S+E+IYL SLP+
Sbjct  33   EEKEWVPVTKLGRLVKDGKIKSMEEIYLFSLPV  65



>emb|CCX13683.1| Similar to 40S ribosomal protein S2; acc. no. P25443 [Pyronema 
omphalodes CBS 100304]
Length=264

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +2

Query  131  TEEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
             EE++W PVTKLGRLVK GKI+S+E+IYLHSLPI
Sbjct  41   NEEKEWQPVTKLGRLVKAGKIKSMEEIYLHSLPI  74



>gb|KIK67075.1| hypothetical protein GYMLUDRAFT_257028 [Gymnopus luxurians FD-317 
M1]
Length=257

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            +E++WVPVTKLGRLVK+GKIRS+E+IYL SLP+
Sbjct  33   DEKEWVPVTKLGRLVKDGKIRSMEEIYLFSLPV  65



>gb|KEQ91049.1| hypothetical protein AUEXF2481DRAFT_70415 [Aureobasidium subglaciale 
EXF-2481]
Length=261

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +2

Query  131  TEEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
             EE++W PVTKLGRLVK GKI+S+E+IYLHSLPI
Sbjct  38   NEEKEWQPVTKLGRLVKAGKIKSMEEIYLHSLPI  71



>ref|XP_002620842.1| 40S ribosomal protein S2 [Blastomyces dermatitidis SLH14081]
 gb|EEQ74565.1| 30S ribosomal protein S5 [Blastomyces dermatitidis SLH14081]
 gb|EEQ92314.1| 30S ribosomal protein S5 [Blastomyces dermatitidis ER-3]
 gb|EGE86494.1| 40S ribosomal protein S2 [Blastomyces dermatitidis ATCC 18188]
 gb|EQL29148.1| 40S ribosomal protein S2 [Blastomyces dermatitidis ATCC 26199]
Length=260

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +2

Query  131  TEEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            ++E++W PVTKLGRLVK GKI S+EQIYLHSLPI
Sbjct  37   SDEKEWQPVTKLGRLVKAGKISSMEQIYLHSLPI  70



>ref|NP_588435.1| 40S ribosomal protein S2 [Schizosaccharomyces pombe 972h-]
 sp|O74892.1|RS2_SCHPO RecName: Full=40S ribosomal protein S2 [Schizosaccharomyces pombe 
972h-]
 emb|CAA21187.1| 40S ribosomal protein S2 (predicted) [Schizosaccharomyces pombe]
Length=253

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EE++WVPVTKLGRLVK GKI+S+E+IYL+SLPI
Sbjct  30   EEKEWVPVTKLGRLVKAGKIKSIEEIYLYSLPI  62



>gb|KDQ27811.1| hypothetical protein PLEOSDRAFT_1089478 [Pleurotus ostreatus 
PC15]
Length=257

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            E+++WVPVTKLGRLVK+GKIRS+E+IYL SLP+
Sbjct  32   EDKEWVPVTKLGRLVKDGKIRSMEEIYLFSLPV  64



>gb|EPZ33474.1| 40S ribosomal protein S2 [Rozella allomycis CSF55]
Length=254

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            E++KWVPVTKLGRLV EGKI+S+E+IY HSLPI
Sbjct  29   EKDKWVPVTKLGRLVLEGKIKSMEEIYQHSLPI  61



>ref|XP_007813951.1| 40S ribosomal protein S2 [Metarhizium acridum CQMa 102]
 gb|EFY86307.1| 40S ribosomal protein S2 [Metarhizium acridum CQMa 102]
Length=255

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +2

Query  131  TEEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            +EE++W PVTKLGRLVK GKI S+E+IYLHSLPI
Sbjct  32   SEEKEWQPVTKLGRLVKAGKINSMEEIYLHSLPI  65



>gb|KIK47138.1| hypothetical protein CY34DRAFT_799679 [Suillus luteus UH-Slu-Lm8-n1]
Length=257

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EE++WVPVTKLGRLVK+GKI+S+E+IYL SLP+
Sbjct  33   EEKEWVPVTKLGRLVKDGKIKSMEEIYLFSLPV  65



>ref|NP_001169209.1| uncharacterized protein LOC100383062 [Zea mays]
 ref|XP_008644414.1| PREDICTED: uncharacterized protein LOC100383062 isoform X1 [Zea 
mays]
 gb|ACN31951.1| unknown [Zea mays]
 tpg|DAA52072.1| TPA: hypothetical protein ZEAMMB73_242652 [Zea mays]
 tpg|DAA52073.1| TPA: hypothetical protein ZEAMMB73_242652 [Zea mays]
Length=274

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EEEKWVPVTKLGRLVKE +I  +E+IYLHSLP+
Sbjct  40   EEEKWVPVTKLGRLVKENRITKIEEIYLHSLPV  72



>gb|KEQ70646.1| 40S ribosomal protein S2 [Aureobasidium pullulans var. namibiae 
CBS 147.97]
Length=261

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +2

Query  131  TEEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
             EE++W PVTKLGRLVK GKI+S+E+IYLHSLPI
Sbjct  38   NEEKEWQPVTKLGRLVKAGKIKSMEEIYLHSLPI  71



>gb|EUC60357.1| 40S ribosomal protein S2 [Rhizoctonia solani AG-3 Rhs1AP]
 gb|KEP53527.1| 40S ribosomal protein S2 [Rhizoctonia solani 123E]
Length=262

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            E+++WVPVTKLGRLVK+GKI+S+E+IYL SLPI
Sbjct  36   EDKEWVPVTKLGRLVKDGKIKSMEEIYLFSLPI  68



>gb|KFY07760.1| hypothetical protein V492_06845, partial [Pseudogymnoascus pannorum 
VKM F-4246]
Length=242

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +2

Query  131  TEEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
             EE++W PVTKLGRLVK GKI+S+E+IYLHSLPI
Sbjct  19   NEEKEWQPVTKLGRLVKAGKIKSMEEIYLHSLPI  52



>ref|XP_002954017.1| component of cytosolic 80S ribosome and 40S small subunit [Volvox 
carteri f. nagariensis]
 gb|EFJ45046.1| component of cytosolic 80S ribosome and 40S small subunit [Volvox 
carteri f. nagariensis]
Length=268

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            +EEKWVP TKLGRLV++GKI+SLEQIYL S+P+
Sbjct  36   DEEKWVPCTKLGRLVQQGKIKSLEQIYLFSMPV  68



>gb|KEQ83956.1| 40S ribosomal protein S2 [Aureobasidium pullulans EXF-150]
Length=261

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +2

Query  131  TEEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
             EE++W PVTKLGRLVK GKI+S+E+IYLHSLPI
Sbjct  38   NEEKEWQPVTKLGRLVKAGKIKSMEEIYLHSLPI  71



>ref|XP_003029996.1| 40S ribosomal protein S2 [Schizophyllum commune H4-8]
 gb|EFI95093.1| hypothetical protein SCHCODRAFT_77428 [Schizophyllum commune 
H4-8]
Length=256

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EE++WVPVTKLGRLVK+GKI+S+E+IYL SLP+
Sbjct  33   EEKEWVPVTKLGRLVKDGKIKSMEEIYLFSLPV  65



>ref|XP_002568379.1| Pc21g13620 [Penicillium rubens Wisconsin 54-1255]
 emb|CAP96259.1| Pc21g13620 [Penicillium rubens Wisconsin 54-1255]
Length=260

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EE++W PVTKLGRLVK GKI S+EQIYLHSLP+
Sbjct  38   EEKEWQPVTKLGRLVKAGKITSMEQIYLHSLPV  70



>ref|XP_008034088.1| 40S ribosomal protein S2 [Trametes versicolor FP-101664 SS1]
 gb|EIW62559.1| 40S ribosomal protein S2 [Trametes versicolor FP-101664 SS1]
Length=259

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EE++WVPVTKLGRLVK+GKI+S+E+IYL SLP+
Sbjct  34   EEKEWVPVTKLGRLVKDGKIKSMEEIYLFSLPV  66



>ref|XP_002470227.1| 40S ribosomal protein S2 [Postia placenta Mad-698-R]
 ref|XP_002476141.1| 40S ribosomal protein S2 [Postia placenta Mad-698-R]
 gb|EED78656.1| 40S ribosomal protein S2 [Postia placenta Mad-698-R]
 gb|EED84530.1| 40S ribosomal protein S2 [Postia placenta Mad-698-R]
Length=257

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EE++WVPVTKLGRLVK+GKI+S+E+IYL SLP+
Sbjct  33   EEKEWVPVTKLGRLVKDGKIKSMEEIYLFSLPV  65



>gb|KIJ49476.1| hypothetical protein M422DRAFT_27842 [Sphaerobolus stellatus 
SS14]
Length=258

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EE++WVPVTKLGRLVK+GKI+S+E+IYL SLP+
Sbjct  33   EEKEWVPVTKLGRLVKDGKIKSMEEIYLFSLPV  65



>emb|CCE35217.1| probable 40S ribosomal protein S5 [Claviceps purpurea 20.1]
Length=255

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +2

Query  131  TEEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            +EE++W PVTKLGRLVK GKI S+E+IYLHSLPI
Sbjct  32   SEEKEWQPVTKLGRLVKAGKINSMEEIYLHSLPI  65



>ref|XP_002052442.1| GJ21626 [Drosophila virilis]
 gb|EDW64597.1| GJ21626 [Drosophila virilis]
Length=268

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            + ++WVPVTKLGRLV+EGKI+SLE+IYL+SLPI
Sbjct  40   DSKEWVPVTKLGRLVREGKIKSLEEIYLYSLPI  72



>gb|KJA19966.1| hypothetical protein HYPSUDRAFT_43874 [Hypholoma sublateritium 
FD-334 SS-4]
Length=257

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EE++WVPVTKLGRLVK+GKI+S+E+IYL SLP+
Sbjct  33   EEKEWVPVTKLGRLVKDGKIKSMEEIYLFSLPV  65



>gb|KEQ63253.1| 40S ribosomal protein S2 [Aureobasidium melanogenum CBS 110374]
Length=261

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +2

Query  131  TEEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
             EE++W PVTKLGRLVK GKI+S+E+IYLHSLPI
Sbjct  38   NEEKEWQPVTKLGRLVKAGKIKSMEEIYLHSLPI  71



>gb|KIJ18666.1| hypothetical protein PAXINDRAFT_167242 [Paxillus involutus ATCC 
200175]
Length=258

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EE++WVPVTKLGRLVK+GKI+S+E+IYL SLP+
Sbjct  33   EEKEWVPVTKLGRLVKDGKIKSMEEIYLFSLPV  65



>gb|KHN96863.1| 40S ribosomal protein S2 [Metarhizium album ARSEF 1941]
Length=255

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +2

Query  131  TEEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            +EE++W PVTKLGRLVK GKI S+E+IYLHSLPI
Sbjct  32   SEEKEWQPVTKLGRLVKAGKINSMEEIYLHSLPI  65



>gb|EPS31029.1| hypothetical protein PDE_05983 [Penicillium oxalicum 114-2]
Length=259

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EE++W PVTKLGRLVK GKI S+EQIYLHSLP+
Sbjct  37   EEKEWQPVTKLGRLVKAGKITSMEQIYLHSLPV  69



>gb|EKV11645.1| hypothetical protein PDIP_55350 [Penicillium digitatum Pd1]
 gb|EKV17032.1| hypothetical protein PDIG_17460 [Penicillium digitatum PHI26]
 emb|CDM38142.1| 40S ribosomal protein S2 [Penicillium roqueforti FM164]
 gb|KGO48258.1| Ribosomal protein S5 [Penicillium expansum]
 gb|KGO53738.1| Ribosomal protein S5 [Penicillium expansum]
 gb|KGO70212.1| Ribosomal protein S5 [Penicillium expansum]
Length=260

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EE++W PVTKLGRLVK GKI S+EQIYLHSLP+
Sbjct  38   EEKEWQPVTKLGRLVKAGKITSMEQIYLHSLPV  70



>ref|XP_001226125.1| 40S ribosomal protein S2 [Chaetomium globosum CBS 148.51]
 gb|EAQ83040.1| hypothetical protein CHGG_10858 [Chaetomium globosum CBS 148.51]
Length=271

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +2

Query  131  TEEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
             EE++W PVTKLGRLVK GKI+S+E+IYLHSLPI
Sbjct  46   NEEKEWQPVTKLGRLVKAGKIKSMEEIYLHSLPI  79



>gb|KDR75932.1| hypothetical protein GALMADRAFT_68985 [Galerina marginata CBS 
339.88]
Length=257

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EE++WVPVTKLGRLVK+GKI+S+E+IYL SLP+
Sbjct  33   EEKEWVPVTKLGRLVKDGKIKSMEEIYLFSLPV  65



>gb|KFD57288.1| hypothetical protein M513_01799 [Trichuris suis]
Length=286

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +2

Query  137  EEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            E+ W+PVTKLGRLVK+GKI+SLE+IYLH+LPI
Sbjct  56   EKDWIPVTKLGRLVKDGKIKSLEEIYLHALPI  87



>ref|XP_002175572.1| 40S ribosomal protein S2 [Schizosaccharomyces japonicus yFS275]
 gb|EEB09279.1| 40S ribosomal protein S2 [Schizosaccharomyces japonicus yFS275]
Length=249

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EE++WVPVTKLGRLVK GKI+S+E+IYL+SLPI
Sbjct  26   EEKEWVPVTKLGRLVKAGKIKSIEEIYLYSLPI  58



>emb|CCF38653.1| 40S ribosomal protein S2 [Colletotrichum higginsianum]
Length=260

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +2

Query  131  TEEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            +EE++W PVTKLGRLVK GKI+S+E+IYLHSLPI
Sbjct  37   SEEKEWQPVTKLGRLVKAGKIQSMEEIYLHSLPI  70



>gb|KII92074.1| hypothetical protein PLICRDRAFT_36850 [Plicaturopsis crispa FD-325 
SS-3]
Length=257

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EE++WVPVTKLGRLVK+GKI+S+E+IYL SLP+
Sbjct  32   EEKEWVPVTKLGRLVKDGKIKSMEEIYLFSLPV  64



>emb|CEL60671.1| 40S ribosomal protein S2 OS=Ictalurus punctatus GN=rps2 PE=2 
SV=1 [Rhizoctonia solani AG-1 IB]
Length=262

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            E+++WVPVTKLGRLVK+GKI+S+E+IYL SLPI
Sbjct  36   EDKEWVPVTKLGRLVKDGKIKSMEEIYLFSLPI  68



>ref|XP_007816707.1| Ribosomal protein S5 [Metarhizium robertsii ARSEF 23]
 gb|EFZ03444.1| Ribosomal protein S5 [Metarhizium robertsii ARSEF 23]
 gb|EXV00111.1| ribosomal protein S2 [Metarhizium robertsii]
 gb|KFG82669.1| 40S ribosomal protein S2 [Metarhizium anisopliae]
 gb|KID64902.1| Ribosomal protein S5, partial [Metarhizium anisopliae ARSEF 549]
 gb|KID75122.1| hypothetical protein MBR_05449, partial [Metarhizium brunneum 
ARSEF 3297]
 gb|KID87479.1| Ribosomal protein S5 [Metarhizium guizhouense ARSEF 977]
 gb|KID99063.1| hypothetical protein MAJ_04853, partial [Metarhizium majus ARSEF 
297]
Length=255

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +2

Query  131  TEEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            +EE++W PVTKLGRLVK GKI S+E+IYLHSLPI
Sbjct  32   SEEKEWQPVTKLGRLVKAGKINSMEEIYLHSLPI  65



>gb|KIK97747.1| hypothetical protein PAXRUDRAFT_824617 [Paxillus rubicundulus 
Ve08.2h10]
Length=257

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EE++WVPVTKLGRLVK+GKI+S+E+IYL SLP+
Sbjct  33   EEKEWVPVTKLGRLVKDGKIKSMEEIYLFSLPV  65



>emb|CCM05701.1| predicted protein [Fibroporia radiculosa]
Length=258

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EE++WVPVTKLGRLVK+GKI+S+E+IYL SLP+
Sbjct  33   EEKEWVPVTKLGRLVKDGKIKSMEEIYLFSLPV  65



>ref|XP_007317645.1| hypothetical protein SERLADRAFT_387604 [Serpula lacrymans var. 
lacrymans S7.9]
 gb|EGN99958.1| hypothetical protein SERLA73DRAFT_51918 [Serpula lacrymans var. 
lacrymans S7.3]
 gb|EGO25523.1| hypothetical protein SERLADRAFT_387604 [Serpula lacrymans var. 
lacrymans S7.9]
Length=258

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  134  EEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            EE++WVPVTKLGRLVK+GKI+S+E+IYL SLP+
Sbjct  33   EEKEWVPVTKLGRLVKDGKIKSMEEIYLFSLPV  65



>gb|KDB15720.1| 40S ribosomal protein S2 [Ustilaginoidea virens]
Length=255

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +2

Query  131  TEEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPI  232
            +EE++W PVTKLGRLVK GKI S+E+IYLHSLPI
Sbjct  32   SEEKEWQPVTKLGRLVKAGKINSMEEIYLHSLPI  65



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 566855288900