BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002C19

Length=364
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009794665.1|  PREDICTED: succinate dehydrogenase [ubiquino...    150   9e-40   Nicotiana sylvestris
ref|XP_004232400.1|  PREDICTED: succinate dehydrogenase [ubiquino...    150   9e-40   Solanum lycopersicum
ref|XP_009624858.1|  PREDICTED: succinate dehydrogenase [ubiquino...    147   5e-39   Nicotiana tomentosiformis
ref|XP_009794664.1|  PREDICTED: succinate dehydrogenase [ubiquino...    145   4e-38   Nicotiana sylvestris
ref|XP_006340609.1|  PREDICTED: succinate dehydrogenase [ubiquino...    144   6e-38   Solanum tuberosum [potatoes]
emb|CDP02029.1|  unnamed protein product                                131   5e-33   Coffea canephora [robusta coffee]
ref|XP_011099603.1|  PREDICTED: succinate dehydrogenase [ubiquino...    130   1e-32   Sesamum indicum [beniseed]
ref|XP_008241667.1|  PREDICTED: succinate dehydrogenase [ubiquino...    125   6e-31   Prunus mume [ume]
ref|XP_009371587.1|  PREDICTED: succinate dehydrogenase [ubiquino...    125   7e-31   Pyrus x bretschneideri [bai li]
ref|XP_008338100.1|  PREDICTED: succinate dehydrogenase [ubiquino...    125   8e-31   Malus domestica [apple tree]
ref|XP_008344291.1|  PREDICTED: succinate dehydrogenase [ubiquino...    125   1e-30   
ref|XP_008338495.1|  PREDICTED: succinate dehydrogenase [ubiquino...    125   1e-30   Malus domestica [apple tree]
ref|XP_011097110.1|  PREDICTED: LOW QUALITY PROTEIN: succinate de...    124   1e-30   Sesamum indicum [beniseed]
ref|XP_004170583.1|  PREDICTED: succinate dehydrogenase [ubiquino...    117   4e-30   
ref|XP_004287904.1|  PREDICTED: succinate dehydrogenase [ubiquino...    123   6e-30   Fragaria vesca subsp. vesca
ref|XP_009350004.1|  PREDICTED: succinate dehydrogenase [ubiquino...    122   7e-30   Pyrus x bretschneideri [bai li]
ref|XP_010547500.1|  PREDICTED: succinate dehydrogenase [ubiquino...    122   7e-30   Tarenaya hassleriana [spider flower]
ref|XP_002310225.1|  Succinate dehydrogenase flavoprotein subunit       121   2e-29   
ref|XP_007202009.1|  hypothetical protein PRUPE_ppa002787mg             121   2e-29   
ref|XP_010679713.1|  PREDICTED: succinate dehydrogenase [ubiquino...    121   2e-29   Beta vulgaris subsp. vulgaris [field beet]
gb|EYU29489.1|  hypothetical protein MIMGU_mgv1a0028801mg               112   3e-29   Erythranthe guttata [common monkey flower]
ref|XP_011025771.1|  PREDICTED: succinate dehydrogenase [ubiquino...    120   5e-29   Populus euphratica
gb|EYU29491.1|  hypothetical protein MIMGU_mgv1a025296mg                112   8e-29   Erythranthe guttata [common monkey flower]
ref|XP_008453738.1|  PREDICTED: succinate dehydrogenase [ubiquino...    119   8e-29   Cucumis melo [Oriental melon]
ref|XP_006383209.1|  hypothetical protein POPTR_0005s12530g             119   1e-28   
gb|KGN53253.1|  hypothetical protein Csa_4G038700                       118   3e-28   Cucumis sativus [cucumbers]
ref|XP_004149154.1|  PREDICTED: succinate dehydrogenase [ubiquino...    118   3e-28   
gb|KHG24771.1|  SDH1-1: Succinate dehydrogenase [ubiquinone] flav...    117   5e-28   Gossypium arboreum [tree cotton]
gb|KHG24770.1|  SDH1-1: Succinate dehydrogenase [ubiquinone] flav...    117   6e-28   Gossypium arboreum [tree cotton]
ref|XP_003517234.1|  PREDICTED: succinate dehydrogenase [ubiquino...    117   7e-28   Glycine max [soybeans]
gb|KHN36125.1|  Succinate dehydrogenase [ubiquinone] flavoprotein...    117   8e-28   Glycine soja [wild soybean]
ref|XP_004512040.1|  PREDICTED: succinate dehydrogenase [ubiquino...    117   8e-28   Cicer arietinum [garbanzo]
ref|XP_009103488.1|  PREDICTED: succinate dehydrogenase [ubiquino...    116   2e-27   
ref|XP_006280112.1|  hypothetical protein CARUB_v10026004mg             116   2e-27   
ref|XP_010484716.1|  PREDICTED: succinate dehydrogenase [ubiquino...    114   2e-27   Camelina sativa [gold-of-pleasure]
ref|XP_011003741.1|  PREDICTED: succinate dehydrogenase [ubiquino...    115   3e-27   Populus euphratica
ref|XP_010550391.1|  PREDICTED: succinate dehydrogenase [ubiquino...    115   3e-27   Tarenaya hassleriana [spider flower]
gb|KJB17788.1|  hypothetical protein B456_003G015500                    115   4e-27   Gossypium raimondii
gb|KDO79531.1|  hypothetical protein CISIN_1g046556mg                   114   5e-27   Citrus sinensis [apfelsine]
ref|XP_006425687.1|  hypothetical protein CICLE_v10025149mg             114   5e-27   Citrus clementina [clementine]
ref|XP_010444735.1|  PREDICTED: succinate dehydrogenase [ubiquino...    114   6e-27   Camelina sativa [gold-of-pleasure]
emb|CDY30754.1|  BnaC07g16540D                                          114   7e-27   Brassica napus [oilseed rape]
ref|XP_002866741.1|  succinate dehydrogenase 1-1                        114   8e-27   
gb|KHF98130.1|  Succinate dehydrogenase [ubiquinone] flavoprotein...    114   9e-27   Gossypium arboreum [tree cotton]
gb|ADZ75464.1|  succinate dehydrogenase                                 114   1e-26   Litchi chinensis [litchi]
gb|KJB48417.1|  hypothetical protein B456_008G068200                    114   1e-26   Gossypium raimondii
gb|KJB48416.1|  hypothetical protein B456_008G068200                    114   1e-26   Gossypium raimondii
ref|XP_009103489.1|  PREDICTED: succinate dehydrogenase [ubiquino...    113   2e-26   Brassica rapa
ref|NP_201477.1|  succinate dehydrogenase [ubiquinone] flavoprote...    113   2e-26   Arabidopsis thaliana [mouse-ear cress]
gb|KHN41982.1|  Succinate dehydrogenase [ubiquinone] flavoprotein...    112   3e-26   Glycine soja [wild soybean]
ref|XP_003537582.1|  PREDICTED: succinate dehydrogenase [ubiquino...    112   3e-26   Glycine max [soybeans]
ref|XP_010464904.1|  PREDICTED: succinate dehydrogenase [ubiquino...    112   4e-26   Camelina sativa [gold-of-pleasure]
ref|XP_003518027.1|  PREDICTED: succinate dehydrogenase [ubiquino...    112   6e-26   Glycine max [soybeans]
ref|XP_010113491.1|  Succinate dehydrogenase [ubiquinone] flavopr...    111   9e-26   
ref|XP_007046958.1|  Succinate dehydrogenase 1-1 isoform 2              109   1e-25   
gb|KDP30152.1|  hypothetical protein JCGZ_18113                         111   1e-25   Jatropha curcas
gb|KEH27558.1|  succinate dehydrogenase [ubiquinone] flavoprotein...    110   1e-25   Medicago truncatula
ref|XP_003611986.1|  Succinate dehydrogenase                            110   2e-25   Medicago truncatula
ref|XP_007046957.1|  Succinate dehydrogenase 1-1 isoform 1              110   2e-25   Theobroma cacao [chocolate]
emb|CDY49839.1|  BnaC02g43980D                                          110   3e-25   Brassica napus [oilseed rape]
gb|EPS73058.1|  hypothetical protein M569_01696                         107   3e-25   Genlisea aurea
ref|XP_009406751.1|  PREDICTED: succinate dehydrogenase [ubiquino...    109   5e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006393871.1|  hypothetical protein EUTSA_v10003821mg             109   5e-25   Eutrema salsugineum [saltwater cress]
ref|XP_002530482.1|  succinate dehydrogenase, putative                  108   1e-24   
ref|XP_010029813.1|  PREDICTED: succinate dehydrogenase [ubiquino...    108   1e-24   Eucalyptus grandis [rose gum]
ref|XP_006409150.1|  hypothetical protein EUTSA_v10022591mg             106   5e-24   
ref|XP_004509253.1|  PREDICTED: succinate dehydrogenase [ubiquino...    104   2e-23   
ref|XP_004509252.1|  PREDICTED: succinate dehydrogenase [ubiquino...    105   2e-23   Cicer arietinum [garbanzo]
ref|XP_007156937.1|  hypothetical protein PHAVU_002G029800g             104   2e-23   Phaseolus vulgaris [French bean]
gb|KFK28359.1|  succinate dehydrogenase                                 104   2e-23   Arabis alpina [alpine rockcress]
ref|XP_010263680.1|  PREDICTED: succinate dehydrogenase [ubiquino...    103   4e-23   Nelumbo nucifera [Indian lotus]
ref|XP_009112333.1|  PREDICTED: succinate dehydrogenase [ubiquino...    103   4e-23   Brassica rapa
emb|CDY57124.1|  BnaA09g52600D                                          103   5e-23   Brassica napus [oilseed rape]
ref|XP_004981574.1|  PREDICTED: succinate dehydrogenase [ubiquino...    102   9e-23   Setaria italica
ref|XP_009112332.1|  PREDICTED: succinate dehydrogenase [ubiquino...    102   9e-23   Brassica rapa
ref|XP_002463806.1|  hypothetical protein SORBIDRAFT_01g006490          102   1e-22   Sorghum bicolor [broomcorn]
ref|XP_008787307.1|  PREDICTED: succinate dehydrogenase [ubiquino...    102   1e-22   Phoenix dactylifera
ref|XP_010942844.1|  PREDICTED: succinate dehydrogenase [ubiquino...    102   2e-22   Elaeis guineensis
ref|XP_010942839.1|  PREDICTED: succinate dehydrogenase [ubiquino...    102   2e-22   Elaeis guineensis
ref|XP_010942023.1|  PREDICTED: succinate dehydrogenase [ubiquino...    101   2e-22   Elaeis guineensis
ref|XP_010254866.1|  PREDICTED: succinate dehydrogenase [ubiquino...    100   5e-22   Nelumbo nucifera [Indian lotus]
ref|XP_010489548.1|  PREDICTED: succinate dehydrogenase [ubiquino...    100   5e-22   Camelina sativa [gold-of-pleasure]
ref|XP_010414323.1|  PREDICTED: succinate dehydrogenase [ubiquino...    100   6e-22   Camelina sativa [gold-of-pleasure]
ref|XP_008783479.1|  PREDICTED: succinate dehydrogenase [ubiquino...    100   6e-22   Phoenix dactylifera
ref|XP_010467662.1|  PREDICTED: succinate dehydrogenase [ubiquino...    100   6e-22   Camelina sativa [gold-of-pleasure]
ref|XP_007156038.1|  hypothetical protein PHAVU_003G253200g             100   7e-22   Phaseolus vulgaris [French bean]
ref|XP_008783478.1|  PREDICTED: succinate dehydrogenase [ubiquino...    100   1e-21   Phoenix dactylifera
ref|XP_004972473.1|  PREDICTED: succinate dehydrogenase [ubiquino...  99.8    1e-21   Setaria italica
emb|CDX81369.1|  BnaC09g07800D                                        99.4    2e-21   
ref|NP_001058845.1|  Os07g0134800                                     99.4    2e-21   
dbj|BAK08049.1|  predicted protein                                    99.0    2e-21   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EEE66523.1|  hypothetical protein OsJ_23002                        99.4    2e-21   Oryza sativa Japonica Group [Japonica rice]
tpg|DAA59498.1|  TPA: hypothetical protein ZEAMMB73_792658            99.0    2e-21   
ref|XP_009408578.1|  PREDICTED: succinate dehydrogenase [ubiquino...  99.0    3e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001146352.1|  uncharacterized protein LOC100279930             98.6    3e-21   Zea mays [maize]
ref|NP_001146722.1|  uncharacterized protein LOC100280324             98.6    3e-21   Zea mays [maize]
gb|ACG43057.1|  succinate dehydrogenase flavoprotein subunit,mito...  98.6    3e-21   Zea mays [maize]
tpg|DAA42707.1|  TPA: hypothetical protein ZEAMMB73_508415            98.6    3e-21   
dbj|BAK02783.1|  predicted protein                                    98.2    5e-21   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002886171.1|  succinate dehydrogenase 1-2                      97.8    6e-21   
ref|NP_179435.1|  succinate dehydrogenase [ubiquinone] flavoprote...  97.1    1e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002269407.1|  PREDICTED: succinate dehydrogenase [ubiquino...  96.7    2e-20   Vitis vinifera
ref|XP_003558573.1|  PREDICTED: succinate dehydrogenase [ubiquino...  96.3    2e-20   Brachypodium distachyon [annual false brome]
gb|AIZ74343.1|  succinate dehydrogenase                               95.5    4e-20   Pinus massoniana [Chinese red pine]
ref|XP_006299856.1|  hypothetical protein CARUB_v10016059mg           94.7    5e-20   
ref|XP_006856022.1|  hypothetical protein AMTR_s00059p00054360        95.1    5e-20   
gb|KFK40220.1|  hypothetical protein AALP_AA3G346200                  95.1    6e-20   Arabis alpina [alpine rockcress]
ref|XP_002970038.1|  hypothetical protein SELMODRAFT_440964           95.1    6e-20   Selaginella moellendorffii
gb|EMS46614.1|  Succinate dehydrogenase [ubiquinone] flavoprotein...  94.0    1e-19   Triticum urartu
ref|XP_002985229.1|  hypothetical protein SELMODRAFT_446158           92.8    4e-19   Selaginella moellendorffii
ref|XP_009150830.1|  PREDICTED: succinate dehydrogenase [ubiquino...  91.7    9e-19   Brassica rapa
emb|CDY29234.1|  BnaA06g25230D                                        91.7    9e-19   Brassica napus [oilseed rape]
ref|XP_004981575.1|  PREDICTED: succinate dehydrogenase [ubiquino...  89.7    4e-18   
ref|XP_006658260.1|  PREDICTED: succinate dehydrogenase [ubiquino...  89.7    4e-18   Oryza brachyantha
gb|EMT18500.1|  Succinate dehydrogenase (ubiquinone) flavoprotein...  89.4    6e-18   
gb|EMS68611.1|  Succinate dehydrogenase [ubiquinone] flavoprotein...  89.0    8e-18   Triticum urartu
emb|CDY36482.1|  BnaC03g48410D                                        89.0    9e-18   Brassica napus [oilseed rape]
gb|EMT27843.1|  Succinate dehydrogenase (ubiquinone) flavoprotein...  89.0    1e-17   
ref|XP_011396968.1|  Succinate dehydrogenase [ubiquinone] flavopr...  85.9    8e-17   Auxenochlorella protothecoides
ref|XP_003557614.1|  PREDICTED: succinate dehydrogenase [ubiquino...  85.5    1e-16   Brachypodium distachyon [annual false brome]
gb|KCW56781.1|  hypothetical protein EUGRSUZ_I024522                  85.1    2e-16   Eucalyptus grandis [rose gum]
gb|KDD75364.1|  FAD binding domain-containing protein                 84.3    2e-16   Helicosporidium sp. ATCC 50920
ref|XP_002602350.1|  hypothetical protein BRAFLDRAFT_128477           84.7    3e-16   Branchiostoma floridae
gb|KIW65101.1|  succinate dehydrogenase [ubiquinone] flavoprotein...  83.2    8e-16   Phialophora americana
ref|XP_007759146.1|  succinate dehydrogenase [ubiquinone] flavopr...  83.2    9e-16   Cladophialophora yegresii CBS 114405
emb|CDQ88961.1|  unnamed protein product                              79.0    9e-16   Oncorhynchus mykiss
ref|XP_001689842.1|  succinate dehydrogenase subunit A                83.2    9e-16   Chlamydomonas reinhardtii
ref|XP_008725706.1|  succinate dehydrogenase [ubiquinone] flavopr...  83.2    9e-16   Cladophialophora carrionii CBS 160.54
ref|WP_040449408.1|  fumarate reductase                               82.8    9e-16   Hoeflea phototrophica
ref|XP_001762172.1|  predicted protein                                82.8    9e-16   
gb|KIM80776.1|  hypothetical protein PILCRDRAFT_516876                82.8    1e-15   Piloderma croceum F 1598
gb|KIW07596.1|  succinate dehydrogenase [ubiquinone] flavoprotein...  82.8    1e-15   Verruconis gallopava
ref|XP_007364698.1|  succinate dehydrogenase                          82.4    2e-15   Dichomitus squalens LYAD-421 SS1
ref|XP_002505866.1|  succinate dehydrogenase                          82.4    2e-15   Micromonas commoda
ref|XP_001938444.1|  succinate dehydrogenase flavoprotein subunit...  82.0    2e-15   Pyrenophora tritici-repentis Pt-1C-BFP
ref|XP_001780340.1|  predicted protein                                81.6    2e-15   
ref|XP_008720747.1|  succinate dehydrogenase [ubiquinone] flavopr...  82.0    2e-15   Cyphellophora europaea CBS 101466
gb|KIV95505.1|  succinate dehydrogenase [ubiquinone] flavoprotein...  82.0    2e-15   Exophiala mesophila
gb|EXX63396.1|  succinate dehydrogenase flavoprotein subunit SDH1     81.6    3e-15   Rhizophagus irregularis DAOM 197198w
ref|NP_594319.1|  succinate dehydrogenase Sdh1 (predicted)            81.3    3e-15   Schizosaccharomyces pombe
emb|CEG67799.1|  Putative Succinate dehydrogenase flavoprotein su...  81.3    4e-15   Rhizopus microsporus
ref|XP_007513731.1|  succinate dehydrogenase flavoprotein subunit     81.6    4e-15   Bathycoccus prasinos
tpg|DAA34477.1|  TPA: succinate dehydrogenase flavoprotein subunit    78.6    4e-15   Amblyomma variegatum
ref|XP_007708277.1|  hypothetical protein COCCADRAFT_85691            81.3    4e-15   Bipolaris zeicola 26-R-13
ref|XP_007692911.1|  hypothetical protein COCMIDRAFT_108460           81.3    4e-15   Bipolaris oryzae ATCC 44560
ref|XP_001438844.1|  hypothetical protein                             78.6    4e-15   Paramecium tetraurelia strain d4-2
ref|XP_002172921.1|  succinate dehydrogenase Sdh1                     80.9    5e-15   Schizosaccharomyces japonicus yFS275
ref|XP_004768496.1|  PREDICTED: succinate dehydrogenase [ubiquino...  80.9    5e-15   
ref|XP_007701408.1|  hypothetical protein COCSADRAFT_120336           80.9    5e-15   Bipolaris sorokiniana ND90Pr
ref|XP_009226311.1|  hypothetical protein GGTG_10181                  80.9    5e-15   Gaeumannomyces tritici R3-111a-1
emb|CCJ28744.1|  unnamed protein product                              81.3    6e-15   Pneumocystis jirovecii
ref|XP_003082803.1|  succinate dehydrogenase flavoprotein alpha s...  80.9    6e-15   Ostreococcus tauri
emb|CDS03760.1|  hypothetical protein LRAMOSA01161                    80.5    6e-15   Lichtheimia ramosa
ref|XP_008036136.1|  succinate dehydrogenase                          80.9    6e-15   Trametes versicolor FP-101664 SS1
ref|XP_007871954.1|  hypothetical protein PNEG_00097                  80.5    6e-15   Pneumocystis murina B123
ref|XP_002186498.1|  succinate dehydrogenase flavoprotein             80.1    8e-15   Phaeodactylum tricornutum CCAP 1055/1
dbj|BAE87311.1|  unnamed protein product                              77.8    9e-15   Macaca fascicularis [crab eating macaque]
ref|XP_002494175.1|  Flavoprotein subunit of succinate dehydrogen...  80.1    9e-15   Komagataella phaffii GS115
ref|XP_005707863.1|  succinate dehydrogenase (ubiquinone) flavopr...  80.1    9e-15   Galdieria sulphuraria
gb|KFY12526.1|  hypothetical protein V491_06755                       78.6    9e-15   Pseudogymnoascus sp. VKM F-3775
gb|KIV77229.1|  succinate dehydrogenase [ubiquinone] flavoprotein...  80.1    1e-14   Exophiala sideris
emb|CDS32637.1|  succinate dehydrogenase (ubiquinone)                 80.1    1e-14   Hymenolepis microstoma
ref|XP_001014703.2|  succinate dehydrogenase, flavoprotein subuni...  79.7    1e-14   Tetrahymena thermophila SB210
ref|XP_003063914.1|  predicted protein                                79.7    1e-14   Micromonas pusilla CCMP1545
ref|XP_001748251.1|  hypothetical protein                             79.7    1e-14   Monosiga brevicollis MX1
gb|ESZ94343.1|  succinate dehydrogenase flavoprotein subunit          79.7    1e-14   Sclerotinia borealis F-4128
gb|KFY41308.1|  hypothetical protein V494_03077                       80.1    1e-14   Pseudogymnoascus sp. VKM F-4513 (FW-928)
gb|KFY41539.1|  hypothetical protein V495_04895                       80.1    1e-14   Pseudogymnoascus sp. VKM F-4514 (FW-929)
gb|KFY12701.1|  hypothetical protein V492_03719                       80.1    1e-14   Pseudogymnoascus sp. VKM F-4246
gb|KFX90124.1|  hypothetical protein V490_06643                       80.1    1e-14   Pseudogymnoascus sp. VKM F-3557
gb|KFY85893.1|  hypothetical protein V500_08041                       80.1    1e-14   Pseudogymnoascus sp. VKM F-4518 (FW-2643)
ref|XP_005644633.1|  succinate dehydrogenase                          79.3    1e-14   Coccomyxa subellipsoidea C-169
gb|KFY21799.1|  hypothetical protein V493_07105                       80.1    1e-14   Pseudogymnoascus sp. VKM F-4281 (FW-2241)
ref|XP_007724687.1|  succinate dehydrogenase [ubiquinone] flavopr...  79.7    1e-14   Capronia coronata CBS 617.96
gb|KDQ06748.1|  hypothetical protein BOTBODRAFT_121111                79.7    1e-14   Botryobasidium botryosum FD-172 SS1
ref|XP_006752267.1|  PREDICTED: succinate dehydrogenase [ubiquino...  76.6    2e-14   Leptonychotes weddellii
gb|KFX97497.1|  hypothetical protein O988_04844                       79.3    2e-14   Pseudogymnoascus sp. VKM F-3808
ref|XP_004035042.1|  succinate dehydrogenase, putative                79.3    2e-14   Ichthyophthirius multifiliis
emb|CDH53199.1|  succinate dehydrogenase                              79.3    2e-14   Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_006114284.1|  PREDICTED: succinate dehydrogenase [ubiquino...  77.0    2e-14   
emb|CDH57827.1|  succinate dehydrogenase                              79.3    2e-14   Lichtheimia corymbifera JMRC:FSU:9682
gb|EIE82583.1|  succinate dehydrogenase [ubiquinone] flavoprotein...  79.3    2e-14   Rhizopus delemar RA 99-880
gb|KFZ08763.1|  hypothetical protein V502_09175                       79.3    2e-14   Pseudogymnoascus sp. VKM F-4520 (FW-2644)
gb|EIE88610.1|  succinate dehydrogenase [ubiquinone] flavoprotein...  79.3    2e-14   Rhizopus delemar RA 99-880
ref|XP_003738076.1|  PREDICTED: succinate dehydrogenase [ubiquino...  79.3    2e-14   Galendromus occidentalis
gb|KFY69831.1|  hypothetical protein V499_09711                       79.3    2e-14   Pseudogymnoascus sp. VKM F-103
gb|ELR10143.1|  succinate dehydrogenase flavoprotein subunit, mit...  79.3    2e-14   Pseudogymnoascus destructans 20631-21
ref|XP_447749.1|  hypothetical protein                                79.3    2e-14   [Candida] glabrata
gb|KFY53709.1|  hypothetical protein V496_07397                       79.3    2e-14   Pseudogymnoascus sp. VKM F-4515 (FW-2607)
emb|CDI99717.1|  succinate dehydrogenase (ubiquinone)                 79.3    2e-14   
emb|CDS18948.1|  succinate dehydrogenase ubiquinone                   79.3    2e-14   Echinococcus granulosus
gb|EJY79900.1|  hypothetical protein OXYTRI_22821                     79.0    2e-14   Oxytricha trifallax
gb|EUB62925.1|  Succinate dehydrogenase [ubiquinone] flavoprotein...  79.0    2e-14   Echinococcus granulosus
ref|XP_009206357.1|  PREDICTED: LOW QUALITY PROTEIN: succinate de...  79.0    2e-14   Papio anubis [baboon]
ref|XP_001458195.1|  hypothetical protein                             79.0    2e-14   Paramecium tetraurelia strain d4-2
ref|XP_007443042.1|  PREDICTED: succinate dehydrogenase [ubiquino...  76.3    2e-14   Python bivittatus
gb|KIW38441.1|  succinate dehydrogenase [ubiquinone] flavoprotein...  79.0    2e-14   Exophiala oligosperma
ref|XP_001423305.1|  hypothetical protein                             77.4    2e-14   Paramecium tetraurelia strain d4-2
ref|XP_001434264.1|  hypothetical protein                             79.0    2e-14   Paramecium tetraurelia strain d4-2
ref|XP_006956287.1|  succinate dehydrogenase                          79.0    2e-14   Wallemia mellicola CBS 633.66
ref|XP_002293997.1|  succinate dehydrogenase flavoprotein subunit     79.0    2e-14   Thalassiosira pseudonana CCMP1335
gb|EPY51569.1|  succinate dehydrogenase Sdh1                          79.0    3e-14   Schizosaccharomyces cryophilus OY26
ref|XP_001438472.1|  hypothetical protein                             77.4    3e-14   Paramecium tetraurelia strain d4-2
sp|Q0QF01.2|SDHA_PIG  RecName: Full=Succinate dehydrogenase [ubiq...  79.0    3e-14   Sus scrofa [pigs]
ref|NP_001080770.1|  succinate dehydrogenase [ubiquinone] flavopr...  79.0    3e-14   Xenopus laevis [clawed frog]
emb|CEJ89492.1|  Putative Succinate dehydrogenase, flavoprotein s...  79.0    3e-14   Torrubiella hemipterigena
ref|XP_003443736.1|  PREDICTED: succinate dehydrogenase [ubiquino...  79.0    3e-14   
ref|XP_007411829.1|  hypothetical protein MELLADRAFT_44058            79.0    3e-14   Melampsora larici-populina 98AG31
ref|XP_008577168.1|  PREDICTED: succinate dehydrogenase [ubiquino...  79.0    3e-14   Galeopterus variegatus [Malayan flying lemur]
gb|KIY92921.1|  succinate dehydrogenase (ubiquinone)flavoprotein ...  76.3    3e-14   Monoraphidium neglectum
ref|XP_001610645.1|  succinate dehydrogenase alpha subunit            78.6    3e-14   Babesia bovis T2Bo
ref|XP_001347005.1|  Succinate dehydrogenase                          78.6    3e-14   Paramecium tetraurelia strain d4-2
ref|XP_502696.2|  YALI0D11374p                                        78.6    3e-14   Yarrowia lipolytica CLIB122
ref|XP_007596575.1|  succinate dehydrogenase                          79.0    3e-14   
ref|XP_001908590.1|  hypothetical protein                             78.6    3e-14   Podospora anserina S mat+
ref|XP_007827022.1|  succinate dehydrogenase                          78.6    3e-14   Pestalotiopsis fici W106-1
ref|XP_007486821.1|  PREDICTED: succinate dehydrogenase [ubiquino...  78.6    3e-14   Monodelphis domestica
emb|CEP10579.1|  hypothetical protein                                 78.6    3e-14   Parasitella parasitica
ref|XP_001439561.1|  hypothetical protein                             78.6    3e-14   Paramecium tetraurelia strain d4-2
ref|XP_003658647.1|  hypothetical protein MYCTH_2294679               78.6    3e-14   Thermothelomyces thermophila ATCC 42464
ref|XP_001220862.1|  conserved hypothetical protein                   78.6    3e-14   Chaetomium globosum CBS 148.51
ref|XP_010778035.1|  PREDICTED: succinate dehydrogenase [ubiquino...  78.6    3e-14   Notothenia coriiceps [yellowbelly rockcod]
emb|CCX08923.1|  Similar to Probable succinate dehydrogenase [ubi...  78.6    3e-14   Pyronema omphalodes CBS 100304
ref|XP_007779503.1|  succinate dehydrogenase [ubiquinone] flavopr...  78.6    3e-14   Coniosporium apollinis CBS 100218
gb|EME49868.1|  hypothetical protein DOTSEDRAFT_68607                 78.6    4e-14   Dothistroma septosporum NZE10
emb|CEJ95053.1|  Putative Succinate dehydrogenase Sdh1                78.6    4e-14   Torrubiella hemipterigena
ref|XP_006680864.1|  hypothetical protein BATDEDRAFT_90431            78.6    4e-14   Batrachochytrium dendrobatidis JAM81
gb|EPX73916.1|  succinate dehydrogenase Sdh1                          78.6    4e-14   Schizosaccharomyces octosporus yFS286
ref|XP_001422453.1|  predicted protein                                78.6    4e-14   Ostreococcus lucimarinus CCE9901
ref|XP_007764259.1|  succinate dehydrogenase                          78.6    4e-14   Coniophora puteana RWD-64-598 SS2
emb|CCF47738.1|  succinate dehydrogenase flavoprotein subunit         78.6    4e-14   Colletotrichum higginsianum
gb|AAI05358.1|  SDHA protein                                          78.6    4e-14   Bos taurus [bovine]
gb|KDN66981.1|  putative succinate dehydrogenase                      78.6    4e-14   Colletotrichum sublineola
ref|NP_001083473.1|  succinate dehydrogenase [ubiquinone] flavopr...  78.6    4e-14   Xenopus laevis [clawed frog]
gb|EMP36598.1|  Succinate dehydrogenase [ubiquinone] flavoprotein...  79.0    4e-14   Chelonia mydas [green seaturtle]
gb|KFU88788.1|  hypothetical protein M959_14246                       78.2    4e-14   Chaetura pelagica
ref|XP_006000045.1|  PREDICTED: succinate dehydrogenase [ubiquino...  78.2    4e-14   
gb|EFQ26492.1|  succinate dehydrogenase                               78.2    4e-14   Colletotrichum graminicola M1.001
gb|ELR57152.1|  Succinate dehydrogenase [ubiquinone] flavoprotein...  78.2    4e-14   Bos mutus
ref|XP_005841533.1|  hypothetical protein GUITHDRAFT_159138           78.2    4e-14   Guillardia theta CCMP2712
ref|XP_010740614.1|  PREDICTED: succinate dehydrogenase [ubiquino...  78.2    4e-14   Larimichthys crocea [croceine croaker]
ref|XP_004178307.1|  hypothetical protein TBLA_0A10080                78.2    4e-14   Tetrapisispora blattae CBS 6284
ref|XP_002723240.2|  PREDICTED: LOW QUALITY PROTEIN: succinate de...  78.2    4e-14   
ref|XP_007896310.1|  PREDICTED: succinate dehydrogenase [ubiquino...  78.2    4e-14   Callorhinchus milii [Australian ghost shark]
ref|XP_005894721.1|  PREDICTED: succinate dehydrogenase [ubiquino...  78.2    4e-14   Bos mutus
ref|XP_003958904.1|  hypothetical protein KAFR_0H03590                78.2    4e-14   Kazachstania africana CBS 2517
gb|KFV53858.1|  hypothetical protein N328_10936                       77.0    5e-14   Gavia stellata
ref|XP_002496111.1|  ZYRO0C10736p                                     78.2    5e-14   Zygosaccharomyces rouxii
ref|XP_004625229.1|  PREDICTED: succinate dehydrogenase [ubiquino...  78.2    5e-14   
ref|XP_008023526.1|  hypothetical protein SETTUDRAFT_128655           78.2    5e-14   Exserohilum turcica Et28A
gb|EXV04327.1|  fumarate reductase flavoprotein and FAD binding d...  78.2    5e-14   Metarhizium robertsii
gb|KFQ42751.1|  hypothetical protein N333_03026                       78.2    5e-14   Nestor notabilis
ref|XP_005153461.1|  PREDICTED: succinate dehydrogenase [ubiquino...  78.2    5e-14   Melopsittacus undulatus
gb|KID91213.1|  succinate dehydrogenase flavoprotein subunit prec...  78.2    5e-14   Metarhizium guizhouense ARSEF 977
ref|XP_009810795.1|  PREDICTED: succinate dehydrogenase [ubiquino...  77.4    5e-14   Gavia stellata
gb|EMF16625.1|  succinate dehydrogenase                               78.2    5e-14   Sphaerulina musiva SO2202
gb|KID80181.1|  succinate dehydrogenase flavoprotein subunit prec...  78.2    5e-14   Metarhizium brunneum ARSEF 3297
ref|XP_007807401.1|  succinate dehydrogenase flavoprotein subunit...  78.2    5e-14   Metarhizium acridum CQMa 102
gb|KDQ59570.1|  hypothetical protein JAAARDRAFT_174980                78.2    5e-14   Jaapia argillacea MUCL 33604
ref|XP_003802052.1|  PREDICTED: succinate dehydrogenase [ubiquino...  78.2    5e-14   Otolemur garnettii
ref|NP_001015989.1|  succinate dehydrogenase [ubiquinone] flavopr...  78.2    5e-14   Xenopus tropicalis [western clawed frog]
ref|XP_003443735.1|  PREDICTED: succinate dehydrogenase [ubiquino...  78.2    5e-14   Oreochromis niloticus
gb|KIH86612.1|  succinate dehydrogenase (ubiquinone) flavoprotein...  77.8    5e-14   Sporothrix brasiliensis 5110
gb|ERT03174.1|  succinate dehydrogenase [ubiquinone] flavoprotein...  77.8    5e-14   Sporothrix schenckii ATCC 58251
ref|XP_009856021.1|  succinate dehydrogenase flavoprotein subunit...  77.8    5e-14   Neurospora tetrasperma FGSC 2508
ref|XP_007253128.1|  PREDICTED: succinate dehydrogenase [ubiquino...  78.2    5e-14   Astyanax mexicanus [blind cave fish]
ref|XP_005694950.1|  PREDICTED: LOW QUALITY PROTEIN: succinate de...  77.8    6e-14   
ref|XP_004207738.1|  PREDICTED: probable succinate dehydrogenase ...  75.5    6e-14   
ref|XP_009038442.1|  hypothetical protein AURANDRAFT_37947            77.8    6e-14   Aureococcus anophagefferens
gb|EEH39263.2|  succinate dehydrogenase flavoprotein subunit          77.8    6e-14   Paracoccidioides lutzii Pb01
ref|XP_004597966.1|  PREDICTED: succinate dehydrogenase [ubiquino...  77.8    6e-14   Ochotona princeps [southern American pika]
ref|XP_003759626.1|  PREDICTED: succinate dehydrogenase [ubiquino...  78.2    6e-14   
ref|XP_009822820.1|  succinate dehydrogenase [ubiquinone] flavopr...  77.8    6e-14   Aphanomyces astaci
ref|XP_005943868.1|  PREDICTED: succinate dehydrogenase [ubiquino...  77.8    6e-14   Haplochromis burtoni
ref|XP_006198350.1|  PREDICTED: succinate dehydrogenase [ubiquino...  77.8    6e-14   
ref|XP_002949632.1|  succinate dehydrogenase subunit A, mitochond...  77.8    6e-14   Volvox carteri f. nagariensis
gb|KIW22833.1|  succinate dehydrogenase [ubiquinone] flavoprotein...  77.8    6e-14   Cladophialophora immunda
ref|XP_006794953.1|  PREDICTED: succinate dehydrogenase [ubiquino...  77.8    6e-14   Neolamprologus brichardi [lyretail cichlid]
ref|XP_004566884.1|  PREDICTED: succinate dehydrogenase [ubiquino...  77.8    6e-14   Maylandia zebra
ref|XP_005743318.1|  PREDICTED: succinate dehydrogenase [ubiquino...  77.8    6e-14   
ref|XP_007556052.1|  PREDICTED: succinate dehydrogenase [ubiquino...  77.8    6e-14   
ref|XP_008990539.1|  PREDICTED: succinate dehydrogenase [ubiquino...  77.8    6e-14   
ref|XP_005248388.1|  PREDICTED: succinate dehydrogenase [ubiquino...  77.8    6e-14   
gb|EFB16202.1|  hypothetical protein PANDA_016381                     77.8    6e-14   
gb|KEQ94689.1|  hypothetical protein AUEXF2481DRAFT_30062             77.8    6e-14   
ref|XP_009177174.1|  LOW QUALITY PROTEIN: hypothetical protein T2...  77.8    6e-14   
ref|XP_006000044.1|  PREDICTED: succinate dehydrogenase [ubiquino...  77.8    6e-14   
ref|NP_001126633.1|  succinate dehydrogenase [ubiquinone] flavopr...  77.8    6e-14   
ref|XP_004897665.1|  PREDICTED: succinate dehydrogenase [ubiquino...  77.8    6e-14   
dbj|BAD92228.1|  succinate dehydrogenase complex, subunit A, flav...  77.8    6e-14   
gb|KEQ68526.1|  succinate dehydrogenase                               77.8    6e-14   
gb|KEQ61905.1|  succinate dehydrogenase                               77.8    6e-14   
ref|XP_008430258.1|  PREDICTED: succinate dehydrogenase [ubiquino...  77.8    6e-14   
ref|XP_003310656.1|  PREDICTED: succinate dehydrogenase [ubiquino...  77.8    6e-14   
ref|XP_004017146.1|  PREDICTED: succinate dehydrogenase [ubiquino...  77.8    6e-14   
ref|XP_004897666.1|  PREDICTED: succinate dehydrogenase [ubiquino...  77.8    6e-14   
ref|XP_010878748.1|  PREDICTED: succinate dehydrogenase [ubiquino...  77.8    6e-14   
gb|KEQ80815.1|  succinate dehydrogenase                               77.8    6e-14   
ref|XP_005065480.1|  PREDICTED: succinate dehydrogenase [ubiquino...  77.8    7e-14   
ref|XP_011327122.1|  succinate dehydrogenase flavoprotein subunit     77.8    7e-14   
ref|XP_004992765.1|  succinate dehydrogenase flavoprotein subunit     77.8    7e-14   
ref|XP_006053543.1|  PREDICTED: succinate dehydrogenase [ubiquino...  77.8    7e-14   
sp|Q8HXW3.1|SDHA_MACFA  RecName: Full=Succinate dehydrogenase [ub...  77.8    7e-14   
gb|ABS45038.1|  succinate dehydrogenase complex, subunit A, flavo...  77.8    7e-14   
ref|XP_535807.4|  PREDICTED: succinate dehydrogenase [ubiquinone]...  77.8    7e-14   
sp|P31039.3|SDHA_BOVIN  RecName: Full=Succinate dehydrogenase [ub...  77.8    7e-14   
gb|EYB27594.1|  hypothetical protein FG05_13136                       77.8    7e-14   
ref|XP_009255565.1|  hypothetical protein FPSE_04172                  77.8    7e-14   
ref|XP_005799067.1|  PREDICTED: succinate dehydrogenase [ubiquino...  77.8    7e-14   
ref|XP_001630650.1|  predicted protein                                77.8    7e-14   
ref|XP_011232411.1|  PREDICTED: succinate dehydrogenase [ubiquino...  77.8    7e-14   
ref|XP_004698464.1|  PREDICTED: succinate dehydrogenase [ubiquino...  77.8    7e-14   
emb|CDQ59370.1|  unnamed protein product                              77.8    7e-14   
ref|XP_004077837.1|  PREDICTED: succinate dehydrogenase [ubiquino...  77.8    7e-14   
ref|XP_007520591.1|  PREDICTED: succinate dehydrogenase [ubiquino...  77.8    7e-14   
ref|XP_007087340.1|  PREDICTED: succinate dehydrogenase [ubiquino...  77.8    7e-14   
ref|XP_006053542.1|  PREDICTED: succinate dehydrogenase [ubiquino...  77.8    7e-14   
ref|XP_002926686.1|  PREDICTED: succinate dehydrogenase [ubiquino...  77.8    7e-14   
gb|KHN96326.1|  succinate dehydrogenase flavoprotein subunit          77.8    7e-14   
pdb|1ZOY|A  Chain A, Crystal Structure Of Mitochondrial Respirato...  77.8    7e-14   
dbj|BAI45573.1|  succinate dehydrogenase complex, subunit A, flav...  77.8    7e-14   
gb|AAD51006.1|  succinate dehydrogenase flavoprotein subunit          77.8    7e-14   
gb|AAA20683.1|  succinate dehydrogenase flavoprotein subunit          77.8    7e-14   
ref|XP_007087339.1|  PREDICTED: succinate dehydrogenase [ubiquino...  77.8    7e-14   
gb|KIW51393.1|  succinate dehydrogenase [ubiquinone] flavoprotein...  77.8    7e-14   
ref|XP_008285126.1|  PREDICTED: succinate dehydrogenase [ubiquino...  77.8    7e-14   
gb|EWG47921.1|  succinate dehydrogenase [ubiquinone] flavoprotein...  77.8    7e-14   
ref|XP_004380319.1|  PREDICTED: succinate dehydrogenase [ubiquino...  77.8    7e-14   
ref|NP_004159.2|  succinate dehydrogenase [ubiquinone] flavoprote...  77.8    7e-14   
ref|XP_009447008.1|  PREDICTED: succinate dehydrogenase [ubiquino...  77.8    7e-14   
dbj|GAD97210.1|  succinate dehydrogenase subunit Sdh1, putative       77.8    7e-14   
ref|XP_008077212.1|  FAD/NAD(P)-binding protein                       77.8    7e-14   
ref|XP_004440080.1|  PREDICTED: succinate dehydrogenase [ubiquino...  77.8    7e-14   
ref|XP_003965975.1|  PREDICTED: succinate dehydrogenase [ubiquino...  77.8    7e-14   
pdb|1YQ3|A  Chain A, Avian Respiratory Complex Ii With Oxaloaceta...  77.8    7e-14   
emb|CCE28004.1|  probable succinate dehydrogenase (ubiquinone) fl...  77.8    7e-14   
ref|XP_004274571.1|  PREDICTED: succinate dehydrogenase [ubiquino...  77.8    7e-14   
ref|XP_010968642.1|  PREDICTED: succinate dehydrogenase [ubiquino...  77.8    7e-14   
ref|XP_001263661.1|  succinate dehydrogenase, flavoprotein subunit    77.8    7e-14   
gb|KIL91039.1|  succinate dehydrogenase                               77.8    7e-14   
gb|ELK08185.1|  Succinate dehydrogenase [ubiquinone] flavoprotein...  77.8    7e-14   
ref|XP_007879755.1|  hypothetical protein PFL1_04040                  77.8    7e-14   
ref|NP_776603.1|  succinate dehydrogenase [ubiquinone] flavoprote...  77.8    7e-14   
ref|XP_754832.1|  succinate dehydrogenase subunit Sdh1                77.8    7e-14   
ref|XP_006277023.1|  PREDICTED: succinate dehydrogenase [ubiquino...  77.8    7e-14   
ref|XP_009160044.1|  succinate dehydrogenase [ubiquinone] flavopr...  77.8    7e-14   
emb|CAG12868.1|  unnamed protein product                              77.8    7e-14   
ref|XP_011285521.1|  PREDICTED: succinate dehydrogenase [ubiquino...  77.8    7e-14   
ref|XP_010993759.1|  PREDICTED: succinate dehydrogenase [ubiquino...  77.8    7e-14   
emb|CDS14117.1|  Putative Similar to succinate dehydrogenaseFT fl...  77.4    7e-14   
gb|KFQ97613.1|  hypothetical protein Y956_03360                       77.8    7e-14   
gb|KFQ36963.1|  hypothetical protein N332_11943                       77.8    7e-14   
gb|KFO62090.1|  hypothetical protein N302_14450                       77.8    7e-14   
gb|KFP70936.1|  hypothetical protein N310_07763                       77.4    7e-14   
gb|AAQ91270.1|  succinate dehydrogenase complex, subunit A, flavo...  77.8    7e-14   
ref|XP_008635741.1|  PREDICTED: succinate dehydrogenase [ubiquino...  77.8    7e-14   
ref|XP_005517419.1|  PREDICTED: succinate dehydrogenase [ubiquino...  77.8    7e-14   
ref|XP_003932567.1|  PREDICTED: succinate dehydrogenase [ubiquino...  77.8    7e-14   
dbj|GAC97081.1|  hypothetical protein PHSY_004665                     77.8    7e-14   
ref|XP_007289350.1|  succinate dehydrogenase subunit A                77.8    7e-14   
ref|XP_007959728.1|  PREDICTED: succinate dehydrogenase [ubiquino...  77.4    7e-14   
gb|EPY77719.1|  Succinate dehydrogenase [ubiquinone] flavoprotein...  77.8    7e-14   
gb|KFP56718.1|  hypothetical protein N322_07610                       77.4    7e-14   
gb|EMT65082.1|  Putative succinate dehydrogenase [ubiquinone] fla...  77.8    7e-14   
ref|XP_008706975.1|  PREDICTED: succinate dehydrogenase [ubiquino...  77.8    7e-14   
ref|XP_008489527.1|  PREDICTED: succinate dehydrogenase [ubiquino...  77.8    7e-14   
emb|CCT65624.1|  probable succinate dehydrogenase (ubiquinone) fl...  77.4    7e-14   
ref|XP_008111210.1|  PREDICTED: succinate dehydrogenase [ubiquino...  77.8    7e-14   
gb|KEY82539.1|  succinate dehydrogenase subunit Sdh1                  77.4    7e-14   
ref|XP_003222362.1|  PREDICTED: succinate dehydrogenase [ubiquino...  77.8    7e-14   
ref|XP_010581868.1|  PREDICTED: succinate dehydrogenase [ubiquino...  77.8    7e-14   
ref|NP_001264327.1|  succinate dehydrogenase [ubiquinone] flavopr...  77.8    7e-14   
emb|CBQ70579.1|  probable SDH1-succinate dehydrogenase (ubiquinon...  77.4    7e-14   
ref|XP_007191728.1|  PREDICTED: succinate dehydrogenase [ubiquino...  77.8    7e-14   
ref|XP_005296564.1|  PREDICTED: succinate dehydrogenase [ubiquino...  77.8    7e-14   
gb|KGL79173.1|  hypothetical protein N309_10897                       77.4    7e-14   
ref|XP_005024960.1|  PREDICTED: succinate dehydrogenase [ubiquino...  77.8    7e-14   
gb|KFV94452.1|  hypothetical protein N327_04852                       77.4    8e-14   
gb|EOA97453.1|  Succinate dehydrogenase [ubiquinone] flavoprotein...  77.4    8e-14   
ref|XP_008322167.1|  PREDICTED: succinate dehydrogenase [ubiquino...  77.4    8e-14   
ref|WP_015917402.1|  succinate dehydrogenase                          77.4    8e-14   
ref|XP_008929918.1|  PREDICTED: succinate dehydrogenase [ubiquino...  77.4    8e-14   
ref|XP_010871789.1|  PREDICTED: succinate dehydrogenase [ubiquino...  77.4    8e-14   
gb|KFW87390.1|  hypothetical protein N305_02195                       77.4    8e-14   
gb|KFQ00625.1|  hypothetical protein N330_06548                       77.4    8e-14   
gb|KFO98943.1|  hypothetical protein N300_02759                       77.4    8e-14   
gb|KFO70080.1|  hypothetical protein N303_02487                       77.4    8e-14   
ref|XP_006696117.1|  hypothetical protein CTHT_0057970                77.4    8e-14   
ref|XP_005248386.1|  PREDICTED: succinate dehydrogenase [ubiquino...  77.4    8e-14   
ref|XP_006917234.1|  PREDICTED: succinate dehydrogenase [ubiquino...  77.8    8e-14   
ref|XP_009859687.1|  PREDICTED: succinate dehydrogenase [ubiquino...  77.4    8e-14   
sp|Q9YHT1.2|SDHA_CHICK  RecName: Full=Succinate dehydrogenase [ub...  77.4    8e-14   
ref|XP_005482997.1|  PREDICTED: succinate dehydrogenase [ubiquino...  77.4    8e-14   
gb|KFV94117.1|  hypothetical protein N326_10838                       77.4    8e-14   
gb|KFV66684.1|  hypothetical protein N307_11319                       77.4    8e-14   
gb|KFU99762.1|  hypothetical protein N340_09646                       77.4    8e-14   
gb|KFP35487.1|  hypothetical protein N324_10880                       77.4    8e-14   
gb|EMC82422.1|  Succinate dehydrogenase [ubiquinone] flavoprotein...  77.4    8e-14   
dbj|GAC72599.1|  succinate dehydrogenase, flavoprotein subunit        77.4    8e-14   
gb|KFR02178.1|  hypothetical protein N306_08358                       77.4    8e-14   
gb|KFQ80343.1|  hypothetical protein N337_09224                       77.4    8e-14   
dbj|BAG63797.1|  unnamed protein product                              77.4    8e-14   
gb|AAH41016.1|  SDHA protein                                          77.0    8e-14   
ref|XP_005242930.1|  PREDICTED: succinate dehydrogenase [ubiquino...  77.4    8e-14   
ref|NP_001133088.1|  succinate dehydrogenase [ubiquinone] flavopr...  77.4    8e-14   
gb|KFP18054.1|  hypothetical protein Z169_14842                       77.4    8e-14   
gb|KFO83849.1|  hypothetical protein N320_07491                       77.4    8e-14   
gb|KFO04306.1|  hypothetical protein N312_06102                       77.4    8e-14   
ref|XP_008933390.1|  PREDICTED: succinate dehydrogenase [ubiquino...  77.4    8e-14   
gb|KFM08162.1|  hypothetical protein AS27_00696                       77.4    8e-14   
ref|XP_009447009.1|  PREDICTED: succinate dehydrogenase [ubiquino...  77.4    8e-14   
gb|KFV51667.1|  hypothetical protein N341_07863                       77.4    8e-14   
ref|XP_005041812.1|  PREDICTED: succinate dehydrogenase [ubiquino...  77.4    8e-14   
ref|XP_001248568.1|  succinate dehydrogenase [ubiquinone] flavopr...  77.4    8e-14   
ref|NP_957204.1|  succinate dehydrogenase [ubiquinone] flavoprote...  77.4    8e-14   
gb|KGL93620.1|  hypothetical protein N301_03832                       77.4    8e-14   
dbj|GAN07792.1|  succinate dehydrogenase                              77.4    8e-14   
gb|ACI32957.1|  Succinate dehydrogenase flavoprotein subunit, mit...  77.4    8e-14   
ref|XP_002487966.1|  succinate dehydrogenase subunit Sdh1, putative   77.4    8e-14   
ref|XP_009099409.1|  PREDICTED: succinate dehydrogenase [ubiquino...  77.4    8e-14   
gb|KFW71650.1|  hypothetical protein AS28_14071                       77.4    8e-14   
gb|KFQ67530.1|  hypothetical protein N335_10047                       77.4    8e-14   
gb|KFP93913.1|  hypothetical protein N329_05626                       77.4    8e-14   
ref|XP_005419422.1|  PREDICTED: succinate dehydrogenase [ubiquino...  77.4    8e-14   
gb|ACL50597.1|  succinate dehydrogenase subunit A                     77.4    8e-14   
ref|XP_001553708.1|  conserved hypothetical protein                   77.4    8e-14   
ref|XP_005356790.1|  PREDICTED: succinate dehydrogenase [ubiquino...  77.4    8e-14   
ref|XP_003070866.1|  succinate dehydrogenase flavoprotein subunit...  77.4    8e-14   
ref|XP_009447007.1|  PREDICTED: succinate dehydrogenase [ubiquino...  77.4    8e-14   
gb|KFU97552.1|  hypothetical protein N339_09864                       77.4    8e-14   
ref|XP_008322168.1|  PREDICTED: succinate dehydrogenase [ubiquino...  77.4    8e-14   
gb|ACL50596.1|  succinate dehydrogenase subunit A                     77.4    8e-14   
ref|XP_005356789.1|  PREDICTED: succinate dehydrogenase [ubiquino...  77.4    8e-14   
gb|KFW88808.1|  hypothetical protein N336_10354                       77.4    8e-14   
gb|EST06229.1|  succinate dehydrogenase, flavoprotein subunit         77.4    8e-14   
emb|CDI52111.1|  probable SDH1-succinate dehydrogenase (ubiquinon...  77.4    8e-14   
ref|XP_009278478.1|  PREDICTED: succinate dehydrogenase [ubiquino...  77.4    8e-14   
sp|Q7ZVF3.2|SDHA_DANRE  RecName: Full=Succinate dehydrogenase [ub...  77.4    8e-14   
gb|KFP76780.1|  hypothetical protein N311_12366                       77.4    8e-14   
emb|CDO68875.1|  hypothetical protein BN946_scf185000.g18             77.4    8e-14   
ref|XP_002189477.1|  PREDICTED: succinate dehydrogenase [ubiquino...  77.4    8e-14   
gb|KFP48218.1|  hypothetical protein N323_02368                       77.4    8e-14   
ref|XP_006990092.1|  PREDICTED: succinate dehydrogenase [ubiquino...  77.4    8e-14   
ref|XP_007321927.1|  minor succinate dehydrogenase isozyme, Sdh1p     77.4    8e-14   
gb|KFA66479.1|  hypothetical protein S40285_00756                     77.4    8e-14   
gb|KFM79777.1|  putative succinate dehydrogenase [ubiquinone] fla...  74.7    8e-14   
gb|EMR89101.1|  putative succinate dehydrogenase flavoprotein sub...  77.4    8e-14   
emb|CCD47494.1|  hypothetical protein BofuT4_P006530.1                77.0    8e-14   
gb|KFA71919.1|  hypothetical protein S40288_08745                     77.4    8e-14   
emb|CCF54561.1|  probable SDH1-succinate dehydrogenase (ubiquinon...  77.4    8e-14   
ref|XP_009542285.1|  hypothetical protein HETIRDRAFT_379356           77.4    9e-14   
ref|XP_005340813.1|  PREDICTED: succinate dehydrogenase [ubiquino...  77.4    9e-14   
gb|KFV82234.1|  hypothetical protein N308_03082                       77.4    9e-14   
gb|KFP23995.1|  hypothetical protein N325_09885                       77.4    9e-14   
gb|KEY70670.1|  hypothetical protein S7711_02270                      77.4    9e-14   
ref|XP_011387114.1|  putative succinate dehydrogenase flavoprotei...  77.4    9e-14   
ref|XP_008594321.1|  succinate dehydrogenase flavoprotein subunit     77.4    9e-14   
ref|XP_003656612.1|  hypothetical protein THITE_61645                 77.4    9e-14   
emb|CDS14431.1|  Putative Genomic scaffold, msy_sf_7                  77.4    9e-14   
gb|KIP04793.1|  hypothetical protein PHLGIDRAFT_109109                77.4    9e-14   
ref|XP_005510052.1|  PREDICTED: succinate dehydrogenase [ubiquino...  77.4    9e-14   
ref|XP_007847694.1|  succinate dehydrogenase flavoprotein subunit     77.4    9e-14   
ref|XP_009532904.1|  hypothetical protein PHYSODRAFT_248886           77.4    9e-14   
ref|XP_008167562.1|  PREDICTED: succinate dehydrogenase [ubiquino...  77.4    9e-14   
gb|KIK59746.1|  hypothetical protein GYMLUDRAFT_261747                77.4    9e-14   
ref|XP_004411670.1|  PREDICTED: succinate dehydrogenase [ubiquino...  77.4    9e-14   
ref|XP_003513683.1|  PREDICTED: succinate dehydrogenase [ubiquino...  77.4    9e-14   
ref|XP_001591238.1|  conserved hypothetical protein                   77.4    9e-14   
gb|KIJ54874.1|  hypothetical protein M422DRAFT_24770                  77.4    9e-14   
gb|EGU79334.1|  hypothetical protein FOXB_10163                       77.4    9e-14   
ref|XP_011372206.1|  PREDICTED: succinate dehydrogenase [ubiquino...  77.4    9e-14   
ref|XP_007276272.1|  succinate dehydrogenase flavoprotein subunit     77.4    9e-14   
ref|XP_005407043.1|  PREDICTED: succinate dehydrogenase [ubiquino...  77.4    1e-13   
ref|XP_005407041.1|  PREDICTED: succinate dehydrogenase [ubiquino...  77.4    1e-13   
ref|NP_569112.1|  succinate dehydrogenase [ubiquinone] flavoprote...  77.4    1e-13   
gb|EGW09041.1|  Succinate dehydrogenase [ubiquinone] flavoprotein...  77.4    1e-13   
ref|XP_006019061.1|  PREDICTED: LOW QUALITY PROTEIN: succinate de...  77.4    1e-13   
gb|ENH88419.1|  succinate dehydrogenase                               77.4    1e-13   
ref|XP_003462152.1|  PREDICTED: succinate dehydrogenase [ubiquino...  77.4    1e-13   
ref|XP_003839233.1|  similar to succinate dehydrogenase flavoprot...  77.4    1e-13   
gb|KIK49372.1|  hypothetical protein CY34DRAFT_797317                 77.4    1e-13   
gb|EQB59172.1|  hypothetical protein CGLO_00469                       77.4    1e-13   
gb|KFO38502.1|  Succinate dehydrogenase [ubiquinone] flavoprotein...  77.4    1e-13   
ref|XP_010602550.1|  PREDICTED: succinate dehydrogenase [ubiquino...  77.4    1e-13   
ref|XP_005407042.1|  PREDICTED: succinate dehydrogenase [ubiquino...  77.4    1e-13   
ref|WP_037164826.1|  MULTISPECIES: fumarate reductase                 77.0    1e-13   
ref|WP_029617457.1|  fumarate reductase                               77.0    1e-13   
dbj|BAE26754.1|  unnamed protein product                              77.0    1e-13   
emb|CDW91390.1|  succinate dehydrogenase                              77.0    1e-13   
gb|EKG22188.1|  Fumarate reductase/succinate dehydrogenase FAD-bi...  77.0    1e-13   
ref|XP_004478573.1|  PREDICTED: LOW QUALITY PROTEIN: succinate de...  77.0    1e-13   
ref|XP_007580355.1|  putative succinate dehydrogenase flavoprotei...  77.0    1e-13   
gb|KIM97751.1|  hypothetical protein OIDMADRAFT_202859                77.0    1e-13   
gb|EWC45945.1|  mitochondrial putative succinate dehydrogenase ub...  77.0    1e-13   
ref|XP_003718957.1|  hypothetical protein MGG_00168                   77.0    1e-13   
ref|XP_005659088.1|  PREDICTED: LOW QUALITY PROTEIN: succinate de...  75.9    1e-13   
ref|XP_007913169.1|  putative succinate dehydrogenase flavoprotei...  77.0    1e-13   
ref|XP_011121810.1|  hypothetical protein AOL_s00078g245              77.0    1e-13   
ref|XP_003857174.1|  succinate dehydrogenase flavoprotein subunit     77.0    1e-13   
gb|KIX99088.1|  succinate dehydrogenase [ubiquinone] flavoprotein...  77.0    1e-13   



>ref|XP_009794665.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial isoform X2 [Nicotiana sylvestris]
Length=629

 Score =   150 bits (378),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 91/98 (93%), Positives = 93/98 (95%), Gaps = 0/98 (0%)
 Frame = +3

Query  69   MWRCVSRGLRIPSDRSIAGRSHFRRLFSSQTNVGGSSYTVVDHTYDavvvgaggaglraa  248
            MWRCVSRGLR  S+RSI+G  HFRRLFSSQTNVGGSSYTVVDHTYDAVVVGAGGAGLRAA
Sbjct  1    MWRCVSRGLRASSNRSISGGGHFRRLFSSQTNVGGSSYTVVDHTYDAVVVGAGGAGLRAA  60

Query  249  igLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            IGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NMT
Sbjct  61   IGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMT  98



>ref|XP_004232400.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial [Solanum lycopersicum]
Length=629

 Score =   150 bits (378),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 91/98 (93%), Positives = 93/98 (95%), Gaps = 0/98 (0%)
 Frame = +3

Query  69   MWRCVSRGLRIPSDRSIAGRSHFRRLFSSQTNVGGSSYTVVDHTYDavvvgaggaglraa  248
            MWRCVSRGLR  S+RSI+G  HFRRLFSSQTNVGGSSYTVVDHTYDAVVVGAGGAGLRAA
Sbjct  1    MWRCVSRGLRASSNRSISGGGHFRRLFSSQTNVGGSSYTVVDHTYDAVVVGAGGAGLRAA  60

Query  249  igLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            IGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NMT
Sbjct  61   IGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMT  98



>ref|XP_009624858.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial [Nicotiana tomentosiformis]
Length=629

 Score =   147 bits (372),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 89/98 (91%), Positives = 93/98 (95%), Gaps = 0/98 (0%)
 Frame = +3

Query  69   MWRCVSRGLRIPSDRSIAGRSHFRRLFSSQTNVGGSSYTVVDHTYDavvvgaggaglraa  248
            MWRCVSRGLR  S+RSI+G  HFRRLFSSQTNVGGSSYTVVDHTYDAVVVGAGGAGLRAA
Sbjct  1    MWRCVSRGLRASSNRSISGGGHFRRLFSSQTNVGGSSYTVVDHTYDAVVVGAGGAGLRAA  60

Query  249  igLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            IGLSEHGFNTAC+TKLFPTRSHTVAAQGGINAAL NM+
Sbjct  61   IGLSEHGFNTACLTKLFPTRSHTVAAQGGINAALGNMS  98



>ref|XP_009794664.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial isoform X1 [Nicotiana sylvestris]
Length=630

 Score =   145 bits (366),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 91/99 (92%), Positives = 93/99 (94%), Gaps = 1/99 (1%)
 Frame = +3

Query  69   MWRCVSRGLRIPSDRSIAGRSHFRRLFSSQT-NVGGSSYTVVDHTYDavvvgaggaglra  245
            MWRCVSRGLR  S+RSI+G  HFRRLFSSQT NVGGSSYTVVDHTYDAVVVGAGGAGLRA
Sbjct  1    MWRCVSRGLRASSNRSISGGGHFRRLFSSQTANVGGSSYTVVDHTYDAVVVGAGGAGLRA  60

Query  246  aigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            AIGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NMT
Sbjct  61   AIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMT  99



>ref|XP_006340609.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial-like [Solanum tuberosum]
Length=630

 Score =   144 bits (364),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 90/99 (91%), Positives = 93/99 (94%), Gaps = 1/99 (1%)
 Frame = +3

Query  69   MWRCVSRGLRIPSDRSIAGRS-HFRRLFSSQTNVGGSSYTVVDHTYDavvvgaggaglra  245
            MWRCVSRGLR  S+RSI+G   HFRRLFSSQTNVGGSSYT+VDHTYDAVVVGAGGAGLRA
Sbjct  1    MWRCVSRGLRASSNRSISGGGGHFRRLFSSQTNVGGSSYTIVDHTYDAVVVGAGGAGLRA  60

Query  246  aigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            AIGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NMT
Sbjct  61   AIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMT  99



>emb|CDP02029.1| unnamed protein product [Coffea canephora]
Length=632

 Score =   131 bits (329),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 86/101 (85%), Gaps = 3/101 (3%)
 Frame = +3

Query  69   MWRCVSRGLRIPSDRSIAG---RSHFRRLFSSQTNVGGSSYTVVDHTYDavvvgaggagl  239
            MWRCVSRGL I   RSIAG   R    RLFS+Q NV GS YTVVDHTYDAVVVGAGGAGL
Sbjct  1    MWRCVSRGLGISPKRSIAGDSFRPLINRLFSAQANVAGSDYTVVDHTYDAVVVGAGGAGL  60

Query  240  raaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            RAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NMT
Sbjct  61   RAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMT  101



>ref|XP_011099603.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit, mitochondrial [Sesamum indicum]
Length=628

 Score =   130 bits (327),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 83/98 (85%), Positives = 86/98 (88%), Gaps = 1/98 (1%)
 Frame = +3

Query  69   MWRCVSRGLRIPSDRSIAGRSHFRRLFSSQTNVGGSSYTVVDHTYDavvvgaggaglraa  248
            MWRCVSRGLRIPS  S +     RRLFS+Q+N G  SYTVVDHTYDAVVVGAGGAGLRAA
Sbjct  1    MWRCVSRGLRIPSKNSTSAFP-VRRLFSNQSNAGAPSYTVVDHTYDAVVVGAGGAGLRAA  59

Query  249  igLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            IGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NMT
Sbjct  60   IGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMT  97



>ref|XP_008241667.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial [Prunus mume]
Length=633

 Score =   125 bits (314),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 83/102 (81%), Positives = 89/102 (87%), Gaps = 4/102 (4%)
 Frame = +3

Query  69   MWRCVSRGLRIP-SDRSIAG---RSHFRRLFSSQTNVGGSSYTVVDHTYDavvvgaggag  236
            MWRCVSR L +P S RS++    RSHF RLFS+++  G SSYTVVDHTYDAVVVGAGGAG
Sbjct  1    MWRCVSRRLGVPYSQRSVSSDSLRSHFSRLFSTESATGRSSYTVVDHTYDAVVVGAGGAG  60

Query  237  lraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            LRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NMT
Sbjct  61   LRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMT  102



>ref|XP_009371587.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit, mitochondrial [Pyrus x bretschneideri]
Length=633

 Score =   125 bits (314),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 84/102 (82%), Positives = 88/102 (86%), Gaps = 4/102 (4%)
 Frame = +3

Query  69   MWRCVSRGLRIPS-DRSIAG---RSHFRRLFSSQTNVGGSSYTVVDHTYDavvvgaggag  236
            MWRCVSRGL + S  RS +G   RSHF RLFSS++  G S YTVVDHTYDAVVVGAGGAG
Sbjct  1    MWRCVSRGLGVSSSKRSASGDSLRSHFSRLFSSESATGRSPYTVVDHTYDAVVVGAGGAG  60

Query  237  lraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            LRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NMT
Sbjct  61   LRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMT  102



>ref|XP_008338100.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit, mitochondrial [Malus domestica]
Length=633

 Score =   125 bits (314),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 84/102 (82%), Positives = 88/102 (86%), Gaps = 4/102 (4%)
 Frame = +3

Query  69   MWRCVSRGLRIPS-DRSIAG---RSHFRRLFSSQTNVGGSSYTVVDHTYDavvvgaggag  236
            MWRCVSRGL + S  RS +G   RSHF RLFSS++  G S YTVVDHTYDAVVVGAGGAG
Sbjct  1    MWRCVSRGLGVSSSKRSASGDSLRSHFPRLFSSESATGRSPYTVVDHTYDAVVVGAGGAG  60

Query  237  lraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            LRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NMT
Sbjct  61   LRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMT  102



>ref|XP_008344291.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial, partial [Malus domestica]
Length=626

 Score =   125 bits (313),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 86/102 (84%), Gaps = 4/102 (4%)
 Frame = +3

Query  69   MWRCVSRGLRIPSDRSIAG----RSHFRRLFSSQTNVGGSSYTVVDHTYDavvvgaggag  236
            MWRCVSRGL + S +  A     RSHF RLFSS++  G S YTVVDHTYDAVVVGAGGAG
Sbjct  1    MWRCVSRGLGVSSSKRSASTDSLRSHFSRLFSSESATGRSPYTVVDHTYDAVVVGAGGAG  60

Query  237  lraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            LRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NMT
Sbjct  61   LRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMT  102



>ref|XP_008338495.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial [Malus domestica]
Length=633

 Score =   125 bits (313),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 86/102 (84%), Gaps = 4/102 (4%)
 Frame = +3

Query  69   MWRCVSRGLRIPSDRSIAG----RSHFRRLFSSQTNVGGSSYTVVDHTYDavvvgaggag  236
            MWRCVSRGL + S +  A     RSHF RLFSS++  G S YTVVDHTYDAVVVGAGGAG
Sbjct  1    MWRCVSRGLGVSSSKRSASTDSLRSHFSRLFSSESATGRSPYTVVDHTYDAVVVGAGGAG  60

Query  237  lraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            LRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NMT
Sbjct  61   LRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMT  102



>ref|XP_011097110.1| PREDICTED: LOW QUALITY PROTEIN: succinate dehydrogenase [ubiquinone] 
flavoprotein subunit 1, mitochondrial-like [Sesamum 
indicum]
Length=627

 Score =   124 bits (312),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 85/98 (87%), Gaps = 1/98 (1%)
 Frame = +3

Query  69   MWRCVSRGLRIPSDRSIAGRSHFRRLFSSQTNVGGSSYTVVDHTYDavvvgaggaglraa  248
            MWRCVSRGLRIPS +S +  +   R FS+Q+N    SYTVVDHTYDAVVVGAGGAGLRAA
Sbjct  1    MWRCVSRGLRIPSKKSTSA-APISRFFSAQSNGATPSYTVVDHTYDAVVVGAGGAGLRAA  59

Query  249  igLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            IGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NMT
Sbjct  60   IGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMT  97



>ref|XP_004170583.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial-like, partial [Cucumis sativus]
Length=186

 Score =   117 bits (293),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 81/107 (76%), Positives = 84/107 (79%), Gaps = 12/107 (11%)
 Frame = +3

Query  69   MWRCVSRGLRI---------PSDRSIAGRSHFRRLFSSQTNVGGSSYTVVDHTYDavvvg  221
            MWRCVSRGLR          P+D     RS F R FS+ +  G SSYTVVDHTYDAVVVG
Sbjct  1    MWRCVSRGLRASSSFSRKSSPNDHL---RSQFSRFFSADSTAGRSSYTVVDHTYDAVVVG  57

Query  222  aggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            AGGAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NMT
Sbjct  58   AGGAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMT  104



>ref|XP_004287904.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial [Fragaria vesca subsp. vesca]
Length=634

 Score =   123 bits (308),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 84/103 (82%), Positives = 87/103 (84%), Gaps = 5/103 (5%)
 Frame = +3

Query  69   MWRCVSRGLRIPS-DRSIAG----RSHFRRLFSSQTNVGGSSYTVVDHTYDavvvgagga  233
            MWRCVSR L + S  RS+A     RSHF RLFSS +  G SSYTVVDHTYDAVVVGAGGA
Sbjct  1    MWRCVSRRLGVSSPSRSVAANDSLRSHFSRLFSSDSATGRSSYTVVDHTYDAVVVGAGGA  60

Query  234  glraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            GLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NMT
Sbjct  61   GLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMT  103



>ref|XP_009350004.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial [Pyrus x bretschneideri]
Length=633

 Score =   122 bits (307),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 86/102 (84%), Gaps = 4/102 (4%)
 Frame = +3

Query  69   MWRCVSRGLRIPSDRSIAG----RSHFRRLFSSQTNVGGSSYTVVDHTYDavvvgaggag  236
            MWRCVSRGL + S +  A     RS+F RLFSS++  G S YTVVDHTYDAVVVGAGGAG
Sbjct  1    MWRCVSRGLGVSSSKRSASTDSLRSYFSRLFSSESATGRSPYTVVDHTYDAVVVGAGGAG  60

Query  237  lraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            LRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NMT
Sbjct  61   LRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMT  102



>ref|XP_010547500.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial [Tarenaya hassleriana]
Length=633

 Score =   122 bits (307),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 85/102 (83%), Gaps = 4/102 (4%)
 Frame = +3

Query  69   MWRCVSRGLRIPSDRSIAGRSH----FRRLFSSQTNVGGSSYTVVDHTYDavvvgaggag  236
            MWRCVSRGLR+PS R+     H    F R FS+ +  G SSYT+VDHTYDAVVVGAGGAG
Sbjct  1    MWRCVSRGLRVPSSRTSFFNDHSGSRFSRFFSTGSTEGRSSYTIVDHTYDAVVVGAGGAG  60

Query  237  lraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            LRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NMT
Sbjct  61   LRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMT  102



>ref|XP_002310225.1| Succinate dehydrogenase flavoprotein subunit [Populus trichocarpa]
 gb|EEE90675.1| Succinate dehydrogenase flavoprotein subunit [Populus trichocarpa]
Length=633

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 87/102 (85%), Gaps = 4/102 (4%)
 Frame = +3

Query  69   MWRCVSRGLRIP--SDRS--IAGRSHFRRLFSSQTNVGGSSYTVVDHTYDavvvgaggag  236
            MWRCV+RGLR+P  + RS   + RSH  R FS+ T  G SSYTVVDHTYDAVVVGAGGAG
Sbjct  1    MWRCVARGLRLPCSTKRSSNDSFRSHISRFFSTDTTGGRSSYTVVDHTYDAVVVGAGGAG  60

Query  237  lraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            LRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NMT
Sbjct  61   LRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMT  102



>ref|XP_007202009.1| hypothetical protein PRUPE_ppa002787mg [Prunus persica]
 gb|EMJ03208.1| hypothetical protein PRUPE_ppa002787mg [Prunus persica]
Length=633

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 86/102 (84%), Gaps = 4/102 (4%)
 Frame = +3

Query  69   MWRCVSRGLRIPSDRSIAG----RSHFRRLFSSQTNVGGSSYTVVDHTYDavvvgaggag  236
            MWRCVSR L +PS +        RSHF RLFS+++  G SSYTVVDHTYDAVVVGAGGAG
Sbjct  1    MWRCVSRRLGVPSSQRSVSSDSLRSHFSRLFSTESATGRSSYTVVDHTYDAVVVGAGGAG  60

Query  237  lraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            LRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NMT
Sbjct  61   LRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMT  102



>ref|XP_010679713.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit, mitochondrial [Beta vulgaris subsp. vulgaris]
Length=635

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 90/104 (87%), Gaps = 6/104 (6%)
 Frame = +3

Query  69   MWRCVSRGLR-----IPSDRSIAGRSHFRRLFSSQTN-VGGSSYTVVDHTYDavvvgagg  230
            MWRCV+RG R       ++ SI+ +S F RLFSS+++ VGG+SYTVVDHTYDAVVVGAGG
Sbjct  1    MWRCVTRGFRSHSWKTSNNPSISSQSPFSRLFSSESSAVGGASYTVVDHTYDAVVVGAGG  60

Query  231  aglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            AGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NMT
Sbjct  61   AGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMT  104



>gb|EYU29489.1| hypothetical protein MIMGU_mgv1a0028801mg, partial [Erythranthe 
guttata]
 gb|EYU29490.1| hypothetical protein MIMGU_mgv1a0028801mg, partial [Erythranthe 
guttata]
Length=86

 Score =   112 bits (280),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 73/87 (84%), Positives = 77/87 (89%), Gaps = 1/87 (1%)
 Frame = +3

Query  69   MWRCVSRGLRIPSDRSIAGRSHFRRLFSSQTNVGGSSYTVVDHTYDavvvgaggaglraa  248
            MWRCVSRGLRIPS +S +  S  RRLFS+Q+N    SYTVVDHTYDAVVVGAGGAGLRAA
Sbjct  1    MWRCVSRGLRIPSRKSTSADS-IRRLFSTQSNDAAPSYTVVDHTYDAVVVGAGGAGLRAA  59

Query  249  igLSEHGFNTACITKLFPTRSHTVAAQ  329
            IGLSEHGFNTACITKLFPTRSHTVAAQ
Sbjct  60   IGLSEHGFNTACITKLFPTRSHTVAAQ  86



>ref|XP_011025771.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial [Populus euphratica]
Length=633

 Score =   120 bits (301),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 87/102 (85%), Gaps = 4/102 (4%)
 Frame = +3

Query  69   MWRCVSRGLRIP--SDRS--IAGRSHFRRLFSSQTNVGGSSYTVVDHTYDavvvgaggag  236
            MWRCV+RGLR+P  + RS   + RSH  R FS+ +  G SSYTVVDHTYDAVVVGAGGAG
Sbjct  1    MWRCVARGLRLPCSTKRSSNDSFRSHISRFFSTDSTGGRSSYTVVDHTYDAVVVGAGGAG  60

Query  237  lraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            LRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NMT
Sbjct  61   LRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMT  102



>gb|EYU29491.1| hypothetical protein MIMGU_mgv1a025296mg [Erythranthe guttata]
Length=117

 Score =   112 bits (280),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 75/96 (78%), Positives = 81/96 (84%), Gaps = 1/96 (1%)
 Frame = +3

Query  69   MWRCVSRGLRIPSDRSIAGRSHFRRLFSSQTNVGGSSYTVVDHTYDavvvgaggaglraa  248
            MWRCVSRGLRIPS +S +  S  RRLFS+Q+N    SYTVVDHTYDAVVVGAGGAGLRAA
Sbjct  1    MWRCVSRGLRIPSRKSTSADS-IRRLFSTQSNDAAPSYTVVDHTYDAVVVGAGGAGLRAA  59

Query  249  igLSEHGFNTACITKLFPTRSHTVAAQGGINAALRN  356
            IGLSEHGFNTACITKLFPTRSHTVAAQ  + + L N
Sbjct  60   IGLSEHGFNTACITKLFPTRSHTVAAQLFMLSYLTN  95



>ref|XP_008453738.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial [Cucumis melo]
Length=635

 Score =   119 bits (299),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 83/104 (80%), Gaps = 6/104 (6%)
 Frame = +3

Query  69   MWRCVSRGLRIPSDRSIAG------RSHFRRLFSSQTNVGGSSYTVVDHTYDavvvgagg  230
            MWRCVSRGLR  S  S         RS F R FS+ +  G SSYTVVDHTYDAVVVGAGG
Sbjct  1    MWRCVSRGLRASSSFSTKSPPNDHLRSQFSRFFSADSTAGRSSYTVVDHTYDAVVVGAGG  60

Query  231  aglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            AGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NMT
Sbjct  61   AGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMT  104



>ref|XP_006383209.1| hypothetical protein POPTR_0005s12530g [Populus trichocarpa]
 gb|ERP61006.1| hypothetical protein POPTR_0005s12530g [Populus trichocarpa]
Length=638

 Score =   119 bits (298),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 85/105 (81%), Gaps = 7/105 (7%)
 Frame = +3

Query  69   MWRCVSRGLRIPSDRSIAG-------RSHFRRLFSSQTNVGGSSYTVVDHTYDavvvgag  227
            MWRCV+RGLR+PS  S          R H  R FS+ +  GGSSYTVVDHTYDAVVVGAG
Sbjct  1    MWRCVARGLRLPSSSSSTKILSNDSFRFHSTRFFSADSTGGGSSYTVVDHTYDAVVVGAG  60

Query  228  gaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            GAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NMT
Sbjct  61   GAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMT  105



>gb|KGN53253.1| hypothetical protein Csa_4G038700 [Cucumis sativus]
Length=635

 Score =   118 bits (295),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 81/107 (76%), Positives = 84/107 (79%), Gaps = 12/107 (11%)
 Frame = +3

Query  69   MWRCVSRGLRI---------PSDRSIAGRSHFRRLFSSQTNVGGSSYTVVDHTYDavvvg  221
            MWRCVSRGLR          P+D     RS F R FS+ +  G SSYTVVDHTYDAVVVG
Sbjct  1    MWRCVSRGLRASSSFSRKSSPNDHL---RSQFSRFFSADSTAGRSSYTVVDHTYDAVVVG  57

Query  222  aggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            AGGAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NMT
Sbjct  58   AGGAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMT  104



>ref|XP_004149154.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial-like [Cucumis sativus]
Length=635

 Score =   118 bits (295),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 81/107 (76%), Positives = 84/107 (79%), Gaps = 12/107 (11%)
 Frame = +3

Query  69   MWRCVSRGLR---------IPSDRSIAGRSHFRRLFSSQTNVGGSSYTVVDHTYDavvvg  221
            MWRCVSRGLR          P+D     RS F R FS+ +  G SSYTVVDHTYDAVVVG
Sbjct  1    MWRCVSRGLRASSSFSRKSSPNDHL---RSQFSRFFSADSTAGRSSYTVVDHTYDAVVVG  57

Query  222  aggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            AGGAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NMT
Sbjct  58   AGGAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMT  104



>gb|KHG24771.1| SDH1-1: Succinate dehydrogenase [ubiquinone] flavoprotein subunit 
1, mitochondrial [Gossypium arboreum]
Length=616

 Score =   117 bits (293),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 85/102 (83%), Gaps = 7/102 (7%)
 Frame = +3

Query  69   MWRCVSRGLRIP-SDRSIAG---RSHFRRLFSSQTNVGGSSYTVVDHTYDavvvgaggag  236
            MWRCVSR LRIP S RS++    RSHF R FS+ +   G  YT+VDHTYDAVVVGAGGAG
Sbjct  1    MWRCVSRSLRIPYSKRSVSNDTVRSHFSRFFSTGS---GREYTIVDHTYDAVVVGAGGAG  57

Query  237  lraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            LRAAIGLSEHGF TACITKLFPTRSHTVAAQGGINAAL NMT
Sbjct  58   LRAAIGLSEHGFKTACITKLFPTRSHTVAAQGGINAALGNMT  99



>gb|KHG24770.1| SDH1-1: Succinate dehydrogenase [ubiquinone] flavoprotein subunit 
1, mitochondrial [Gossypium arboreum]
Length=636

 Score =   117 bits (293),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 85/102 (83%), Gaps = 7/102 (7%)
 Frame = +3

Query  69   MWRCVSRGLRIP-SDRSIAG---RSHFRRLFSSQTNVGGSSYTVVDHTYDavvvgaggag  236
            MWRCVSR LRIP S RS++    RSHF R FS+ +   G  YT+VDHTYDAVVVGAGGAG
Sbjct  1    MWRCVSRSLRIPYSKRSVSNDTVRSHFSRFFSTGS---GREYTIVDHTYDAVVVGAGGAG  57

Query  237  lraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            LRAAIGLSEHGF TACITKLFPTRSHTVAAQGGINAAL NMT
Sbjct  58   LRAAIGLSEHGFKTACITKLFPTRSHTVAAQGGINAALGNMT  99



>ref|XP_003517234.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial-like isoform 1 [Glycine max]
Length=630

 Score =   117 bits (292),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 85/102 (83%), Gaps = 7/102 (7%)
 Frame = +3

Query  69   MWRCVSRGLRIP-SDRSIAGRS---HFRRLFSSQTNVGGSSYTVVDHTYDavvvgaggag  236
            MWRC++RGLR P S RS +  S   HF R FSS  N   SSYTVVDHTYDAVVVGAGGAG
Sbjct  1    MWRCIARGLRGPASTRSTSNHSLGSHFYRFFSSGAN---SSYTVVDHTYDAVVVGAGGAG  57

Query  237  lraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            LRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NMT
Sbjct  58   LRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMT  99



>gb|KHN36125.1| Succinate dehydrogenase [ubiquinone] flavoprotein subunit 1, 
mitochondrial [Glycine soja]
Length=627

 Score =   117 bits (292),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 85/102 (83%), Gaps = 7/102 (7%)
 Frame = +3

Query  69   MWRCVSRGLRIP-SDRSIAGRS---HFRRLFSSQTNVGGSSYTVVDHTYDavvvgaggag  236
            MWRC++RGLR P S RS +  S   HF R FSS  N   SSYTVVDHTYDAVVVGAGGAG
Sbjct  1    MWRCIARGLRGPASTRSTSNHSLGSHFYRFFSSGAN---SSYTVVDHTYDAVVVGAGGAG  57

Query  237  lraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            LRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NMT
Sbjct  58   LRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMT  99



>ref|XP_004512040.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial-like [Cicer arietinum]
Length=623

 Score =   117 bits (292),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 79/98 (81%), Positives = 82/98 (84%), Gaps = 6/98 (6%)
 Frame = +3

Query  69   MWRCVSRGLRIPSDRSIAGRSHFRRLFSSQTNVGGSSYTVVDHTYDavvvgaggaglraa  248
            MWRCV+RGLR  S  +   RSH  R FSS  N   SSYTVVDHTYDA+VVGAGGAGLRAA
Sbjct  1    MWRCVARGLRASSSNT---RSHVSRFFSSGVN---SSYTVVDHTYDAIVVGAGGAGLRAA  54

Query  249  igLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            IGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NMT
Sbjct  55   IGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMT  92



>ref|XP_009103488.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial isoform X1 [Brassica rapa]
 emb|CDY53847.1| BnaA07g37420D [Brassica napus]
Length=627

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 81/98 (83%), Gaps = 2/98 (2%)
 Frame = +3

Query  69   MWRCVSRGLRIPSDRSIAGRSHFRRLFSSQTNVGGSSYTVVDHTYDavvvgaggaglraa  248
            MWRCVSR LR+PS R+    S F R  S+ +  G   YT+VDHTYDAVVVGAGGAGLRAA
Sbjct  1    MWRCVSRSLRVPSSRTSLSGSRFSRFLSTGSQTG--DYTIVDHTYDAVVVGAGGAGLRAA  58

Query  249  igLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            IGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NM+
Sbjct  59   IGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMS  96



>ref|XP_006280112.1| hypothetical protein CARUB_v10026004mg, partial [Capsella rubella]
 gb|EOA13010.1| hypothetical protein CARUB_v10026004mg, partial [Capsella rubella]
Length=689

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 77/109 (71%), Positives = 88/109 (81%), Gaps = 7/109 (6%)
 Frame = +3

Query  54   QNLQEMWRCVSRGLRIPSDRS------IAGRSHFRRLFSSQTNVGGSSYTVVDHTYDavv  215
            ++  +MWRCVSRG R PS ++      ++G S F R FS+ +    SSYT+VDHTYDAVV
Sbjct  51   ESTTKMWRCVSRGFRAPSSKTSSLFDGVSG-SRFSRFFSTGSTDTKSSYTIVDHTYDAVV  109

Query  216  vgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            VGAGGAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NM+
Sbjct  110  VGAGGAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMS  158



>ref|XP_010484716.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial-like [Camelina sativa]
Length=529

 Score =   114 bits (286),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 85/104 (82%), Gaps = 7/104 (7%)
 Frame = +3

Query  69   MWRCVSRGLRIPSDRS------IAGRSHFRRLFSSQTNVGGSSYTVVDHTYDavvvgagg  230
            MWRCVSRG R PS ++      ++G S F R FS+ +    SSYT+VDHTYDAVVVGAGG
Sbjct  1    MWRCVSRGFRAPSSKTSSLFDGVSG-SRFPRFFSTGSTDTKSSYTIVDHTYDAVVVGAGG  59

Query  231  aglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            AGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NM+
Sbjct  60   AGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMS  103



>ref|XP_011003741.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial-like [Populus euphratica]
Length=636

 Score =   115 bits (288),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 84/105 (80%), Gaps = 7/105 (7%)
 Frame = +3

Query  69   MWRCVSRGLRIPSDRSIAG-------RSHFRRLFSSQTNVGGSSYTVVDHTYDavvvgag  227
            MWRCV+RGLR+PS  S          RSH  R FS+ +    SSYTVVDHTYDAVVVGAG
Sbjct  1    MWRCVARGLRLPSSSSSTKILSNDSFRSHSTRFFSADSTGERSSYTVVDHTYDAVVVGAG  60

Query  228  gaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            GAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NMT
Sbjct  61   GAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMT  105



>ref|XP_010550391.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial [Tarenaya hassleriana]
Length=634

 Score =   115 bits (288),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 78/103 (76%), Positives = 83/103 (81%), Gaps = 5/103 (5%)
 Frame = +3

Query  69   MWRCVSRGLRIPSDRSIA-----GRSHFRRLFSSQTNVGGSSYTVVDHTYDavvvgagga  233
            MWRCVSRGLR+ S    +       S F R FS+ +  G SSYT+VDHTYDAVVVGAGGA
Sbjct  1    MWRCVSRGLRVASSSRTSLFDGHSGSRFSRFFSTGSTGGRSSYTIVDHTYDAVVVGAGGA  60

Query  234  glraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            GLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NMT
Sbjct  61   GLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALANMT  103



>gb|KJB17788.1| hypothetical protein B456_003G015500 [Gossypium raimondii]
Length=630

 Score =   115 bits (287),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 79/102 (77%), Positives = 84/102 (82%), Gaps = 7/102 (7%)
 Frame = +3

Query  69   MWRCVSRGLRIP-SDRSIAG---RSHFRRLFSSQTNVGGSSYTVVDHTYDavvvgaggag  236
            MWRCVSR LR P S RS++    RSHF R FS+ +   G  YT+VDHTYDAVVVGAGGAG
Sbjct  1    MWRCVSRSLRTPFSKRSVSNDTVRSHFSRFFSTGS---GREYTIVDHTYDAVVVGAGGAG  57

Query  237  lraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            LRAAIGLSEHGF TACITKLFPTRSHTVAAQGGINAAL NMT
Sbjct  58   LRAAIGLSEHGFKTACITKLFPTRSHTVAAQGGINAALGNMT  99



>gb|KDO79531.1| hypothetical protein CISIN_1g046556mg [Citrus sinensis]
Length=633

 Score =   114 bits (286),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 80/104 (77%), Positives = 86/104 (83%), Gaps = 9/104 (9%)
 Frame = +3

Query  69   MWRCVSRGLRIPS---DRSIAG---RSHFRRLFSSQTNVGGSSYTVVDHTYDavvvgagg  230
            MWRCVSRGL + S    RS++    RSHF RLFS+ +  G   YT+VDHTYDAVVVGAGG
Sbjct  1    MWRCVSRGLGLSSYRSKRSVSNDSLRSHFSRLFSTNSTGG---YTIVDHTYDAVVVGAGG  57

Query  231  aglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            AGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NMT
Sbjct  58   AGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMT  101



>ref|XP_006425687.1| hypothetical protein CICLE_v10025149mg [Citrus clementina]
 ref|XP_006466784.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit, mitochondrial-like [Citrus sinensis]
 gb|ESR38927.1| hypothetical protein CICLE_v10025149mg [Citrus clementina]
Length=632

 Score =   114 bits (286),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 80/104 (77%), Positives = 86/104 (83%), Gaps = 9/104 (9%)
 Frame = +3

Query  69   MWRCVSRGLRIPS---DRSIAG---RSHFRRLFSSQTNVGGSSYTVVDHTYDavvvgagg  230
            MWRCVSRGL + S    RS++    RSHF RLFS+ +  G   YT+VDHTYDAVVVGAGG
Sbjct  1    MWRCVSRGLGLSSYRSKRSVSNDSLRSHFSRLFSTNSTGG---YTIVDHTYDAVVVGAGG  57

Query  231  aglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            AGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NMT
Sbjct  58   AGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMT  101



>ref|XP_010444735.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial isoform X1 [Camelina sativa]
 ref|XP_010444737.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial isoform X3 [Camelina sativa]
Length=634

 Score =   114 bits (286),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 85/104 (82%), Gaps = 7/104 (7%)
 Frame = +3

Query  69   MWRCVSRGLRIPSDRS------IAGRSHFRRLFSSQTNVGGSSYTVVDHTYDavvvgagg  230
            MWRCVSRG R PS ++      ++G S F R FS+ +    SSYT+VDHTYDAVVVGAGG
Sbjct  1    MWRCVSRGFRAPSSKTSSLFDGVSG-SRFPRFFSTGSTDTKSSYTIVDHTYDAVVVGAGG  59

Query  231  aglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            AGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NM+
Sbjct  60   AGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMS  103



>emb|CDY30754.1| BnaC07g16540D [Brassica napus]
Length=627

 Score =   114 bits (286),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 80/98 (82%), Gaps = 2/98 (2%)
 Frame = +3

Query  69   MWRCVSRGLRIPSDRSIAGRSHFRRLFSSQTNVGGSSYTVVDHTYDavvvgaggaglraa  248
            MWRCVSR LR PS R+    S F R  S+ +  G   YT+VDHTYDAVVVGAGGAGLRAA
Sbjct  1    MWRCVSRSLRAPSSRTSLSGSRFSRFLSTGSQTG--DYTIVDHTYDAVVVGAGGAGLRAA  58

Query  249  igLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            IGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NM+
Sbjct  59   IGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMS  96



>ref|XP_002866741.1| succinate dehydrogenase 1-1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43000.1| succinate dehydrogenase 1-1 [Arabidopsis lyrata subsp. lyrata]
Length=634

 Score =   114 bits (285),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 85/104 (82%), Gaps = 7/104 (7%)
 Frame = +3

Query  69   MWRCVSRGLRIPSDRS------IAGRSHFRRLFSSQTNVGGSSYTVVDHTYDavvvgagg  230
            MWRCVSRG R PS ++      ++G S F R FS+ +    SSYT+VDHTYDAVVVGAGG
Sbjct  1    MWRCVSRGFRAPSSKTSSLFDGVSG-SRFSRFFSTGSTDTRSSYTIVDHTYDAVVVGAGG  59

Query  231  aglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            AGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NM+
Sbjct  60   AGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMS  103



>gb|KHF98130.1| Succinate dehydrogenase [ubiquinone] flavoprotein subunit 1, 
mitochondrial -like protein [Gossypium arboreum]
Length=621

 Score =   114 bits (285),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 77/99 (78%), Positives = 82/99 (83%), Gaps = 1/99 (1%)
 Frame = +3

Query  69   MWRCVSRGLRIP-SDRSIAGRSHFRRLFSSQTNVGGSSYTVVDHTYDavvvgaggaglra  245
            MWRCVSR LR P S+RS+A  S    + S  +   GS YT+VDHTYDAVVVGAGGAGLRA
Sbjct  1    MWRCVSRSLRAPYSNRSVAANSLRSNISSFFSTYAGSPYTIVDHTYDAVVVGAGGAGLRA  60

Query  246  aigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            AIGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NMT
Sbjct  61   AIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMT  99



>gb|ADZ75464.1| succinate dehydrogenase [Litchi chinensis]
Length=628

 Score =   114 bits (284),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 84/101 (83%), Gaps = 7/101 (7%)
 Frame = +3

Query  69   MWRCVSRGLRIPSDRSIAG---RSHFRRLFSSQTNVGGSSYTVVDHTYDavvvgaggagl  239
            MWRCVSRGL   S RSI+    RSH  RLFS+ +  G   YTVVDHTYDAVVVGAGGAGL
Sbjct  1    MWRCVSRGLGF-SKRSISNDSIRSHIPRLFSTDSTGG---YTVVDHTYDAVVVGAGGAGL  56

Query  240  raaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            RAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NMT
Sbjct  57   RAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMT  97



>gb|KJB48417.1| hypothetical protein B456_008G068200 [Gossypium raimondii]
Length=630

 Score =   114 bits (284),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 79/102 (77%), Positives = 84/102 (82%), Gaps = 7/102 (7%)
 Frame = +3

Query  69   MWRCVSRGLRIP-SDRSIAG---RSHFRRLFSSQTNVGGSSYTVVDHTYDavvvgaggag  236
            MWRCVSR LR P S+RS+A    RS+    FS+     GS YT+VDHTYDAVVVGAGGAG
Sbjct  1    MWRCVSRSLRAPYSNRSVAANSLRSNISSFFSTH---AGSPYTIVDHTYDAVVVGAGGAG  57

Query  237  lraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            LRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NMT
Sbjct  58   LRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMT  99



>gb|KJB48416.1| hypothetical protein B456_008G068200 [Gossypium raimondii]
Length=628

 Score =   114 bits (284),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 79/102 (77%), Positives = 84/102 (82%), Gaps = 7/102 (7%)
 Frame = +3

Query  69   MWRCVSRGLRIP-SDRSIAG---RSHFRRLFSSQTNVGGSSYTVVDHTYDavvvgaggag  236
            MWRCVSR LR P S+RS+A    RS+    FS+     GS YT+VDHTYDAVVVGAGGAG
Sbjct  1    MWRCVSRSLRAPYSNRSVAANSLRSNISSFFSTH---AGSPYTIVDHTYDAVVVGAGGAG  57

Query  237  lraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            LRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NMT
Sbjct  58   LRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMT  99



>ref|XP_009103489.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial isoform X2 [Brassica rapa]
Length=626

 Score =   113 bits (282),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 80/98 (82%), Gaps = 3/98 (3%)
 Frame = +3

Query  69   MWRCVSRGLRIPSDRSIAGRSHFRRLFSSQTNVGGSSYTVVDHTYDavvvgaggaglraa  248
            MWRCVSR LR+PS R+    S F R  S+ +      YT+VDHTYDAVVVGAGGAGLRAA
Sbjct  1    MWRCVSRSLRVPSSRTSLSGSRFSRFLSTGST---GDYTIVDHTYDAVVVGAGGAGLRAA  57

Query  249  igLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            IGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NM+
Sbjct  58   IGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMS  95



>ref|NP_201477.1| succinate dehydrogenase [ubiquinone] flavoprotein subunit 1 [Arabidopsis 
thaliana]
 sp|O82663.1|SDHA1_ARATH RecName: Full=Succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial; AltName: Full=Flavoprotein subunit 
1 of complex II; Short=FP; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAK32928.1|AF367341_1 AT5g66760/MSN2_16 [Arabidopsis thaliana]
 gb|AAL32015.1|AF436833_1 AT5g66760/MSN2_16 [Arabidopsis thaliana]
 emb|CAA05025.1| succinate dehydrogenase flavoprotein alpha subunit [Arabidopsis 
thaliana]
 dbj|BAA97282.1| succinate dehydrogenase flavoprotein alpha subunit [Arabidopsis 
thaliana]
 gb|AAK74032.1| AT5g66760/MSN2_16 [Arabidopsis thaliana]
 gb|AAM70521.1| AT5g66760/MSN2_16 [Arabidopsis thaliana]
 gb|AED98260.1| succinate dehydrogenase [ubiquinone] flavoprotein subunit 1 [Arabidopsis 
thaliana]
Length=634

 Score =   113 bits (282),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 76/104 (73%), Positives = 85/104 (82%), Gaps = 7/104 (7%)
 Frame = +3

Query  69   MWRCVSRGLRIPSDRS------IAGRSHFRRLFSSQTNVGGSSYTVVDHTYDavvvgagg  230
            MWRCVSRG R P+ ++      ++G S F R FS+ +    SSYT+VDHTYDAVVVGAGG
Sbjct  1    MWRCVSRGFRAPASKTSSLFDGVSG-SRFSRFFSTGSTDTRSSYTIVDHTYDAVVVGAGG  59

Query  231  aglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            AGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NM+
Sbjct  60   AGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMS  103



>gb|KHN41982.1| Succinate dehydrogenase [ubiquinone] flavoprotein subunit 1, 
mitochondrial [Glycine soja]
Length=627

 Score =   112 bits (281),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 83/102 (81%), Gaps = 7/102 (7%)
 Frame = +3

Query  69   MWRCVSRGLRIP-SDRSIAGRS---HFRRLFSSQTNVGGSSYTVVDHTYDavvvgaggag  236
            MWRC++RGLR P S RS +  S      R FSS  N   SSYTVVDHTYDAVVVGAGGAG
Sbjct  1    MWRCIARGLRGPASTRSTSNHSLGSQLSRFFSSGAN---SSYTVVDHTYDAVVVGAGGAG  57

Query  237  lraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            LRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NMT
Sbjct  58   LRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMT  99



>ref|XP_003537582.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial-like isoform 1 [Glycine max]
Length=630

 Score =   112 bits (281),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 83/102 (81%), Gaps = 7/102 (7%)
 Frame = +3

Query  69   MWRCVSRGLRIP-SDRSIAGRS---HFRRLFSSQTNVGGSSYTVVDHTYDavvvgaggag  236
            MWRC++RGLR P S RS +  S      R FSS  N   SSYTVVDHTYDAVVVGAGGAG
Sbjct  1    MWRCIARGLRGPASTRSTSNHSLGSQLSRFFSSGAN---SSYTVVDHTYDAVVVGAGGAG  57

Query  237  lraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            LRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NMT
Sbjct  58   LRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMT  99



>ref|XP_010464904.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial-like isoform X1 [Camelina sativa]
 ref|XP_010464913.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial-like isoform X2 [Camelina sativa]
 ref|XP_010464922.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial-like isoform X3 [Camelina sativa]
Length=634

 Score =   112 bits (280),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 76/104 (73%), Positives = 84/104 (81%), Gaps = 7/104 (7%)
 Frame = +3

Query  69   MWRCVSRGLRIPSDRS------IAGRSHFRRLFSSQTNVGGSSYTVVDHTYDavvvgagg  230
            MWRCVSR  R PS ++      ++G S F R FS+ +    SSYT+VDHTYDAVVVGAGG
Sbjct  1    MWRCVSRSFRAPSSKTSSLFDGVSG-SRFSRFFSTGSTDTKSSYTIVDHTYDAVVVGAGG  59

Query  231  aglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            AGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NM+
Sbjct  60   AGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMS  103



>ref|XP_003518027.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial-like [Glycine max]
Length=634

 Score =   112 bits (279),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 79/103 (77%), Positives = 83/103 (81%), Gaps = 5/103 (5%)
 Frame = +3

Query  69   MWRCVSRGLRIP-SDRSIAG----RSHFRRLFSSQTNVGGSSYTVVDHTYDavvvgagga  233
            MWRCV+R +R+P S+RSI      RSH  R FS     G SSY VVDH YDAVVVGAGGA
Sbjct  1    MWRCVARAIRVPASERSIPNHQPLRSHISRFFSGGGGGGSSSYNVVDHKYDAVVVGAGGA  60

Query  234  glraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            GLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NMT
Sbjct  61   GLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMT  103



>ref|XP_010113491.1| Succinate dehydrogenase [ubiquinone] flavoprotein subunit 1 [Morus 
notabilis]
 gb|EXC35518.1| Succinate dehydrogenase [ubiquinone] flavoprotein subunit 1 [Morus 
notabilis]
Length=627

 Score =   111 bits (277),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 85/109 (78%), Positives = 88/109 (81%), Gaps = 11/109 (10%)
 Frame = +3

Query  69   MWRCVSRGLRIPS--------DRSIAG---RSHFRRLFSSQTNVGGSSYTVVDHTYDavv  215
            MWRCVSRGLRIPS        +RS+     RS   R FSS +  GGSSYTVVDHTYDAVV
Sbjct  1    MWRCVSRGLRIPSSSSSSSSSNRSLLNGSLRSRISRFFSSGSAPGGSSYTVVDHTYDAVV  60

Query  216  vgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            VGAGGAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NMT
Sbjct  61   VGAGGAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMT  109



>ref|XP_007046958.1| Succinate dehydrogenase 1-1 isoform 2 [Theobroma cacao]
 gb|EOX91115.1| Succinate dehydrogenase 1-1 isoform 2 [Theobroma cacao]
Length=473

 Score =   109 bits (273),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 76/102 (75%), Positives = 84/102 (82%), Gaps = 6/102 (6%)
 Frame = +3

Query  69   MWRCVSRGLRIP-SDRSIAG---RSHFRRLFSSQTNVGGSSYTVVDHTYDavvvgaggag  236
            MWRCVSR LR+P S RS++    RSH  +   +++    S YT+VDHTYDAVVVGAGGAG
Sbjct  1    MWRCVSRSLRVPYSKRSVSYDSLRSHISKFLDNESVR--SPYTIVDHTYDAVVVGAGGAG  58

Query  237  lraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            LRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NMT
Sbjct  59   LRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMT  100



>gb|KDP30152.1| hypothetical protein JCGZ_18113 [Jatropha curcas]
Length=639

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 77/112 (69%), Positives = 85/112 (76%), Gaps = 18/112 (16%)
 Frame = +3

Query  69   MWRCVSRGLRIP--------------SDRSIAGRSHFRRLFSSQTNVGGSSYTVVDHTYD  206
            MWRCV+R +R+P              S+ S+  RSH  R FS+Q+  G   YT+VDHTYD
Sbjct  1    MWRCVARAVRVPSCSSSSFSASNKSISNDSL--RSHIPRFFSTQSTAG--QYTIVDHTYD  56

Query  207  avvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            AVVVGAGGAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NMT
Sbjct  57   AVVVGAGGAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMT  108



>gb|KEH27558.1| succinate dehydrogenase [ubiquinone] flavoprotein subunit [Medicago 
truncatula]
Length=593

 Score =   110 bits (275),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 77/103 (75%), Positives = 82/103 (80%), Gaps = 13/103 (13%)
 Frame = +3

Query  69   MWRCVSRGLRIP-----SDRSIAGRSHFRRLFSSQTNVGGSSYTVVDHTYDavvvgagga  233
            MWRCV+RGLR+P     S+ S+  R    R FSS+      SYTVVDH YDAVVVGAGGA
Sbjct  1    MWRCVARGLRVPRSSNRSNNSLGSR--LSRFFSSE------SYTVVDHKYDAVVVGAGGA  52

Query  234  glraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            GLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NMT
Sbjct  53   GLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMT  95



>ref|XP_003611986.1| Succinate dehydrogenase [Medicago truncatula]
 gb|AES94944.1| succinate dehydrogenase [ubiquinone] flavoprotein subunit [Medicago 
truncatula]
Length=626

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 77/103 (75%), Positives = 82/103 (80%), Gaps = 13/103 (13%)
 Frame = +3

Query  69   MWRCVSRGLRIP-----SDRSIAGRSHFRRLFSSQTNVGGSSYTVVDHTYDavvvgagga  233
            MWRCV+RGLR+P     S+ S+  R    R FSS+      SYTVVDH YDAVVVGAGGA
Sbjct  1    MWRCVARGLRVPRSSNRSNNSLGSR--LSRFFSSE------SYTVVDHKYDAVVVGAGGA  52

Query  234  glraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            GLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NMT
Sbjct  53   GLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMT  95



>ref|XP_007046957.1| Succinate dehydrogenase 1-1 isoform 1 [Theobroma cacao]
 gb|EOX91114.1| Succinate dehydrogenase 1-1 isoform 1 [Theobroma cacao]
Length=631

 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 76/102 (75%), Positives = 84/102 (82%), Gaps = 6/102 (6%)
 Frame = +3

Query  69   MWRCVSRGLRIP-SDRSIAG---RSHFRRLFSSQTNVGGSSYTVVDHTYDavvvgaggag  236
            MWRCVSR LR+P S RS++    RSH  +   +++    S YT+VDHTYDAVVVGAGGAG
Sbjct  1    MWRCVSRSLRVPYSKRSVSYDSLRSHISKFLDNESVR--SPYTIVDHTYDAVVVGAGGAG  58

Query  237  lraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            LRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NMT
Sbjct  59   LRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMT  100



>emb|CDY49839.1| BnaC02g43980D [Brassica napus]
Length=628

 Score =   110 bits (274),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 76/99 (77%), Positives = 82/99 (83%), Gaps = 3/99 (3%)
 Frame = +3

Query  69   MWRCVSRGLRIPSDRSIAGRS-HFRRLFSSQTNVGGSSYTVVDHTYDavvvgaggaglra  245
            MWRCVSR LR+PS R+ +     F R FSS +  G   YT+VDHTYDAVVVGAGGAGLRA
Sbjct  1    MWRCVSRSLRVPSSRNSSLSGSRFPRFFSSASQTG--DYTIVDHTYDAVVVGAGGAGLRA  58

Query  246  aigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            AIGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NM+
Sbjct  59   AIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMS  97



>gb|EPS73058.1| hypothetical protein M569_01696, partial [Genlisea aurea]
Length=324

 Score =   107 bits (267),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 70/76 (92%), Positives = 73/76 (96%), Gaps = 1/76 (1%)
 Frame = +3

Query  135  FRRLFSSQTNVGGSSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSH  314
            FRRLFSSQ+N GG+ YTVVDHTYDA+VVGAGGAGLRAAIGLSEHGFNTACITKLFPTRSH
Sbjct  7    FRRLFSSQSN-GGAEYTVVDHTYDAIVVGAGGAGLRAAIGLSEHGFNTACITKLFPTRSH  65

Query  315  TVAAQGGINAALRNMT  362
            TVAAQGGINAAL NMT
Sbjct  66   TVAAQGGINAALGNMT  81



>ref|XP_009406751.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit, mitochondrial-like [Musa acuminata subsp. malaccensis]
Length=635

 Score =   109 bits (272),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 76/104 (73%), Positives = 84/104 (81%), Gaps = 6/104 (6%)
 Frame = +3

Query  69   MWR-CVSRGLRIPSDRSIAGRSHFRRLFSSQTNV-----GGSSYTVVDHTYDavvvgagg  230
            MWR CVSR LR PS+++  G +  R   S+  N+     G +SYT+VDHTYDAVVVGAGG
Sbjct  1    MWRSCVSRALRFPSNKASIGGASIRSSQSASRNLSTGSDGRNSYTIVDHTYDAVVVGAGG  60

Query  231  aglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            AGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NMT
Sbjct  61   AGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMT  104



>ref|XP_006393871.1| hypothetical protein EUTSA_v10003821mg [Eutrema salsugineum]
 dbj|BAJ33900.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ31157.1| hypothetical protein EUTSA_v10003821mg [Eutrema salsugineum]
Length=626

 Score =   109 bits (272),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 73/98 (74%), Positives = 78/98 (80%), Gaps = 3/98 (3%)
 Frame = +3

Query  69   MWRCVSRGLRIPSDRSIAGRSHFRRLFSSQTNVGGSSYTVVDHTYDavvvgaggaglraa  248
            MWRCVSR LR P  R+    S   RLFS+ +      Y +VDHTYDAVVVGAGGAGLRAA
Sbjct  1    MWRCVSRSLRAPYSRTSLSGSRISRLFSTGST---DDYKIVDHTYDAVVVGAGGAGLRAA  57

Query  249  igLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            IGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NM+
Sbjct  58   IGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMS  95



>ref|XP_002530482.1| succinate dehydrogenase, putative [Ricinus communis]
 gb|EEF31905.1| succinate dehydrogenase, putative [Ricinus communis]
Length=622

 Score =   108 bits (269),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 79/98 (81%), Gaps = 7/98 (7%)
 Frame = +3

Query  69   MWRCVSRGLRIPSDRSIAGRSHFRRLFSSQTNVGGSSYTVVDHTYDavvvgaggaglraa  248
            MWRCV+RGLR+PS  S              ++ G SSYT+VDHTYDAVVVGAGGAGLRAA
Sbjct  1    MWRCVARGLRVPSSSSKK-------SIYYDSSAGQSSYTIVDHTYDAVVVGAGGAGLRAA  53

Query  249  igLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            IGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NMT
Sbjct  54   IGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMT  91



>ref|XP_010029813.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial [Eucalyptus grandis]
Length=627

 Score =   108 bits (269),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 74/102 (73%), Positives = 80/102 (78%), Gaps = 10/102 (10%)
 Frame = +3

Query  69   MWRCVSRGLRIPSDRSIAG----RSHFRRLFSSQTNVGGSSYTVVDHTYDavvvgaggag  236
            MWRC++RGLR P+     G    RS   R FSS+      SYT+VDH YDAVVVGAGGAG
Sbjct  1    MWRCIARGLRSPASSGGGGGGSLRSRVSRFFSSE------SYTIVDHKYDAVVVGAGGAG  54

Query  237  lraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            LRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NM+
Sbjct  55   LRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMS  96



>ref|XP_006409150.1| hypothetical protein EUTSA_v10022591mg [Eutrema salsugineum]
 gb|ESQ50603.1| hypothetical protein EUTSA_v10022591mg [Eutrema salsugineum]
Length=634

 Score =   106 bits (264),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 76/105 (72%), Positives = 81/105 (77%), Gaps = 9/105 (9%)
 Frame = +3

Query  69   MWRCVSRGLRIPSD-----RSIAG--RSHFRRLFSSQTNVGGSSYTVVDHTYDavvvgag  227
            MWRCV R LR+PS       S  G   S   R FS+++  G   YT+VDHTYDAVVVGAG
Sbjct  1    MWRCVPRRLRVPSSSTRRSESNGGFVSSQVSRFFSARSKTG--VYTIVDHTYDAVVVGAG  58

Query  228  gaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            GAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NMT
Sbjct  59   GAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMT  103



>ref|XP_004509253.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial-like isoform X2 [Cicer arietinum]
Length=582

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 75/99 (76%), Positives = 80/99 (81%), Gaps = 4/99 (4%)
 Frame = +3

Query  69   MWRCVSRGLRIPSDRSIAG-RSHFRRLFSSQTNVGGSSYTVVDHTYDavvvgaggaglra  245
            MWR VSR +   S+ ++   RSHF R FSS    G SSY VVDH YDAVVVGAGGAGLRA
Sbjct  1    MWRFVSRTISERSNPNLQPLRSHFSRFFSSG---GNSSYNVVDHKYDAVVVGAGGAGLRA  57

Query  246  aigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            AIGLSEHGFNTAC+TKLFPTRSHTVAAQGGINAAL NMT
Sbjct  58   AIGLSEHGFNTACVTKLFPTRSHTVAAQGGINAALGNMT  96



>ref|XP_004509252.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial-like isoform X1 [Cicer arietinum]
Length=627

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 75/99 (76%), Positives = 80/99 (81%), Gaps = 4/99 (4%)
 Frame = +3

Query  69   MWRCVSRGLRIPSDRSIAG-RSHFRRLFSSQTNVGGSSYTVVDHTYDavvvgaggaglra  245
            MWR VSR +   S+ ++   RSHF R FSS    G SSY VVDH YDAVVVGAGGAGLRA
Sbjct  1    MWRFVSRTISERSNPNLQPLRSHFSRFFSSG---GNSSYNVVDHKYDAVVVGAGGAGLRA  57

Query  246  aigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            AIGLSEHGFNTAC+TKLFPTRSHTVAAQGGINAAL NMT
Sbjct  58   AIGLSEHGFNTACVTKLFPTRSHTVAAQGGINAALGNMT  96



>ref|XP_007156937.1| hypothetical protein PHAVU_002G029800g [Phaseolus vulgaris]
 gb|ESW28931.1| hypothetical protein PHAVU_002G029800g [Phaseolus vulgaris]
Length=631

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 76/103 (74%), Positives = 81/103 (79%), Gaps = 8/103 (8%)
 Frame = +3

Query  69   MWRCVSRGLR--IPSDRSIAGRSH---FRRLFSSQTNVGGSSYTVVDHTYDavvvgagga  233
            MWRC++RGLR    + RS +   H     R FSS  N   +SYTVVDHTYDAVVVGAGGA
Sbjct  1    MWRCIARGLRGAASTTRSTSNHPHGSYPSRFFSSGVN---NSYTVVDHTYDAVVVGAGGA  57

Query  234  glraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            GLRAAIGLSEHGF TACITKLFPTRSHTVAAQGGINAAL NMT
Sbjct  58   GLRAAIGLSEHGFKTACITKLFPTRSHTVAAQGGINAALGNMT  100



>gb|KFK28359.1| succinate dehydrogenase [Arabis alpina]
Length=629

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 79/98 (81%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = +3

Query  69   MWRCVSRGLRIPSDRSIAGRSHFRRLFSSQTNVGGSSYTVVDHTYDavvvgaggaglraa  248
            MWRCVSR LR PS R+    S F R FSS ++ G SSYT+VDHTYDAVVVGAGGAGLRAA
Sbjct  1    MWRCVSRSLRAPSSRTSLSGSRFSRFFSSGSSDGRSSYTIVDHTYDAVVVGAGGAGLRAA  60

Query  249  igLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            IGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NM+
Sbjct  61   IGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMS  98



>ref|XP_010263680.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit, mitochondrial isoform X1 [Nelumbo nucifera]
Length=637

 Score =   103 bits (258),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 76/106 (72%), Positives = 82/106 (77%), Gaps = 8/106 (8%)
 Frame = +3

Query  69   MWRCVSRGLRIPSDRSIAGRSHFR--------RLFSSQTNVGGSSYTVVDHTYDavvvga  224
            MWRCVSRGL +    S + RS           R  S+++  G SSYT+VDHTYDAVVVGA
Sbjct  1    MWRCVSRGLGLSPSSSSSKRSISSEPLKRLTTRFLSTESTGGRSSYTIVDHTYDAVVVGA  60

Query  225  ggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            GGAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NMT
Sbjct  61   GGAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMT  106



>ref|XP_009112333.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial-like isoform X2 [Brassica rapa]
Length=627

 Score =   103 bits (258),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 82/98 (84%), Gaps = 2/98 (2%)
 Frame = +3

Query  69   MWRCVSRGLRIPSDRSIAGRSHFRRLFSSQTNVGGSSYTVVDHTYDavvvgaggaglraa  248
            MWRCVSR LR PS R+    S F R FSS ++ G   YT+VDHTYDAVVVGAGGAGLRAA
Sbjct  1    MWRCVSRSLRAPSSRTSLSGSRFSRFFSSSSSTG--DYTIVDHTYDAVVVGAGGAGLRAA  58

Query  249  igLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            IGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NM+
Sbjct  59   IGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMS  96



>emb|CDY57124.1| BnaA09g52600D [Brassica napus]
Length=627

 Score =   103 bits (258),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 82/98 (84%), Gaps = 2/98 (2%)
 Frame = +3

Query  69   MWRCVSRGLRIPSDRSIAGRSHFRRLFSSQTNVGGSSYTVVDHTYDavvvgaggaglraa  248
            MWRCVSR LR PS R+    S F R FSS ++ G   YT+VDHTYDAVVVGAGGAGLRAA
Sbjct  1    MWRCVSRSLRAPSSRTSLSGSRFSRFFSSSSSTG--DYTIVDHTYDAVVVGAGGAGLRAA  58

Query  249  igLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            IGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NM+
Sbjct  59   IGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMS  96



>ref|XP_004981574.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit, mitochondrial-like isoform X1 [Setaria italica]
Length=620

 Score =   102 bits (255),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 77/99 (78%), Positives = 79/99 (80%), Gaps = 11/99 (11%)
 Frame = +3

Query  69   MWR-CVSRGLRIPSDRSIAGRSHFRRLFSSQTNVGGSSYTVVDHTYDavvvgaggaglra  245
            MWR CVSRGLR     + A R     LFS+      SSYTVVDHTYDAVVVGAGGAGLRA
Sbjct  1    MWRSCVSRGLRKAQAAASASR-----LFSTS-----SSYTVVDHTYDAVVVGAGGAGLRA  50

Query  246  aigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            AIGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NMT
Sbjct  51   AIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMT  89



>ref|XP_009112332.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial-like isoform X1 [Brassica rapa]
Length=628

 Score =   102 bits (255),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 76/99 (77%), Positives = 81/99 (82%), Gaps = 3/99 (3%)
 Frame = +3

Query  69   MWRCVSRGLRIPSDR-SIAGRSHFRRLFSSQTNVGGSSYTVVDHTYDavvvgaggaglra  245
            MWRCVSR LR PS R S++G    R   SS +  G   YT+VDHTYDAVVVGAGGAGLRA
Sbjct  1    MWRCVSRSLRAPSSRTSLSGSRFSRFFSSSSSQTG--DYTIVDHTYDAVVVGAGGAGLRA  58

Query  246  aigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            AIGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NM+
Sbjct  59   AIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMS  97



>ref|XP_002463806.1| hypothetical protein SORBIDRAFT_01g006490 [Sorghum bicolor]
 gb|EER90804.1| hypothetical protein SORBIDRAFT_01g006490 [Sorghum bicolor]
Length=620

 Score =   102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 75/99 (76%), Positives = 79/99 (80%), Gaps = 11/99 (11%)
 Frame = +3

Query  69   MWR-CVSRGLRIPSDRSIAGRSHFRRLFSSQTNVGGSSYTVVDHTYDavvvgaggaglra  245
            MWR CVSRGLR      +   +   RLFS+      SSYTVVDHTYDAVVVGAGGAGLRA
Sbjct  1    MWRGCVSRGLR-----KVKAAASASRLFSTS-----SSYTVVDHTYDAVVVGAGGAGLRA  50

Query  246  aigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            AIGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NM+
Sbjct  51   AIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMS  89



>ref|XP_008787307.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit, mitochondrial-like [Phoenix dactylifera]
Length=633

 Score =   102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 76/104 (73%), Positives = 80/104 (77%), Gaps = 8/104 (8%)
 Frame = +3

Query  69   MWR-CVSRGLRIPSDRSIAGRSHFRRL-----FSSQTNVGGSSYTVVDHTYDavvvgagg  230
            MWR CVSR LR+ S ++  G    RR      F S  + G   YTVVDHTYDAVVVGAGG
Sbjct  1    MWRSCVSRSLRLSSKKASIGGQPIRRYPSRPRFFSTNSFG--QYTVVDHTYDAVVVGAGG  58

Query  231  aglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            AGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NMT
Sbjct  59   AGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMT  102



>ref|XP_010942844.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit, mitochondrial isoform X2 [Elaeis guineensis]
Length=618

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 78/105 (74%), Positives = 82/105 (78%), Gaps = 9/105 (9%)
 Frame = +3

Query  69   MWR-CVSRGLRIPS-DRSIAGRSHFRR-----LFSSQTNVGGSSYTVVDHTYDavvvgag  227
            MWR CVSRGLR+ S  ++  GR   R       F S  +VG   YTVVDHTYDAVVVGAG
Sbjct  1    MWRSCVSRGLRLLSCKKASIGRQPIRHSPSTPRFLSTNSVG--QYTVVDHTYDAVVVGAG  58

Query  228  gaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            GAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NMT
Sbjct  59   GAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMT  103



>ref|XP_010942839.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit, mitochondrial isoform X1 [Elaeis guineensis]
Length=634

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 78/105 (74%), Positives = 82/105 (78%), Gaps = 9/105 (9%)
 Frame = +3

Query  69   MWR-CVSRGLRIPS-DRSIAGRSHFRR-----LFSSQTNVGGSSYTVVDHTYDavvvgag  227
            MWR CVSRGLR+ S  ++  GR   R       F S  +VG   YTVVDHTYDAVVVGAG
Sbjct  1    MWRSCVSRGLRLLSCKKASIGRQPIRHSPSTPRFLSTNSVG--QYTVVDHTYDAVVVGAG  58

Query  228  gaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            GAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NMT
Sbjct  59   GAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMT  103



>ref|XP_010942023.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit, mitochondrial-like [Elaeis guineensis]
Length=633

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 75/102 (74%), Positives = 80/102 (78%), Gaps = 4/102 (4%)
 Frame = +3

Query  69   MWR-CVSRGLRIPSDRSIAGRSHFRRLFSSQTNVGGSS---YTVVDHTYDavvvgaggag  236
            MWR CVSR LR+ S ++  G    RR  S+   +   S   YTVVDHTYDAVVVGAGGAG
Sbjct  1    MWRSCVSRALRLSSRKASIGGQPIRRSRSTPRFLSTDSFGQYTVVDHTYDAVVVGAGGAG  60

Query  237  lraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            LRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NMT
Sbjct  61   LRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMT  102



>ref|XP_010254866.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit, mitochondrial-like [Nelumbo nucifera]
Length=634

 Score =   100 bits (250),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 74/105 (70%), Positives = 80/105 (76%), Gaps = 9/105 (9%)
 Frame = +3

Query  69   MWRCVSRGLRIPSDRSIAG-------RSHFRRLFSSQTNVGGSSYTVVDHTYDavvvgag  227
            MWRCVSRG R+ S  S          +    R FS+Q+     SYT+VDHTYDAVVVGAG
Sbjct  1    MWRCVSRGFRLSSSASSKRSISSEPLKPLISRFFSTQSPR--LSYTIVDHTYDAVVVGAG  58

Query  228  gaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            GAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NM+
Sbjct  59   GAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMS  103



>ref|XP_010489548.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 2, mitochondrial [Camelina sativa]
Length=630

 Score =   100 bits (250),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 73/103 (71%), Positives = 77/103 (75%), Gaps = 9/103 (9%)
 Frame = +3

Query  69   MWRCVSRGLRIPSDRSIAGR-----SHFRRLFSSQTNVGGSSYTVVDHTYDavvvgagga  233
            MWRC    LR+ S R          S   R FS+ +    SSYT+VDHTYDAVVVGAGGA
Sbjct  1    MWRC----LRVASSRRSESNGAFVTSQLSRFFSTPSTGDRSSYTIVDHTYDAVVVGAGGA  56

Query  234  glraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            GLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NMT
Sbjct  57   GLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMT  99



>ref|XP_010414323.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 2, mitochondrial-like [Camelina sativa]
Length=630

 Score =   100 bits (249),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 73/103 (71%), Positives = 77/103 (75%), Gaps = 9/103 (9%)
 Frame = +3

Query  69   MWRCVSRGLRIPSDRSIAGR-----SHFRRLFSSQTNVGGSSYTVVDHTYDavvvgagga  233
            MWRC    LR+ S R          S   R FS+ +    SSYT+VDHTYDAVVVGAGGA
Sbjct  1    MWRC----LRVASSRRSESNGAFVTSQLSRFFSTPSTGDRSSYTIVDHTYDAVVVGAGGA  56

Query  234  glraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            GLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NMT
Sbjct  57   GLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMT  99



>ref|XP_008783479.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit, mitochondrial isoform X2 [Phoenix dactylifera]
Length=528

 Score =   100 bits (248),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 82/104 (79%), Gaps = 7/104 (7%)
 Frame = +3

Query  69   MWR-CVSRGLRIPSDRSIA-GRSHFRRLFSSQ----TNVGGSSYTVVDHTYDavvvgagg  230
            MW+ CVSRGLR+ S +  + GR   R   S+     TN  G  YTVVDHTYDAVVVGAGG
Sbjct  1    MWQSCVSRGLRLLSSKKASIGRQPIRHSPSTPRFLVTNSVGQ-YTVVDHTYDAVVVGAGG  59

Query  231  aglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            AGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NMT
Sbjct  60   AGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMT  103



>ref|XP_010467662.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 2, mitochondrial-like [Camelina sativa]
Length=630

 Score =   100 bits (249),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 73/103 (71%), Positives = 77/103 (75%), Gaps = 9/103 (9%)
 Frame = +3

Query  69   MWRCVSRGLRIPSDRSIAGR-----SHFRRLFSSQTNVGGSSYTVVDHTYDavvvgagga  233
            MWRC    LR+ S R          S   R FS+ +    SSYT+VDHTYDAVVVGAGGA
Sbjct  1    MWRC----LRVASSRRSESNGAFVTSQLSRFFSTPSTGDRSSYTIVDHTYDAVVVGAGGA  56

Query  234  glraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            GLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NMT
Sbjct  57   GLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMT  99



>ref|XP_007156038.1| hypothetical protein PHAVU_003G253200g [Phaseolus vulgaris]
 gb|ESW28032.1| hypothetical protein PHAVU_003G253200g [Phaseolus vulgaris]
Length=620

 Score =   100 bits (249),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 78/98 (80%), Gaps = 9/98 (9%)
 Frame = +3

Query  69   MWRCVSRGLRIPSDRSIAGRSHFRRLFSSQTNVGGSSYTVVDHTYDavvvgaggaglraa  248
            MWRCV+R     + +S+  RS   R FSS    G SSY VVDH YDAVVVGAGGAGLRAA
Sbjct  1    MWRCVARA----NHQSL--RSRVSRFFSSG---GNSSYNVVDHKYDAVVVGAGGAGLRAA  51

Query  249  igLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            IGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NMT
Sbjct  52   IGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMT  89



>ref|XP_008783478.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit, mitochondrial isoform X1 [Phoenix dactylifera]
Length=634

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 82/104 (79%), Gaps = 7/104 (7%)
 Frame = +3

Query  69   MWR-CVSRGLRIPSDRSIA-GRSHFRRLFSSQ----TNVGGSSYTVVDHTYDavvvgagg  230
            MW+ CVSRGLR+ S +  + GR   R   S+     TN  G  YTVVDHTYDAVVVGAGG
Sbjct  1    MWQSCVSRGLRLLSSKKASIGRQPIRHSPSTPRFLVTNSVGQ-YTVVDHTYDAVVVGAGG  59

Query  231  aglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            AGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NMT
Sbjct  60   AGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMT  103



>ref|XP_004972473.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit, mitochondrial-like [Setaria italica]
Length=619

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 77/99 (78%), Positives = 80/99 (81%), Gaps = 12/99 (12%)
 Frame = +3

Query  69   MWR-CVSRGLRIPSDRSIAGRSHFRRLFSSQTNVGGSSYTVVDHTYDavvvgaggaglra  245
            MWR CVSRGL     R+ A  S   RL S+ +    SSYTVVDHTYDAVVVGAGGAGLRA
Sbjct  1    MWRSCVSRGL----SRAKASAS---RLLSTAS----SSYTVVDHTYDAVVVGAGGAGLRA  49

Query  246  aigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            AIGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NMT
Sbjct  50   AIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMT  88



>emb|CDX81369.1| BnaC09g07800D [Brassica napus]
Length=628

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 72/98 (73%), Positives = 77/98 (79%), Gaps = 1/98 (1%)
 Frame = +3

Query  69   MWRCVSRGLRIPSDRSIAGRSHFRRLFSSQTNVGGSSYTVVDHTYDavvvgaggaglraa  248
            MWRCVSR LR PS    +        F S ++  G  YT+VDHTYDAVVVGAGGAGLRAA
Sbjct  1    MWRCVSRSLRAPSSSRTSLSGSRFSRFFSSSSQTGD-YTIVDHTYDAVVVGAGGAGLRAA  59

Query  249  igLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            IGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NM+
Sbjct  60   IGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMS  97



>ref|NP_001058845.1| Os07g0134800 [Oryza sativa Japonica Group]
 sp|Q6ZDY8.1|SDHA_ORYSJ RecName: Full=Succinate dehydrogenase [ubiquinone] flavoprotein 
subunit, mitochondrial; AltName: Full=Flavoprotein subunit 
of complex II; Short=FP; Flags: Precursor [Oryza sativa Japonica 
Group]
 dbj|BAC83515.1| putative succinate dehydrogenase flavoprotein alpha subunit [Oryza 
sativa Japonica Group]
 dbj|BAF20759.1| Os07g0134800 [Oryza sativa Japonica Group]
 dbj|BAG89728.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC81474.1| hypothetical protein OsI_24801 [Oryza sativa Indica Group]
Length=630

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 77/103 (75%), Positives = 81/103 (79%), Gaps = 9/103 (9%)
 Frame = +3

Query  69   MWR-CVSRGLRIPSDRSIAGRSHFR----RLFSSQTNVGGSSYTVVDHTYDavvvgagga  233
            MWR CVSRGLR  S    +  S       RLFS+ +    SSYTVVDH+YDAVVVGAGGA
Sbjct  1    MWRGCVSRGLRSLSKGKGSSSSAPVSAAARLFSTAS----SSYTVVDHSYDAVVVGAGGA  56

Query  234  glraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            GLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NMT
Sbjct  57   GLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMT  99



>dbj|BAK08049.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=619

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 79/99 (80%), Gaps = 12/99 (12%)
 Frame = +3

Query  69   MWR-CVSRGLRIPSDRSIAGRSHFRRLFSSQTNVGGSSYTVVDHTYDavvvgaggaglra  245
            MWR CVSRGL          ++   RLFS+ +    SSYTVVDH+YDAVVVGAGGAGLRA
Sbjct  1    MWRGCVSRGLS-------KAKASASRLFSTTS----SSYTVVDHSYDAVVVGAGGAGLRA  49

Query  246  aigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            AIGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NM+
Sbjct  50   AIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMS  88



>gb|EEE66523.1| hypothetical protein OsJ_23002 [Oryza sativa Japonica Group]
Length=661

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 77/103 (75%), Positives = 81/103 (79%), Gaps = 9/103 (9%)
 Frame = +3

Query  69   MWR-CVSRGLRIPSDRSIAGRSHFR----RLFSSQTNVGGSSYTVVDHTYDavvvgagga  233
            MWR CVSRGLR  S    +  S       RLFS+ +    SSYTVVDH+YDAVVVGAGGA
Sbjct  1    MWRGCVSRGLRSLSKGKGSSSSAPVSAAARLFSTAS----SSYTVVDHSYDAVVVGAGGA  56

Query  234  glraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            GLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NMT
Sbjct  57   GLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMT  99



>tpg|DAA59498.1| TPA: hypothetical protein ZEAMMB73_792658 [Zea mays]
Length=586

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 76/99 (77%), Positives = 80/99 (81%), Gaps = 12/99 (12%)
 Frame = +3

Query  69   MWR-CVSRGLRIPSDRSIAGRSHFRRLFSSQTNVGGSSYTVVDHTYDavvvgaggaglra  245
            MWR CVSRGL     R+ A  S   RL S+ +    SSYTVVDHTYDAVVVGAGGAGLRA
Sbjct  1    MWRSCVSRGL----SRAKASAS---RLLSTAS----SSYTVVDHTYDAVVVGAGGAGLRA  49

Query  246  aigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            AIGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NM+
Sbjct  50   AIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMS  88



>ref|XP_009408578.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit, mitochondrial [Musa acuminata subsp. malaccensis]
Length=636

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 74/106 (70%), Positives = 79/106 (75%), Gaps = 9/106 (8%)
 Frame = +3

Query  69   MWR-CVSRGLRIPSDRSIAGRSHFR-------RLFSSQTNVGGSSYTVVDHTYDavvvga  224
            MWR C+ R  R     S  G    R       R FS+ + VG SSYT+VDHTYDAVVVGA
Sbjct  1    MWRRCLPRNFRFSRKASPIGSEPIRQSPWTAPRSFSTDS-VGRSSYTIVDHTYDAVVVGA  59

Query  225  ggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            GGAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NM+
Sbjct  60   GGAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMS  105



>ref|NP_001146352.1| uncharacterized protein LOC100279930 [Zea mays]
 gb|ACL53755.1| unknown [Zea mays]
 gb|ACN36155.1| unknown [Zea mays]
 gb|ACN36156.1| unknown [Zea mays]
 tpg|DAA59497.1| TPA: succinate dehydrogenase flavoprotein subunit [Zea mays]
Length=619

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 76/99 (77%), Positives = 80/99 (81%), Gaps = 12/99 (12%)
 Frame = +3

Query  69   MWR-CVSRGLRIPSDRSIAGRSHFRRLFSSQTNVGGSSYTVVDHTYDavvvgaggaglra  245
            MWR CVSRGL     R+ A  S   RL S+ +    SSYTVVDHTYDAVVVGAGGAGLRA
Sbjct  1    MWRSCVSRGL----SRAKASAS---RLLSTAS----SSYTVVDHTYDAVVVGAGGAGLRA  49

Query  246  aigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            AIGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NM+
Sbjct  50   AIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMS  88



>ref|NP_001146722.1| uncharacterized protein LOC100280324 [Zea mays]
 gb|ACL54621.1| unknown [Zea mays]
Length=619

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 76/99 (77%), Positives = 80/99 (81%), Gaps = 12/99 (12%)
 Frame = +3

Query  69   MWR-CVSRGLRIPSDRSIAGRSHFRRLFSSQTNVGGSSYTVVDHTYDavvvgaggaglra  245
            MWR CVSRGL     R+ A  S   RL S+ +    SSYTVVDHTYDAVVVGAGGAGLRA
Sbjct  1    MWRSCVSRGL----SRAKASAS---RLLSTAS----SSYTVVDHTYDAVVVGAGGAGLRA  49

Query  246  aigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            AIGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NM+
Sbjct  50   AIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMS  88



>gb|ACG43057.1| succinate dehydrogenase flavoprotein subunit,mitochondrial precursor 
[Zea mays]
Length=619

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 76/99 (77%), Positives = 80/99 (81%), Gaps = 12/99 (12%)
 Frame = +3

Query  69   MWR-CVSRGLRIPSDRSIAGRSHFRRLFSSQTNVGGSSYTVVDHTYDavvvgaggaglra  245
            MWR CVSRGL     R+ A  S   RL S+ +    SSYTVVDHTYDAVVVGAGGAGLRA
Sbjct  1    MWRSCVSRGL----SRAKASAS---RLLSTAS----SSYTVVDHTYDAVVVGAGGAGLRA  49

Query  246  aigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            AIGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NM+
Sbjct  50   AIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMS  88



>tpg|DAA42707.1| TPA: hypothetical protein ZEAMMB73_508415 [Zea mays]
Length=700

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 76/99 (77%), Positives = 80/99 (81%), Gaps = 12/99 (12%)
 Frame = +3

Query  69   MWR-CVSRGLRIPSDRSIAGRSHFRRLFSSQTNVGGSSYTVVDHTYDavvvgaggaglra  245
            MWR CVSRGL     R+ A  S   RL S+ +    SSYTVVDHTYDAVVVGAGGAGLRA
Sbjct  82   MWRSCVSRGL----SRAKASAS---RLLSTAS----SSYTVVDHTYDAVVVGAGGAGLRA  130

Query  246  aigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            AIGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NM+
Sbjct  131  AIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMS  169



>dbj|BAK02783.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=621

 Score = 98.2 bits (243),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 75/99 (76%), Positives = 79/99 (80%), Gaps = 10/99 (10%)
 Frame = +3

Query  69   MWR-CVSRGLRIPSDRSIAGRSHFRRLFSSQTNVGGSSYTVVDHTYDavvvgaggaglra  245
            MWR CVSRGLR     + A  +   R FS+      SSYTVVDHTYDAVVVGAGGAGLRA
Sbjct  1    MWRSCVSRGLR----EAKAAAAAASRRFSTT-----SSYTVVDHTYDAVVVGAGGAGLRA  51

Query  246  aigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            AIGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NM+
Sbjct  52   AIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMS  90



>ref|XP_002886171.1| succinate dehydrogenase 1-2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62430.1| succinate dehydrogenase 1-2 [Arabidopsis lyrata subsp. lyrata]
Length=631

 Score = 97.8 bits (242),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 79/104 (76%), Gaps = 10/104 (10%)
 Frame = +3

Query  69   MWRCVSRGLRIPSDRSIAGRSHF-----RRLFSSQTNVGG-SSYTVVDHTYDavvvgagg  230
            MWRC    LR+ S R       F      R FS+ ++ G  SSYT+VDHTYDAVVVGAGG
Sbjct  1    MWRC----LRVASWRRSESNGAFITTRLSRFFSAPSSTGDRSSYTIVDHTYDAVVVGAGG  56

Query  231  aglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            AGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NM+
Sbjct  57   AGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMS  100



>ref|NP_179435.1| succinate dehydrogenase [ubiquinone] flavoprotein subunit 2 [Arabidopsis 
thaliana]
 sp|Q9ZPX5.1|SDHA2_ARATH RecName: Full=Succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 2, mitochondrial; AltName: Full=Flavoprotein subunit 
2 of complex II; Short=FP; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAD15493.1| putative succinate dehydrogenase flavoprotein subunit [Arabidopsis 
thaliana]
 dbj|BAC43712.1| putative succinate dehydrogenase flavoprotein subunit [Arabidopsis 
thaliana]
 gb|AAO64873.1| At2g18450 [Arabidopsis thaliana]
 gb|AEC06769.1| succinate dehydrogenase [ubiquinone] flavoprotein subunit 2 [Arabidopsis 
thaliana]
Length=632

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 71/101 (70%), Positives = 76/101 (75%), Gaps = 3/101 (3%)
 Frame = +3

Query  69   MWRC--VSRGLRIPSDRSIAGRSHFRRLFSSQTNVGG-SSYTVVDHTYDavvvgaggagl  239
            MWRC  V+   R          S   R FS+  + G  SSYT+VDHTYDAVVVGAGGAGL
Sbjct  1    MWRCLRVASSSRRSESNGAFITSQLSRFFSAPPSAGDKSSYTIVDHTYDAVVVGAGGAGL  60

Query  240  raaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            RAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NM+
Sbjct  61   RAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMS  101



>ref|XP_002269407.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit, mitochondrial [Vitis vinifera]
 emb|CBI17530.3| unnamed protein product [Vitis vinifera]
Length=670

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 79/139 (57%), Positives = 85/139 (61%), Gaps = 41/139 (29%)
 Frame = +3

Query  69   MWRCVSRGLRI---PSDRSIAG---RSHFRRLFSS---------------QTNVGG----  173
            MWRCVSRGLR     S RS+     + H  R FS+               +  +G     
Sbjct  1    MWRCVSRGLRFRSSDSKRSLTSEYLKPHISRFFSTESTGGGSSGTSEAEIKAAIGELSKH  60

Query  174  ----------------SSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPT  305
                            SSYT+VDHTYDAVVVGAGGAGLRAAIGLSEHGFNTACITKLFPT
Sbjct  61   GVDTAGITELYRSSYTSSYTIVDHTYDAVVVGAGGAGLRAAIGLSEHGFNTACITKLFPT  120

Query  306  RSHTVAAQGGINAALRNMT  362
            RSHTVAAQGGINAAL NMT
Sbjct  121  RSHTVAAQGGINAALGNMT  139



>ref|XP_003558573.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit, mitochondrial [Brachypodium distachyon]
Length=617

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 76/99 (77%), Positives = 78/99 (79%), Gaps = 14/99 (14%)
 Frame = +3

Query  69   MWR-CVSRGLRIPSDRSIAGRSHFRRLFSSQTNVGGSSYTVVDHTYDavvvgaggaglra  245
            MWR CVSRGLR         ++  RR  SS      SSYTVVDHTYDAVVVGAGGAGLRA
Sbjct  1    MWRSCVSRGLR-------EAKAAARRFSSS------SSYTVVDHTYDAVVVGAGGAGLRA  47

Query  246  aigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            AIGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NMT
Sbjct  48   AIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMT  86



>gb|AIZ74343.1| succinate dehydrogenase [Pinus massoniana]
Length=635

 Score = 95.5 bits (236),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 75/104 (72%), Positives = 81/104 (78%), Gaps = 6/104 (6%)
 Frame = +3

Query  69   MWRCVSRGL----RIPSDRSI-AGRSHFRRLFSSQTNVGGS-SYTVVDHTYDavvvgagg  230
            MWR V+R +     + + RS   GR   R   S  + VGGS SYT+VDHTYDAVVVGAGG
Sbjct  1    MWRRVARNICSSSTVNTIRSYHNGRILCRSASSGTSPVGGSGSYTIVDHTYDAVVVGAGG  60

Query  231  aglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            AGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NMT
Sbjct  61   AGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMT  104



>ref|XP_006299856.1| hypothetical protein CARUB_v10016059mg [Capsella rubella]
 gb|EOA32754.1| hypothetical protein CARUB_v10016059mg [Capsella rubella]
Length=509

 Score = 94.7 bits (234),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 63/98 (64%), Gaps = 11/98 (11%)
 Frame = +3

Query  69   MWRCVSRGLRIPSDRSIAGRSHFRRLFSSQTNVGGSSYTVVDHTYDavvvgaggaglraa  248
            MWRC+    R    +     S   R FS+ +   G+SY +VDHTYDAVVVGA        
Sbjct  1    MWRCLRVAARRSESKGGFINSQLSRFFSAPSTGDGTSYRIVDHTYDAVVVGA--------  52

Query  249  igLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
                EHGFNTACITKLFPTRSHTVAAQGG+NAAL NMT
Sbjct  53   ---GEHGFNTACITKLFPTRSHTVAAQGGVNAALGNMT  87



>ref|XP_006856022.1| hypothetical protein AMTR_s00059p00054360 [Amborella trichopoda]
 gb|ERN17489.1| hypothetical protein AMTR_s00059p00054360 [Amborella trichopoda]
Length=631

 Score = 95.1 bits (235),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 72/100 (72%), Positives = 78/100 (78%), Gaps = 2/100 (2%)
 Frame = +3

Query  69   MWRCVSRGLRIPSDR-SIA-GRSHFRRLFSSQTNVGGSSYTVVDHTYDavvvgaggaglr  242
            MWRCVS  LR+   + SI+ G        S  ++    SYT+VDHTYDAVVVGAGGAGLR
Sbjct  1    MWRCVSGALRLAHAKGSISNGPIQTLLSRSLSSSSTTGSYTIVDHTYDAVVVGAGGAGLR  60

Query  243  aaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            AAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NMT
Sbjct  61   AAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMT  100



>gb|KFK40220.1| hypothetical protein AALP_AA3G346200 [Arabis alpina]
Length=637

 Score = 95.1 bits (235),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 74/106 (70%), Positives = 80/106 (75%), Gaps = 8/106 (8%)
 Frame = +3

Query  69   MWRCV-SRGLRIPSDRSIAG-------RSHFRRLFSSQTNVGGSSYTVVDHTYDavvvga  224
            MW CV  R LR+PS  S          R+   R FSS++    SSYT+VDHTYDAVVVGA
Sbjct  1    MWCCVVPRRLRVPSSPSRRSESNGHFIRTQVSRFFSSRSTGERSSYTIVDHTYDAVVVGA  60

Query  225  ggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            GGAGLRAAIGLSEHGF TAC+TKLFPTRSHTVAAQGGINAAL NMT
Sbjct  61   GGAGLRAAIGLSEHGFKTACVTKLFPTRSHTVAAQGGINAALGNMT  106



>ref|XP_002970038.1| hypothetical protein SELMODRAFT_440964 [Selaginella moellendorffii]
 gb|EFJ29162.1| hypothetical protein SELMODRAFT_440964 [Selaginella moellendorffii]
Length=628

 Score = 95.1 bits (235),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 67/92 (73%), Positives = 73/92 (79%), Gaps = 8/92 (9%)
 Frame = +3

Query  111  RSIAGRSHFRRLFSSQTNV--------GGSSYTVVDHTYDavvvgaggaglraaigLSEH  266
            R+     H RRL+SS + V         G++Y +VDHTYDAVVVGAGGAGLRAAIGLSEH
Sbjct  6    RAALREQHQRRLYSSASRVLSNGAPSATGAAYPIVDHTYDAVVVGAGGAGLRAAIGLSEH  65

Query  267  GFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            GFNTACITKLFPTRSHTVAAQGGINAAL NMT
Sbjct  66   GFNTACITKLFPTRSHTVAAQGGINAALGNMT  97



>gb|EMS46614.1| Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial 
[Triticum urartu]
Length=591

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 78/99 (79%), Gaps = 10/99 (10%)
 Frame = +3

Query  69   MWRC-VSRGLRIPSDRSIAGRSHFRRLFSSQTNVGGSSYTVVDHTYDavvvgaggaglra  245
            MWR  VSRGLR     + A  +   R FS+      SSYTVVDHTYDAVVVGAGGAGLRA
Sbjct  1    MWRSRVSRGLR----EAKAAAAAASRRFSTT-----SSYTVVDHTYDAVVVGAGGAGLRA  51

Query  246  aigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            AIGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NM+
Sbjct  52   AIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMS  90



>ref|XP_002985229.1| hypothetical protein SELMODRAFT_446158 [Selaginella moellendorffii]
 gb|EFJ13723.1| hypothetical protein SELMODRAFT_446158 [Selaginella moellendorffii]
Length=628

 Score = 92.8 bits (229),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 65/83 (78%), Positives = 70/83 (84%), Gaps = 8/83 (10%)
 Frame = +3

Query  138  RRLFSSQTNV--------GGSSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITK  293
            RRL+SS + V         G++Y +VDHTYDAVVVGAGGAGLRAAIGLSEHGFNTACITK
Sbjct  15   RRLYSSASRVLSNAAPSTTGAAYPIVDHTYDAVVVGAGGAGLRAAIGLSEHGFNTACITK  74

Query  294  LFPTRSHTVAAQGGINAALRNMT  362
            LFPTRSHTVAAQGGINAAL NMT
Sbjct  75   LFPTRSHTVAAQGGINAALGNMT  97



>ref|XP_009150830.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 2, mitochondrial [Brassica rapa]
Length=632

 Score = 91.7 bits (226),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 67/74 (91%), Gaps = 2/74 (3%)
 Frame = +3

Query  141  RLFSSQTNVGGSSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTV  320
            R FS+++  G   YT+VDHTYDAVVVGAGGAGLRAAIGLSEHGFNTACITKLFPTRSHTV
Sbjct  30   RFFSARSTTG--DYTIVDHTYDAVVVGAGGAGLRAAIGLSEHGFNTACITKLFPTRSHTV  87

Query  321  AAQGGINAALRNMT  362
            AAQGGINAAL NMT
Sbjct  88   AAQGGINAALGNMT  101



>emb|CDY29234.1| BnaA06g25230D [Brassica napus]
Length=633

 Score = 91.7 bits (226),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 67/74 (91%), Gaps = 2/74 (3%)
 Frame = +3

Query  141  RLFSSQTNVGGSSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTV  320
            R FS+++  G   YT+VDHTYDAVVVGAGGAGLRAAIGLSEHGFNTACITKLFPTRSHTV
Sbjct  30   RFFSARSTTG--DYTIVDHTYDAVVVGAGGAGLRAAIGLSEHGFNTACITKLFPTRSHTV  87

Query  321  AAQGGINAALRNMT  362
            AAQGGINAAL NMT
Sbjct  88   AAQGGINAALGNMT  101



>ref|XP_004981575.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit, mitochondrial-like isoform X2 [Setaria italica]
Length=594

 Score = 89.7 bits (221),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 61/62 (98%), Positives = 61/62 (98%), Gaps = 0/62 (0%)
 Frame = +3

Query  177  SYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRN  356
            SYTVVDHTYDAVVVGAGGAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL N
Sbjct  2    SYTVVDHTYDAVVVGAGGAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGN  61

Query  357  MT  362
            MT
Sbjct  62   MT  63



>ref|XP_006658260.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit, mitochondrial-like [Oryza brachyantha]
Length=634

 Score = 89.7 bits (221),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 77/106 (73%), Positives = 81/106 (76%), Gaps = 11/106 (10%)
 Frame = +3

Query  69   MWR-CVSRGLR-------IPSDRSIAGRSHFRRLFSSQTNVGGSSYTVVDHTYDavvvga  224
            MWR CVSRGLR         SD      +   RL S+ T+   SSYTVVDH+YDAVVVGA
Sbjct  1    MWRGCVSRGLRSLSKGRATSSDPVSVSAAAAARLLSTTTS---SSYTVVDHSYDAVVVGA  57

Query  225  ggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            GGAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NMT
Sbjct  58   GGAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMT  103



>gb|EMT18500.1| Succinate dehydrogenase (ubiquinone) flavoprotein subunit, mitochondrial 
[Aegilops tauschii]
Length=608

 Score = 89.4 bits (220),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 60/62 (97%), Positives = 61/62 (98%), Gaps = 0/62 (0%)
 Frame = +3

Query  177  SYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRN  356
            SYTVVDHTYDAVVVGAGGAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL N
Sbjct  11   SYTVVDHTYDAVVVGAGGAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGN  70

Query  357  MT  362
            M+
Sbjct  71   MS  72



>gb|EMS68611.1| Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial 
[Triticum urartu]
Length=606

 Score = 89.0 bits (219),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 60/63 (95%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = +3

Query  174  SSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALR  353
            SSYTVVDH+YDAVVVGAGGAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL 
Sbjct  13   SSYTVVDHSYDAVVVGAGGAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALG  72

Query  354  NMT  362
            NM+
Sbjct  73   NMS  75



>emb|CDY36482.1| BnaC03g48410D [Brassica napus]
Length=633

 Score = 89.0 bits (219),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 66/74 (89%), Gaps = 2/74 (3%)
 Frame = +3

Query  141  RLFSSQTNVGGSSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTV  320
            RLFS+++      YT+VDH YDAVVVGAGGAGLRAAIGLSEHGFNTACITKLFPTRSHTV
Sbjct  30   RLFSARSTT--RDYTIVDHKYDAVVVGAGGAGLRAAIGLSEHGFNTACITKLFPTRSHTV  87

Query  321  AAQGGINAALRNMT  362
            AAQGGINAAL NMT
Sbjct  88   AAQGGINAALGNMT  101



>gb|EMT27843.1| Succinate dehydrogenase (ubiquinone) flavoprotein subunit, mitochondrial 
[Aegilops tauschii]
Length=742

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 60/63 (95%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = +3

Query  174  SSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALR  353
            SSYTVVDH+YDAVVVGAGGAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL 
Sbjct  182  SSYTVVDHSYDAVVVGAGGAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALG  241

Query  354  NMT  362
            NM+
Sbjct  242  NMS  244



>ref|XP_011396968.1| Succinate dehydrogenase [ubiquinone] flavoprotein subunit 1, 
mitochondrial [Auxenochlorella protothecoides]
 gb|KFM24082.1| Succinate dehydrogenase [ubiquinone] flavoprotein subunit 1, 
mitochondrial [Auxenochlorella protothecoides]
Length=621

 Score = 85.9 bits (211),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 55/67 (82%), Positives = 63/67 (94%), Gaps = 0/67 (0%)
 Frame = +3

Query  162  NVGGSSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGIN  341
            +VG ++Y ++DHTYDA+VVGAGGAGLRA++GLSE GFNTACITKLFPTRSHTVAAQGGIN
Sbjct  22   SVGKTAYPIIDHTYDAIVVGAGGAGLRASVGLSELGFNTACITKLFPTRSHTVAAQGGIN  81

Query  342  AALRNMT  362
            AAL NMT
Sbjct  82   AALGNMT  88



>ref|XP_003557614.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit, mitochondrial-like [Brachypodium distachyon]
Length=620

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 80/99 (81%), Gaps = 11/99 (11%)
 Frame = +3

Query  69   MWRC-VSRGLRIPSDRSIAGRSHFRRLFSSQTNVGGSSYTVVDHTYDavvvgaggaglra  245
            MWR  VSRGL         G++   RLFS+ T+   SSYT+VDH+YDAVVVGAGGAGLRA
Sbjct  1    MWRSFVSRGLS-------KGKASASRLFSTTTS---SSYTLVDHSYDAVVVGAGGAGLRA  50

Query  246  aigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            AIGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NM+
Sbjct  51   AIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMS  89



>gb|KCW56781.1| hypothetical protein EUGRSUZ_I024522, partial [Eucalyptus grandis]
Length=592

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 57/61 (93%), Positives = 59/61 (97%), Gaps = 0/61 (0%)
 Frame = +3

Query  180  YTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNM  359
            YT+VDH YDAVVVGAGGAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL NM
Sbjct  1    YTIVDHKYDAVVVGAGGAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNM  60

Query  360  T  362
            +
Sbjct  61   S  61



>gb|KDD75364.1| FAD binding domain-containing protein, partial [Helicosporidium 
sp. ATCC 50920]
Length=481

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 63/74 (85%), Gaps = 4/74 (5%)
 Frame = +3

Query  141  RLFSSQTNVGGSSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTV  320
            R FS+    G  SY ++DHTYDA+VVGAGGAGLRA +GLSE GFNTACITKLFPTRSHTV
Sbjct  24   RAFST----GRKSYPIIDHTYDAIVVGAGGAGLRATVGLSELGFNTACITKLFPTRSHTV  79

Query  321  AAQGGINAALRNMT  362
            AAQGGINAAL NMT
Sbjct  80   AAQGGINAALGNMT  93



>ref|XP_002602350.1| hypothetical protein BRAFLDRAFT_128477 [Branchiostoma floridae]
 gb|EEN58362.1| hypothetical protein BRAFLDRAFT_128477 [Branchiostoma floridae]
Length=668

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 61/82 (74%), Positives = 67/82 (82%), Gaps = 2/82 (2%)
 Frame = +3

Query  114  SIAGRSHFRRLFSSQTNVGGSSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITK  293
            +I GR    +L  S+ NVG ++Y VVDHTYDAVVVGAGGAGLRAA GL+  GF TACITK
Sbjct  39   TIEGRRSDAKL--SEGNVGTNNYPVVDHTYDAVVVGAGGAGLRAAFGLASEGFKTACITK  96

Query  294  LFPTRSHTVAAQGGINAALRNM  359
            LFPTRSHTVAAQGGINAAL NM
Sbjct  97   LFPTRSHTVAAQGGINAALGNM  118



>gb|KIW65101.1| succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial 
[Capronia semiimmersa]
Length=652

 Score = 83.2 bits (204),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 66/86 (77%), Gaps = 0/86 (0%)
 Frame = +3

Query  102  PSDRSIAGRSHFRRLFSSQTNVGGSSYTVVDHTYDavvvgaggaglraaigLSEHGFNTA  281
            P+ R +A +    +   S  +  G SY ++DH YDAVVVGAGGAGLRAA GL+E GFNTA
Sbjct  33   PAARVVASQPLRAKEAQSPLSATGGSYAIIDHEYDAVVVGAGGAGLRAAFGLAEAGFNTA  92

Query  282  CITKLFPTRSHTVAAQGGINAALRNM  359
            C+TKLFPTRSHTVAAQGGINAAL NM
Sbjct  93   CVTKLFPTRSHTVAAQGGINAALGNM  118



>ref|XP_007759146.1| succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial 
[Cladophialophora yegresii CBS 114405]
 gb|EXJ56612.1| succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial 
[Cladophialophora yegresii CBS 114405]
Length=640

 Score = 83.2 bits (204),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = +3

Query  102  PSDRSIAGRSHFRRLFSSQTNVGGSSYTVVDHTYDavvvgaggaglraaigLSEHGFNTA  281
            P+ R +A +    +   S     G SY ++DH YDAVVVGAGGAGLRAA GL+E GFNTA
Sbjct  21   PAARVVASQPLRAKEAQSPLTATGGSYAIIDHEYDAVVVGAGGAGLRAAFGLAEAGFNTA  80

Query  282  CITKLFPTRSHTVAAQGGINAALRNM  359
            C+TKLFPTRSHTVAAQGGINAAL NM
Sbjct  81   CVTKLFPTRSHTVAAQGGINAALGNM  106



>emb|CDQ88961.1| unnamed protein product [Oncorhynchus mykiss]
Length=151

 Score = 79.0 bits (193),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 69/95 (73%), Gaps = 8/95 (8%)
 Frame = +3

Query  75   RCVSRGLRIPSDRSIAGRSHFRRLFSSQTNVGGSSYTVVDHTYDavvvgaggaglraaig  254
            RC SR +      SI G+    ++    ++   + Y VVDH +DAVVVGAGGAGLRAA G
Sbjct  23   RCSSRNIHF----SIYGKKDNAKV----SDDISTQYPVVDHEFDAVVVGAGGAGLRAAFG  74

Query  255  LSEHGFNTACITKLFPTRSHTVAAQGGINAALRNM  359
            LSE GFNTAC+TKLFPTRSHTVAAQGGINAAL NM
Sbjct  75   LSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNM  109



>ref|XP_001689842.1| succinate dehydrogenase subunit A [Chlamydomonas reinhardtii]
 gb|EDP09580.1| succinate dehydrogenase subunit A [Chlamydomonas reinhardtii]
Length=635

 Score = 83.2 bits (204),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 56/71 (79%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = +3

Query  150  SSQTNVGGSSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQ  329
            + Q      SY V+DH YDA+VVGAGGAGLRAA+GLSE GFNTACITKLFPTRSHTVAAQ
Sbjct  32   TQQAGFASQSYPVIDHQYDAIVVGAGGAGLRAAVGLSELGFNTACITKLFPTRSHTVAAQ  91

Query  330  GGINAALRNMT  362
            GGINAAL NMT
Sbjct  92   GGINAALGNMT  102



>ref|XP_008725706.1| succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial 
[Cladophialophora carrionii CBS 160.54]
 gb|ETI26361.1| succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial 
[Cladophialophora carrionii CBS 160.54]
Length=703

 Score = 83.2 bits (204),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = +3

Query  102  PSDRSIAGRSHFRRLFSSQTNVGGSSYTVVDHTYDavvvgaggaglraaigLSEHGFNTA  281
            P+ R +A +    +   S     G SY ++DH YDAVVVGAGGAGLRAA GL+E GFNTA
Sbjct  84   PAARVVASQPLRAKEAQSPLTATGGSYAIIDHEYDAVVVGAGGAGLRAAFGLAEAGFNTA  143

Query  282  CITKLFPTRSHTVAAQGGINAALRNM  359
            C+TKLFPTRSHTVAAQGGINAAL NM
Sbjct  144  CVTKLFPTRSHTVAAQGGINAALGNM  169



>ref|WP_040449408.1| fumarate reductase [Hoeflea phototrophica]
 gb|EDQ31711.2| succinate dehydrogenase, flavoprotein subunit [Hoeflea phototrophica 
DFL-43]
Length=613

 Score = 82.8 bits (203),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 51/73 (70%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = +3

Query  144  LFSSQTNVGGSSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVA  323
            + +S  N+GG +YT+VDH YD VVVGAGGAGLRA +G++E GF TACI+K+FPTRSHTVA
Sbjct  2    VMTSSVNIGGRAYTIVDHAYDVVVVGAGGAGLRATLGMAEQGFRTACISKVFPTRSHTVA  61

Query  324  AQGGINAALRNMT  362
            AQGGI A+L NMT
Sbjct  62   AQGGIAASLTNMT  74



>ref|XP_001762172.1| predicted protein [Physcomitrella patens]
 gb|EDQ72964.1| predicted protein [Physcomitrella patens]
Length=595

 Score = 82.8 bits (203),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 57/62 (92%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +3

Query  177  SYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRN  356
            SY +VDHTYDA+VVGAGGAGLRAAIGLSE GFNTACITKLFPTRSHTVAAQGGINAAL N
Sbjct  3    SYPLVDHTYDAIVVGAGGAGLRAAIGLSESGFNTACITKLFPTRSHTVAAQGGINAALGN  62

Query  357  MT  362
            MT
Sbjct  63   MT  64



>gb|KIM80776.1| hypothetical protein PILCRDRAFT_516876 [Piloderma croceum F 1598]
Length=643

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 73/99 (74%), Gaps = 7/99 (7%)
 Frame = +3

Query  84   SRGLRIPSDRSIAGRSHFRRLFSS------QTNVGGSSYTVVDHTYDavvvgaggaglra  245
            SR L +PS RS    S  R++ ++      +T+     Y ++DH YDA+VVGAGGAGLRA
Sbjct  12   SRAL-LPSRRSFQTSSSVRKVVATNPVKAEETSWASGKYPLIDHEYDAIVVGAGGAGLRA  70

Query  246  aigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            A GL+E GF+TACITKLFPTRSHTVAAQGGINAAL NMT
Sbjct  71   AFGLAEAGFSTACITKLFPTRSHTVAAQGGINAALGNMT  109



>gb|KIW07596.1| succinate dehydrogenase [ubiquinone] flavoprotein subunit 2, 
mitochondrial [Verruconis gallopava]
Length=648

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 71/102 (70%), Gaps = 8/102 (8%)
 Frame = +3

Query  75   RCVSRGLRIPSDRSIAGRSHFRRLFSSQ-------TNVGGSSYTVVDHTYDavvvgagga  233
            R +SR +R PS R         ++ +SQ          G  SY V+DH YDA+VVGAGG+
Sbjct  14   RQLSRAVRTPS-RQFTQSHRLAKIITSQPLRAKEAQTSGSHSYPVIDHEYDAIVVGAGGS  72

Query  234  glraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNM  359
            GLRAA GL+E GFNTACI+KLFPTRSHTVAAQGGINAAL NM
Sbjct  73   GLRAAFGLAEAGFNTACISKLFPTRSHTVAAQGGINAALGNM  114



>ref|XP_007364698.1| succinate dehydrogenase [Dichomitus squalens LYAD-421 SS1]
 gb|EJF62625.1| succinate dehydrogenase [Dichomitus squalens LYAD-421 SS1]
Length=638

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 60/101 (59%), Positives = 73/101 (72%), Gaps = 5/101 (5%)
 Frame = +3

Query  75   RCVSRGLRIPSDRSIAGRSHFRRLFSS-----QTNVGGSSYTVVDHTYDavvvgaggagl  239
            + +++GLR  S RS    +  RR+ ++     Q       Y +++H YDA+VVGAGGAGL
Sbjct  4    KSLNKGLRASSARSFHSSAPARRVVATNPVKAQEVQSFGKYPLIEHEYDAIVVGAGGAGL  63

Query  240  raaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            RAA GL+E GFNTACITKLFPTRSHTVAAQGGINAAL NMT
Sbjct  64   RAAFGLAEAGFNTACITKLFPTRSHTVAAQGGINAALGNMT  104



>ref|XP_002505866.1| succinate dehydrogenase [Micromonas sp. RCC299]
 gb|ACO67124.1| succinate dehydrogenase [Micromonas sp. RCC299]
Length=640

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 56/63 (89%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = +3

Query  174  SSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALR  353
            S+YT++DH YDAVVVGAGGAGLRAAIGLSEHG  TACITKLFPTRSHTVAAQGGINAAL 
Sbjct  47   SAYTIIDHEYDAVVVGAGGAGLRAAIGLSEHGLKTACITKLFPTRSHTVAAQGGINAALG  106

Query  354  NMT  362
            NMT
Sbjct  107  NMT  109



>ref|XP_001938444.1| succinate dehydrogenase flavoprotein subunit, mitochondrial precursor 
[Pyrenophora tritici-repentis Pt-1C-BFP]
 ref|XP_003295854.1| hypothetical protein PTT_03506 [Pyrenophora teres f. teres 0-1]
 gb|EDU51031.1| succinate dehydrogenase flavoprotein subunit, mitochondrial precursor 
[Pyrenophora tritici-repentis Pt-1C-BFP]
 gb|EFQ96052.1| hypothetical protein PTT_03506 [Pyrenophora teres f. teres 0-1]
Length=647

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 70/93 (75%), Gaps = 7/93 (8%)
 Frame = +3

Query  102  PSDRSIAGRSHFRRLFSSQT----NVGG---SSYTVVDHTYDavvvgaggaglraaigLS  260
            P+ R+ +     RR+F+++      V G   S Y V+DH YDA+VVGAGGAGLRAA GL+
Sbjct  21   PTARAFSSTRPARRIFATENLRAKEVSGFISSKYPVIDHEYDAIVVGAGGAGLRAAFGLA  80

Query  261  EHGFNTACITKLFPTRSHTVAAQGGINAALRNM  359
            E GFNTACI+KLFPTRSHTVAAQGGINAAL NM
Sbjct  81   EAGFNTACISKLFPTRSHTVAAQGGINAALGNM  113



>ref|XP_001780340.1| predicted protein [Physcomitrella patens]
 gb|EDQ54899.1| predicted protein [Physcomitrella patens]
Length=631

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 57/66 (86%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = +3

Query  165  VGGSSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINA  344
            V   SY +VDHTYDA+VVGAGGAGLRAAIGLSE GF TACITKLFPTRSHTVAAQGGINA
Sbjct  35   VDAKSYPIVDHTYDAIVVGAGGAGLRAAIGLSETGFTTACITKLFPTRSHTVAAQGGINA  94

Query  345  ALRNMT  362
            AL NMT
Sbjct  95   ALGNMT  100



>ref|XP_008720747.1| succinate dehydrogenase [ubiquinone] flavoprotein subunit 2, 
mitochondrial [Cyphellophora europaea CBS 101466]
 gb|ETN37215.1| succinate dehydrogenase [ubiquinone] flavoprotein subunit 2, 
mitochondrial [Cyphellophora europaea CBS 101466]
Length=647

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 52/67 (78%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +3

Query  159  TNVGGSSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGI  338
            TN+ G +Y VVDH YDA+V+GAGGAGLRA  GL+E GFNTAC++KLFPTRSHTVAAQGGI
Sbjct  47   TNIHGHAYNVVDHQYDALVIGAGGAGLRATFGLAEAGFNTACVSKLFPTRSHTVAAQGGI  106

Query  339  NAALRNM  359
            NAAL NM
Sbjct  107  NAALGNM  113



>gb|KIV95505.1| succinate dehydrogenase [ubiquinone] flavoprotein subunit 2, 
mitochondrial [Exophiala mesophila]
Length=648

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 55/63 (87%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +3

Query  171  GSSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAAL  350
            G SY V+DH YDAVVVGAGGAGLRAA GL+E GFNTACITKLFPTRSHTVAAQGGINAAL
Sbjct  52   GKSYPVIDHEYDAVVVGAGGAGLRAAFGLAEAGFNTACITKLFPTRSHTVAAQGGINAAL  111

Query  351  RNM  359
             NM
Sbjct  112  GNM  114



>gb|EXX63396.1| succinate dehydrogenase flavoprotein subunit SDH1 [Rhizophagus 
irregularis DAOM 197198w]
 gb|EXX63397.1| succinate dehydrogenase flavoprotein subunit SDH1 [Rhizophagus 
irregularis DAOM 197198w]
Length=645

 Score = 81.6 bits (200),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = +3

Query  174  SSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALR  353
            S Y V+DHTYDA+VVGAGG+GLR+A GL+E GFNTACITK+FPTRSHTVAAQGGINAAL 
Sbjct  50   SKYPVIDHTYDAIVVGAGGSGLRSAFGLAEAGFNTACITKIFPTRSHTVAAQGGINAALG  109

Query  354  NMT  362
            NMT
Sbjct  110  NMT  112



>ref|NP_594319.1| succinate dehydrogenase Sdh1 (predicted) [Schizosaccharomyces 
pombe 972h-]
 sp|Q9UTJ7.1|SDHA_SCHPO RecName: Full=Probable succinate dehydrogenase [ubiquinone] flavoprotein 
subunit, mitochondrial; AltName: Full=Flavoprotein 
subunit of complex II; Short=FP; Flags: Precursor [Schizosaccharomyces 
pombe 972h-]
 emb|CAB61213.1| succinate dehydrogenase Sdh1 (predicted) [Schizosaccharomyces 
pombe]
Length=641

 Score = 81.3 bits (199),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +3

Query  177  SYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRN  356
             Y V+DHTYDA+VVGAGGAGLRA  GL+E GFNTACITKLFPTRSHTVAAQGGINAAL N
Sbjct  47   KYPVIDHTYDAIVVGAGGAGLRATFGLAEAGFNTACITKLFPTRSHTVAAQGGINAALGN  106

Query  357  MT  362
            MT
Sbjct  107  MT  108



>emb|CEG67799.1| Putative Succinate dehydrogenase flavoprotein subunit [Rhizopus 
microsporus]
Length=647

 Score = 81.3 bits (199),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 55/63 (87%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +3

Query  174  SSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALR  353
            S Y V+DH YDAVVVGAGGAGLRAA GL+E GFNTACITKLFPTRSHTVAAQGGINAAL 
Sbjct  52   SKYPVIDHEYDAVVVGAGGAGLRAAFGLAEAGFNTACITKLFPTRSHTVAAQGGINAALG  111

Query  354  NMT  362
            NMT
Sbjct  112  NMT  114



>ref|XP_007513731.1| succinate dehydrogenase flavoprotein subunit [Bathycoccus prasinos]
 emb|CCO16256.1| succinate dehydrogenase flavoprotein subunit [Bathycoccus prasinos]
Length=775

 Score = 81.6 bits (200),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 53/64 (83%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +3

Query  171  GSSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAAL  350
            G  Y ++DH YDAVVVGAGGAGLRAAIGLSEHG+ TAC+TKLFPTRSHTVAAQGGINAAL
Sbjct  171  GKEYEIIDHEYDAVVVGAGGAGLRAAIGLSEHGYKTACVTKLFPTRSHTVAAQGGINAAL  230

Query  351  RNMT  362
             NM+
Sbjct  231  GNMS  234



>tpg|DAA34477.1| TPA_exp: succinate dehydrogenase flavoprotein subunit [Amblyomma 
variegatum]
Length=217

 Score = 78.6 bits (192),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 67/101 (66%), Positives = 72/101 (71%), Gaps = 10/101 (10%)
 Frame = +3

Query  84   SRGLRIPSDRSIA-----GRSHFRRLF-SSQTN---VGGSSYTVVDHTYDavvvgaggag  236
            SR +  P+ R +      G S  RR F +SQ N   V G  Y VVDHT+DAVVVGAGGAG
Sbjct  5    SRWIVRPAIRDLQFGKVRGVSSVRRKFHTSQKNEQKVAGG-YEVVDHTFDAVVVGAGGAG  63

Query  237  lraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNM  359
            LRAA GL E GF TACITKLFPTRSHTVAAQGGINAAL NM
Sbjct  64   LRAASGLVEAGFKTACITKLFPTRSHTVAAQGGINAALGNM  104



>ref|XP_007708277.1| hypothetical protein COCCADRAFT_85691 [Bipolaris zeicola 26-R-13]
 gb|EMD94165.1| hypothetical protein COCHEDRAFT_1130495 [Bipolaris maydis C5]
 gb|ENI07535.1| hypothetical protein COCC4DRAFT_163571 [Bipolaris maydis ATCC 
48331]
 gb|EUC37384.1| hypothetical protein COCCADRAFT_85691 [Bipolaris zeicola 26-R-13]
 gb|EUN28914.1| hypothetical protein COCVIDRAFT_94516 [Bipolaris victoriae FI3]
Length=647

 Score = 81.3 bits (199),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 73/100 (73%), Gaps = 8/100 (8%)
 Frame = +3

Query  81   VSRGLRIPSDRSIAGRSHFRRLFSSQ-------TNVGGSSYTVVDHTYDavvvgaggagl  239
            ++R  R PS R+ +    F+R+ +++       +    S Y V+DH YDA+VVGAGGAGL
Sbjct  15   LARSFR-PSTRAFSSTRPFQRIIATENLRAKEASGFISSKYPVIDHQYDAIVVGAGGAGL  73

Query  240  raaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNM  359
            RAA GL+E GFNTACI+KLFPTRSHTVAAQGGINAAL NM
Sbjct  74   RAAFGLAEAGFNTACISKLFPTRSHTVAAQGGINAALGNM  113



>ref|XP_007692911.1| hypothetical protein COCMIDRAFT_108460 [Bipolaris oryzae ATCC 
44560]
 gb|EUC40579.1| hypothetical protein COCMIDRAFT_108460 [Bipolaris oryzae ATCC 
44560]
Length=647

 Score = 81.3 bits (199),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 73/100 (73%), Gaps = 8/100 (8%)
 Frame = +3

Query  81   VSRGLRIPSDRSIAGRSHFRRLFSSQ-------TNVGGSSYTVVDHTYDavvvgaggagl  239
            ++R  R PS R+ +    F+R+ +++       +    S Y V+DH YDA+VVGAGGAGL
Sbjct  15   LARSFR-PSTRAFSSTRPFQRIIATENLRAKEASGFISSKYPVIDHQYDAIVVGAGGAGL  73

Query  240  raaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNM  359
            RAA GL+E GFNTACI+KLFPTRSHTVAAQGGINAAL NM
Sbjct  74   RAAFGLAEAGFNTACISKLFPTRSHTVAAQGGINAALGNM  113



>ref|XP_001438844.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK71447.1| unnamed protein product [Paramecium tetraurelia]
Length=262

 Score = 78.6 bits (192),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 54/62 (87%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +3

Query  177  SYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRN  356
             YTV+DHTYDAVVVGAGGAGLRAA GL E GF TACI+KLFPTRSHTVAAQGGINAAL N
Sbjct  41   KYTVIDHTYDAVVVGAGGAGLRAAFGLVELGFKTACISKLFPTRSHTVAAQGGINAALGN  100

Query  357  MT  362
            MT
Sbjct  101  MT  102



>ref|XP_002172921.1| succinate dehydrogenase Sdh1 [Schizosaccharomyces japonicus yFS275]
 gb|EEB06628.1| succinate dehydrogenase Sdh1 [Schizosaccharomyces japonicus yFS275]
Length=641

 Score = 80.9 bits (198),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 57/77 (74%), Positives = 63/77 (82%), Gaps = 1/77 (1%)
 Frame = +3

Query  132  HFRRLFSSQTNVGGS-SYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTR  308
            H + L + Q N   S  Y ++DHTYDA+VVGAGGAGLRAA GL+E GFNTACITKLFPTR
Sbjct  31   HTQPLRAQQANTPSSVKYPLIDHTYDAIVVGAGGAGLRAAFGLAEAGFNTACITKLFPTR  90

Query  309  SHTVAAQGGINAALRNM  359
            SHTVAAQGGINAAL NM
Sbjct  91   SHTVAAQGGINAALGNM  107



>ref|XP_004768496.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit, mitochondrial, partial [Mustela putorius furo]
 ref|XP_004812569.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit, mitochondrial, partial [Mustela putorius furo]
Length=661

 Score = 80.9 bits (198),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 71/109 (65%), Gaps = 8/109 (7%)
 Frame = +3

Query  36   HCKPN-NQNLQEMWRCVSRGLRIPSDRSIAGRSHFRRLFSSQTNVGGSSYTVVDHTYDav  212
             C P+ +Q     WR  +RG     D +    +      S+Q       Y VVDH +DAV
Sbjct  10   ECSPSVSQQRPATWRTDTRGFHFSVDGNKRSSAKVSDSISTQ-------YPVVDHEFDAV  62

Query  213  vvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNM  359
            VVGAGGAGLRAA GLSE GFNTAC+TKLFPTRSHTVAAQGGINAAL NM
Sbjct  63   VVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNM  111



>ref|XP_007701408.1| hypothetical protein COCSADRAFT_120336 [Bipolaris sorokiniana 
ND90Pr]
 gb|EMD63185.1| hypothetical protein COCSADRAFT_120336 [Bipolaris sorokiniana 
ND90Pr]
Length=647

 Score = 80.9 bits (198),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 73/100 (73%), Gaps = 8/100 (8%)
 Frame = +3

Query  81   VSRGLRIPSDRSIAGRSHFRRLFSSQ-------TNVGGSSYTVVDHTYDavvvgaggagl  239
            ++R  R PS R+ +    F+R+ +++       +    S Y V+DH YDA+VVGAGGAGL
Sbjct  15   LARSFR-PSTRAFSSTRPFQRVIATENLRAKEASGFISSKYPVIDHQYDAIVVGAGGAGL  73

Query  240  raaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNM  359
            RAA GL+E GFNTACI+KLFPTRSHTVAAQGGINAAL NM
Sbjct  74   RAAFGLAEAGFNTACISKLFPTRSHTVAAQGGINAALGNM  113



>ref|XP_009226311.1| hypothetical protein GGTG_10181 [Gaeumannomyces graminis var. 
tritici R3-111a-1]
 gb|EJT73337.1| hypothetical protein GGTG_10181 [Gaeumannomyces graminis var. 
tritici R3-111a-1]
Length=650

 Score = 80.9 bits (198),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 53/63 (84%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +3

Query  171  GSSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAAL  350
            GS Y V+DH YDA+VVGAGGAGLRAA GL+E GFNTACI+KLFPTRSHTVAAQGGINAAL
Sbjct  54   GSKYPVIDHEYDAIVVGAGGAGLRAAFGLAEAGFNTACISKLFPTRSHTVAAQGGINAAL  113

Query  351  RNM  359
             NM
Sbjct  114  GNM  116



>emb|CCJ28744.1| unnamed protein product [Pneumocystis jirovecii]
Length=1155

 Score = 81.3 bits (199),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 53/61 (87%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = +3

Query  180  YTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNM  359
            YTVVDH YD VVVG+GGAGLRAA GL+E G+NTACITKLFPTRSHTVAAQGGINAAL NM
Sbjct  249  YTVVDHEYDVVVVGSGGAGLRAAFGLAEAGYNTACITKLFPTRSHTVAAQGGINAALGNM  308

Query  360  T  362
            T
Sbjct  309  T  309



>ref|XP_003082803.1| succinate dehydrogenase flavoprotein alpha subunit (ISS) [Ostreococcus 
tauri]
 emb|CAL56758.1| Succinate dehydrogenase/fumarate reductase,flavoprotein subunit 
[Ostreococcus tauri]
Length=681

 Score = 80.9 bits (198),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 56/76 (74%), Positives = 63/76 (83%), Gaps = 2/76 (3%)
 Frame = +3

Query  135  FRRLFSSQTNVGGSSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSH  314
            F R +S  +    S+Y ++DH YDA+VVGAGGAGLRAAIGL EHGF TAC+TKLFPTRSH
Sbjct  78   FARAYSGTS--ASSAYEIIDHEYDALVVGAGGAGLRAAIGLGEHGFKTACVTKLFPTRSH  135

Query  315  TVAAQGGINAALRNMT  362
            TVAAQGGINAAL NMT
Sbjct  136  TVAAQGGINAALGNMT  151



>emb|CDS03760.1| hypothetical protein LRAMOSA01161 [Absidia idahoensis var. thermophila]
Length=603

 Score = 80.5 bits (197),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 55/63 (87%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +3

Query  174  SSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALR  353
            S YTV DHTYDAVVVGAGGAGLRA+ GL+E GF TACITKLFPTRSHTVAAQGGINAAL 
Sbjct  7    SKYTVFDHTYDAVVVGAGGAGLRASFGLAEAGFKTACITKLFPTRSHTVAAQGGINAALG  66

Query  354  NMT  362
            NMT
Sbjct  67   NMT  69



>ref|XP_008036136.1| succinate dehydrogenase [Trametes versicolor FP-101664 SS1]
 gb|EIW60778.1| succinate dehydrogenase [Trametes versicolor FP-101664 SS1]
Length=637

 Score = 80.9 bits (198),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 60/101 (59%), Positives = 73/101 (72%), Gaps = 6/101 (6%)
 Frame = +3

Query  75   RCVSRGLRIPSDRSIAGRSHFRRLFSS-----QTNVGGSSYTVVDHTYDavvvgaggagl  239
            + + R LR  + RS +  +  RR+ ++     Q   G   Y +++H YDA+VVGAGGAGL
Sbjct  4    KSLPRALR-ATQRSFSSSAPARRVVATNPVKAQEVQGWGKYPLIEHEYDAIVVGAGGAGL  62

Query  240  raaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            RAA GL+E GFNTACITKLFPTRSHTVAAQGGINAAL NMT
Sbjct  63   RAAFGLAEAGFNTACITKLFPTRSHTVAAQGGINAALGNMT  103



>ref|XP_007871954.1| hypothetical protein PNEG_00097 [Pneumocystis murina B123]
 gb|EMR11659.1| hypothetical protein PNEG_00097 [Pneumocystis murina B123]
Length=646

 Score = 80.5 bits (197),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 52/64 (81%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +3

Query  171  GSSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAAL  350
            GS Y++VDH YD VVVG+GGAGLRAA GLSE G++TAC+TKLFPTRSHTVAAQGGINAAL
Sbjct  50   GSKYSIVDHEYDVVVVGSGGAGLRAAFGLSEAGYSTACVTKLFPTRSHTVAAQGGINAAL  109

Query  351  RNMT  362
             NMT
Sbjct  110  GNMT  113



>ref|XP_002186498.1| succinate dehydrogenase flavoprotein [Phaeodactylum tricornutum 
CCAP 1055/1]
 gb|ACI65968.1| succinate dehydrogenase flavoprotein [Phaeodactylum tricornutum 
CCAP 1055/1]
Length=638

 Score = 80.1 bits (196),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 53/61 (87%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = +3

Query  177  SYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRN  356
             YTV+DHTYDAVVVGAGG+GLRAA+GLSE GF TAC+TKLFPTRSHTVAAQGGINAAL N
Sbjct  38   DYTVIDHTYDAVVVGAGGSGLRAAMGLSEAGFKTACVTKLFPTRSHTVAAQGGINAALGN  97

Query  357  M  359
            M
Sbjct  98   M  98



>dbj|BAE87311.1| unnamed protein product [Macaca fascicularis]
Length=253

 Score = 77.8 bits (190),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +3

Query  174  SSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALR  353
            + Y VVDH +DAVVVGAGGAGLRAA GLSE GFNTAC+TKLFPTRSHTVAAQGGINAAL 
Sbjct  53   AQYPVVDHEFDAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALG  112

Query  354  NM  359
            NM
Sbjct  113  NM  114



>ref|XP_002494175.1| Flavoprotein subunit of succinate dehydrogenase (Sdh1p, Sdh2p, 
Sdh3p, Sdh4p) [Komagataella pastoris GS115]
 emb|CAY71996.1| Flavoprotein subunit of succinate dehydrogenase (Sdh1p, Sdh2p, 
Sdh3p, Sdh4p) [Komagataella pastoris GS115]
 emb|CCA40403.1| succinate dehydrogenase (ubiquinone) flavoprotein subunit [Komagataella 
pastoris CBS 7435]
Length=637

 Score = 80.1 bits (196),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 71/95 (75%), Gaps = 14/95 (15%)
 Frame = +3

Query  117  IAGRSHF------RRLFSSQTNVGGSS--------YTVVDHTYDavvvgaggaglraaig  254
            ++GRS F      R+++S+Q +V G++        Y ++DH YD VVVGAGGAGLRAA G
Sbjct  9    MSGRSWFSTTSVARKVYSAQQDVKGTNASIAMAKDYHIIDHEYDCVVVGAGGAGLRAAFG  68

Query  255  LSEHGFNTACITKLFPTRSHTVAAQGGINAALRNM  359
            L++ GF TACI+KLFPTRSHTVAAQGGINAAL NM
Sbjct  69   LAKEGFKTACISKLFPTRSHTVAAQGGINAALGNM  103



>ref|XP_005707863.1| succinate dehydrogenase (ubiquinone) flavoprotein subunit isoform 
1 [Galdieria sulphuraria]
 gb|EME31343.1| succinate dehydrogenase (ubiquinone) flavoprotein subunit isoform 
1 [Galdieria sulphuraria]
Length=661

 Score = 80.1 bits (196),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = +3

Query  150  SSQTNVGGSSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQ  329
            +S ++  G SY++VDHTYDAVVVGAGGAGLRA IGL E G   ACITKLFPTRSHTVAAQ
Sbjct  48   ASPSSFSGKSYSIVDHTYDAVVVGAGGAGLRATIGLCEAGLKAACITKLFPTRSHTVAAQ  107

Query  330  GGINAALRNMT  362
            GGINAAL NMT
Sbjct  108  GGINAALGNMT  118



>gb|KFY12526.1| hypothetical protein V491_06755, partial [Pseudogymnoascus pannorum 
VKM F-3775]
Length=370

 Score = 78.6 bits (192),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +3

Query  171  GSSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAAL  350
            G+ Y V+DH YDA+VVGAGGAGLRAA GL+E GFNTACI+KLFPTRSHTVAAQGGINAAL
Sbjct  51   GNQYPVIDHEYDAIVVGAGGAGLRAAFGLAEAGFNTACISKLFPTRSHTVAAQGGINAAL  110

Query  351  RNM  359
             NM
Sbjct  111  GNM  113



>gb|KIV77229.1| succinate dehydrogenase [ubiquinone] flavoprotein subunit 2, 
mitochondrial [Exophiala sideris]
Length=648

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 70/99 (71%), Gaps = 8/99 (8%)
 Frame = +3

Query  84   SRGLRIPSDRSIAGRSHFRRLFSSQ-------TNVGGSSYTVVDHTYDavvvgaggaglr  242
            SR L+ P+ R  +      R+ +SQ       +     SY V+DH YDAVVVGAGGAGLR
Sbjct  17   SRALK-PTRRQFSTTRPVARVVASQPLRAKEASPFASKSYPVIDHQYDAVVVGAGGAGLR  75

Query  243  aaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNM  359
            AA GL+E GFNTAC+TKLFPTRSHTVAAQGGINAAL NM
Sbjct  76   AAFGLAEAGFNTACVTKLFPTRSHTVAAQGGINAALGNM  114



>emb|CDS32637.1| succinate dehydrogenase (ubiquinone) [Hymenolepis microstoma]
Length=648

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 53/63 (84%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = +3

Query  171  GSSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAAL  350
            G  YT++DHTYDAVVVGAGGAGLRAA GLS  GF TAC+TKLFPTRSHTVAAQGGINAAL
Sbjct  33   GKDYTIIDHTYDAVVVGAGGAGLRAAFGLSNEGFKTACVTKLFPTRSHTVAAQGGINAAL  92

Query  351  RNM  359
             NM
Sbjct  93   GNM  95



>ref|XP_001014703.2| succinate dehydrogenase, flavoprotein subunit containing protein 
[Tetrahymena thermophila]
 gb|EAR94519.2| succinate dehydrogenase [ubiquinone] flavoprotein subunit [Tetrahymena 
thermophila SB210]
Length=636

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 54/61 (89%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = +3

Query  180  YTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNM  359
            YTV+DHTYDA+VVGAGGAGLRAA GL E GF TACITKLFPTRSHTVAAQGGINAAL NM
Sbjct  42   YTVIDHTYDAIVVGAGGAGLRAAFGLVEEGFKTACITKLFPTRSHTVAAQGGINAALGNM  101

Query  360  T  362
            T
Sbjct  102  T  102



>ref|XP_003063914.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH52287.1| predicted protein [Micromonas pusilla CCMP1545]
Length=640

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 63/74 (85%), Gaps = 2/74 (3%)
 Frame = +3

Query  147  FSSQTNVGGS--SYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTV  320
            F++  + G +  +Y ++DH YDAVVVGAGGAGLRAAIGLSEHG  TAC+TKLFPTRSHTV
Sbjct  35   FATSASAGANKPAYQIIDHEYDAVVVGAGGAGLRAAIGLSEHGLKTACVTKLFPTRSHTV  94

Query  321  AAQGGINAALRNMT  362
            AAQGGINAAL NMT
Sbjct  95   AAQGGINAALGNMT  108



>ref|XP_001748251.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ87012.1| predicted protein [Monosiga brevicollis MX1]
Length=646

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 67/88 (76%), Gaps = 5/88 (6%)
 Frame = +3

Query  111  RSIAGRSHFRRLFSS-----QTNVGGSSYTVVDHTYDavvvgaggaglraaigLSEHGFN  275
            +S A RS  R+L +S      T    S+Y +VDH +DAVVVGAGGAGLRAA GL+E GF 
Sbjct  7    KSTAARSASRQLHTSLRRARATEQVSSAYPIVDHEFDAVVVGAGGAGLRAAFGLTEKGFK  66

Query  276  TACITKLFPTRSHTVAAQGGINAALRNM  359
            TACITKLFPTRSHTVAAQGGINAAL NM
Sbjct  67   TACITKLFPTRSHTVAAQGGINAALGNM  94



>gb|ESZ94343.1| succinate dehydrogenase flavoprotein subunit [Sclerotinia borealis 
F-4157]
Length=647

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +3

Query  171  GSSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAAL  350
            G+ Y VVDH YDA+V+GAGGAGLRAA GL+E GFNTACI+KLFPTRSHTVAAQGGINAAL
Sbjct  51   GNKYPVVDHEYDAIVIGAGGAGLRAAFGLAEAGFNTACISKLFPTRSHTVAAQGGINAAL  110

Query  351  RNM  359
             NM
Sbjct  111  GNM  113



>gb|KFY41308.1| hypothetical protein V494_03077 [Pseudogymnoascus pannorum VKM 
F-4513 (FW-928)]
Length=1086

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +3

Query  171  GSSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAAL  350
            G+ Y V+DH YDA+VVGAGGAGLRAA GL+E GFNTACI+KLFPTRSHTVAAQGGINAAL
Sbjct  51   GNQYPVIDHEYDAIVVGAGGAGLRAAFGLAEAGFNTACISKLFPTRSHTVAAQGGINAAL  110

Query  351  RNM  359
             NM
Sbjct  111  GNM  113



>gb|KFY41539.1| hypothetical protein V495_04895 [Pseudogymnoascus pannorum VKM 
F-4514 (FW-929)]
 gb|KFY54965.1| hypothetical protein V497_07316 [Pseudogymnoascus pannorum VKM 
F-4516 (FW-969)]
Length=1020

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +3

Query  171  GSSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAAL  350
            G+ Y V+DH YDA+VVGAGGAGLRAA GL+E GFNTACI+KLFPTRSHTVAAQGGINAAL
Sbjct  51   GNQYPVIDHEYDAIVVGAGGAGLRAAFGLAEAGFNTACISKLFPTRSHTVAAQGGINAAL  110

Query  351  RNM  359
             NM
Sbjct  111  GNM  113



>gb|KFY12701.1| hypothetical protein V492_03719 [Pseudogymnoascus pannorum VKM 
F-4246]
Length=1025

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +3

Query  171  GSSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAAL  350
            G+ Y V+DH YDA+VVGAGGAGLRAA GL+E GFNTACI+KLFPTRSHTVAAQGGINAAL
Sbjct  51   GNQYPVIDHEYDAIVVGAGGAGLRAAFGLAEAGFNTACISKLFPTRSHTVAAQGGINAAL  110

Query  351  RNM  359
             NM
Sbjct  111  GNM  113



>gb|KFX90124.1| hypothetical protein V490_06643 [Pseudogymnoascus pannorum VKM 
F-3557]
Length=1020

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +3

Query  171  GSSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAAL  350
            G+ Y V+DH YDA+VVGAGGAGLRAA GL+E GFNTACI+KLFPTRSHTVAAQGGINAAL
Sbjct  51   GNQYPVIDHEYDAIVVGAGGAGLRAAFGLAEAGFNTACISKLFPTRSHTVAAQGGINAAL  110

Query  351  RNM  359
             NM
Sbjct  111  GNM  113



>gb|KFY85893.1| hypothetical protein V500_08041 [Pseudogymnoascus pannorum VKM 
F-4518 (FW-2643)]
Length=1041

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +3

Query  171  GSSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAAL  350
            G+ Y V+DH YDA+VVGAGGAGLRAA GL+E GFNTACI+KLFPTRSHTVAAQGGINAAL
Sbjct  51   GNQYPVIDHEYDAIVVGAGGAGLRAAFGLAEAGFNTACISKLFPTRSHTVAAQGGINAAL  110

Query  351  RNM  359
             NM
Sbjct  111  GNM  113



>ref|XP_005644633.1| succinate dehydrogenase [Coccomyxa subellipsoidea C-169]
 gb|EIE20089.1| succinate dehydrogenase [Coccomyxa subellipsoidea C-169]
Length=606

 Score = 79.3 bits (194),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 51/63 (81%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +3

Query  174  SSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALR  353
            SSY ++DHTYDA+V+GAGGAGLRA +GL E GFN ACITKLFPTRSHTVAAQGGINAAL 
Sbjct  8    SSYPIIDHTYDAIVIGAGGAGLRATVGLCEAGFNAACITKLFPTRSHTVAAQGGINAALG  67

Query  354  NMT  362
            NM+
Sbjct  68   NMS  70



>gb|KFY21799.1| hypothetical protein V493_07105 [Pseudogymnoascus pannorum VKM 
F-4281 (FW-2241)]
Length=1037

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +3

Query  171  GSSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAAL  350
            G+ Y V+DH YDA+VVGAGGAGLRAA GL+E GFNTACI+KLFPTRSHTVAAQGGINAAL
Sbjct  51   GNQYPVIDHEYDAIVVGAGGAGLRAAFGLAEAGFNTACISKLFPTRSHTVAAQGGINAAL  110

Query  351  RNM  359
             NM
Sbjct  111  GNM  113



>ref|XP_007724687.1| succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial 
[Capronia coronata CBS 617.96]
 gb|EXJ88681.1| succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial 
[Capronia coronata CBS 617.96]
Length=648

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 54/62 (87%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +3

Query  174  SSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALR  353
            S Y V+DH YDAVVVGAGGAGLRAA GL+E GFNTACITKLFPTRSHTVAAQGGINAAL 
Sbjct  53   SKYPVIDHEYDAVVVGAGGAGLRAAFGLAEAGFNTACITKLFPTRSHTVAAQGGINAALG  112

Query  354  NM  359
            NM
Sbjct  113  NM  114



>gb|KDQ06748.1| hypothetical protein BOTBODRAFT_121111 [Botryobasidium botryosum 
FD-172 SS1]
Length=643

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 72/100 (72%), Gaps = 9/100 (9%)
 Frame = +3

Query  87   RGLRIPSDRSIAGRSHFRRLFSS--------QTNVGGSSYTVVDHTYDavvvgaggaglr  242
            R L  PS RS+   +  R++ +S        ++      YT+++H YDA+VVGAGGAGLR
Sbjct  11   RALAAPS-RSLHASAAARQVVASSPLKAEEVKSYAADGKYTLIEHEYDAIVVGAGGAGLR  69

Query  243  aaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            AA GL+E GFNTACITKLFPTRSHTVAAQGG+NAAL NMT
Sbjct  70   AAFGLAEAGFNTACITKLFPTRSHTVAAQGGVNAALGNMT  109



>ref|XP_006752267.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit, mitochondrial-like, partial [Leptonychotes weddellii]
Length=248

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +3

Query  174  SSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALR  353
            + Y VVDH +DAVVVGAGGAGLRAA GLSE GFNTAC+TKLFPTRSHTVAAQGGINAAL 
Sbjct  3    TQYPVVDHEFDAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALG  62

Query  354  NM  359
            NM
Sbjct  63   NM  64



>gb|KFX97497.1| hypothetical protein O988_04844 [Pseudogymnoascus pannorum VKM 
F-3808]
Length=646

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +3

Query  171  GSSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAAL  350
            G+ Y V+DH YDA+VVGAGGAGLRAA GL+E GFNTACI+KLFPTRSHTVAAQGGINAAL
Sbjct  51   GNQYPVIDHEYDAIVVGAGGAGLRAAFGLAEAGFNTACISKLFPTRSHTVAAQGGINAAL  110

Query  351  RNM  359
             NM
Sbjct  111  GNM  113



>ref|XP_004035042.1| succinate dehydrogenase, putative [Ichthyophthirius multifiliis]
 gb|EGR31556.1| succinate dehydrogenase, putative [Ichthyophthirius multifiliis]
Length=637

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 54/63 (86%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +3

Query  174  SSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALR  353
            + YTV+DHTYDAVVVGAGGAGLRAA GL E GF TACI+KLFPTRSHTVAAQGGINAAL 
Sbjct  40   NKYTVIDHTYDAVVVGAGGAGLRAAFGLVEEGFKTACISKLFPTRSHTVAAQGGINAALG  99

Query  354  NMT  362
            NMT
Sbjct  100  NMT  102



>emb|CDH53199.1| succinate dehydrogenase [Lichtheimia corymbifera JMRC:FSU:9682]
Length=649

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 54/63 (86%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = +3

Query  174  SSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALR  353
            S Y V+DH YDAVVVGAGGAGLRAA GL+E G NTACITKLFPTRSHTVAAQGGINAAL 
Sbjct  54   SKYPVIDHEYDAVVVGAGGAGLRAAFGLAEAGLNTACITKLFPTRSHTVAAQGGINAALG  113

Query  354  NMT  362
            NMT
Sbjct  114  NMT  116



>ref|XP_006114284.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit, mitochondrial, partial [Pelodiscus sinensis]
Length=300

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +3

Query  174  SSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALR  353
            + Y VVDH +DAVVVGAGGAGLRAA GLSE GFNTAC+TKLFPTRSHTVAAQGGINAAL 
Sbjct  55   TQYPVVDHEFDAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALG  114

Query  354  NM  359
            NM
Sbjct  115  NM  116



>emb|CDH57827.1| succinate dehydrogenase [Lichtheimia corymbifera JMRC:FSU:9682]
Length=649

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 54/63 (86%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = +3

Query  174  SSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALR  353
            S Y V+DH YDAVVVGAGGAGLRAA GL+E G NTACITKLFPTRSHTVAAQGGINAAL 
Sbjct  54   SKYPVIDHEYDAVVVGAGGAGLRAAFGLAEAGLNTACITKLFPTRSHTVAAQGGINAALG  113

Query  354  NMT  362
            NMT
Sbjct  114  NMT  116



>gb|EIE82583.1| succinate dehydrogenase [ubiquinone] flavoprotein subunit 1 [Rhizopus 
delemar RA 99-880]
Length=627

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 54/64 (84%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +3

Query  171  GSSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAAL  350
             S Y ++DH YDAVVVGAGGAGLRAA GL+E GFNTACITKLFPTRSHTVAAQGGINAAL
Sbjct  31   ASKYPIIDHEYDAVVVGAGGAGLRAAFGLAEAGFNTACITKLFPTRSHTVAAQGGINAAL  90

Query  351  RNMT  362
             NMT
Sbjct  91   GNMT  94



>gb|KFZ08763.1| hypothetical protein V502_09175 [Pseudogymnoascus pannorum VKM 
F-4520 (FW-2644)]
Length=646

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +3

Query  171  GSSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAAL  350
            G+ Y V+DH YDA+VVGAGGAGLRAA GL+E GFNTACI+KLFPTRSHTVAAQGGINAAL
Sbjct  51   GNQYPVIDHEYDAIVVGAGGAGLRAAFGLAEAGFNTACISKLFPTRSHTVAAQGGINAAL  110

Query  351  RNM  359
             NM
Sbjct  111  GNM  113



>gb|EIE88610.1| succinate dehydrogenase [ubiquinone] flavoprotein subunit 1 [Rhizopus 
delemar RA 99-880]
Length=649

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 54/64 (84%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +3

Query  171  GSSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAAL  350
             S Y ++DH YDAVVVGAGGAGLRAA GL+E GFNTACITKLFPTRSHTVAAQGGINAAL
Sbjct  53   ASKYPIIDHEYDAVVVGAGGAGLRAAFGLAEAGFNTACITKLFPTRSHTVAAQGGINAAL  112

Query  351  RNMT  362
             NMT
Sbjct  113  GNMT  116



>ref|XP_003738076.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit, mitochondrial-like [Metaseiulus occidentalis]
Length=647

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 61/95 (64%), Positives = 67/95 (71%), Gaps = 8/95 (8%)
 Frame = +3

Query  87   RGLRIPSDRSIAGRSHFRRLFSSQTNVGGSS----YTVVDHTYDavvvgaggaglraaig  254
            R LR  S R+        R FS+ + V G +    Y VVDH +DA+VVGAGGAGLRAA G
Sbjct  6    RALRFGSQRA----QLLSRNFSATSAVSGKADWKGYKVVDHEFDAIVVGAGGAGLRAAFG  61

Query  255  LSEHGFNTACITKLFPTRSHTVAAQGGINAALRNM  359
            L E GF TACITKLFPTRSHTVAAQGGINAAL NM
Sbjct  62   LVEEGFKTACITKLFPTRSHTVAAQGGINAALGNM  96



>gb|KFY69831.1| hypothetical protein V499_09711 [Pseudogymnoascus pannorum VKM 
F-103]
 gb|KFZ00659.1| hypothetical protein V501_10569 [Pseudogymnoascus pannorum VKM 
F-4519 (FW-2642)]
Length=646

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +3

Query  171  GSSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAAL  350
            G+ Y V+DH YDA+VVGAGGAGLRAA GL+E GFNTACI+KLFPTRSHTVAAQGGINAAL
Sbjct  51   GNQYPVIDHEYDAIVVGAGGAGLRAAFGLAEAGFNTACISKLFPTRSHTVAAQGGINAAL  110

Query  351  RNM  359
             NM
Sbjct  111  GNM  113



>gb|ELR10143.1| succinate dehydrogenase flavoprotein subunit, mitochondrial [Pseudogymnoascus 
destructans 20631-21]
Length=646

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +3

Query  171  GSSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAAL  350
            G+ Y V+DH YDA+VVGAGGAGLRAA GL+E GFNTACI+KLFPTRSHTVAAQGGINAAL
Sbjct  51   GNQYPVIDHEYDAIVVGAGGAGLRAAFGLAEAGFNTACISKLFPTRSHTVAAQGGINAAL  110

Query  351  RNM  359
             NM
Sbjct  111  GNM  113



>ref|XP_447749.1| hypothetical protein [Candida glabrata CBS 138]
 emb|CAG60696.1| unnamed protein product [Candida glabrata]
Length=710

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 70/105 (67%), Gaps = 8/105 (8%)
 Frame = +3

Query  45   PNNQNLQEMWRCVSRGLRIPSDRSIAGRSHFRRLFSSQTNVGGSSYTVVDHTYDavvvga  224
            PN    ++M R    GLR+    +   R H     ++   +G   Y V+DH YD +VVGA
Sbjct  80   PNTSTHKKMLRT---GLRLRQLSTSCVRRH-----AAPAGLGAGKYNVIDHEYDCLVVGA  131

Query  225  ggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNM  359
            GGAGLRAA GL+E GF TACI+KLFPTRSHTVAAQGGINAAL NM
Sbjct  132  GGAGLRAAFGLAEAGFKTACISKLFPTRSHTVAAQGGINAALGNM  176



>gb|KFY53709.1| hypothetical protein V496_07397 [Pseudogymnoascus pannorum VKM 
F-4515 (FW-2607)]
 gb|KFY78918.1| hypothetical protein V498_09017 [Pseudogymnoascus pannorum VKM 
F-4517 (FW-2822)]
Length=646

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +3

Query  171  GSSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAAL  350
            G+ Y V+DH YDA+VVGAGGAGLRAA GL+E GFNTACI+KLFPTRSHTVAAQGGINAAL
Sbjct  51   GNQYPVIDHEYDAIVVGAGGAGLRAAFGLAEAGFNTACISKLFPTRSHTVAAQGGINAAL  110

Query  351  RNM  359
             NM
Sbjct  111  GNM  113



>emb|CDI99717.1| succinate dehydrogenase (ubiquinone) [Echinococcus multilocularis]
 emb|CDS36999.1| succinate dehydrogenase (ubiquinone) [Echinococcus multilocularis]
Length=661

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 53/70 (76%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = +3

Query  150  SSQTNVGGSSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQ  329
            S   +  G  YT++DHTYDAVVVGAGGAGLRAA GL+  GF TAC+TKLFPTRSHTVAAQ
Sbjct  39   SRHVSTVGKDYTIIDHTYDAVVVGAGGAGLRAAFGLANEGFKTACVTKLFPTRSHTVAAQ  98

Query  330  GGINAALRNM  359
            GGINAAL NM
Sbjct  99   GGINAALGNM  108



>emb|CDS18948.1| succinate dehydrogenase ubiquinone [Echinococcus granulosus]
Length=668

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 53/70 (76%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = +3

Query  150  SSQTNVGGSSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQ  329
            S   +  G  YT++DHTYDAVVVGAGGAGLRAA GL+  GF TAC+TKLFPTRSHTVAAQ
Sbjct  46   SRHVSTVGKDYTIIDHTYDAVVVGAGGAGLRAAFGLANEGFKTACVTKLFPTRSHTVAAQ  105

Query  330  GGINAALRNM  359
            GGINAAL NM
Sbjct  106  GGINAALGNM  115



>gb|EJY79900.1| hypothetical protein OXYTRI_22821 [Oxytricha trifallax]
Length=640

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 60/68 (88%), Gaps = 2/68 (3%)
 Frame = +3

Query  156  QTNVGGSSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGG  335
            Q  +G  +YTV+DHTYDA+VVGAGGAGLRAA GL+E GF TACI+KLFPTRSHTVAAQGG
Sbjct  41   QEKIG--NYTVIDHTYDAIVVGAGGAGLRAAFGLAEAGFKTACISKLFPTRSHTVAAQGG  98

Query  336  INAALRNM  359
            INAAL NM
Sbjct  99   INAALGNM  106



>gb|EUB62925.1| Succinate dehydrogenase [ubiquinone] flavoprotein subunit [Echinococcus 
granulosus]
Length=648

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 53/70 (76%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = +3

Query  150  SSQTNVGGSSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQ  329
            S   +  G  YT++DHTYDAVVVGAGGAGLRAA GL+  GF TAC+TKLFPTRSHTVAAQ
Sbjct  26   SRHVSTVGKDYTIIDHTYDAVVVGAGGAGLRAAFGLANEGFKTACVTKLFPTRSHTVAAQ  85

Query  330  GGINAALRNM  359
            GGINAAL NM
Sbjct  86   GGINAALGNM  95



>ref|XP_009206357.1| PREDICTED: LOW QUALITY PROTEIN: succinate dehydrogenase [ubiquinone] 
flavoprotein subunit, mitochondrial-like [Papio anubis]
Length=686

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +3

Query  174  SSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALR  353
            + Y VVDH +DAVVVGAGGAGLRAA GLSE GFNTAC+TKLFPTRSHTVAAQGGINAAL 
Sbjct  53   AQYPVVDHEFDAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALE  112

Query  354  NM  359
            NM
Sbjct  113  NM  114



>ref|XP_001458195.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK90798.1| unnamed protein product [Paramecium tetraurelia]
Length=619

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 54/61 (89%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = +3

Query  180  YTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNM  359
            YTV+DHTYDAVVVGAGGAGLRAA GL E GF TACI+KLFPTRSHTVAAQGGINAAL NM
Sbjct  42   YTVIDHTYDAVVVGAGGAGLRAAFGLVELGFKTACISKLFPTRSHTVAAQGGINAALGNM  101

Query  360  T  362
            T
Sbjct  102  T  102



>ref|XP_007443042.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit, mitochondrial-like [Python bivittatus]
Length=215

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +3

Query  174  SSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALR  353
            + Y VVDH +DAVVVGAGGAGLRAA GLSE GFNTAC++KLFPTRSHTVAAQGGINAAL 
Sbjct  49   TQYPVVDHEFDAVVVGAGGAGLRAAFGLSEAGFNTACVSKLFPTRSHTVAAQGGINAALG  108

Query  354  NM  359
            NM
Sbjct  109  NM  110



>gb|KIW38441.1| succinate dehydrogenase [ubiquinone] flavoprotein subunit 2, 
mitochondrial [Exophiala oligosperma]
Length=648

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +3

Query  174  SSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALR  353
            S Y V+DH YDAVVVGAGGAGLRAA GL+E GFNTAC+TKLFPTRSHTVAAQGGINAAL 
Sbjct  53   SKYAVIDHEYDAVVVGAGGAGLRAAFGLAEAGFNTACVTKLFPTRSHTVAAQGGINAALG  112

Query  354  NM  359
            NM
Sbjct  113  NM  114



>ref|XP_001423305.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK55907.1| unnamed protein product [Paramecium tetraurelia]
Length=362

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 54/61 (89%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = +3

Query  180  YTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNM  359
            YTV+DHTYDAVVVGAGGAGLRAA GL E GF TACI+KLFPTRSHTVAAQGGINAAL NM
Sbjct  42   YTVIDHTYDAVVVGAGGAGLRAAFGLVELGFKTACISKLFPTRSHTVAAQGGINAALGNM  101

Query  360  T  362
            T
Sbjct  102  T  102



>ref|XP_001434264.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK66867.1| unnamed protein product [Paramecium tetraurelia]
Length=636

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 54/61 (89%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = +3

Query  180  YTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNM  359
            YTV+DHTYDAVVVGAGGAGLRAA GL E GF TACI+KLFPTRSHTVAAQGGINAAL NM
Sbjct  42   YTVIDHTYDAVVVGAGGAGLRAAFGLVELGFKTACISKLFPTRSHTVAAQGGINAALGNM  101

Query  360  T  362
            T
Sbjct  102  T  102



>ref|XP_006956287.1| succinate dehydrogenase [Wallemia sebi CBS 633.66]
 gb|EIM23616.1| succinate dehydrogenase [Wallemia sebi CBS 633.66]
Length=642

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +3

Query  174  SSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALR  353
            S+Y V+DH YDA+VVGAGG+GLRAA GL+E GF TACITKLFPTRSHTVAAQGGINAAL 
Sbjct  46   SNYPVIDHEYDALVVGAGGSGLRAAFGLAEAGFKTACITKLFPTRSHTVAAQGGINAALG  105

Query  354  NMT  362
            NMT
Sbjct  106  NMT  108



>ref|XP_002293997.1| succinate dehydrogenase flavoprotein subunit [Thalassiosira pseudonana 
CCMP1335]
 gb|EED89006.1| succinate dehydrogenase flavoprotein subunit [Thalassiosira pseudonana 
CCMP1335]
Length=637

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 50/60 (83%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +3

Query  180  YTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNM  359
            YT+VDHTYDA+V+GAGG+GLRAA+GLSE GF TAC++KLFPTRSHTVAAQGGINAAL NM
Sbjct  38   YTIVDHTYDALVIGAGGSGLRAAMGLSEAGFKTACVSKLFPTRSHTVAAQGGINAALGNM  97



>gb|EPY51569.1| succinate dehydrogenase Sdh1 [Schizosaccharomyces cryophilus 
OY26]
Length=641

 Score = 79.0 bits (193),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +3

Query  177  SYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRN  356
             Y +VDHTYDA+VVGAGGAGLRA  GL+E GF+TACITKLFPTRSHTVAAQGGINAAL N
Sbjct  47   KYPIVDHTYDAIVVGAGGAGLRATFGLAEAGFSTACITKLFPTRSHTVAAQGGINAALGN  106

Query  357  MT  362
            MT
Sbjct  107  MT  108



>ref|XP_001438472.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK71075.1| unnamed protein product [Paramecium tetraurelia]
Length=361

 Score = 77.4 bits (189),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 54/61 (89%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = +3

Query  180  YTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNM  359
            YTV+DHTYDAVVVGAGGAGLRAA GL E GF TACI+KLFPTRSHTVAAQGGINAAL NM
Sbjct  42   YTVIDHTYDAVVVGAGGAGLRAAFGLVELGFKTACISKLFPTRSHTVAAQGGINAALGNM  101

Query  360  T  362
            T
Sbjct  102  T  102



>sp|Q0QF01.2|SDHA_PIG RecName: Full=Succinate dehydrogenase [ubiquinone] flavoprotein 
subunit, mitochondrial; AltName: Full=Flavoprotein subunit 
of complex II; Short=Fp; Flags: Precursor [Sus scrofa]
Length=664

 Score = 79.0 bits (193),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 68/92 (74%), Gaps = 6/92 (7%)
 Frame = +3

Query  102  PSDRSIAGRS-HF-----RRLFSSQTNVGGSSYTVVDHTYDavvvgaggaglraaigLSE  263
            P+   I  RS HF     +R  +  ++   + Y VVDH +DAVVVGAGGAGLRAA GLSE
Sbjct  23   PAASPIGARSFHFTVDGNKRSSAKVSDAISTQYPVVDHEFDAVVVGAGGAGLRAAFGLSE  82

Query  264  HGFNTACITKLFPTRSHTVAAQGGINAALRNM  359
             GFNTAC+TKLFPTRSHTVAAQGGINAAL NM
Sbjct  83   AGFNTACVTKLFPTRSHTVAAQGGINAALGNM  114



>ref|NP_001080770.1| succinate dehydrogenase [ubiquinone] flavoprotein subunit B, 
mitochondrial precursor [Xenopus laevis]
 sp|Q801S2.1|SDHAB_XENLA RecName: Full=Succinate dehydrogenase [ubiquinone] flavoprotein 
subunit B, mitochondrial; AltName: Full=Flavoprotein subunit 
of complex II B; Short=Fp; Flags: Precursor [Xenopus laevis]
 gb|AAH47261.1| Sdha protein [Xenopus laevis]
Length=665

 Score = 79.0 bits (193),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 77/108 (71%), Gaps = 13/108 (12%)
 Frame = +3

Query  75   RCVSRGLRIPSD------RSIAGRSHF------RRLFSSQTNVGGSS-YTVVDHTYDavv  215
            R +SR L++ S        SIA R +F      R+  S++ +   S+ Y VVDH +DAVV
Sbjct  10   RLLSRALQLTSTLQNCTATSIAARRNFHFTVYGRKDTSAKVSDSISTQYPVVDHDFDAVV  69

Query  216  vgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNM  359
            VGAGGAGLRAA GLSE GFNTACITKLFPTRSHTVAAQGGINAAL NM
Sbjct  70   VGAGGAGLRAAFGLSEAGFNTACITKLFPTRSHTVAAQGGINAALGNM  117



>emb|CEJ89492.1| Putative Succinate dehydrogenase, flavoprotein subunit [Torrubiella 
hemipterigena]
Length=651

 Score = 79.0 bits (193),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 51/61 (84%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = +3

Query  177  SYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRN  356
            +YTV+DH YDA+V+GAGGAGLRAA GL+E GFNTACI+KLFPTRSHTVAAQGGINAAL N
Sbjct  57   NYTVIDHEYDALVIGAGGAGLRAAFGLAEAGFNTACISKLFPTRSHTVAAQGGINAALGN  116

Query  357  M  359
            M
Sbjct  117  M  117



>ref|XP_003443736.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit, mitochondrial-like isoform 2 [Oreochromis niloticus]
Length=663

 Score = 79.0 bits (193),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 60/100 (60%), Positives = 68/100 (68%), Gaps = 5/100 (5%)
 Frame = +3

Query  75   RCVSRGLRIPSDRSIAGRSHFRRLFSSQTNVGGSS-----YTVVDHTYDavvvgaggagl  239
            R +S     P   S+  R+    ++  + N   S      Y VVDH +DAVVVGAGGAGL
Sbjct  14   RVLSTAKAWPPLLSVGSRNFHFSIYGKKKNAKVSDDISTQYPVVDHEFDAVVVGAGGAGL  73

Query  240  raaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNM  359
            RAA GLSE GFNTAC+TKLFPTRSHTVAAQGGINAAL NM
Sbjct  74   RAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNM  113



>ref|XP_007411829.1| hypothetical protein MELLADRAFT_44058 [Melampsora larici-populina 
98AG31]
 gb|EGG04738.1| hypothetical protein MELLADRAFT_44058 [Melampsora larici-populina 
98AG31]
Length=648

 Score = 79.0 bits (193),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 58/112 (52%), Positives = 73/112 (65%), Gaps = 14/112 (13%)
 Frame = +3

Query  69   MWRCVSRGLRIPSDRSIAGRSHFR------RLFSSQ--------TNVGGSSYTVVDHTYD  206
            M R +S  ++ P  + I  +  F       ++ S+Q        + +    Y ++DH YD
Sbjct  1    MLRSISSSIKPPLSKLIKSQRGFSTTQSCSKIISTQPLKASQAPSIISSGKYPIIDHEYD  60

Query  207  avvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            A+VVGAGGAGLRAA GL+E G NTACITKLFPTRSHTVAAQGG+NAAL NMT
Sbjct  61   AIVVGAGGAGLRAAFGLAEAGLNTACITKLFPTRSHTVAAQGGVNAALGNMT  112



>ref|XP_008577168.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit, mitochondrial [Galeopterus variegatus]
Length=665

 Score = 79.0 bits (193),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = +3

Query  138  RRLFSSQTNVGGSSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHT  317
            +R  +  +N   + Y VVDH +DAVVVGAGGAGLRAA GLSE GFNTACITKLFPTRSHT
Sbjct  42   KRASAKVSNSISTQYPVVDHEFDAVVVGAGGAGLRAAFGLSEAGFNTACITKLFPTRSHT  101

Query  318  VAAQGGINAALRNM  359
            VAAQGGINAAL NM
Sbjct  102  VAAQGGINAALGNM  115



>gb|KIY92921.1| succinate dehydrogenase (ubiquinone)flavoprotein subunit [Monoraphidium 
neglectum]
Length=244

 Score = 76.3 bits (186),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = +3

Query  174  SSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALR  353
             SY ++DH YDA+VVGAGGAGLRAA+GLSE G  TACITKLFPTRSHTVAAQGGINAAL 
Sbjct  65   KSYPMIDHQYDAIVVGAGGAGLRAAVGLSEAGLKTACITKLFPTRSHTVAAQGGINAALG  124

Query  354  NMT  362
            NM+
Sbjct  125  NMS  127



>ref|XP_001610645.1| succinate dehydrogenase alpha subunit [Babesia bovis T2Bo]
 gb|EDO07077.1| succinate dehydrogenase alpha subunit, putative [Babesia bovis]
Length=624

 Score = 78.6 bits (192),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 66/81 (81%), Gaps = 5/81 (6%)
 Frame = +3

Query  129  SHFRRLFSSQT---NVGGSSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLF  299
            S F R FSS+    N+ G  +TVV+HTYDAV+VGAGGAGLRAA+ LS  G+ TAC++KLF
Sbjct  12   SKFGRKFSSEAVSRNISG--HTVVEHTYDAVIVGAGGAGLRAALELSSTGYKTACVSKLF  69

Query  300  PTRSHTVAAQGGINAALRNMT  362
            PTRSHTVAAQGGINAAL NMT
Sbjct  70   PTRSHTVAAQGGINAALGNMT  90



>ref|XP_001347005.1| Succinate dehydrogenase [Paramecium tetraurelia strain d4-2]
 emb|CAH03378.1| Succinate dehydrogenase, putative [Paramecium tetraurelia]
Length=636

 Score = 78.6 bits (192),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 54/61 (89%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = +3

Query  180  YTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNM  359
            YTV+DHTYDAVVVGAGGAGLRAA GL E GF TACI+KLFPTRSHTVAAQGGINAAL NM
Sbjct  42   YTVIDHTYDAVVVGAGGAGLRAAFGLVELGFKTACISKLFPTRSHTVAAQGGINAALGNM  101

Query  360  T  362
            T
Sbjct  102  T  102



>ref|XP_502696.2| YALI0D11374p [Yarrowia lipolytica]
 emb|CAG80884.2| YALI0D11374p [Yarrowia lipolytica CLIB122]
Length=638

 Score = 78.6 bits (192),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +3

Query  174  SSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALR  353
            S Y VVDH YD VVVGAGGAGLRAA GL+E GFNTACI+KLFPTRSHTVAAQGGINAAL 
Sbjct  43   SKYAVVDHEYDCVVVGAGGAGLRAAFGLAEAGFNTACISKLFPTRSHTVAAQGGINAALG  102

Query  354  NM  359
            NM
Sbjct  103  NM  104



>ref|XP_007596575.1| succinate dehydrogenase [Colletotrichum fioriniae PJ7]
 gb|EXF79789.1| succinate dehydrogenase [Colletotrichum fioriniae PJ7]
Length=729

 Score = 79.0 bits (193),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +3

Query  174  SSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALR  353
            S Y VVDH YDA+VVGAGGAGLRAA GL+E GFNTACI+KLFPTRSHTVAAQGGINAAL 
Sbjct  134  SKYPVVDHEYDAIVVGAGGAGLRAAFGLAEAGFNTACISKLFPTRSHTVAAQGGINAALG  193

Query  354  NM  359
            NM
Sbjct  194  NM  195



>ref|XP_001908590.1| hypothetical protein [Podospora anserina S mat+]
 emb|CAP69263.1| unnamed protein product [Podospora anserina S mat+]
 emb|CDP23282.1| Putative mitochondrial succinate dehydrogenase [ubiquinone] flavoprotein 
subunit precursor [Podospora anserina S mat+]
Length=648

 Score = 78.6 bits (192),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +3

Query  174  SSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALR  353
            S Y V+DH YDA+VVGAGGAGLRAA GL+E GFNTACI+KLFPTRSHTVAAQGGINAAL 
Sbjct  54   SKYPVIDHEYDAIVVGAGGAGLRAAFGLAEAGFNTACISKLFPTRSHTVAAQGGINAALG  113

Query  354  NM  359
            NM
Sbjct  114  NM  115



>ref|XP_007827022.1| succinate dehydrogenase [Pestalotiopsis fici W106-1]
 gb|ETS86422.1| succinate dehydrogenase [Pestalotiopsis fici W106-1]
Length=640

 Score = 78.6 bits (192),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +3

Query  174  SSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALR  353
            S Y V+DH YDA+VVGAGGAGLRAA GL+E GFNTACI+KLFPTRSHTVAAQGGINAAL 
Sbjct  45   SKYPVIDHEYDAIVVGAGGAGLRAAFGLAEAGFNTACISKLFPTRSHTVAAQGGINAALG  104

Query  354  NM  359
            NM
Sbjct  105  NM  106



>ref|XP_007486821.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit, mitochondrial [Monodelphis domestica]
Length=665

 Score = 78.6 bits (192),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = +3

Query  138  RRLFSSQTNVGGSSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHT  317
            +R  +  +N   + Y VVDH +DA+VVGAGGAGLRAA GLSE GFNTACITKLFPTRSHT
Sbjct  42   KRSSAKVSNSISTQYPVVDHEFDALVVGAGGAGLRAAFGLSEAGFNTACITKLFPTRSHT  101

Query  318  VAAQGGINAALRNM  359
            VAAQGGINAAL NM
Sbjct  102  VAAQGGINAALGNM  115



>emb|CEP10579.1| hypothetical protein [Parasitella parasitica]
Length=649

 Score = 78.6 bits (192),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 53/63 (84%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = +3

Query  174  SSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALR  353
            S Y ++DH YDAVVVGAGGAGLRAA GL+E G NTACITKLFPTRSHTVAAQGGINAAL 
Sbjct  54   SKYPIIDHEYDAVVVGAGGAGLRAAFGLAEAGLNTACITKLFPTRSHTVAAQGGINAALG  113

Query  354  NMT  362
            NMT
Sbjct  114  NMT  116



>ref|XP_001439561.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK72164.1| unnamed protein product [Paramecium tetraurelia]
Length=636

 Score = 78.6 bits (192),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 54/61 (89%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = +3

Query  180  YTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNM  359
            YTV+DHTYDAVVVGAGGAGLRAA GL E GF TACI+KLFPTRSHTVAAQGGINAAL NM
Sbjct  42   YTVIDHTYDAVVVGAGGAGLRAAFGLVELGFKTACISKLFPTRSHTVAAQGGINAALGNM  101

Query  360  T  362
            T
Sbjct  102  T  102



>ref|XP_003658647.1| hypothetical protein MYCTH_2294679 [Myceliophthora thermophila 
ATCC 42464]
 gb|AEO53402.1| hypothetical protein MYCTH_2294679 [Myceliophthora thermophila 
ATCC 42464]
Length=648

 Score = 78.6 bits (192),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +3

Query  174  SSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALR  353
            S Y V+DH YDA+VVGAGGAGLRAA GL+E GFNTACI+KLFPTRSHTVAAQGGINAAL 
Sbjct  53   SKYPVIDHEYDAIVVGAGGAGLRAAFGLAEAGFNTACISKLFPTRSHTVAAQGGINAALG  112

Query  354  NM  359
            NM
Sbjct  113  NM  114



>ref|XP_001220862.1| conserved hypothetical protein [Chaetomium globosum CBS 148.51]
 gb|EAQ93406.1| conserved hypothetical protein [Chaetomium globosum CBS 148.51]
Length=644

 Score = 78.6 bits (192),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +3

Query  174  SSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALR  353
            S Y V+DH YDA+VVGAGGAGLRAA GL+E GFNTACI+KLFPTRSHTVAAQGGINAAL 
Sbjct  49   SKYPVIDHEYDALVVGAGGAGLRAAFGLAEAGFNTACISKLFPTRSHTVAAQGGINAALG  108

Query  354  NM  359
            NM
Sbjct  109  NM  110



>ref|XP_010778035.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit, mitochondrial [Notothenia coriiceps]
Length=663

 Score = 78.6 bits (192),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 54/62 (87%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +3

Query  174  SSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALR  353
            + Y VVDH +DAVVVGAGGAGLRAA GLSE GFNTACITKLFPTRSHTVAAQGGINAAL 
Sbjct  52   TQYPVVDHEFDAVVVGAGGAGLRAAFGLSEAGFNTACITKLFPTRSHTVAAQGGINAALG  111

Query  354  NM  359
            NM
Sbjct  112  NM  113



>emb|CCX08923.1| Similar to Probable succinate dehydrogenase [ubiquinone] flavoprotein 
subunit, mitochondrial; acc. no. Q9UTJ7 [Pyronema omphalodes 
CBS 100304]
Length=646

 Score = 78.6 bits (192),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +3

Query  174  SSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALR  353
            S Y V+DH YDA+VVGAGGAGLRAA GL+E GFNTACI+KLFPTRSHTVAAQGGINAAL 
Sbjct  51   SQYPVIDHEYDAIVVGAGGAGLRAAFGLAEAGFNTACISKLFPTRSHTVAAQGGINAALG  110

Query  354  NM  359
            NM
Sbjct  111  NM  112



>ref|XP_007779503.1| succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial 
[Coniosporium apollinis CBS 100218]
 gb|EON64186.1| succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial 
[Coniosporium apollinis CBS 100218]
Length=639

 Score = 78.6 bits (192),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 59/99 (60%), Positives = 68/99 (69%), Gaps = 7/99 (7%)
 Frame = +3

Query  84   SRGLRIPSDRSIAGRSHFRRLFSSQTNVGGSS-------YTVVDHTYDavvvgaggaglr  242
            +R L  P  RS +      R+ +SQ      +       Y V+DH YDA+VVGAGGAGLR
Sbjct  7    ARQLFRPQTRSFSSTKPVARIITSQPLRAKEASPHVSHKYPVIDHEYDAIVVGAGGAGLR  66

Query  243  aaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNM  359
            AA GL+E GFNTACI+KLFPTRSHTVAAQGGINAAL NM
Sbjct  67   AAFGLAEAGFNTACISKLFPTRSHTVAAQGGINAALGNM  105



>gb|EME49868.1| hypothetical protein DOTSEDRAFT_68607 [Dothistroma septosporum 
NZE10]
Length=643

 Score = 78.6 bits (192),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = +3

Query  171  GSSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAAL  350
            G  Y V+DH YDA+VVGAGGAGLRAA GL+E GFNTACI+KLFPTRSHTVAAQGGINAAL
Sbjct  47   GHKYPVIDHEYDALVVGAGGAGLRAAFGLAEAGFNTACISKLFPTRSHTVAAQGGINAAL  106

Query  351  RNM  359
             NM
Sbjct  107  GNM  109



>emb|CEJ95053.1| Putative Succinate dehydrogenase Sdh1 [Torrubiella hemipterigena]
Length=647

 Score = 78.6 bits (192),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +3

Query  174  SSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALR  353
            S Y V+DH YDA+V+GAGGAGLRAA GL+E GFNTACI+KLFPTRSHTVAAQGGINAAL 
Sbjct  52   SKYPVIDHEYDALVIGAGGAGLRAAFGLAEAGFNTACISKLFPTRSHTVAAQGGINAALG  111

Query  354  NM  359
            NM
Sbjct  112  NM  113



>ref|XP_006680864.1| hypothetical protein BATDEDRAFT_90431 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF78497.1| hypothetical protein BATDEDRAFT_90431 [Batrachochytrium dendrobatidis 
JAM81]
Length=639

 Score = 78.6 bits (192),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 71/99 (72%), Gaps = 7/99 (7%)
 Frame = +3

Query  87   RGLRIPSDRSIAGRSHFRRLFSSQT-------NVGGSSYTVVDHTYDavvvgaggaglra  245
            +  RI   RS    +  +R+ ++QT       +   ++Y ++DHTYDA+VVGAGGAGLRA
Sbjct  9    KSARIVQHRSFHASAFTQRISTTQTLRASAAQSTISAAYPIIDHTYDALVVGAGGAGLRA  68

Query  246  aigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNMT  362
            A GL++ G  TACITKLFPTRSHTVAAQGGINAAL NMT
Sbjct  69   AFGLAKEGLKTACITKLFPTRSHTVAAQGGINAALANMT  107



>gb|EPX73916.1| succinate dehydrogenase Sdh1 [Schizosaccharomyces octosporus 
yFS286]
Length=641

 Score = 78.6 bits (192),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +3

Query  177  SYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRN  356
             Y ++DHTYDA+VVGAGGAGLRA  GL+E GF TACITKLFPTRSHTVAAQGGINAAL N
Sbjct  47   KYPIIDHTYDAIVVGAGGAGLRATFGLAEAGFKTACITKLFPTRSHTVAAQGGINAALGN  106

Query  357  MT  362
            MT
Sbjct  107  MT  108



>ref|XP_001422453.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABP00770.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=633

 Score = 78.6 bits (192),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 52/61 (85%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = +3

Query  180  YTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNM  359
            Y ++DH YDA+VVGAGGAGLRAAIGL EHGF TAC+TKLFPTRSHTVAAQGGINAAL NM
Sbjct  43   YEIIDHEYDALVVGAGGAGLRAAIGLGEHGFKTACVTKLFPTRSHTVAAQGGINAALGNM  102

Query  360  T  362
            T
Sbjct  103  T  103



>ref|XP_007764259.1| succinate dehydrogenase [Coniophora puteana RWD-64-598 SS2]
 gb|EIW85004.1| succinate dehydrogenase [Coniophora puteana RWD-64-598 SS2]
Length=643

 Score = 78.6 bits (192),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 66/87 (76%), Gaps = 3/87 (3%)
 Frame = +3

Query  102  PSDRSIAGRSHFRRLFSSQTNVGGSSYTVVDHTYDavvvgaggaglraaigLSEHGFNTA  281
            P+ R +A      +  SS +N     Y +++H YDA+V+GAGGAGLRAA GL+E GFNTA
Sbjct  26   PARRVVATNPVKAQEVSSWSN---GKYPLIEHEYDAIVIGAGGAGLRAAFGLAEAGFNTA  82

Query  282  CITKLFPTRSHTVAAQGGINAALRNMT  362
            CITKLFPTRSHTVAAQGGINAAL NMT
Sbjct  83   CITKLFPTRSHTVAAQGGINAALGNMT  109



>emb|CCF47738.1| succinate dehydrogenase flavoprotein subunit [Colletotrichum 
higginsianum]
Length=640

 Score = 78.6 bits (192),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +3

Query  174  SSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALR  353
            S Y V+DH YDA+VVGAGGAGLRAA GL+E GFNTACI+KLFPTRSHTVAAQGGINAAL 
Sbjct  45   SKYPVIDHEYDAIVVGAGGAGLRAAFGLAEAGFNTACISKLFPTRSHTVAAQGGINAALG  104

Query  354  NM  359
            NM
Sbjct  105  NM  106



>gb|AAI05358.1| SDHA protein [Bos taurus]
Length=678

 Score = 78.6 bits (192),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 74/114 (65%), Gaps = 9/114 (8%)
 Frame = +3

Query  45   PNNQNLQEMWRCVSRGL---RIPSDRSIAGRS-HF-----RRLFSSQTNVGGSSYTVVDH  197
            P    +  +WR     L   + P+      RS HF     +R  +  ++   + Y VVDH
Sbjct  15   PGVAAVSRLWRARRLALTCTKWPAAWQTGTRSFHFTVDGNKRSSAKVSDAISAQYPVVDH  74

Query  198  TYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNM  359
             +DAVVVGAGGAGLRAA GLSE GFNTAC+TKLFPTRSHTVAAQGGINAAL NM
Sbjct  75   EFDAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNM  128



>gb|KDN66981.1| putative succinate dehydrogenase [Colletotrichum sublineola]
Length=643

 Score = 78.6 bits (192),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +3

Query  174  SSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALR  353
            S Y V+DH YDA+VVGAGGAGLRAA GL+E GFNTACI+KLFPTRSHTVAAQGGINAAL 
Sbjct  48   SKYPVIDHEYDAIVVGAGGAGLRAAFGLAEAGFNTACISKLFPTRSHTVAAQGGINAALG  107

Query  354  NM  359
            NM
Sbjct  108  NM  109



>ref|NP_001083473.1| succinate dehydrogenase [ubiquinone] flavoprotein subunit A, 
mitochondrial precursor [Xenopus laevis]
 sp|Q6PA58.1|SDHAA_XENLA RecName: Full=Succinate dehydrogenase [ubiquinone] flavoprotein 
subunit A, mitochondrial; AltName: Full=Flavoprotein subunit 
of complex II A; Short=Fp; Flags: Precursor [Xenopus laevis]
 gb|AAH60446.1| MGC68518 protein [Xenopus laevis]
Length=665

 Score = 78.6 bits (192),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 54/62 (87%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +3

Query  174  SSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALR  353
            + Y VVDH +DAVVVGAGGAGLRAA GLSE GFNTACITKLFPTRSHTVAAQGGINAAL 
Sbjct  56   TQYPVVDHEFDAVVVGAGGAGLRAAFGLSEAGFNTACITKLFPTRSHTVAAQGGINAALG  115

Query  354  NM  359
            NM
Sbjct  116  NM  117



>gb|EMP36598.1| Succinate dehydrogenase [ubiquinone] flavoprotein subunit [Chelonia 
mydas]
Length=1450

 Score = 79.0 bits (193),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 53/62 (85%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +3

Query  174  SSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALR  353
            + Y VVDH +DAVVVGAGGAGLRAA GLSE GFNTAC+TKLFPTRSHTVAAQGGINAAL 
Sbjct  36   TQYPVVDHEFDAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALG  95

Query  354  NM  359
            NM
Sbjct  96   NM  97



>gb|KFU88788.1| hypothetical protein M959_14246, partial [Chaetura pelagica]
Length=643

 Score = 78.2 bits (191),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 60/96 (63%), Positives = 68/96 (71%), Gaps = 3/96 (3%)
 Frame = +3

Query  72   WRCVSRGLRIPSDRSIAGRSHFRRLFSSQTNVGGSSYTVVDHTYDavvvgaggaglraai  251
            W   SR L      ++ G+ +     SS  +   + Y VVDH +DAVVVGAGGAGLRAA 
Sbjct  1    WPVASRALARNLHFTVYGKKNASTKVSSSIS---TQYPVVDHEFDAVVVGAGGAGLRAAF  57

Query  252  gLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNM  359
            GLSE GFNTAC+TKLFPTRSHTVAAQGGINAAL NM
Sbjct  58   GLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNM  93



>ref|XP_006000045.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit, mitochondrial-like isoform X2 [Latimeria chalumnae]
Length=626

 Score = 78.2 bits (191),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 73/110 (66%), Gaps = 17/110 (15%)
 Frame = +3

Query  81   VSRGLRIPSDRSIAGRS------------HF-----RRLFSSQTNVGGSSYTVVDHTYDa  209
            +SR  R+ + R +A R+            HF     +   S  T+   + Y VVDH +DA
Sbjct  4    LSRASRVVAKRLLADRTLPAVSQAVSRDFHFTIYGKKEKTSKVTDSLSTQYPVVDHEFDA  63

Query  210  vvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRNM  359
            VVVGAGGAGLRAA GLSE GFNTAC+TKLFPTRSHTVAAQGGINAAL NM
Sbjct  64   VVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNM  113



>gb|EFQ26492.1| succinate dehydrogenase [Colletotrichum graminicola M1.001]
Length=643

 Score = 78.2 bits (191),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +3

Query  174  SSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALR  353
            S Y V+DH YDA+VVGAGGAGLRAA GL+E GFNTACI+KLFPTRSHTVAAQGGINAAL 
Sbjct  48   SKYPVIDHEYDAIVVGAGGAGLRAAFGLAEAGFNTACISKLFPTRSHTVAAQGGINAALG  107

Query  354  NM  359
            NM
Sbjct  108  NM  109



>gb|ELR57152.1| Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial, 
partial [Bos mutus]
Length=643

 Score = 78.2 bits (191),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 54/62 (87%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +3

Query  174  SSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALR  353
            + Y VVDH +DAVVVGAGGAGLRAA GLSE GFNTACITKLFPTRSHTVAAQGGINAAL 
Sbjct  32   AQYPVVDHEFDAVVVGAGGAGLRAAFGLSEAGFNTACITKLFPTRSHTVAAQGGINAALG  91

Query  354  NM  359
            NM
Sbjct  92   NM  93



>ref|XP_005841533.1| hypothetical protein GUITHDRAFT_159138 [Guillardia theta CCMP2712]
 gb|EKX54553.1| hypothetical protein GUITHDRAFT_159138 [Guillardia theta CCMP2712]
Length=608

 Score = 78.2 bits (191),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +3

Query  177  SYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALRN  356
             Y +VDHTYDAVVVGAGGAGLRAA+G +E+GFN ACITKLFPTRSHTVAAQGGINAAL N
Sbjct  15   QYHIVDHTYDAVVVGAGGAGLRAAVGFAENGFNVACITKLFPTRSHTVAAQGGINAALGN  74

Query  357  MT  362
            MT
Sbjct  75   MT  76



>ref|XP_010740614.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit, mitochondrial [Larimichthys crocea]
Length=663

 Score = 78.2 bits (191),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 54/62 (87%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +3

Query  174  SSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALR  353
            + Y VVDH +DAVVVGAGGAGLRAA GLSE GFNTACITKLFPTRSHTVAAQGGINAAL 
Sbjct  52   TQYPVVDHEFDAVVVGAGGAGLRAAFGLSEAGFNTACITKLFPTRSHTVAAQGGINAALG  111

Query  354  NM  359
            NM
Sbjct  112  NM  113



>ref|XP_004178307.1| hypothetical protein TBLA_0A10080 [Tetrapisispora blattae CBS 
6284]
 emb|CCH58788.1| hypothetical protein TBLA_0A10080 [Tetrapisispora blattae CBS 
6284]
Length=629

 Score = 78.2 bits (191),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = +3

Query  135  FRRLFSSQTNVGGSSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSH  314
            ++R  ++ T   G  Y +VDH YD VVVGAGGAGLRAA GL+E GF TACI+KLFPTRSH
Sbjct  19   YKRTMATATENVGDKYNIVDHEYDCVVVGAGGAGLRAAFGLAEAGFKTACISKLFPTRSH  78

Query  315  TVAAQGGINAALRN  356
            TVAAQGGINAAL N
Sbjct  79   TVAAQGGINAALGN  92



>ref|XP_002723240.2| PREDICTED: LOW QUALITY PROTEIN: succinate dehydrogenase [ubiquinone] 
flavoprotein subunit, mitochondrial [Oryctolagus cuniculus]
Length=697

 Score = 78.2 bits (191),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 54/62 (87%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +3

Query  174  SSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALR  353
            + Y VVDH +DAVVVGAGGAGLRAA GLSE GFNTACITKLFPTRSHTVAAQGGINAAL 
Sbjct  86   AQYPVVDHEFDAVVVGAGGAGLRAAFGLSEAGFNTACITKLFPTRSHTVAAQGGINAALG  145

Query  354  NM  359
            NM
Sbjct  146  NM  147



>ref|XP_007896310.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit, mitochondrial [Callorhinchus milii]
Length=658

 Score = 78.2 bits (191),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 54/62 (87%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +3

Query  174  SSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALR  353
            + Y VVDH +DAVVVGAGGAGLRAA GLSE GFNTACITKLFPTRSHTVAAQGGINAAL 
Sbjct  48   TQYPVVDHEFDAVVVGAGGAGLRAAFGLSEAGFNTACITKLFPTRSHTVAAQGGINAALG  107

Query  354  NM  359
            NM
Sbjct  108  NM  109



>ref|XP_005894721.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit, mitochondrial [Bos mutus]
Length=668

 Score = 78.2 bits (191),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 54/62 (87%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +3

Query  174  SSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALR  353
            + Y VVDH +DAVVVGAGGAGLRAA GLSE GFNTACITKLFPTRSHTVAAQGGINAAL 
Sbjct  57   AQYPVVDHEFDAVVVGAGGAGLRAAFGLSEAGFNTACITKLFPTRSHTVAAQGGINAALG  116

Query  354  NM  359
            NM
Sbjct  117  NM  118



>ref|XP_003958904.1| hypothetical protein KAFR_0H03590 [Kazachstania africana CBS 
2517]
 emb|CCF59769.1| hypothetical protein KAFR_0H03590 [Kazachstania africana CBS 
2517]
Length=631

 Score = 78.2 bits (191),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 62/83 (75%), Gaps = 0/83 (0%)
 Frame = +3

Query  111  RSIAGRSHFRRLFSSQTNVGGSSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACIT  290
            RS    S   R +S+  N   + Y ++DH YD VVVGAGGAGLRAA GL+E GF TAC++
Sbjct  14   RSFRSTSRQWRQYSTDHNSLAAKYPIIDHEYDCVVVGAGGAGLRAAFGLAEAGFKTACVS  73

Query  291  KLFPTRSHTVAAQGGINAALRNM  359
            KLFPTRSHTVAAQGGINAAL NM
Sbjct  74   KLFPTRSHTVAAQGGINAALGNM  96



>gb|KFV53858.1| hypothetical protein N328_10936, partial [Gavia stellata]
Length=400

 Score = 77.0 bits (188),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +3

Query  174  SSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALR  353
            + Y VVDH +DAVVVGAGGAGLRAA GLSE GFNTAC+TKLFPTRSHTVAAQGGINAAL 
Sbjct  32   TQYPVVDHEFDAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALG  91

Query  354  NM  359
            NM
Sbjct  92   NM  93



>ref|XP_002496111.1| ZYRO0C10736p [Zygosaccharomyces rouxii]
 emb|CAR27178.1| ZYRO0C10736p [Zygosaccharomyces rouxii]
Length=644

 Score = 78.2 bits (191),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 62/82 (76%), Gaps = 9/82 (11%)
 Frame = +3

Query  141  RLFSSQTNVGGSS---------YTVVDHTYDavvvgaggaglraaigLSEHGFNTACITK  293
            R+  +Q +VGG S         Y +VDH YD +VVGAGGAGLRAA GL+E G+ TACI+K
Sbjct  28   RVLQTQGDVGGESAPGSLGNGKYHIVDHEYDCLVVGAGGAGLRAAFGLAEAGYKTACISK  87

Query  294  LFPTRSHTVAAQGGINAALRNM  359
            LFPTRSHTVAAQGGINAAL NM
Sbjct  88   LFPTRSHTVAAQGGINAALGNM  109



>ref|XP_004625229.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit, mitochondrial [Octodon degus]
Length=662

 Score = 78.2 bits (191),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 54/62 (87%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +3

Query  174  SSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALR  353
            + Y VVDH +DAVVVGAGGAGLRAA GLSE GFNTACITKLFPTRSHTVAAQGGINAAL 
Sbjct  51   TQYPVVDHEFDAVVVGAGGAGLRAAFGLSEAGFNTACITKLFPTRSHTVAAQGGINAALG  110

Query  354  NM  359
            NM
Sbjct  111  NM  112



>ref|XP_008023526.1| hypothetical protein SETTUDRAFT_128655 [Setosphaeria turcica 
Et28A]
 gb|EOA88875.1| hypothetical protein SETTUDRAFT_128655 [Setosphaeria turcica 
Et28A]
Length=647

 Score = 78.2 bits (191),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +3

Query  174  SSYTVVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALR  353
            S Y ++DH YDA+VVGAGGAGLRAA GL+E GFNTACI+KLFPTRSHTVAAQGGINAAL 
Sbjct  52   SKYPIIDHEYDAIVVGAGGAGLRAAFGLAEAGFNTACISKLFPTRSHTVAAQGGINAALG  111

Query  354  NM  359
            NM
Sbjct  112  NM  113



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 561481202700