BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002C18

Length=476
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006439765.1|  hypothetical protein CICLE_v10022245mg             327   2e-111   Citrus clementina [clementine]
ref|XP_010111536.1|  Rac-like GTP-binding protein 3                     326   4e-111   
gb|KDO69733.1|  hypothetical protein CISIN_1g028362mg                   326   6e-111   Citrus sinensis [apfelsine]
ref|XP_006476738.1|  PREDICTED: rac-like GTP-binding protein 3-like     325   9e-111   Citrus sinensis [apfelsine]
emb|CAN60154.1|  hypothetical protein VITISV_021505                     325   1e-110   Vitis vinifera
ref|XP_011087157.1|  PREDICTED: rac-like GTP-binding protein ARAC8      325   2e-110   Sesamum indicum [beniseed]
ref|XP_002283394.1|  PREDICTED: rac-like GTP-binding protein 3          325   2e-110   Vitis vinifera
ref|XP_010254450.1|  PREDICTED: rac-like GTP-binding protein 3 is...    325   2e-110   
ref|XP_010037588.1|  PREDICTED: rac-like GTP-binding protein 3          324   3e-110   Eucalyptus grandis [rose gum]
ref|XP_010550661.1|  PREDICTED: rac-like GTP-binding protein ARAC10     325   3e-110   Tarenaya hassleriana [spider flower]
ref|XP_009601098.1|  PREDICTED: rac-like GTP-binding protein 3 is...    324   4e-110   
ref|XP_010318920.1|  PREDICTED: rac-like GTP-binding protein 3 is...    323   4e-110   Solanum lycopersicum
ref|XP_011015598.1|  PREDICTED: rac-like GTP-binding protein 3          324   4e-110   Populus euphratica
ref|XP_007036140.1|  Rac-like GTP-binding protein 3 isoform 2           324   5e-110   Theobroma cacao [chocolate]
emb|CDP16997.1|  unnamed protein product                                324   5e-110   Coffea canephora [robusta coffee]
ref|XP_010254444.1|  PREDICTED: rac-like GTP-binding protein 3 is...    323   8e-110   Nelumbo nucifera [Indian lotus]
ref|XP_009786167.1|  PREDICTED: rac-like GTP-binding protein 3 is...    323   8e-110   Nicotiana sylvestris
ref|XP_011044337.1|  PREDICTED: rac-like GTP-binding protein ARAC8      323   8e-110   Populus euphratica
ref|XP_011028604.1|  PREDICTED: rac-like GTP-binding protein ARAC8      323   1e-109   Populus euphratica
ref|XP_004299574.1|  PREDICTED: rac-like GTP-binding protein 3          323   1e-109   Fragaria vesca subsp. vesca
ref|XP_007211210.1|  hypothetical protein PRUPE_ppa011421mg             322   2e-109   Prunus persica
gb|KJB53191.1|  hypothetical protein B456_008G297200                    322   2e-109   Gossypium raimondii
gb|AEQ62558.1|  Rac/Rop GTPase 1                                        322   2e-109   Aquilaria microcarpa
gb|KJB53188.1|  hypothetical protein B456_008G297200                    323   2e-109   Gossypium raimondii
gb|KJB53187.1|  hypothetical protein B456_008G297200                    322   2e-109   Gossypium raimondii
ref|XP_008393056.1|  PREDICTED: rac-like GTP-binding protein ARAC8      322   2e-109   Malus domestica [apple tree]
ref|XP_006345032.1|  PREDICTED: rac-like GTP-binding protein 3-li...    322   3e-109   Solanum tuberosum [potatoes]
ref|XP_008780935.1|  PREDICTED: rac-like GTP-binding protein 3          322   3e-109   Phoenix dactylifera
ref|XP_010272004.1|  PREDICTED: rac-like GTP-binding protein 3          322   4e-109   Nelumbo nucifera [Indian lotus]
gb|AEN71013.1|  small GTPase RacA                                       321   6e-109   Gossypium schwendimanii
gb|KDP31135.1|  hypothetical protein JCGZ_11511                         321   6e-109   Jatropha curcas
gb|AEN71011.1|  small GTPase RacA                                       321   6e-109   Gossypium thurberi
emb|CAD57742.1|  RAC-ROP-like G-protein                                 321   7e-109   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011071815.1|  PREDICTED: rac-like GTP-binding protein 3 is...    321   8e-109   Sesamum indicum [beniseed]
gb|ADY68836.1|  small GTPase                                            321   8e-109   Gossypium hirsutum [American cotton]
ref|XP_002322155.2|  hypothetical protein POPTR_0015s08420g             322   9e-109   
gb|ABG66964.1|  small GTPase                                            320   9e-109   Gossypium hirsutum [American cotton]
ref|XP_008793880.1|  PREDICTED: rac-like GTP-binding protein RAC1       321   9e-109   
ref|XP_002511439.1|  rac gtpase, putative                               320   1e-108   Ricinus communis
ref|XP_006647874.1|  PREDICTED: rac-like GTP-binding protein 3-like     320   1e-108   Oryza brachyantha
ref|XP_008793848.1|  PREDICTED: LOW QUALITY PROTEIN: rac-like GTP...    321   2e-108   
gb|ADY68835.1|  small GTPase                                            320   2e-108   Gossypium raimondii
gb|EYU29925.1|  hypothetical protein MIMGU_mgv1a013827mg                320   2e-108   Erythranthe guttata [common monkey flower]
ref|XP_009407248.1|  PREDICTED: rac-like GTP-binding protein 3          320   2e-108   Musa acuminata subsp. malaccensis [pisang utan]
gb|ADY68833.1|  small GTPase                                            320   2e-108   Gossypium barbadense [Egyptian cotton]
ref|XP_003570667.1|  PREDICTED: rac-like GTP-binding protein 3          320   2e-108   Brachypodium distachyon [annual false brome]
ref|XP_002452568.1|  hypothetical protein SORBIDRAFT_04g028280          320   2e-108   Sorghum bicolor [broomcorn]
ref|XP_010913538.1|  PREDICTED: rac-like GTP-binding protein 3 is...    319   3e-108   Elaeis guineensis
gb|AAX77218.1|  Rac2                                                    319   3e-108   Gossypium hirsutum [American cotton]
ref|NP_001104929.1|  Rho-related protein from plants 1                  319   5e-108   Zea mays [maize]
ref|XP_004501950.1|  PREDICTED: rac-like GTP-binding protein ARAC...    318   5e-108   Cicer arietinum [garbanzo]
ref|XP_010913537.1|  PREDICTED: rac-like GTP-binding protein 3 is...    318   6e-108   Elaeis guineensis
ref|NP_001048088.1|  Os02g0742200                                       318   8e-108   
gb|AFK47680.1|  unknown                                                 318   8e-108   Lotus japonicus
gb|ACC85689.1|  ROP small G protein                                     318   1e-107   Medicago truncatula
ref|XP_008453112.1|  PREDICTED: rac-like GTP-binding protein ARAC8      317   2e-107   
gb|ADY68837.1|  small GTPase                                            317   2e-107   Gossypium hirsutum [American cotton]
ref|XP_010928578.1|  PREDICTED: rac-like GTP-binding protein 3 is...    317   2e-107   
ref|XP_006836715.1|  hypothetical protein AMTR_s00088p00117460          317   3e-107   
ref|XP_007138106.1|  hypothetical protein PHAVU_009G180800g             317   3e-107   Phaseolus vulgaris [French bean]
ref|XP_010254428.1|  PREDICTED: rac-like GTP-binding protein 3 is...    317   4e-107   Nelumbo nucifera [Indian lotus]
gb|EAY87489.1|  hypothetical protein OsI_08896                          317   4e-107   Oryza sativa Indica Group [Indian rice]
ref|XP_006577771.1|  PREDICTED: uncharacterized protein LOC100499...    316   4e-107   
ref|XP_004138120.1|  PREDICTED: rac-like GTP-binding protein 3-like     316   5e-107   Cucumis sativus [cucumbers]
ref|NP_001105063.1|  GTPase protein                                     316   5e-107   Zea mays [maize]
ref|XP_010459411.1|  PREDICTED: rac-like GTP-binding protein ARAC10     316   6e-107   Camelina sativa [gold-of-pleasure]
ref|XP_004953886.1|  PREDICTED: rac-like GTP-binding protein 3-like     316   6e-107   Setaria italica
ref|NP_201093.1|  Rac-like GTP-binding protein ARAC10                   316   6e-107   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006394342.1|  hypothetical protein EUTSA_v10004903mg             316   6e-107   Eutrema salsugineum [saltwater cress]
ref|XP_006281091.1|  hypothetical protein CARUB_v10027121mg             316   7e-107   Capsella rubella
gb|KHN48613.1|  Rac-like GTP-binding protein 3                          316   8e-107   Glycine soja [wild soybean]
ref|XP_009112040.1|  PREDICTED: rac-like GTP-binding protein ARAC...    316   8e-107   
ref|XP_009151409.1|  PREDICTED: rac-like GTP-binding protein ARAC10     316   8e-107   Brassica rapa
ref|XP_009130238.1|  PREDICTED: rac-like GTP-binding protein ARAC...    316   8e-107   Brassica rapa
gb|ADW83711.1|  Rho-like protein 1                                      316   8e-107   Zea mays [maize]
ref|XP_009130239.1|  PREDICTED: rac-like GTP-binding protein ARAC...    316   9e-107   Brassica rapa
ref|XP_009391245.1|  PREDICTED: rac-like GTP-binding protein 3          315   1e-106   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY56740.1|  BnaC09g50900D                                          315   1e-106   Brassica napus [oilseed rape]
ref|XP_010678714.1|  PREDICTED: rac-like GTP-binding protein 3          315   1e-106   Beta vulgaris subsp. vulgaris [field beet]
gb|KCW83424.1|  hypothetical protein EUGRSUZ_B00349                     315   1e-106   Eucalyptus grandis [rose gum]
emb|CDY45748.1|  BnaC02g42340D                                          315   1e-106   Brassica napus [oilseed rape]
ref|XP_009112039.1|  PREDICTED: rac-like GTP-binding protein ARAC...    316   1e-106   Brassica rapa
ref|XP_010503427.1|  PREDICTED: rac-like GTP-binding protein ARAC...    315   1e-106   Camelina sativa [gold-of-pleasure]
gb|ADW83710.1|  Rho-like protein 1                                      315   1e-106   Zea mays [maize]
gb|KHN19324.1|  Rac-like GTP-binding protein ARAC8                      315   2e-106   Glycine soja [wild soybean]
dbj|BAD42977.1|  Arac10                                                 315   2e-106   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010028070.1|  PREDICTED: rac-like GTP-binding protein ARAC8      314   3e-106   Eucalyptus grandis [rose gum]
emb|CDY00332.1|  BnaA06g22330D                                          314   3e-106   
gb|ACM68952.1|  ROP3                                                    313   5e-106   Eriobotrya japonica [loquat]
ref|XP_010515117.1|  PREDICTED: rac-like GTP-binding protein ARAC...    313   5e-106   Camelina sativa [gold-of-pleasure]
ref|XP_009379967.1|  PREDICTED: rac-like GTP-binding protein 3 is...    313   6e-106   Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK28015.1|  hypothetical protein AALP_AA8G460400                    313   8e-106   Arabis alpina [alpine rockcress]
ref|XP_002875876.1|  hypothetical protein ARALYDRAFT_485165             313   9e-106   
gb|EPS61580.1|  hypothetical protein M569_13212                         312   9e-106   Genlisea aurea
ref|XP_009379959.1|  PREDICTED: rac-like GTP-binding protein 3 is...    313   1e-105   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAB41135.1|  rac GTP binding protein Arac8                          312   2e-105   Arabidopsis thaliana [mouse-ear cress]
ref|NP_566897.1|  Rac-like GTP-binding protein ARAC8                    312   2e-105   Arabidopsis thaliana [mouse-ear cress]
gb|AAF43923.1|AF239751_1  Rac-like protein Rop1                         312   2e-105   Tradescantia virginiana
ref|NP_001235733.1|  uncharacterized protein LOC100527158               311   4e-105   
ref|NP_001241937.1|  uncharacterized protein LOC100791566               311   4e-105   
gb|KHN18479.1|  Rac-like GTP-binding protein 3                          312   5e-105   Glycine soja [wild soybean]
ref|XP_006655950.1|  PREDICTED: rac-like GTP-binding protein 4-like     311   8e-105   
ref|XP_006600181.1|  PREDICTED: uncharacterized protein LOC100791...    313   1e-104   
gb|KDO69734.1|  hypothetical protein CISIN_1g028362mg                   308   1e-104   Citrus sinensis [apfelsine]
ref|NP_001057236.1|  Os06g0234200                                       310   1e-104   
ref|XP_006600182.1|  PREDICTED: uncharacterized protein LOC100791...    311   1e-104   Glycine max [soybeans]
ref|NP_001167695.1|  rac-like GTP-binding protein 4                     310   1e-104   
ref|XP_010928577.1|  PREDICTED: rac-like GTP-binding protein 3 is...    310   2e-104   
ref|XP_006291853.1|  hypothetical protein CARUB_v10018028mg             309   2e-104   Capsella rubella
ref|XP_002436763.1|  hypothetical protein SORBIDRAFT_10g008380          310   2e-104   Sorghum bicolor [broomcorn]
ref|NP_001105737.1|  Rho-related protein from plants 5                  309   4e-104   Zea mays [maize]
ref|XP_010503426.1|  PREDICTED: rac-like GTP-binding protein ARAC...    309   4e-104   Camelina sativa [gold-of-pleasure]
gb|KJB53189.1|  hypothetical protein B456_008G297200                    306   7e-104   Gossypium raimondii
ref|XP_004965072.1|  PREDICTED: rac-like GTP-binding protein 4-like     307   2e-103   Setaria italica
ref|XP_009601105.1|  PREDICTED: rac-like GTP-binding protein 3 is...    307   2e-103   
ref|XP_008659034.1|  PREDICTED: rho-related protein from plants 5...    310   2e-103   
ref|XP_009786169.1|  PREDICTED: rac-like GTP-binding protein 3 is...    306   3e-103   Nicotiana sylvestris
ref|XP_010515115.1|  PREDICTED: rac-like GTP-binding protein ARAC...    307   3e-103   Camelina sativa [gold-of-pleasure]
emb|CAD27896.1|  putative ROP4 protein                                  306   6e-103   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ90768.1|  predicted protein                                      305   9e-103   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011071817.1|  PREDICTED: rac-like GTP-binding protein ARAC...    304   1e-102   Sesamum indicum [beniseed]
ref|XP_011071816.1|  PREDICTED: rac-like GTP-binding protein ARAC...    305   1e-102   
ref|XP_007155397.1|  hypothetical protein PHAVU_003G197900g             304   3e-102   Phaseolus vulgaris [French bean]
gb|AFW73359.1|  hypothetical protein ZEAMMB73_875041                    311   7e-102   
gb|AFW85216.1|  hypothetical protein ZEAMMB73_830829                    301   9e-102   
gb|KHN16311.1|  Rac-like GTP-binding protein ARAC8                      302   1e-101   Glycine soja [wild soybean]
gb|ADD23345.1|  putative small GTP-binding protein                      302   2e-101   Triticum aestivum [Canadian hard winter wheat]
gb|KJB53186.1|  hypothetical protein B456_008G297200                    301   3e-101   Gossypium raimondii
ref|XP_006281090.1|  hypothetical protein CARUB_v10027121mg             300   3e-101   
gb|KJB53185.1|  hypothetical protein B456_008G297200                    300   6e-101   Gossypium raimondii
ref|XP_008677774.1|  PREDICTED: GTPase protein isoform X1               298   1e-100   Zea mays [maize]
ref|XP_007036139.1|  RHO-related protein from plants 10 isoform 1       300   3e-100   
sp|O04369.1|RAC1_LOTJA  RecName: Full=Rac-like GTP-binding protei...    296   3e-99    Lotus japonicus
gb|AFK47488.1|  unknown                                                 296   3e-99    Lotus japonicus
ref|XP_008778044.1|  PREDICTED: rac-like GTP-binding protein RAC2...    295   4e-99    
gb|ABK22108.1|  unknown                                                 295   5e-99    Picea sitchensis
ref|XP_004147042.1|  PREDICTED: rac-like GTP-binding protein RAC1...    295   5e-99    Cucumis sativus [cucumbers]
ref|XP_006600183.1|  PREDICTED: uncharacterized protein LOC100791...    296   6e-99    Glycine max [soybeans]
ref|XP_006422604.1|  hypothetical protein CICLE_v10029311mg             293   4e-98    Citrus clementina [clementine]
ref|XP_007136004.1|  hypothetical protein PHAVU_009G009800g             293   5e-98    Phaseolus vulgaris [French bean]
ref|XP_006404303.1|  hypothetical protein EUTSA_v10010729mg             293   7e-98    
ref|XP_002982092.1|  Rop2, RHO family GTPase                            292   7e-98    Selaginella moellendorffii
gb|AGL44365.1|  Rop2                                                    292   7e-98    Hevea brasiliensis [jebe]
ref|XP_010904883.1|  PREDICTED: rac-like GTP-binding protein RAC13      291   1e-97    Elaeis guineensis
ref|XP_003540385.1|  PREDICTED: rac-like GTP-binding protein RAC2...    291   2e-97    
gb|KCW55525.1|  hypothetical protein EUGRSUZ_I01414                     293   2e-97    Eucalyptus grandis [rose gum]
ref|XP_009406225.1|  PREDICTED: rac-like GTP-binding protein 2 is...    292   2e-97    
ref|XP_003540880.1|  PREDICTED: rac-like GTP-binding protein RAC1...    291   2e-97    Glycine max [soybeans]
ref|XP_002530817.1|  rac gtpase, putative                               291   2e-97    Ricinus communis
gb|KHN39876.1|  Rac-like GTP-binding protein RAC1                       291   2e-97    Glycine soja [wild soybean]
ref|XP_007136003.1|  hypothetical protein PHAVU_009G009700g             291   2e-97    Phaseolus vulgaris [French bean]
ref|XP_009406224.1|  PREDICTED: rac-like GTP-binding protein ARAC...    291   3e-97    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002510565.1|  rac gtpase, putative                               291   4e-97    Ricinus communis
ref|XP_009416501.1|  PREDICTED: rac-like GTP-binding protein 2          291   4e-97    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010028726.1|  PREDICTED: rac-like GTP-binding protein 5          290   4e-97    Eucalyptus grandis [rose gum]
gb|AAF43429.1|AF233446_1  rac 1 protein                                 290   4e-97    Physcomitrella patens
ref|XP_010941321.1|  PREDICTED: rac-like GTP-binding protein 5          290   5e-97    Elaeis guineensis
ref|XP_010920122.1|  PREDICTED: rac-like GTP-binding protein 5          290   5e-97    Elaeis guineensis
ref|NP_001045712.1|  Os02g0120800                                       290   5e-97    
gb|ACU23184.1|  unknown                                                 291   5e-97    Glycine max [soybeans]
sp|Q6EP31.2|RAC5_ORYSJ  RecName: Full=Rac-like GTP-binding protei...    290   6e-97    Oryza sativa Japonica Group [Japonica rice]
gb|KJB47671.1|  hypothetical protein B456_008G036100                    290   6e-97    Gossypium raimondii
ref|XP_010035828.1|  PREDICTED: rac-like GTP-binding protein RAC2       290   6e-97    Eucalyptus grandis [rose gum]
ref|XP_009631777.1|  PREDICTED: rac-like GTP-binding protein 5          290   6e-97    Nicotiana tomentosiformis
sp|Q40220.1|RAC2_LOTJA  RecName: Full=Rac-like GTP-binding protei...    290   6e-97    Lotus japonicus
ref|XP_002301960.1|  RAC-like GTP binding protein ARAC4                 290   6e-97    Populus trichocarpa [western balsam poplar]
gb|AAD47828.2|  RAC-like G-protein Rac1                                 290   6e-97    Gossypium hirsutum [American cotton]
ref|XP_002306944.1|  small GTPase Rac4 family protein                   290   6e-97    Populus trichocarpa [western balsam poplar]
ref|XP_009418310.1|  PREDICTED: rac-like GTP-binding protein 5          290   6e-97    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008813511.1|  PREDICTED: rac-like GTP-binding protein 5          290   6e-97    Phoenix dactylifera
ref|XP_008806608.1|  PREDICTED: rac-like GTP-binding protein 5          290   7e-97    
ref|XP_004231040.1|  PREDICTED: rac-like GTP-binding protein 5          290   7e-97    Solanum lycopersicum
gb|ABE11611.1|  Rac-like GTP-binding protein                            290   7e-97    Solanum chacoense
gb|KDP31764.1|  hypothetical protein JCGZ_12225                         290   7e-97    Jatropha curcas
gb|ABK21895.1|  unknown                                                 290   7e-97    Picea sitchensis
ref|XP_010515533.1|  PREDICTED: rac-like GTP-binding protein ARAC11     290   7e-97    
ref|XP_008811402.1|  PREDICTED: rac-like GTP-binding protein 5          290   7e-97    
ref|NP_001105615.1|  Rho-related protein from plants2                   290   7e-97    Zea mays [maize]
ref|XP_006852540.1|  hypothetical protein AMTR_s00021p00186910          290   7e-97    Amborella trichopoda
ref|XP_007149793.1|  hypothetical protein PHAVU_005G099100g             290   8e-97    Phaseolus vulgaris [French bean]
ref|XP_011088603.1|  PREDICTED: rac-like GTP-binding protein 5 is...    290   8e-97    Sesamum indicum [beniseed]
ref|XP_010104154.1|  Rac-like GTP-binding protein ARAC7                 290   8e-97    
ref|XP_010690370.1|  PREDICTED: rac-like GTP-binding protein 5          290   9e-97    Beta vulgaris subsp. vulgaris [field beet]
gb|KDP29655.1|  hypothetical protein JCGZ_18817                         290   9e-97    Jatropha curcas
ref|NP_001242570.1|  uncharacterized protein LOC100805035               290   9e-97    
ref|XP_011083464.1|  PREDICTED: rac-like GTP-binding protein RAC1       290   9e-97    Sesamum indicum [beniseed]
ref|XP_001761909.1|  rop-family small GTPase                            290   9e-97    
ref|NP_190698.1|  Rac-like GTP-binding protein ARAC11                   290   9e-97    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010935113.1|  PREDICTED: rac-like GTP-binding protein 5          290   9e-97    Elaeis guineensis
ref|XP_004303136.1|  PREDICTED: rac-like GTP-binding protein RAC2       290   9e-97    Fragaria vesca subsp. vesca
gb|ACF83636.1|  unknown                                                 290   1e-96    Zea mays [maize]
ref|XP_004289869.1|  PREDICTED: rac-like GTP-binding protein 5          290   1e-96    Fragaria vesca subsp. vesca
ref|XP_010316434.1|  PREDICTED: rac-like GTP-binding protein RHO1       290   1e-96    
ref|XP_010477239.1|  PREDICTED: rac-like GTP-binding protein ARAC5      289   1e-96    Camelina sativa [gold-of-pleasure]
ref|NP_001232850.1|  rac-like GTP-binding protein 6                     290   1e-96    
ref|XP_006379285.1|  small GTPase Rac4 family protein                   290   1e-96    Populus trichocarpa [western balsam poplar]
ref|XP_001773666.1|  rop-family small GTPase                            289   1e-96    
gb|AFW78696.1|  hypothetical protein ZEAMMB73_559671                    290   1e-96    
ref|XP_002278788.1|  PREDICTED: rac-like GTP-binding protein RAC2       289   1e-96    Vitis vinifera
ref|XP_004151903.1|  PREDICTED: rac-like GTP-binding protein 7-like     289   1e-96    Cucumis sativus [cucumbers]
ref|NP_001238503.1|  uncharacterized protein LOC100499696               289   1e-96    Glycine max [soybeans]
ref|XP_002272532.1|  PREDICTED: rac-like GTP-binding protein 5          289   1e-96    Vitis vinifera
ref|NP_001105134.1|  rop6 protein                                       290   1e-96    Zea mays [maize]
ref|XP_009355676.1|  PREDICTED: rac-like GTP-binding protein 5          289   1e-96    Pyrus x bretschneideri [bai li]
ref|XP_006435212.1|  hypothetical protein CICLE_v10002551mg             289   1e-96    Citrus clementina [clementine]
gb|EMS48866.1|  Rac-like GTP-binding protein 3                          289   1e-96    Triticum urartu
ref|XP_002876081.1|  hypothetical protein ARALYDRAFT_906477             289   1e-96    Arabidopsis lyrata subsp. lyrata
ref|XP_003543315.1|  PREDICTED: rac-like GTP-binding protein RAC2...    289   1e-96    Glycine max [soybeans]
ref|NP_001236429.1|  uncharacterized protein LOC100527464               289   1e-96    Glycine max [soybeans]
ref|XP_002278595.1|  PREDICTED: rac-like GTP-binding protein 5          289   1e-96    Vitis vinifera
gb|KJB11994.1|  hypothetical protein B456_002G197500                    289   2e-96    Gossypium raimondii
ref|XP_007041844.1|  RAC-like 3                                         289   2e-96    Theobroma cacao [chocolate]
ref|XP_006340764.1|  PREDICTED: rac-like GTP-binding protein RHO1...    289   2e-96    Solanum tuberosum [potatoes]
gb|ACI03398.1|  rac-like small GTP-binding protein                      289   2e-96    Scoparia dulcis [escobilla]
ref|XP_002987330.1|  RHO family GTPase                                  289   2e-96    Selaginella moellendorffii
gb|ACM07419.1|  Rac/Rop-like small GTPase                               289   2e-96    Scoparia dulcis [escobilla]
ref|XP_004487185.1|  PREDICTED: rac-like GTP-binding protein RAC2...    289   2e-96    Cicer arietinum [garbanzo]
ref|XP_010266823.1|  PREDICTED: rac-like GTP-binding protein 5          289   2e-96    Nelumbo nucifera [Indian lotus]
ref|XP_004961513.1|  PREDICTED: rac-like GTP-binding protein 2-like     290   2e-96    Setaria italica
ref|NP_001240094.1|  uncharacterized protein LOC100798550               289   2e-96    Glycine max [soybeans]
ref|XP_009612580.1|  PREDICTED: rac-like GTP-binding protein RHO1       289   2e-96    Nicotiana tomentosiformis
gb|AAC32124.1|  Rac-like GTP binding protein                            289   2e-96    Picea mariana [black spruce]
ref|XP_011046692.1|  PREDICTED: rac-like GTP-binding protein 5          289   2e-96    Populus euphratica
ref|XP_010692498.1|  PREDICTED: rac-like GTP-binding protein 5          289   2e-96    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006451199.1|  hypothetical protein CICLE_v10009470mg             289   2e-96    Citrus clementina [clementine]
ref|XP_001779421.1|  rop-family small GTPase                            288   2e-96    
gb|ADE75718.1|  unknown                                                 288   2e-96    Picea sitchensis
ref|XP_002284205.1|  PREDICTED: rac-like GTP-binding protein ARAC...    289   2e-96    Vitis vinifera
ref|XP_007213176.1|  hypothetical protein PRUPE_ppa027013mg             288   2e-96    Prunus persica
ref|XP_010426684.1|  PREDICTED: rac-like GTP-binding protein ARAC11     288   2e-96    
ref|XP_010656299.1|  PREDICTED: rac-like GTP-binding protein ARAC...    289   2e-96    Vitis vinifera
emb|CDO96917.1|  unnamed protein product                                288   2e-96    Coffea canephora [robusta coffee]
ref|XP_009614505.1|  PREDICTED: rac-like GTP-binding protein RHO1       288   2e-96    
ref|XP_007200549.1|  hypothetical protein PRUPE_ppa011737mg             288   3e-96    Prunus persica
gb|AEQ62559.1|  Rac/Rop GTPase 2                                        288   3e-96    Aquilaria microcarpa
ref|XP_011093614.1|  PREDICTED: rac-like GTP-binding protein ARAC...    288   3e-96    
ref|XP_008455937.1|  PREDICTED: rac-like GTP-binding protein RAC2       288   3e-96    Cucumis melo [Oriental melon]
ref|XP_009391005.1|  PREDICTED: rac-like GTP-binding protein 5          288   3e-96    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010249660.1|  PREDICTED: rac-like GTP-binding protein ARAC7      288   3e-96    Nelumbo nucifera [Indian lotus]
emb|CDP01867.1|  unnamed protein product                                288   4e-96    Coffea canephora [robusta coffee]
ref|NP_001266008.1|  rac-like GTP-binding protein RAC1-like             288   4e-96    Cicer arietinum [garbanzo]
gb|AFK45598.1|  unknown                                                 288   4e-96    Lotus japonicus
ref|XP_010920642.1|  PREDICTED: rac-like GTP-binding protein 2 is...    288   4e-96    Elaeis guineensis
ref|XP_006376405.1|  hypothetical protein POPTR_0013s12760g             288   4e-96    Populus trichocarpa [western balsam poplar]
gb|KHG13478.1|  Rac-like GTP-binding protein 5                          288   4e-96    Gossypium arboreum [tree cotton]
ref|XP_010498441.1|  PREDICTED: rac-like GTP-binding protein ARAC5      288   4e-96    Camelina sativa [gold-of-pleasure]
ref|XP_010066279.1|  PREDICTED: rac-like GTP-binding protein 5 is...    288   4e-96    Eucalyptus grandis [rose gum]
ref|XP_009418766.1|  PREDICTED: rac-like GTP-binding protein 5          288   4e-96    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002440067.1|  hypothetical protein SORBIDRAFT_09g025400          288   5e-96    Sorghum bicolor [broomcorn]
ref|XP_007017852.1|  RAC-like 3                                         288   5e-96    Theobroma cacao [chocolate]
gb|AGL44367.1|  Rop4                                                    288   5e-96    Hevea brasiliensis [jebe]
ref|XP_006343356.1|  PREDICTED: rac-like GTP-binding protein RHO1...    288   5e-96    Solanum tuberosum [potatoes]
ref|XP_008783259.1|  PREDICTED: rac-like GTP-binding protein 2          288   5e-96    Phoenix dactylifera
ref|XP_011012556.1|  PREDICTED: rac-like GTP-binding protein RHO1...    288   5e-96    Populus euphratica
ref|XP_006305647.1|  hypothetical protein CARUB_v10010350mg             288   5e-96    Capsella rubella
ref|NP_173437.1|  Rac-like GTP-binding protein ARAC4                    288   5e-96    Arabidopsis thaliana [mouse-ear cress]
emb|CDY54338.1|  BnaCnng26840D                                          288   5e-96    Brassica napus [oilseed rape]
ref|XP_009106240.1|  PREDICTED: rac-like GTP-binding protein ARAC5      288   5e-96    Brassica rapa
ref|XP_011092983.1|  PREDICTED: rac-like GTP-binding protein 5          288   6e-96    Sesamum indicum [beniseed]
ref|NP_001290012.1|  rac-like GTP-binding protein RHO1                  288   6e-96    Beta vulgaris subsp. vulgaris [field beet]
gb|AFK47272.1|  unknown                                                 288   6e-96    Lotus japonicus
ref|XP_011093611.1|  PREDICTED: rac-like GTP-binding protein ARAC...    288   6e-96    Sesamum indicum [beniseed]
ref|XP_009786997.1|  PREDICTED: rac-like GTP-binding protein 5          288   6e-96    Nicotiana sylvestris
ref|XP_002525151.1|  rac gtpase, putative                               287   6e-96    Ricinus communis
ref|XP_008357291.1|  PREDICTED: rac-like GTP-binding protein 5          287   6e-96    Malus domestica [apple tree]
ref|XP_006383072.1|  RAC-like GTP binding protein RHO1                  287   6e-96    Populus trichocarpa [western balsam poplar]
ref|XP_011093612.1|  PREDICTED: rac-like GTP-binding protein ARAC...    288   7e-96    Sesamum indicum [beniseed]
ref|NP_001105523.1|  Rho-related protein from plants 7                  288   7e-96    Zea mays [maize]
gb|AAF43430.1|AF233447_1  rac 4 protein                                 287   7e-96    Physcomitrella patens
ref|XP_009409976.1|  PREDICTED: rac-like GTP-binding protein 5          287   7e-96    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007131710.1|  hypothetical protein PHAVU_011G035400g             287   7e-96    Phaseolus vulgaris [French bean]
ref|NP_001105719.1|  Rho-related protein from plants 4                  287   7e-96    
ref|XP_010254054.1|  PREDICTED: rac-like GTP-binding protein ARAC7      288   7e-96    Nelumbo nucifera [Indian lotus]
ref|XP_009612726.1|  PREDICTED: rac-like GTP-binding protein RHO1       287   8e-96    Nicotiana tomentosiformis
ref|XP_002305518.1|  small GTPase Rac4 family protein                   287   8e-96    Populus trichocarpa [western balsam poplar]
ref|XP_010539844.1|  PREDICTED: rac-like GTP-binding protein ARAC5      287   9e-96    Tarenaya hassleriana [spider flower]
ref|XP_004952335.1|  PREDICTED: rac-like GTP-binding protein 7-like     287   9e-96    Setaria italica
ref|XP_010533894.1|  PREDICTED: rac-like GTP-binding protein ARAC5      287   9e-96    Tarenaya hassleriana [spider flower]
ref|XP_002522514.1|  rac gtpase, putative                               287   9e-96    Ricinus communis
ref|XP_011034995.1|  PREDICTED: rac-like GTP-binding protein ARAC5      287   1e-95    
gb|AGL44366.1|  Rop3                                                    287   1e-95    
gb|AFK39736.1|  unknown                                                 287   1e-95    
ref|XP_003635766.1|  Rac-like GTP binding protein                       287   1e-95    
emb|CDY43414.1|  BnaC07g14810D                                          287   1e-95    
ref|XP_010265987.1|  PREDICTED: rac-like GTP-binding protein ARAC3      287   1e-95    
gb|KDO69736.1|  hypothetical protein CISIN_1g028362mg                   287   1e-95    
gb|KJB53194.1|  hypothetical protein B456_008G297200                    286   1e-95    
gb|EYU32943.1|  hypothetical protein MIMGU_mgv1a013795mg                287   1e-95    
ref|XP_006425406.1|  hypothetical protein CICLE_v10026539mg             286   1e-95    
gb|EYU32942.1|  hypothetical protein MIMGU_mgv1a013795mg                287   1e-95    
ref|XP_010279207.1|  PREDICTED: rac-like GTP-binding protein RAC2       286   1e-95    
gb|ABB71820.1|  Rho                                                     286   1e-95    
ref|XP_004143001.1|  PREDICTED: rac-like GTP-binding protein RAC1...    286   2e-95    
ref|XP_002890370.1|  hypothetical protein ARALYDRAFT_472235             286   2e-95    
ref|XP_010536416.1|  PREDICTED: rac-like GTP-binding protein ARAC5      286   2e-95    
ref|XP_007202540.1|  hypothetical protein PRUPE_ppa011074mg             286   2e-95    
emb|CAA10815.2|  Rop subfamily GTPase                                   286   2e-95    
ref|XP_006846898.1|  hypothetical protein AMTR_s00152p00020750          286   2e-95    
emb|CDX73206.1|  BnaC06g36540D                                          286   2e-95    
gb|KFK44134.1|  hypothetical protein AALP_AA1G219700                    286   2e-95    
ref|XP_004234529.1|  PREDICTED: rac-like GTP-binding protein RHO1       286   2e-95    
ref|XP_006377446.1|  RAC-like GTP binding protein ARAC2                 286   2e-95    
ref|XP_009421478.1|  PREDICTED: rac-like GTP-binding protein 7          286   2e-95    
emb|CAC83043.2|  RACB protein                                           286   2e-95    
ref|NP_001056030.1|  Os05g0513800                                       286   3e-95    
ref|XP_004513008.1|  PREDICTED: rac-like GTP-binding protein ARAC...    286   3e-95    
ref|XP_002531163.1|  rac gtpase, putative                               286   3e-95    
ref|XP_007046638.1|  RAC-like 1 isoform 1                               286   3e-95    
ref|XP_006654640.1|  PREDICTED: rac-like GTP-binding protein 2-like     286   3e-95    
ref|XP_007152858.1|  hypothetical protein PHAVU_004G166000g             286   3e-95    
ref|XP_007132690.1|  hypothetical protein PHAVU_011G116400g             286   3e-95    
ref|XP_010548095.1|  PREDICTED: rac-like GTP-binding protein ARAC3      286   3e-95    
gb|AAX77217.1|  Rac3                                                    286   3e-95    
emb|CAD27895.1|  putative RACD protein                                  286   3e-95    
ref|XP_010090337.1|  Rac-like GTP-binding protein ARAC3                 286   3e-95    
ref|XP_008393868.1|  PREDICTED: rac-like GTP-binding protein ARAC1      286   3e-95    
ref|XP_010047913.1|  PREDICTED: rac-like GTP-binding protein ARAC7      286   3e-95    
gb|AHV83603.1|  ROP5                                                    286   3e-95    
gb|EYU37952.1|  hypothetical protein MIMGU_mgv1a014150mg                286   3e-95    
pdb|2NTY|C  Chain C, Rop4-Gdp-Prone8                                    285   4e-95    
ref|XP_004232945.1|  PREDICTED: rac-like GTP-binding protein RAC13      285   4e-95    
gb|KHN20664.1|  Rac-like GTP-binding protein ARAC7                      286   4e-95    
ref|XP_006409243.1|  hypothetical protein EUTSA_v10022861mg             285   4e-95    
ref|XP_010033515.1|  PREDICTED: rac-like GTP-binding protein RHO1       285   4e-95    
ref|XP_009404415.1|  PREDICTED: rac-like GTP-binding protein RAC2       285   4e-95    
ref|XP_010231171.1|  PREDICTED: rac-like GTP-binding protein 2          286   4e-95    
ref|XP_003539954.1|  PREDICTED: rac-like GTP-binding protein RAC2...    285   4e-95    
gb|EYU18077.1|  hypothetical protein MIMGU_mgv1a014213mg                285   4e-95    
ref|XP_010113318.1|  Rac-like GTP-binding protein RHO1                  285   4e-95    
ref|XP_008800174.1|  PREDICTED: rac-like GTP-binding protein 5          285   4e-95    
ref|XP_011099877.1|  PREDICTED: rac-like GTP-binding protein RHO1       285   4e-95    
ref|XP_011045876.1|  PREDICTED: rac-like GTP-binding protein RAC13      285   4e-95    
ref|XP_004146153.1|  PREDICTED: rac-like GTP-binding protein ARAC...    285   4e-95    
ref|XP_009415229.1|  PREDICTED: rac-like GTP-binding protein 2          286   5e-95    
ref|XP_007013116.1|  RHO-related protein from plants 9                  286   5e-95    
ref|XP_003573523.1|  PREDICTED: rac-like GTP-binding protein 6          285   5e-95    
gb|ADY16660.1|  ROP6                                                    285   5e-95    
ref|XP_008789319.1|  PREDICTED: rac-like GTP-binding protein ARAC7      286   5e-95    
emb|CDY39066.1|  BnaA02g17550D                                          285   5e-95    
ref|XP_006446737.1|  hypothetical protein CICLE_v10016797mg             285   5e-95    
ref|XP_009128141.1|  PREDICTED: rac-like GTP-binding protein ARAC5      285   5e-95    
dbj|BAJ53109.1|  JHL20J20.16                                            285   5e-95    
gb|KJB64825.1|  hypothetical protein B456_010G073300                    285   5e-95    
ref|XP_010029661.1|  PREDICTED: rac-like GTP-binding protein RHO1       285   6e-95    
gb|KFK34371.1|  hypothetical protein AALP_AA5G136700                    285   6e-95    
ref|XP_008221237.1|  PREDICTED: rac-like GTP-binding protein 5          285   6e-95    
ref|XP_003573198.1|  PREDICTED: rac-like GTP-binding protein 7 is...    285   6e-95    
ref|NP_001046653.1|  Os02g0312600                                       285   6e-95    
gb|KHG25329.1|  Rac-like GTP-binding protein ARAC7                      285   6e-95    
ref|XP_009794579.1|  PREDICTED: rac-like GTP-binding protein RAC13      285   6e-95    
ref|XP_004233565.1|  PREDICTED: rac-like GTP-binding protein ARAC1      285   6e-95    
gb|ABI84104.1|  GTP-binding Rop/Rac GTPase                              285   6e-95    
ref|XP_010531098.1|  PREDICTED: rac-like GTP-binding protein ARAC...    285   7e-95    
gb|KHN45625.1|  Rac-like GTP-binding protein ARAC7                      285   7e-95    
gb|AFK48298.1|  unknown                                                 285   7e-95    
ref|XP_010459691.1|  PREDICTED: rac-like GTP-binding protein ARAC5      285   7e-95    
ref|NP_177712.1|  Rac-like GTP-binding protein ARAC5                    285   8e-95    
ref|XP_004134675.1|  PREDICTED: rac-like GTP-binding protein 7-like     285   8e-95    
gb|AGL44364.1|  Rop1                                                    285   8e-95    
ref|NP_199409.1|  Rac-like GTP-binding protein ARAC2                    285   9e-95    
ref|XP_008439788.1|  PREDICTED: rac-like GTP-binding protein RAC13      285   9e-95    
ref|XP_002514274.1|  rac gtpase, putative                               285   9e-95    
gb|KFK42023.1|  hypothetical protein AALP_AA2G202200                    285   9e-95    
ref|XP_003570746.1|  PREDICTED: rac-like GTP-binding protein 5          285   9e-95    
gb|AGL44368.1|  Rop5                                                    285   9e-95    
emb|CAD27894.1|  putative ROP6 protein                                  285   1e-94    
ref|XP_004509382.1|  PREDICTED: rac-like GTP-binding protein RHO1...    285   1e-94    
ref|XP_003629271.1|  Rac-like GTP-binding protein                       285   1e-94    
gb|AAM18134.1|AF498358_1  small G-protein ROP6                          285   1e-94    
ref|XP_009376954.1|  PREDICTED: rac-like GTP-binding protein ARAC3      285   1e-94    
gb|KFK40156.1|  hypothetical protein AALP_AA3G337500                    285   1e-94    
gb|AFK42778.1|  unknown                                                 285   1e-94    
ref|XP_008784446.1|  PREDICTED: rac-like GTP-binding protein 7          284   1e-94    
ref|XP_010548268.1|  PREDICTED: rac-like GTP-binding protein ARAC11     284   1e-94    
ref|XP_006646799.1|  PREDICTED: rac-like GTP-binding protein 6-like     284   1e-94    
ref|XP_003534211.1|  PREDICTED: rac-like GTP-binding protein ARAC...    285   1e-94    
ref|XP_003620632.1|  Rac-like GTP-binding protein                       285   1e-94    
ref|XP_006281127.1|  hypothetical protein CARUB_v10027157mg             284   1e-94    
ref|XP_010547413.1|  PREDICTED: rac-like GTP-binding protein ARAC...    284   1e-94    
gb|ABO15583.1|  LLP-Rop1                                                284   1e-94    
ref|XP_009782212.1|  PREDICTED: rac-like GTP-binding protein ARAC...    284   1e-94    
ref|XP_002325588.1|  hypothetical protein POPTR_0019s12210g             284   1e-94    
gb|KJB63495.1|  hypothetical protein B456_010G002600                    284   1e-94    
ref|XP_010915861.1|  PREDICTED: rac-like GTP-binding protein 2 is...    285   1e-94    
ref|XP_006587527.1|  PREDICTED: rac-like GTP-binding protein ARAC...    285   1e-94    
ref|XP_006647205.1|  PREDICTED: rac-like GTP-binding protein 7-li...    285   1e-94    
ref|XP_009104695.1|  PREDICTED: rac-like GTP-binding protein ARAC5      284   1e-94    
ref|XP_004155550.1|  PREDICTED: LOW QUALITY PROTEIN: rac-like GTP...    284   1e-94    
ref|XP_010916043.1|  PREDICTED: rac-like GTP-binding protein RAC13      284   2e-94    
emb|CDO96719.1|  unnamed protein product                                284   2e-94    
ref|XP_010915860.1|  PREDICTED: rac-like GTP-binding protein 2 is...    285   2e-94    
gb|KJB17615.1|  hypothetical protein B456_003G008000                    284   2e-94    
ref|XP_002865214.1|  hypothetical protein ARALYDRAFT_494381             284   2e-94    
ref|XP_009103358.1|  PREDICTED: rac-like GTP-binding protein ARAC4      284   2e-94    
ref|XP_003528925.1|  PREDICTED: rac-like GTP-binding protein ARAC...    284   2e-94    
ref|XP_010413444.1|  PREDICTED: rac-like GTP-binding protein ARAC1      284   2e-94    
ref|XP_011048374.1|  PREDICTED: rac-like GTP-binding protein ARAC7      284   2e-94    
ref|XP_010416495.1|  PREDICTED: rac-like GTP-binding protein ARAC5      285   2e-94    
gb|KJB29658.1|  hypothetical protein B456_005G112500                    283   2e-94    
ref|XP_006583388.1|  PREDICTED: rac-like GTP-binding protein ARAC...    284   2e-94    
ref|XP_009782204.1|  PREDICTED: rac-like GTP-binding protein ARAC...    284   2e-94    
ref|XP_010548703.1|  PREDICTED: rac-like GTP-binding protein ARAC7      284   3e-94    
ref|XP_007223496.1|  hypothetical protein PRUPE_ppa011760mg             283   3e-94    
gb|KCW64122.1|  hypothetical protein EUGRSUZ_G01779                     283   3e-94    
pdb|2WBL|C  Chain C, Three-Dimensional Structure Of A Binary Rop-...    283   3e-94    
ref|XP_009607499.1|  PREDICTED: rac-like GTP-binding protein 5          283   3e-94    
gb|KDP21034.1|  hypothetical protein JCGZ_21505                         283   3e-94    
ref|NP_179371.1|  Rac-like GTP-binding protein ARAC1                    283   3e-94    
ref|XP_006390262.1|  hypothetical protein EUTSA_v10019171mg             283   3e-94    
gb|AEN71048.1|  small GTPase RacB                                       283   4e-94    
gb|AEN71041.1|  small GTPase RacB                                       283   4e-94    
gb|KJB68395.1|  hypothetical protein B456_010G242900                    283   4e-94    
ref|XP_009414443.1|  PREDICTED: rac-like GTP-binding protein 5          283   4e-94    
ref|XP_009392892.1|  PREDICTED: rac-like GTP-binding protein 5          283   4e-94    
emb|CDY57346.1|  BnaC02g47270D                                          283   4e-94    
gb|EPS58180.1|  hypothetical protein M569_16636                         283   4e-94    
gb|AEN71050.1|  small GTPase RacB                                       283   4e-94    
ref|XP_009591893.1|  PREDICTED: rac-like GTP-binding protein RAC13      283   4e-94    
ref|XP_002277471.1|  PREDICTED: rac-like GTP-binding protein RAC13      283   4e-94    
ref|XP_010490393.1|  PREDICTED: rac-like GTP-binding protein ARAC1      283   4e-94    
sp|Q41253.1|RAC13_GOSHI  RecName: Full=Rac-like GTP-binding prote...    283   4e-94    
gb|AFK35868.1|  unknown                                                 283   5e-94    
gb|AFK36265.1|  unknown                                                 283   5e-94    
gb|EYU30811.1|  hypothetical protein MIMGU_mgv1a014224mg                283   5e-94    
ref|XP_010494753.1|  PREDICTED: rac-like GTP-binding protein ARAC...    283   5e-94    
ref|XP_006296623.1|  hypothetical protein CARUB_v10014691mg             283   5e-94    
ref|XP_009352499.1|  PREDICTED: rac-like GTP-binding protein ARAC7      283   5e-94    
sp|Q41254.1|RAC9_GOSHI  RecName: Full=Rac-like GTP-binding protei...    283   5e-94    
ref|XP_011096382.1|  PREDICTED: rac-like GTP-binding protein RAC13      283   5e-94    
gb|AFK47701.1|  unknown                                                 283   5e-94    
gb|KJB54229.1|  hypothetical protein B456_009G026200                    283   6e-94    
ref|XP_010049666.1|  PREDICTED: rac-like GTP-binding protein ARAC7      283   6e-94    
ref|XP_010686365.1|  PREDICTED: rac-like GTP-binding protein RAC1...    283   6e-94    
ref|XP_010557582.1|  PREDICTED: rac-like GTP-binding protein ARAC...    283   6e-94    
gb|KHG17559.1|  Rac-like GTP-binding protein 5                          283   6e-94    
emb|CAG30067.1|  small GTPase Rac4                                      282   6e-94    
gb|EYU40438.1|  hypothetical protein MIMGU_mgv1a014185mg                282   6e-94    
ref|XP_004159725.1|  PREDICTED: LOW QUALITY PROTEIN: rac-like GTP...    282   6e-94    
gb|KFK30140.1|  rac-like gtp-binding protein arac3                      282   7e-94    
ref|XP_008648284.1|  PREDICTED: rop6 protein isoform X1                 283   7e-94    
ref|XP_003607186.1|  Rac-like GTP-binding protein                       282   7e-94    
ref|XP_006341277.1|  PREDICTED: rac-like GTP-binding protein ARAC...    282   7e-94    
ref|XP_010529177.1|  PREDICTED: rac-like GTP-binding protein ARAC2      282   7e-94    
gb|KDP33698.1|  hypothetical protein JCGZ_07269                         283   8e-94    
gb|EPS68917.1|  hypothetical protein M569_05854                         282   8e-94    
ref|XP_009401490.1|  PREDICTED: rac-like GTP-binding protein 5          282   8e-94    
ref|XP_002325004.1|  RAC-like GTP binding protein ARAC7                 283   8e-94    
ref|XP_009408223.1|  PREDICTED: rac-like GTP-binding protein 5          282   9e-94    
gb|KFK30229.1|  hypothetical protein AALP_AA7G234300                    282   9e-94    
ref|XP_002867045.1|  hypothetical protein ARALYDRAFT_491041             282   9e-94    
ref|XP_004299989.1|  PREDICTED: rac-like GTP-binding protein ARAC...    282   9e-94    
ref|XP_010925886.1|  PREDICTED: rac-like GTP-binding protein 2 is...    282   1e-93    
gb|KJB53192.1|  hypothetical protein B456_008G297200                    281   1e-93    
ref|XP_010447010.1|  PREDICTED: rac-like GTP-binding protein ARAC3      282   1e-93    
ref|NP_195228.1|  Rac-like GTP-binding protein ARAC3                    282   1e-93    
gb|KHN41616.1|  Rac-like GTP-binding protein RAC2                       281   1e-93    
ref|XP_006341276.1|  PREDICTED: rac-like GTP-binding protein ARAC...    282   1e-93    
gb|KHG28000.1|  Rac-like GTP-binding protein ARAC3                      281   1e-93    
ref|XP_010437541.1|  PREDICTED: rac-like GTP-binding protein ARAC3      281   1e-93    
ref|XP_004299988.1|  PREDICTED: rac-like GTP-binding protein ARAC...    282   2e-93    
emb|CDX77623.1|  BnaC07g18770D                                          281   2e-93    
ref|XP_007202572.1|  hypothetical protein PRUPE_ppa011463mg             282   2e-93    
ref|XP_009101554.1|  PREDICTED: rac-like GTP-binding protein ARAC2      281   2e-93    
emb|CAI84890.1|  putative Rho GTPase                                    281   2e-93    
ref|XP_007156181.1|  hypothetical protein PHAVU_003G265200g             281   2e-93    
gb|AFK37671.1|  unknown                                                 281   2e-93    
ref|NP_001239863.1|  uncharacterized protein LOC100808748               281   2e-93    
ref|XP_007025494.1|  RAC-like 2                                         281   2e-93    
gb|KHN36014.1|  Rac-like GTP-binding protein RHO1                       281   2e-93    
gb|AAO11651.1|  putative ROP family GTPase                              281   2e-93    
ref|XP_006412039.1|  hypothetical protein EUTSA_v10026296mg             281   2e-93    
dbj|BAC41518.1|  Rac GTPase                                             281   2e-93    
gb|AAO11655.2|  putative ROP family GTPase                              281   2e-93    
ref|XP_009609804.1|  PREDICTED: rac-like GTP-binding protein ARAC7      281   2e-93    
ref|XP_009136611.1|  PREDICTED: rac-like GTP-binding protein RHO1       281   2e-93    
ref|XP_004242938.1|  PREDICTED: rac-like GTP-binding protein ARAC...    281   2e-93    
gb|AAB38780.1|  Rho1Ps homolog                                          281   2e-93    
ref|XP_008242578.1|  PREDICTED: rac-like GTP-binding protein ARAC...    281   2e-93    
gb|EPS66409.1|  hypothetical protein M569_08365                         281   2e-93    
gb|KFK36759.1|  hypothetical protein AALP_AA4G166100                    281   2e-93    
ref|XP_009334760.1|  PREDICTED: rac-like GTP-binding protein RAC1       281   2e-93    
emb|CDY26832.1|  BnaC09g09590D                                          281   3e-93    
gb|ACM68949.1|  ROP1.1                                                  280   3e-93    
gb|KHG12635.1|  Rac-like GTP-binding protein RAC13                      281   3e-93    
ref|XP_009148517.1|  PREDICTED: rac-like GTP-binding protein ARAC6      281   3e-93    
ref|XP_010481512.1|  PREDICTED: rac-like GTP-binding protein ARAC...    281   3e-93    
gb|AAO42256.1|  putative Rho1Ps homolog Rac protein                     281   3e-93    
ref|NP_001048639.1|  Os02g0834000                                       281   3e-93    
ref|XP_002313709.1|  hypothetical protein POPTR_0009s13700g             281   3e-93    
pdb|3BWD|D  Chain D, Crystal Structure Of The Plant Rho Protein Rop5    280   3e-93    
ref|XP_009121076.1|  PREDICTED: rac-like GTP-binding protein ARAC1      281   3e-93    
ref|XP_009124572.1|  PREDICTED: rac-like GTP-binding protein ARAC1      280   3e-93    
ref|XP_009107160.1|  PREDICTED: rac-like GTP-binding protein ARAC3      280   3e-93    
ref|XP_008387924.1|  PREDICTED: rac-like GTP-binding protein ARAC5      280   4e-93    
gb|AFK46528.1|  unknown                                                 280   4e-93    
gb|AAC78242.1|  Rho-like GTP binding protein                            280   4e-93    
ref|XP_008242576.1|  PREDICTED: rac-like GTP-binding protein ARAC...    281   4e-93    
ref|XP_004960651.1|  PREDICTED: rac-like GTP-binding protein 1-li...    281   4e-93    
gb|KDP23992.1|  hypothetical protein JCGZ_25380                         280   4e-93    
ref|XP_009112460.1|  PREDICTED: rac-like GTP-binding protein ARAC1      280   4e-93    



>ref|XP_006439765.1| hypothetical protein CICLE_v10022245mg [Citrus clementina]
 gb|ESR53005.1| hypothetical protein CICLE_v10022245mg [Citrus clementina]
Length=210

 Score =   327 bits (838),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 154/158 (97%), Positives = 157/158 (99%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSLVSRASYEN+LKKWIPELQH++PG PVVLVGTKLDLREDKHYLADHPGL
Sbjct  78   RGADVFVLAFSLVSRASYENVLKKWIPELQHYSPGVPVVLVGTKLDLREDKHYLADHPGL  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA
Sbjct  138  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  175



>ref|XP_010111536.1| Rac-like GTP-binding protein 3 [Morus notabilis]
 gb|EXC31169.1| Rac-like GTP-binding protein 3 [Morus notabilis]
Length=205

 Score =   326 bits (836),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 153/158 (97%), Positives = 155/158 (98%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVV EGTTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVEGTTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSLVSRASYEN++KKWIPELQHFAPG PVVLVGTKLDLREDKHYLADHPGL
Sbjct  78   RGADVFVLAFSLVSRASYENVMKKWIPELQHFAPGVPVVLVGTKLDLREDKHYLADHPGL  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VPVTTAQGEELRKQIG AYYIECSSKTQQNVKAVFDAA
Sbjct  138  VPVTTAQGEELRKQIGTAYYIECSSKTQQNVKAVFDAA  175



>gb|KDO69733.1| hypothetical protein CISIN_1g028362mg [Citrus sinensis]
Length=210

 Score =   326 bits (836),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 153/158 (97%), Positives = 157/158 (99%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSLVSRASYEN+LKKWIPELQH++PG PVVLVGTKLDLREDKHYLADHPGL
Sbjct  78   RGADVFVLAFSLVSRASYENVLKKWIPELQHYSPGVPVVLVGTKLDLREDKHYLADHPGL  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VPVTTAQGEELRKQIGA+YYIECSSKTQQNVKAVFDAA
Sbjct  138  VPVTTAQGEELRKQIGASYYIECSSKTQQNVKAVFDAA  175



>ref|XP_006476738.1| PREDICTED: rac-like GTP-binding protein 3-like [Citrus sinensis]
Length=210

 Score =   325 bits (834),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 152/158 (96%), Positives = 157/158 (99%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGAD+FVLAFSLVSRASYEN+LKKWIPELQH++PG PVVLVGTKLDLREDKHYLADHPGL
Sbjct  78   RGADIFVLAFSLVSRASYENVLKKWIPELQHYSPGVPVVLVGTKLDLREDKHYLADHPGL  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VPVTTAQGEELRKQIGA+YYIECSSKTQQNVKAVFDAA
Sbjct  138  VPVTTAQGEELRKQIGASYYIECSSKTQQNVKAVFDAA  175



>emb|CAN60154.1| hypothetical protein VITISV_021505 [Vitis vinifera]
Length=198

 Score =   325 bits (832),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 152/158 (96%), Positives = 157/158 (99%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFP+DYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPSDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            +GADVF+LAFSLVSRASYEN+LKKWIPELQHFAPG P+VLVGTKLDLREDKHYLADHPGL
Sbjct  78   QGADVFILAFSLVSRASYENVLKKWIPELQHFAPGIPIVLVGTKLDLREDKHYLADHPGL  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA
Sbjct  138  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  175



>ref|XP_011087157.1| PREDICTED: rac-like GTP-binding protein ARAC8 [Sesamum indicum]
Length=209

 Score =   325 bits (833),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 153/158 (97%), Positives = 156/158 (99%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVV EGTTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVEGTTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSLVSRASYENILKKWIPELQHFAPG PVVLVGTKLDLREDKHYLADHPGL
Sbjct  78   RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGIPVVLVGTKLDLREDKHYLADHPGL  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            +PVTTAQGEELR+QIGA+YYIECSSKTQQNVKAVFDAA
Sbjct  138  IPVTTAQGEELRRQIGASYYIECSSKTQQNVKAVFDAA  175



>ref|XP_002283394.1| PREDICTED: rac-like GTP-binding protein 3 [Vitis vinifera]
 emb|CBI15071.3| unnamed protein product [Vitis vinifera]
Length=210

 Score =   325 bits (833),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 152/158 (96%), Positives = 157/158 (99%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFP+DYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPSDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            +GADVF+LAFSLVSRASYEN+LKKWIPELQHFAPG P+VLVGTKLDLREDKHYLADHPGL
Sbjct  78   QGADVFILAFSLVSRASYENVLKKWIPELQHFAPGIPIVLVGTKLDLREDKHYLADHPGL  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA
Sbjct  138  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  175



>ref|XP_010254450.1| PREDICTED: rac-like GTP-binding protein 3 isoform X3 [Nelumbo 
nucifera]
Length=200

 Score =   325 bits (832),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 152/158 (96%), Positives = 155/158 (98%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVV EGTTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVIEGTTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSLVSRASYEN+LKKWIPELQHFAPG PVVL GTKLDLRED+HYLADHPGL
Sbjct  78   RGADVFVLAFSLVSRASYENVLKKWIPELQHFAPGVPVVLAGTKLDLREDRHYLADHPGL  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VP+TTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA
Sbjct  138  VPITTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  175



>ref|XP_010037588.1| PREDICTED: rac-like GTP-binding protein 3 [Eucalyptus grandis]
 gb|KCW49314.1| hypothetical protein EUGRSUZ_K02869 [Eucalyptus grandis]
Length=210

 Score =   324 bits (831),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 152/158 (96%), Positives = 156/158 (99%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVV EGTTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVEGTTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSLVSRASYENILKKWIPELQH+APG P+VLVGTK+DLREDKHYLADHPGL
Sbjct  78   RGADVFVLAFSLVSRASYENILKKWIPELQHYAPGIPLVLVGTKVDLREDKHYLADHPGL  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKA+FDAA
Sbjct  138  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAIFDAA  175



>ref|XP_010550661.1| PREDICTED: rac-like GTP-binding protein ARAC10 [Tarenaya hassleriana]
Length=216

 Score =   325 bits (832),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 152/158 (96%), Positives = 155/158 (98%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVV EGTTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVEGTTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSLVSRASYEN+LKKWIPELQHFAPG P+VLVGTKLDLREDKHYLADHPGL
Sbjct  78   RGADVFVLAFSLVSRASYENVLKKWIPELQHFAPGVPIVLVGTKLDLREDKHYLADHPGL  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VPV+TAQGEELRKQIGA YYIECSSKTQQNVKAVFDAA
Sbjct  138  VPVSTAQGEELRKQIGAMYYIECSSKTQQNVKAVFDAA  175



>ref|XP_009601098.1| PREDICTED: rac-like GTP-binding protein 3 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009601099.1| PREDICTED: rac-like GTP-binding protein 3 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009601100.1| PREDICTED: rac-like GTP-binding protein 3 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009601101.1| PREDICTED: rac-like GTP-binding protein 3 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009601102.1| PREDICTED: rac-like GTP-binding protein 3 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009601104.1| PREDICTED: rac-like GTP-binding protein 3 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_010318918.1| PREDICTED: rac-like GTP-binding protein 3 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010318919.1| PREDICTED: rac-like GTP-binding protein 3 isoform X1 [Solanum 
lycopersicum]
 emb|CAD42725.1| putative rac protein [Nicotiana tabacum]
Length=210

 Score =   324 bits (830),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 152/158 (96%), Positives = 155/158 (98%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDY+PTVFDNFSANVV EGTTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYVPTVFDNFSANVVVEGTTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSLVSRASYENILKKWIPELQH+APG PVVL GTKLDLREDKH+LADHPGL
Sbjct  78   RGADVFVLAFSLVSRASYENILKKWIPELQHYAPGIPVVLAGTKLDLREDKHFLADHPGL  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA
Sbjct  138  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  175



>ref|XP_010318920.1| PREDICTED: rac-like GTP-binding protein 3 isoform X2 [Solanum 
lycopersicum]
Length=198

 Score =   323 bits (829),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 152/158 (96%), Positives = 155/158 (98%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDY+PTVFDNFSANVV EGTTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYVPTVFDNFSANVVVEGTTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSLVSRASYENILKKWIPELQH+APG PVVL GTKLDLREDKH+LADHPGL
Sbjct  78   RGADVFVLAFSLVSRASYENILKKWIPELQHYAPGIPVVLAGTKLDLREDKHFLADHPGL  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA
Sbjct  138  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  175



>ref|XP_011015598.1| PREDICTED: rac-like GTP-binding protein 3 [Populus euphratica]
Length=211

 Score =   324 bits (830),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 151/158 (96%), Positives = 155/158 (98%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVV EGTTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVEGTTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSLVSRASYEN+LKKWIPELQH+APG P+VLVG KLDLREDKHYLADHPGL
Sbjct  78   RGADVFVLAFSLVSRASYENVLKKWIPELQHYAPGIPIVLVGAKLDLREDKHYLADHPGL  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VPVTTAQGEELRKQIGAAYY+ECSSKTQQNVKAVFDAA
Sbjct  138  VPVTTAQGEELRKQIGAAYYVECSSKTQQNVKAVFDAA  175



>ref|XP_007036140.1| Rac-like GTP-binding protein 3 isoform 2 [Theobroma cacao]
 gb|EOY20641.1| Rac-like GTP-binding protein 3 isoform 2 [Theobroma cacao]
Length=210

 Score =   324 bits (830),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 152/158 (96%), Positives = 156/158 (99%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVV EGTTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVEGTTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSLVSRASYEN+LKKWIPELQH+APG PVVLVGTKLDLREDKHYLADHPGL
Sbjct  78   RGADVFVLAFSLVSRASYENVLKKWIPELQHYAPGVPVVLVGTKLDLREDKHYLADHPGL  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            +PV+TAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA
Sbjct  138  LPVSTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  175



>emb|CDP16997.1| unnamed protein product [Coffea canephora]
Length=210

 Score =   324 bits (830),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 153/158 (97%), Positives = 155/158 (98%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVV EGTTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVEGTTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSLVSRASYENILKKWIPEL HFAPG PVVLVGTKLDLREDKHYLADHPGL
Sbjct  78   RGADVFVLAFSLVSRASYENILKKWIPELHHFAPGIPVVLVGTKLDLREDKHYLADHPGL  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VPVTTAQGEELRKQIGAA+YIECSSKTQQNVK+VFDAA
Sbjct  138  VPVTTAQGEELRKQIGAAFYIECSSKTQQNVKSVFDAA  175



>ref|XP_010254444.1| PREDICTED: rac-like GTP-binding protein 3 isoform X2 [Nelumbo 
nucifera]
Length=212

 Score =   323 bits (829),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 152/158 (96%), Positives = 155/158 (98%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVV EGTTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVIEGTTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSLVSRASYEN+LKKWIPELQHFAPG PVVL GTKLDLRED+HYLADHPGL
Sbjct  78   RGADVFVLAFSLVSRASYENVLKKWIPELQHFAPGVPVVLAGTKLDLREDRHYLADHPGL  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VP+TTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA
Sbjct  138  VPITTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  175



>ref|XP_009786167.1| PREDICTED: rac-like GTP-binding protein 3 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009786168.1| PREDICTED: rac-like GTP-binding protein 3 isoform X1 [Nicotiana 
sylvestris]
Length=210

 Score =   323 bits (828),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 151/158 (96%), Positives = 155/158 (98%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDY+PTVFDNFSANVV EGTTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYVPTVFDNFSANVVVEGTTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSLVSRASYENILKKWIPELQH+APG PVVL GTKLDLREDKH+LADHPGL
Sbjct  78   RGADVFVLAFSLVSRASYENILKKWIPELQHYAPGIPVVLAGTKLDLREDKHFLADHPGL  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            +PVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA
Sbjct  138  IPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  175



>ref|XP_011044337.1| PREDICTED: rac-like GTP-binding protein ARAC8 [Populus euphratica]
Length=211

 Score =   323 bits (828),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 151/158 (96%), Positives = 155/158 (98%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVV EGTTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVEGTTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSLVSRASYEN+LKKWIPELQH+APG P+VLVG KLDLREDKHYLADHPGL
Sbjct  78   RGADVFVLAFSLVSRASYENVLKKWIPELQHYAPGIPIVLVGAKLDLREDKHYLADHPGL  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VPVTTAQGEELRKQIGAAYY+ECSSKTQQNVKAVFDAA
Sbjct  138  VPVTTAQGEELRKQIGAAYYVECSSKTQQNVKAVFDAA  175



>ref|XP_011028604.1| PREDICTED: rac-like GTP-binding protein ARAC8 [Populus euphratica]
Length=211

 Score =   323 bits (827),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 152/158 (96%), Positives = 154/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANV  EGTTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVAVEGTTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSLVSRASYEN+LKKWIPELQH+APG PVVLVGTKLDLREDKHYLADHPGL
Sbjct  78   RGADVFVLAFSLVSRASYENVLKKWIPELQHYAPGVPVVLVGTKLDLREDKHYLADHPGL  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VPVT AQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA
Sbjct  138  VPVTMAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  175



>ref|XP_004299574.1| PREDICTED: rac-like GTP-binding protein 3 [Fragaria vesca subsp. 
vesca]
Length=211

 Score =   323 bits (827),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 152/158 (96%), Positives = 154/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDY+PTVFDNFSANVV E TTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYVPTVFDNFSANVVVESTTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSLVSRASYENILKKWIPELQH+APG PVVL GTKLDLREDKHYLADHPGL
Sbjct  78   RGADVFVLAFSLVSRASYENILKKWIPELQHYAPGVPVVLAGTKLDLREDKHYLADHPGL  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA
Sbjct  138  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  175



>ref|XP_007211210.1| hypothetical protein PRUPE_ppa011421mg [Prunus persica]
 ref|XP_008239729.1| PREDICTED: rac-like GTP-binding protein 3 [Prunus mume]
 gb|EMJ12409.1| hypothetical protein PRUPE_ppa011421mg [Prunus persica]
Length=211

 Score =   322 bits (826),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 151/158 (96%), Positives = 155/158 (98%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVV EGTTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVEGTTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSLVSRASYEN+LKKWIPELQH+APG PVVL GTKLDLREDKHYLADHPGL
Sbjct  78   RGADVFVLAFSLVSRASYENVLKKWIPELQHYAPGVPVVLAGTKLDLREDKHYLADHPGL  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VPVTTAQGEELRKQIGA++YIECSSKTQQNVKAVFDAA
Sbjct  138  VPVTTAQGEELRKQIGASFYIECSSKTQQNVKAVFDAA  175



>gb|KJB53191.1| hypothetical protein B456_008G297200 [Gossypium raimondii]
Length=200

 Score =   322 bits (825),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 151/158 (96%), Positives = 155/158 (98%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVV EGTTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVEGTTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSLVSRASYEN+LKKWIPELQH+APG PVVLVGTKLDLREDKHYLADHPGL
Sbjct  78   RGADVFVLAFSLVSRASYENVLKKWIPELQHYAPGVPVVLVGTKLDLREDKHYLADHPGL  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            +PV+TAQGEELRKQIGAAYYIECSSKTQQNVKAVFD A
Sbjct  138  LPVSTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDDA  175



>gb|AEQ62558.1| Rac/Rop GTPase 1 [Aquilaria microcarpa]
Length=210

 Score =   322 bits (826),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 151/158 (96%), Positives = 155/158 (98%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDY+PTVFDNFSANV+ EGTTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYVPTVFDNFSANVIVEGTTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSLVSRASYEN+LKKWIPELQH+APG PVVLVGTKLDLREDKHYLADHPG 
Sbjct  78   RGADVFVLAFSLVSRASYENVLKKWIPELQHYAPGVPVVLVGTKLDLREDKHYLADHPGS  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA
Sbjct  138  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  175



>gb|KJB53188.1| hypothetical protein B456_008G297200 [Gossypium raimondii]
Length=221

 Score =   323 bits (827),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 151/158 (96%), Positives = 155/158 (98%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVV EGTTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVEGTTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSLVSRASYEN+LKKWIPELQH+APG PVVLVGTKLDLREDKHYLADHPGL
Sbjct  78   RGADVFVLAFSLVSRASYENVLKKWIPELQHYAPGVPVVLVGTKLDLREDKHYLADHPGL  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            +PV+TAQGEELRKQIGAAYYIECSSKTQQNVKAVFD A
Sbjct  138  LPVSTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDDA  175



>gb|KJB53187.1| hypothetical protein B456_008G297200 [Gossypium raimondii]
Length=211

 Score =   322 bits (826),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 151/158 (96%), Positives = 155/158 (98%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVV EGTTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVEGTTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSLVSRASYEN+LKKWIPELQH+APG PVVLVGTKLDLREDKHYLADHPGL
Sbjct  78   RGADVFVLAFSLVSRASYENVLKKWIPELQHYAPGVPVVLVGTKLDLREDKHYLADHPGL  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            +PV+TAQGEELRKQIGAAYYIECSSKTQQNVKAVFD A
Sbjct  138  LPVSTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDDA  175



>ref|XP_008393056.1| PREDICTED: rac-like GTP-binding protein ARAC8 [Malus domestica]
Length=211

 Score =   322 bits (825),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 151/158 (96%), Positives = 155/158 (98%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVV EGTTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVEGTTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSLVSRASYEN+LKKWIPELQH+APG PVVL GTKLDLREDKHYLADHPGL
Sbjct  78   RGADVFVLAFSLVSRASYENVLKKWIPELQHYAPGVPVVLAGTKLDLREDKHYLADHPGL  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VPVTTAQGEELRKQIGA++YIECSSKTQQNVKAVFDAA
Sbjct  138  VPVTTAQGEELRKQIGASFYIECSSKTQQNVKAVFDAA  175



>ref|XP_006345032.1| PREDICTED: rac-like GTP-binding protein 3-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006345033.1| PREDICTED: rac-like GTP-binding protein 3-like isoform X2 [Solanum 
tuberosum]
Length=210

 Score =   322 bits (825),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 151/158 (96%), Positives = 154/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDY+PTVFDNFSANVV EGTTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYVPTVFDNFSANVVVEGTTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSLVSRASYENILKKWIPELQH+APG PVVL GTKLDLREDKH+LADHPGL
Sbjct  78   RGADVFVLAFSLVSRASYENILKKWIPELQHYAPGIPVVLAGTKLDLREDKHFLADHPGL  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VPVTTAQGEELRKQIGAAYYIECSSKTQQNVK VFDAA
Sbjct  138  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKGVFDAA  175



>ref|XP_008780935.1| PREDICTED: rac-like GTP-binding protein 3 [Phoenix dactylifera]
Length=213

 Score =   322 bits (825),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 149/158 (94%), Positives = 155/158 (98%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVV +GTTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVDGTTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSLVSRASYEN+LKKWIPELQH+APG PVVL GTKLDLREDKHYL+DHPG+
Sbjct  78   RGADVFVLAFSLVSRASYENVLKKWIPELQHYAPGVPVVLAGTKLDLREDKHYLSDHPGM  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            +PVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA
Sbjct  138  IPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  175



>ref|XP_010272004.1| PREDICTED: rac-like GTP-binding protein 3 [Nelumbo nucifera]
Length=211

 Score =   322 bits (824),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 151/158 (96%), Positives = 155/158 (98%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVV EGTTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVEGTTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSLVSRASYEN+LKKWIPELQH+APG PVVL GTKLDLREDKHYLADHPG+
Sbjct  78   RGADVFVLAFSLVSRASYENVLKKWIPELQHYAPGVPVVLAGTKLDLREDKHYLADHPGM  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VPVTTAQGEEL+KQIGAAYYIECSSKTQQNVKAVFDAA
Sbjct  138  VPVTTAQGEELQKQIGAAYYIECSSKTQQNVKAVFDAA  175



>gb|AEN71013.1| small GTPase RacA [Gossypium schwendimanii]
Length=211

 Score =   321 bits (823),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 151/158 (96%), Positives = 155/158 (98%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVV EGTTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVEGTTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSLVSRASYEN+LKKWIPELQH+APG PVVLVGTKLDLREDKHYLADHPGL
Sbjct  78   RGADVFVLAFSLVSRASYENVLKKWIPELQHYAPGVPVVLVGTKLDLREDKHYLADHPGL  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            +PV+TAQGEELRKQIGAAYYIECSSKTQQNVKAVFD A
Sbjct  138  LPVSTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDDA  175



>gb|KDP31135.1| hypothetical protein JCGZ_11511 [Jatropha curcas]
Length=216

 Score =   321 bits (823),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 151/158 (96%), Positives = 155/158 (98%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYT+NKFPTDYIPTVFDNFSANVV EGTTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTNNKFPTDYIPTVFDNFSANVVVEGTTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFV+AFSLVSRASYEN+LKKWIPELQH+APG PVVLVGTKLDLREDKHYLADHPGL
Sbjct  78   RGADVFVVAFSLVSRASYENVLKKWIPELQHYAPGVPVVLVGTKLDLREDKHYLADHPGL  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            V VTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA
Sbjct  138  VAVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  175



>gb|AEN71011.1| small GTPase RacA [Gossypium thurberi]
 gb|AEN71012.1| small GTPase RacA [Gossypium laxum]
 gb|AEN71014.1| small GTPase RacA [Gossypium turneri]
 gb|AEN71016.1| small GTPase RacA [Gossypium mustelinum]
 gb|AEN71018.1| small GTPase RacA [Gossypium darwinii]
 gb|AEN71022.1| small GTPase RacA [Gossypium barbadense var. brasiliense]
 gb|AEN71024.1| small GTPase RacA [Gossypium barbadense var. peruvianum]
 gb|AEN71027.1| small GTPase RacA [Gossypium armourianum]
 gb|AEN71028.1| small GTPase RacA [Gossypium harknessii]
 gb|AEN71029.1| small GTPase RacA [Gossypium davidsonii]
 gb|AEN71030.1| small GTPase RacA [Gossypium klotzschianum]
 gb|AEN71031.1| small GTPase RacA [Gossypium aridum]
 gb|AEN71032.1| small GTPase RacA [Gossypium gossypioides]
 gb|AEN71033.1| small GTPase RacA [Gossypium lobatum]
 gb|AEN71034.1| small GTPase RacA [Gossypium trilobum]
 gb|KJB53182.1| hypothetical protein B456_008G297200 [Gossypium raimondii]
Length=211

 Score =   321 bits (823),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 151/158 (96%), Positives = 155/158 (98%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVV EGTTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVEGTTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSLVSRASYEN+LKKWIPELQH+APG PVVLVGTKLDLREDKHYLADHPGL
Sbjct  78   RGADVFVLAFSLVSRASYENVLKKWIPELQHYAPGVPVVLVGTKLDLREDKHYLADHPGL  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            +PV+TAQGEELRKQIGAAYYIECSSKTQQNVKAVFD A
Sbjct  138  LPVSTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDDA  175



>emb|CAD57742.1| RAC-ROP-like G-protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ98596.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=213

 Score =   321 bits (822),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 149/158 (94%), Positives = 155/158 (98%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVA+GTTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVADGTTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSLVSRASYENI+KKWIPELQH+APG PVVLVGTKLDLREDKHYL DHPG+
Sbjct  78   RGADVFVLAFSLVSRASYENIMKKWIPELQHYAPGVPVVLVGTKLDLREDKHYLLDHPGM  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            +PVTTAQGEELRKQ+GA YYIECSSKTQQNVKAVFDAA
Sbjct  138  IPVTTAQGEELRKQVGALYYIECSSKTQQNVKAVFDAA  175



>ref|XP_011071815.1| PREDICTED: rac-like GTP-binding protein 3 isoform X1 [Sesamum 
indicum]
Length=210

 Score =   321 bits (822),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 152/158 (96%), Positives = 154/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVV EGTTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVEGTTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSLVSRASYENI+KKWIPELQHFAPG PVVLVGTKLDLREDK YLADHPGL
Sbjct  78   RGADVFVLAFSLVSRASYENIVKKWIPELQHFAPGIPVVLVGTKLDLREDKRYLADHPGL  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VPVTTAQGEELRK IGA+YYIECSSKTQQNVKAVFDAA
Sbjct  138  VPVTTAQGEELRKHIGASYYIECSSKTQQNVKAVFDAA  175



>gb|ADY68836.1| small GTPase [Gossypium hirsutum]
Length=211

 Score =   321 bits (822),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 152/158 (96%), Positives = 155/158 (98%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVV EGTTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVEGTTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSLVSRASYENILKKWIPELQH+APG PVVLVGTKLDLREDKHYLADHPGL
Sbjct  78   RGADVFVLAFSLVSRASYENILKKWIPELQHYAPGVPVVLVGTKLDLREDKHYLADHPGL  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            +PV+TAQGEEL KQIGAAYYIECSSKTQQNVKAVFDAA
Sbjct  138  LPVSTAQGEELCKQIGAAYYIECSSKTQQNVKAVFDAA  175



>ref|XP_002322155.2| hypothetical protein POPTR_0015s08420g [Populus trichocarpa]
 gb|EEF06282.2| hypothetical protein POPTR_0015s08420g [Populus trichocarpa]
Length=252

 Score =   322 bits (826),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 152/158 (96%), Positives = 154/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANV  EGTTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVAVEGTTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSLVSRASYEN+LKKWIPELQH+APG PVVLVGTKLDLREDKHYLADHPGL
Sbjct  78   RGADVFVLAFSLVSRASYENVLKKWIPELQHYAPGVPVVLVGTKLDLREDKHYLADHPGL  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VPVT AQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA
Sbjct  138  VPVTMAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  175



>gb|ABG66964.1| small GTPase [Gossypium hirsutum]
 gb|ADU04137.1| small GTPase [Gossypium hirsutum]
 gb|ADY68832.1| small GTPase [Gossypium barbadense]
 gb|ADY68834.1| small GTPase [Gossypium herbaceum subsp. africanum]
 gb|AEN71015.1| small GTPase RacA [Gossypium mustelinum]
 gb|AEN71017.1| small GTPase RacA [Gossypium darwinii]
 gb|AEN71019.1| small GTPase RacA [Gossypium tomentosum]
 gb|AEN71021.1| small GTPase RacA [Gossypium barbadense var. brasiliense]
 gb|AEN71023.1| small GTPase RacA [Gossypium barbadense var. peruvianum]
 gb|AEN71025.1| small GTPase RacA [Gossypium hirsutum subsp. latifolium]
Length=211

 Score =   320 bits (821),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 152/158 (96%), Positives = 155/158 (98%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVV EGTTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVEGTTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSLVSRASYENILKKWIPELQH+APG PVVLVGTKLDLREDKHYLADHPGL
Sbjct  78   RGADVFVLAFSLVSRASYENILKKWIPELQHYAPGVPVVLVGTKLDLREDKHYLADHPGL  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            +PV+TAQGEEL KQIGAAYYIECSSKTQQNVKAVFDAA
Sbjct  138  LPVSTAQGEELCKQIGAAYYIECSSKTQQNVKAVFDAA  175



>ref|XP_008793880.1| PREDICTED: rac-like GTP-binding protein RAC1 [Phoenix dactylifera]
Length=222

 Score =   321 bits (822),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 149/158 (94%), Positives = 156/158 (99%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVV +GTTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  34   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVDGTTVNLGLWDTAGQEDYNRLRPLSY  93

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSLVSRASYEN+LKKWIPELQHFAPG PVVLVGTKLDLREDK++L+DHPG+
Sbjct  94   RGADVFVLAFSLVSRASYENVLKKWIPELQHFAPGVPVVLVGTKLDLREDKYFLSDHPGI  153

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            +PVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA
Sbjct  154  IPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  191



>ref|XP_002511439.1| rac gtpase, putative [Ricinus communis]
 gb|EEF52041.1| rac gtpase, putative [Ricinus communis]
Length=211

 Score =   320 bits (820),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 148/158 (94%), Positives = 154/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVV EGTTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVEGTTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSLVSRASYEN+LKKW+PELQH+APG P+VLVGTKLDLREDKHYLADHPGL
Sbjct  78   RGADVFVLAFSLVSRASYENVLKKWVPELQHYAPGVPIVLVGTKLDLREDKHYLADHPGL  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
             PVTT QGEELRKQIGAAYY+ECSSKTQQNVKAVFDA+
Sbjct  138  TPVTTTQGEELRKQIGAAYYVECSSKTQQNVKAVFDAS  175



>ref|XP_006647874.1| PREDICTED: rac-like GTP-binding protein 3-like [Oryza brachyantha]
Length=214

 Score =   320 bits (821),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 149/158 (94%), Positives = 154/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVV + TTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVDSTTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSLVSRASYENI+KKWIPELQH+APG P+VLVGTKLDLREDKHYL DHPGL
Sbjct  78   RGADVFVLAFSLVSRASYENIMKKWIPELQHYAPGVPIVLVGTKLDLREDKHYLLDHPGL  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            +PVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA
Sbjct  138  IPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  175



>ref|XP_008793848.1| PREDICTED: LOW QUALITY PROTEIN: rac-like GTP-binding protein 
3 [Phoenix dactylifera]
Length=230

 Score =   321 bits (822),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 149/158 (94%), Positives = 156/158 (99%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVV +GTTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  34   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVDGTTVNLGLWDTAGQEDYNRLRPLSY  93

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSLVSRASYEN+LKKWIPELQHFAPG PVVLVGTKLDLREDK++L+DHPG+
Sbjct  94   RGADVFVLAFSLVSRASYENVLKKWIPELQHFAPGVPVVLVGTKLDLREDKYFLSDHPGI  153

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            +PVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA
Sbjct  154  IPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  191



>gb|ADY68835.1| small GTPase [Gossypium raimondii]
Length=211

 Score =   320 bits (820),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 150/158 (95%), Positives = 155/158 (98%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYT+NKFPTDYIPTVFDNFSANVV EGTTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTNNKFPTDYIPTVFDNFSANVVVEGTTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSLVSRASYEN+LKKWIPELQH+APG PVVLVGTKLDLREDKHYLADHPGL
Sbjct  78   RGADVFVLAFSLVSRASYENVLKKWIPELQHYAPGVPVVLVGTKLDLREDKHYLADHPGL  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            +PV+TAQGEELRKQIGAAYYIECSSKTQQNVKAVFD A
Sbjct  138  LPVSTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDDA  175



>gb|EYU29925.1| hypothetical protein MIMGU_mgv1a013827mg [Erythranthe guttata]
Length=209

 Score =   320 bits (819),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 151/158 (96%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDY+PTVFDNFSANVV EG TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYVPTVFDNFSANVVVEGITVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RG DVFVLAFSLVSRASYENI KKWIPELQHFAPG PVVLVGTKLDLREDKHYLADHPGL
Sbjct  78   RGGDVFVLAFSLVSRASYENIFKKWIPELQHFAPGIPVVLVGTKLDLREDKHYLADHPGL  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VPVTTAQGEELRK IGAAYYIECSSKTQQNVKAVFDAA
Sbjct  138  VPVTTAQGEELRKHIGAAYYIECSSKTQQNVKAVFDAA  175



>ref|XP_009407248.1| PREDICTED: rac-like GTP-binding protein 3 [Musa acuminata subsp. 
malaccensis]
Length=210

 Score =   320 bits (819),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 151/158 (96%), Positives = 155/158 (98%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEG TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGITVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSLVSRASYEN+LKKWIPEL H+APG PVVLVGTKLDLREDK+YLADHPG+
Sbjct  78   RGADVFVLAFSLVSRASYENVLKKWIPELHHYAPGVPVVLVGTKLDLREDKYYLADHPGV  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA
Sbjct  138  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  175



>gb|ADY68833.1| small GTPase [Gossypium barbadense]
Length=211

 Score =   320 bits (819),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 150/158 (95%), Positives = 154/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVV EGTT NLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVEGTTANLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSLVSRASYEN+LKKWIPELQH+APG PVVLVGTKLDLREDKHYLADHPGL
Sbjct  78   RGADVFVLAFSLVSRASYENVLKKWIPELQHYAPGVPVVLVGTKLDLREDKHYLADHPGL  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            +PV+TAQGEELRKQIGAAYYIECSSKTQQNVKAVFD A
Sbjct  138  LPVSTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDDA  175



>ref|XP_003570667.1| PREDICTED: rac-like GTP-binding protein 3 [Brachypodium distachyon]
Length=214

 Score =   320 bits (819),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 149/158 (94%), Positives = 154/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVA+GTTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVADGTTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSLVSRASYENI+KKWIPELQH+APG PVVLVGTKLDLREDKHYL DHPG+
Sbjct  78   RGADVFVLAFSLVSRASYENIMKKWIPELQHYAPGVPVVLVGTKLDLREDKHYLLDHPGM  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            +PVTT QGEELRKQIGA YYIECSSKTQQNVKAVFDAA
Sbjct  138  IPVTTVQGEELRKQIGALYYIECSSKTQQNVKAVFDAA  175



>ref|XP_002452568.1| hypothetical protein SORBIDRAFT_04g028280 [Sorghum bicolor]
 gb|EES05544.1| hypothetical protein SORBIDRAFT_04g028280 [Sorghum bicolor]
Length=214

 Score =   320 bits (819),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 149/158 (94%), Positives = 154/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVV +GTTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVDGTTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSLVSRASYENI+KKWIPELQH+APG PVVLVGTKLDLREDKHYL DHPGL
Sbjct  78   RGADVFVLAFSLVSRASYENIMKKWIPELQHYAPGVPVVLVGTKLDLREDKHYLMDHPGL  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VPVTTAQGEELR+QIGA YY+ECSSKTQQNVKAVFDAA
Sbjct  138  VPVTTAQGEELRRQIGAMYYVECSSKTQQNVKAVFDAA  175



>ref|XP_010913538.1| PREDICTED: rac-like GTP-binding protein 3 isoform X2 [Elaeis 
guineensis]
Length=202

 Score =   319 bits (817),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 148/158 (94%), Positives = 155/158 (98%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVV +GTTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVDGTTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSLVSRASYEN+LKKWIPELQH+APG PVVLVGTKLDLREDKHYL+DHPG+
Sbjct  78   RGADVFVLAFSLVSRASYENVLKKWIPELQHYAPGVPVVLVGTKLDLREDKHYLSDHPGM  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            +PVTTAQGEELRKQIGAA YIECSSKTQQNVKAVFD+A
Sbjct  138  IPVTTAQGEELRKQIGAANYIECSSKTQQNVKAVFDSA  175



>gb|AAX77218.1| Rac2 [Gossypium hirsutum]
 gb|ADU04142.1| small GTPase [Gossypium hirsutum]
 gb|AEN71020.1| small GTPase RacA [Gossypium tomentosum]
 gb|AEN71026.1| small GTPase RacA [Gossypium hirsutum subsp. latifolium]
Length=211

 Score =   319 bits (818),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 150/158 (95%), Positives = 155/158 (98%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVV EGTTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVEGTTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSLVSRAS+EN+LKKWIPELQH+APG PVVLVGTKLDLREDKHYLADHPGL
Sbjct  78   RGADVFVLAFSLVSRASHENVLKKWIPELQHYAPGVPVVLVGTKLDLREDKHYLADHPGL  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            +PV+TAQGEELRKQIGAAYYIECSSKTQQNVKAVFD A
Sbjct  138  LPVSTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDDA  175



>ref|NP_001104929.1| Rho-related protein from plants 1 [Zea mays]
 gb|AAD34355.1| Rop1 small GTP binding protein [Zea mays]
 gb|ACR37995.1| unknown [Zea mays]
 gb|AFW73358.1| Rop1 small GTP binding protein [Zea mays]
Length=214

 Score =   319 bits (817),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 149/158 (94%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVV +GTTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVDGTTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSLVSRASYENI+KKWIPELQH+APG PVVL GTKLDLREDKHYL DHPGL
Sbjct  78   RGADVFVLAFSLVSRASYENIMKKWIPELQHYAPGVPVVLAGTKLDLREDKHYLMDHPGL  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VPVTTAQGEELR+QIGA YYIECSSKTQQNVKAVFDAA
Sbjct  138  VPVTTAQGEELRRQIGAMYYIECSSKTQQNVKAVFDAA  175



>ref|XP_004501950.1| PREDICTED: rac-like GTP-binding protein ARAC10-like [Cicer arietinum]
Length=211

 Score =   318 bits (816),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 150/158 (95%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVV EG TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVEGITVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSLVSRASYEN+ KKWIPELQHFAPG PVVLVGTKLDLREDKHYLADHPGL
Sbjct  78   RGADVFVLAFSLVSRASYENVFKKWIPELQHFAPGVPVVLVGTKLDLREDKHYLADHPGL  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VPVTT QGEELRKQIGA YYIECSSKTQQNVK VFDAA
Sbjct  138  VPVTTEQGEELRKQIGATYYIECSSKTQQNVKGVFDAA  175



>ref|XP_010913537.1| PREDICTED: rac-like GTP-binding protein 3 isoform X1 [Elaeis 
guineensis]
Length=213

 Score =   318 bits (816),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 148/158 (94%), Positives = 155/158 (98%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVV +GTTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVDGTTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSLVSRASYEN+LKKWIPELQH+APG PVVLVGTKLDLREDKHYL+DHPG+
Sbjct  78   RGADVFVLAFSLVSRASYENVLKKWIPELQHYAPGVPVVLVGTKLDLREDKHYLSDHPGM  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            +PVTTAQGEELRKQIGAA YIECSSKTQQNVKAVFD+A
Sbjct  138  IPVTTAQGEELRKQIGAANYIECSSKTQQNVKAVFDSA  175



>ref|NP_001048088.1| Os02g0742200 [Oryza sativa Japonica Group]
 sp|Q6Z808.1|RAC3_ORYSJ RecName: Full=Rac-like GTP-binding protein 3; AltName: Full=OsRac3 
[Oryza sativa Japonica Group]
 dbj|BAA84494.1| small GTP-binding protein OsRac3 [Oryza sativa]
 dbj|BAD15735.1| small GTP-binding protein OsRac3 [Oryza sativa Japonica Group]
 dbj|BAF10002.1| Os02g0742200 [Oryza sativa Japonica Group]
 gb|EEE57791.1| hypothetical protein OsJ_08342 [Oryza sativa Japonica Group]
Length=214

 Score =   318 bits (815),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 147/158 (93%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVV + TTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVDSTTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSLVSRASYENI+KKWIPELQH+APG P+VLVGTKLDLREDKHYL DHPG+
Sbjct  78   RGADVFVLAFSLVSRASYENIMKKWIPELQHYAPGVPIVLVGTKLDLREDKHYLLDHPGM  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            +PVTTAQGEELRKQIGAAYYIECSSKTQQNVK VFDAA
Sbjct  138  IPVTTAQGEELRKQIGAAYYIECSSKTQQNVKGVFDAA  175



>gb|AFK47680.1| unknown [Lotus japonicus]
Length=211

 Score =   318 bits (815),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 149/158 (94%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVV EG TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVMEGITVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSLVSRASYEN+LKKWIPELQHFAPG PVVLVGTKLDLREDKHYLADHPGL
Sbjct  78   RGADVFVLAFSLVSRASYENVLKKWIPELQHFAPGVPVVLVGTKLDLREDKHYLADHPGL  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VPVT+ QGEELRKQIGA YYIECSSKTQQNVK +FDAA
Sbjct  138  VPVTSEQGEELRKQIGATYYIECSSKTQQNVKGIFDAA  175



>gb|ACC85689.1| ROP small G protein [Medicago truncatula]
 gb|ACJ84142.1| unknown [Medicago truncatula]
 gb|AFK43599.1| unknown [Medicago truncatula]
 gb|KEH35058.1| Rho-like GTP-binding protein [Medicago truncatula]
Length=211

 Score =   318 bits (814),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 148/158 (94%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVV EG TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVEGITVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSLVSRASYEN+ KKWIPELQHFAPG PVVLVGTKLDLRED+HYLADHPG+
Sbjct  78   RGADVFVLAFSLVSRASYENVFKKWIPELQHFAPGVPVVLVGTKLDLREDRHYLADHPGM  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VPVTT QGEELRKQIGA YYIECSSKTQQNVK VFDAA
Sbjct  138  VPVTTEQGEELRKQIGATYYIECSSKTQQNVKGVFDAA  175



>ref|XP_008453112.1| PREDICTED: rac-like GTP-binding protein ARAC8 [Cucumis melo]
Length=210

 Score =   317 bits (813),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 148/158 (94%), Positives = 154/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVV EGTTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVEGTTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSLVSRASYEN+LKKWIPELQH+APG PVVLVGTKLDLREDK YLADHPGL
Sbjct  78   RGADVFILAFSLVSRASYENVLKKWIPELQHYAPGVPVVLVGTKLDLREDKFYLADHPGL  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VPVTT+QGEELRKQIGA YY+ECSSKTQQNVK+VFDAA
Sbjct  138  VPVTTSQGEELRKQIGATYYVECSSKTQQNVKSVFDAA  175



>gb|ADY68837.1| small GTPase [Gossypium hirsutum]
Length=211

 Score =   317 bits (813),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 149/158 (94%), Positives = 155/158 (98%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFD+FSANVV EGTTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYIPTVFDDFSANVVVEGTTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSLVSRAS+EN+LKKWIPELQH+APG PVVLVGTKLDLREDKHYLADHPGL
Sbjct  78   RGADVFVLAFSLVSRASHENVLKKWIPELQHYAPGVPVVLVGTKLDLREDKHYLADHPGL  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            +PV+TAQGEELRKQIGAAYYIECSSKTQQNVKAVFD A
Sbjct  138  LPVSTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDDA  175



>ref|XP_010928578.1| PREDICTED: rac-like GTP-binding protein 3 isoform X2 [Elaeis 
guineensis]
Length=213

 Score =   317 bits (813),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 148/158 (94%), Positives = 156/158 (99%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVV +GTTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVDGTTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSLVSRASYEN+LKKWIPELQH+APG PVVLVGTKLDLREDK++L+DHPG+
Sbjct  78   RGADVFVLAFSLVSRASYENVLKKWIPELQHYAPGVPVVLVGTKLDLREDKYFLSDHPGI  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            +PVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA
Sbjct  138  MPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  175



>ref|XP_006836715.1| hypothetical protein AMTR_s00088p00117460 [Amborella trichopoda]
 gb|ERM99568.1| hypothetical protein AMTR_s00088p00117460 [Amborella trichopoda]
Length=201

 Score =   317 bits (811),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 146/158 (92%), Positives = 155/158 (98%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVV +GTTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVDGTTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFV+AFSLVSRASYEN++KKWIPELQH+APG PVVLVGTKLDLREDK+YL+DHPG+
Sbjct  78   RGADVFVVAFSLVSRASYENVMKKWIPELQHYAPGVPVVLVGTKLDLREDKYYLSDHPGM  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VPVTTAQGEELRKQIG AYYIECSSKTQQNVK+VFDAA
Sbjct  138  VPVTTAQGEELRKQIGVAYYIECSSKTQQNVKSVFDAA  175



>ref|XP_007138106.1| hypothetical protein PHAVU_009G180800g [Phaseolus vulgaris]
 ref|XP_007138107.1| hypothetical protein PHAVU_009G180800g [Phaseolus vulgaris]
 gb|ESW10100.1| hypothetical protein PHAVU_009G180800g [Phaseolus vulgaris]
 gb|ESW10101.1| hypothetical protein PHAVU_009G180800g [Phaseolus vulgaris]
Length=211

 Score =   317 bits (812),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 148/158 (94%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVV EG TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVEGITVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSLVSRASYEN+LKKWIPELQHFAPG P+VLVGTKLDLREDKHY+ADHPGL
Sbjct  78   RGADVFVLAFSLVSRASYENVLKKWIPELQHFAPGIPLVLVGTKLDLREDKHYMADHPGL  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            +PVTT QGEELRKQIGA YYIECSSKTQQNVK VFDAA
Sbjct  138  MPVTTEQGEELRKQIGATYYIECSSKTQQNVKGVFDAA  175



>ref|XP_010254428.1| PREDICTED: rac-like GTP-binding protein 3 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010254436.1| PREDICTED: rac-like GTP-binding protein 3 isoform X1 [Nelumbo 
nucifera]
Length=218

 Score =   317 bits (812),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 152/164 (93%), Positives = 155/164 (95%), Gaps = 6/164 (4%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVV EGTTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVIEGTTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKL------DLREDKHYL  344
            RGADVFVLAFSLVSRASYEN+LKKWIPELQHFAPG PVVL GTKL      DLRED+HYL
Sbjct  78   RGADVFVLAFSLVSRASYENVLKKWIPELQHFAPGVPVVLAGTKLVYNGFSDLREDRHYL  137

Query  345  ADHPGLVPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            ADHPGLVP+TTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA
Sbjct  138  ADHPGLVPITTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  181



>gb|EAY87489.1| hypothetical protein OsI_08896 [Oryza sativa Indica Group]
Length=230

 Score =   317 bits (812),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 147/158 (93%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVV + TTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVDSTTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSLVSRASYENI+KKWIPELQH+APG P+VLVGTKLDLREDKHYL DHPG+
Sbjct  78   RGADVFVLAFSLVSRASYENIMKKWIPELQHYAPGVPIVLVGTKLDLREDKHYLLDHPGM  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            +PVTTAQGEELRKQIGAAYYIECSSKTQQNVK VFDAA
Sbjct  138  IPVTTAQGEELRKQIGAAYYIECSSKTQQNVKGVFDAA  175



>ref|XP_006577771.1| PREDICTED: uncharacterized protein LOC100499774 isoform X1 [Glycine 
max]
Length=212

 Score =   316 bits (810),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 148/158 (94%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVV EG TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  19   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVEGITVNLGLWDTAGQEDYNRLRPLSY  78

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSLVSRASYEN+LKKWIPELQHFAPG P+VLVGTKLDLRED+HY+ADHPGL
Sbjct  79   RGADVFVLAFSLVSRASYENVLKKWIPELQHFAPGIPLVLVGTKLDLREDRHYMADHPGL  138

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VPVTT QGEELRK IGA YYIECSSKTQQNVKAVFDAA
Sbjct  139  VPVTTEQGEELRKHIGATYYIECSSKTQQNVKAVFDAA  176



>ref|XP_004138120.1| PREDICTED: rac-like GTP-binding protein 3-like [Cucumis sativus]
 ref|XP_004170175.1| PREDICTED: rac-like GTP-binding protein 3-like [Cucumis sativus]
 gb|KGN63600.1| hypothetical protein Csa_1G005610 [Cucumis sativus]
Length=210

 Score =   316 bits (810),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 148/158 (94%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVV EGTTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVEGTTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSLVSRASYEN+LKKWIPELQH+APG PVVLVGTKLDLREDK YLADHPGL
Sbjct  78   RGADVFILAFSLVSRASYENVLKKWIPELQHYAPGVPVVLVGTKLDLREDKFYLADHPGL  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VPVTT QGEELRKQIGA YY+ECSSKTQQNVK+VFDAA
Sbjct  138  VPVTTLQGEELRKQIGATYYVECSSKTQQNVKSVFDAA  175



>ref|NP_001105063.1| GTPase protein [Zea mays]
 gb|AAK53059.1|AF376054_1 putative Rop family GTPase ROP8 [Zea mays]
 gb|ACR38124.1| unknown [Zea mays]
 gb|AFW64509.1| hypothetical protein ZEAMMB73_073883 [Zea mays]
Length=214

 Score =   316 bits (810),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 148/158 (94%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVV +GTTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVDGTTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSLVSRASYENI+KKWIPELQH+A G PVVLVGTK DLREDKHYL DHPGL
Sbjct  78   RGADVFVLAFSLVSRASYENIMKKWIPELQHYARGVPVVLVGTKFDLREDKHYLMDHPGL  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VPVTTAQGEELR+QIGA YYIECSSKTQQNVKAVFDAA
Sbjct  138  VPVTTAQGEELRRQIGAMYYIECSSKTQQNVKAVFDAA  175



>ref|XP_010459411.1| PREDICTED: rac-like GTP-binding protein ARAC10 [Camelina sativa]
 ref|XP_010444142.1| PREDICTED: rac-like GTP-binding protein ARAC10 [Camelina sativa]
Length=215

 Score =   316 bits (810),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 148/158 (94%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVV EGTTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVEGTTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVL+FSLVSRASYEN+ KKWIPELQHFAPG P+VLVGTKLDLREDKHYLADHPGL
Sbjct  78   RGADVFVLSFSLVSRASYENVFKKWIPELQHFAPGVPLVLVGTKLDLREDKHYLADHPGL  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
             PVTTAQGEELRK IGA YYIECSSKTQQNVKAVFD+A
Sbjct  138  SPVTTAQGEELRKLIGATYYIECSSKTQQNVKAVFDSA  175



>ref|XP_004953886.1| PREDICTED: rac-like GTP-binding protein 3-like [Setaria italica]
Length=214

 Score =   316 bits (810),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 147/158 (93%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVV + TTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVDSTTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSLVSRASYENI+KKWIPELQH+APG P+VL GTKLDLREDKHYL DHPGL
Sbjct  78   RGADVFVLAFSLVSRASYENIMKKWIPELQHYAPGVPIVLAGTKLDLREDKHYLMDHPGL  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VPVTTAQGEELR+QIGA YYIECSSKTQQNVKAVFDAA
Sbjct  138  VPVTTAQGEELRRQIGAMYYIECSSKTQQNVKAVFDAA  175



>ref|NP_201093.1| Rac-like GTP-binding protein ARAC10 [Arabidopsis thaliana]
 ref|XP_002864823.1| hypothetical protein ARALYDRAFT_496470 [Arabidopsis lyrata subsp. 
lyrata]
 sp|O82481.1|RAC10_ARATH RecName: Full=Rac-like GTP-binding protein ARAC10; AltName: Full=GTPase 
protein ROP11 [Arabidopsis thaliana]
 gb|AAF40238.1|AF115467_1 Arac10 [Arabidopsis thaliana]
 gb|AAC63014.1| rac GTP binding protein Arac10 [Arabidopsis thaliana]
 dbj|BAB10857.1| rac GTP binding protein Arac10 [Arabidopsis thaliana]
 gb|AAO22805.1| putative GTP binding protein Arac10 [Arabidopsis thaliana]
 gb|AAO42453.1| putative GTP binding protein Arac10 [Arabidopsis thaliana]
 dbj|BAD44656.1| Arac10 [Arabidopsis thaliana]
 gb|EFH41082.1| hypothetical protein ARALYDRAFT_496470 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AED97667.1| Rac-like GTP-binding protein ARAC10 [Arabidopsis thaliana]
Length=215

 Score =   316 bits (810),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 148/158 (94%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVV EGTTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVEGTTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVL+FSLVSRASYEN+ KKWIPELQHFAPG P+VLVGTKLDLREDKHYLADHPGL
Sbjct  78   RGADVFVLSFSLVSRASYENVFKKWIPELQHFAPGVPLVLVGTKLDLREDKHYLADHPGL  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
             PVTTAQGEELRK IGA YYIECSSKTQQNVKAVFD+A
Sbjct  138  SPVTTAQGEELRKLIGATYYIECSSKTQQNVKAVFDSA  175



>ref|XP_006394342.1| hypothetical protein EUTSA_v10004903mg [Eutrema salsugineum]
 gb|ESQ31628.1| hypothetical protein EUTSA_v10004903mg [Eutrema salsugineum]
Length=215

 Score =   316 bits (810),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 148/158 (94%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVV EGTTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVEGTTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVL+FSLVSRASYEN+ KKWIPELQHFAPG P+VLVGTKLDLREDKHYLADHPGL
Sbjct  78   RGADVFVLSFSLVSRASYENVFKKWIPELQHFAPGVPLVLVGTKLDLREDKHYLADHPGL  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
             PVTTAQGEELRK IGA YYIECSSKTQQNVKAVFD+A
Sbjct  138  SPVTTAQGEELRKLIGATYYIECSSKTQQNVKAVFDSA  175



>ref|XP_006281091.1| hypothetical protein CARUB_v10027121mg [Capsella rubella]
 gb|EOA13989.1| hypothetical protein CARUB_v10027121mg [Capsella rubella]
Length=215

 Score =   316 bits (810),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 148/158 (94%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVV EGTTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVEGTTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVL+FSLVSRASYEN+ KKWIPELQHFAPG P+VLVGTKLDLREDKHYLADHPGL
Sbjct  78   RGADVFVLSFSLVSRASYENVFKKWIPELQHFAPGVPLVLVGTKLDLREDKHYLADHPGL  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
             PVTTAQGEELRK IGA YYIECSSKTQQNVKAVFD+A
Sbjct  138  SPVTTAQGEELRKLIGATYYIECSSKTQQNVKAVFDSA  175



>gb|KHN48613.1| Rac-like GTP-binding protein 3 [Glycine soja]
Length=225

 Score =   316 bits (810),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 147/158 (93%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVV EGTTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVEGTTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSLVS ASYEN+LKKW+PELQHFAPG PVVLVGTKLDLREDKHYLADHPGL
Sbjct  78   RGADVFVLAFSLVSHASYENVLKKWVPELQHFAPGIPVVLVGTKLDLREDKHYLADHPGL  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VPVT+ QGEELRK +GA YYIECSSKTQQNVK+VFDAA
Sbjct  138  VPVTSEQGEELRKLVGATYYIECSSKTQQNVKSVFDAA  175



>ref|XP_009112040.1| PREDICTED: rac-like GTP-binding protein ARAC10 isoform X2 [Brassica 
rapa]
Length=213

 Score =   316 bits (809),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 147/158 (93%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDY+PTVFDNFSANVV EGTTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  26   AVGKTCMLICYTSNKFPTDYVPTVFDNFSANVVVEGTTVNLGLWDTAGQEDYNRLRPLSY  85

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVL+FSLVSRASYEN+ KKWIPELQHFAPG P+VLVGTKLDLREDKHYLADHPGL
Sbjct  86   RGADVFVLSFSLVSRASYENVFKKWIPELQHFAPGVPLVLVGTKLDLREDKHYLADHPGL  145

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
             PVTTAQGEELRK IGA YYIECSSKTQQNVKAVFD+A
Sbjct  146  SPVTTAQGEELRKLIGATYYIECSSKTQQNVKAVFDSA  183



>ref|XP_009151409.1| PREDICTED: rac-like GTP-binding protein ARAC10 [Brassica rapa]
Length=224

 Score =   316 bits (810),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 147/158 (93%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPT FDNFSANVV EGTTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  27   AVGKTCMLICYTSNKFPTDYIPTAFDNFSANVVVEGTTVNLGLWDTAGQEDYNRLRPLSY  86

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVL+FSLVSRASYEN+ KKWIPELQHFAPG P+VLVGTKLDLREDKHYLADHPGL
Sbjct  87   RGADVFVLSFSLVSRASYENVFKKWIPELQHFAPGVPLVLVGTKLDLREDKHYLADHPGL  146

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
             PVTTAQGEELRK IGA YYIECSSKTQQNVKAVFD+A
Sbjct  147  SPVTTAQGEELRKLIGATYYIECSSKTQQNVKAVFDSA  184



>ref|XP_009130238.1| PREDICTED: rac-like GTP-binding protein ARAC10 isoform X1 [Brassica 
rapa]
 emb|CDY30738.1| BnaA02g33600D [Brassica napus]
Length=215

 Score =   316 bits (809),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 147/158 (93%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVV EGTTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVEGTTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVL+FSLVSRASYEN+ KKWIPELQHFAPG P+VLVGTKLDLRED+HYLADHPGL
Sbjct  78   RGADVFVLSFSLVSRASYENVFKKWIPELQHFAPGVPLVLVGTKLDLREDRHYLADHPGL  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
             PVTTAQGEELRK IGA YYIECSSKTQQNVKAVFD+A
Sbjct  138  SPVTTAQGEELRKLIGATYYIECSSKTQQNVKAVFDSA  175



>gb|ADW83711.1| Rho-like protein 1 [Zea mays]
Length=214

 Score =   316 bits (809),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 147/158 (93%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVV +GTTVNLGLWDTAGQE YNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVDGTTVNLGLWDTAGQEGYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSLVSRASYENI+KKWIPELQH+APG PVVL GTKLDLREDKHYL DHPG+
Sbjct  78   RGADVFVLAFSLVSRASYENIMKKWIPELQHYAPGVPVVLAGTKLDLREDKHYLMDHPGM  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VPVTTAQGEELR+QIGA YYIECSSKTQQNVKAVFDAA
Sbjct  138  VPVTTAQGEELRRQIGAMYYIECSSKTQQNVKAVFDAA  175



>ref|XP_009130239.1| PREDICTED: rac-like GTP-binding protein ARAC10 isoform X2 [Brassica 
rapa]
Length=214

 Score =   316 bits (809),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 147/158 (93%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVV EGTTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVEGTTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVL+FSLVSRASYEN+ KKWIPELQHFAPG P+VLVGTKLDLRED+HYLADHPGL
Sbjct  78   RGADVFVLSFSLVSRASYENVFKKWIPELQHFAPGVPLVLVGTKLDLREDRHYLADHPGL  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
             PVTTAQGEELRK IGA YYIECSSKTQQNVKAVFD+A
Sbjct  138  SPVTTAQGEELRKLIGATYYIECSSKTQQNVKAVFDSA  175



>ref|XP_009391245.1| PREDICTED: rac-like GTP-binding protein 3 [Musa acuminata subsp. 
malaccensis]
Length=214

 Score =   315 bits (808),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 145/158 (92%), Positives = 155/158 (98%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDY+PTVFDNFSANVV +GTTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYVPTVFDNFSANVVVDGTTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSLVSRASYEN++KKWIPELQH+APG P++LVGTKLDLREDKHYLADHPG+
Sbjct  78   RGADVFVLAFSLVSRASYENVVKKWIPELQHYAPGVPLLLVGTKLDLREDKHYLADHPGI  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
             PVTTAQGEELRK+IGAAYY+ECSSKTQQNVKAVFDAA
Sbjct  138  FPVTTAQGEELRKKIGAAYYVECSSKTQQNVKAVFDAA  175



>emb|CDY56740.1| BnaC09g50900D [Brassica napus]
Length=216

 Score =   315 bits (808),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 147/158 (93%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDY+PTVFDNFSANVV EGTTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYVPTVFDNFSANVVVEGTTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVL+FSLVSRASYEN+ KKWIPELQHFAPG P+VLVGTKLDLREDKHYLADHPGL
Sbjct  78   RGADVFVLSFSLVSRASYENVFKKWIPELQHFAPGVPLVLVGTKLDLREDKHYLADHPGL  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
             PVTTAQGEELRK IGA YYIECSSKTQQNVKAVFD+A
Sbjct  138  SPVTTAQGEELRKLIGATYYIECSSKTQQNVKAVFDSA  175



>ref|XP_010678714.1| PREDICTED: rac-like GTP-binding protein 3 [Beta vulgaris subsp. 
vulgaris]
Length=211

 Score =   315 bits (807),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 145/158 (92%), Positives = 154/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVV E TTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVESTTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RG DVFVLAFSLVSRASYEN+LKKW+PELQH+APG P+VLVGTKLDLREDKHYLADHPG+
Sbjct  78   RGGDVFVLAFSLVSRASYENVLKKWVPELQHYAPGIPMVLVGTKLDLREDKHYLADHPGV  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VPVTTA+GEELRKQ+GA+YYIECSSKTQQNVKAVFD+A
Sbjct  138  VPVTTAEGEELRKQVGASYYIECSSKTQQNVKAVFDSA  175



>gb|KCW83424.1| hypothetical protein EUGRSUZ_B00349 [Eucalyptus grandis]
Length=204

 Score =   315 bits (807),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 147/158 (93%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVV EG TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVEGITVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSLVSRASYEN+LKKWIPELQH APG P+VLVGTK+DLR+DKHY+ADHPGL
Sbjct  78   RGADVFVLAFSLVSRASYENVLKKWIPELQHHAPGIPLVLVGTKMDLRDDKHYMADHPGL  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VPVTTAQGEE+RKQIGA YYIECSSKTQQNVKAVFDAA
Sbjct  138  VPVTTAQGEEMRKQIGAMYYIECSSKTQQNVKAVFDAA  175



>emb|CDY45748.1| BnaC02g42340D [Brassica napus]
Length=213

 Score =   315 bits (807),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 147/158 (93%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVV EGTTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  15   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVEGTTVNLGLWDTAGQEDYNRLRPLSY  74

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVL+FSLVSRASYEN+ KKWIPELQHFAPG P+VLVGTKLDLRED+HYLADHPGL
Sbjct  75   RGADVFVLSFSLVSRASYENVFKKWIPELQHFAPGVPLVLVGTKLDLREDRHYLADHPGL  134

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
             PVTTAQGEELRK IGA YYIECSSKTQQNVKAVFD+A
Sbjct  135  SPVTTAQGEELRKLIGATYYIECSSKTQQNVKAVFDSA  172



>ref|XP_009112039.1| PREDICTED: rac-like GTP-binding protein ARAC10 isoform X1 [Brassica 
rapa]
Length=224

 Score =   316 bits (809),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 147/158 (93%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDY+PTVFDNFSANVV EGTTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  26   AVGKTCMLICYTSNKFPTDYVPTVFDNFSANVVVEGTTVNLGLWDTAGQEDYNRLRPLSY  85

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVL+FSLVSRASYEN+ KKWIPELQHFAPG P+VLVGTKLDLREDKHYLADHPGL
Sbjct  86   RGADVFVLSFSLVSRASYENVFKKWIPELQHFAPGVPLVLVGTKLDLREDKHYLADHPGL  145

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
             PVTTAQGEELRK IGA YYIECSSKTQQNVKAVFD+A
Sbjct  146  SPVTTAQGEELRKLIGATYYIECSSKTQQNVKAVFDSA  183



>ref|XP_010503427.1| PREDICTED: rac-like GTP-binding protein ARAC8 isoform X2 [Camelina 
sativa]
 ref|XP_010426275.1| PREDICTED: rac-like GTP-binding protein ARAC8 [Camelina sativa]
Length=208

 Score =   315 bits (807),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 145/158 (92%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVV EG TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVEGITVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSL+SRASYEN+ KKWIPELQHFAPG P+VLVGTK+DLREDKHYL+DHPGL
Sbjct  78   RGADVFVLAFSLISRASYENVFKKWIPELQHFAPGVPIVLVGTKMDLREDKHYLSDHPGL  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
             PVTT+QGEELRK IGA YYIECSSKTQQNVKAVFDAA
Sbjct  138  SPVTTSQGEELRKHIGATYYIECSSKTQQNVKAVFDAA  175



>gb|ADW83710.1| Rho-like protein 1 [Zea mays]
Length=214

 Score =   315 bits (807),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 148/158 (94%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVV +GTTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVDGTTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSLVSRASYENI+KKWIPELQH+APG PVVL GTKLDLREDK YL DHPGL
Sbjct  78   RGADVFVLAFSLVSRASYENIMKKWIPELQHYAPGVPVVLAGTKLDLREDKLYLMDHPGL  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VPVTTAQGEELR+QIGA YYIECSSKTQQNVKAVFDAA
Sbjct  138  VPVTTAQGEELRRQIGAMYYIECSSKTQQNVKAVFDAA  175



>gb|KHN19324.1| Rac-like GTP-binding protein ARAC8 [Glycine soja]
Length=212

 Score =   315 bits (807),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 148/158 (94%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVV EG TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  19   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVEGITVNLGLWDTAGQEDYNRLRPLSY  78

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSLVSRASYEN+LKKWIPELQHFAPG P+VLVGTKLDLREDKHY+ADHP L
Sbjct  79   RGADVFVLAFSLVSRASYENVLKKWIPELQHFAPGIPLVLVGTKLDLREDKHYMADHPSL  138

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VPVTT QGEELRK IGA YYIECSSKTQQNVKAVFDAA
Sbjct  139  VPVTTDQGEELRKHIGATYYIECSSKTQQNVKAVFDAA  176



>dbj|BAD42977.1| Arac10 [Arabidopsis thaliana]
Length=215

 Score =   315 bits (806),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 147/158 (93%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVV EGTTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVEGTTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVL+FSLVSR SYEN+ KKWIPELQHFAPG P+VLVGTKLDLREDKHYLADHPGL
Sbjct  78   RGADVFVLSFSLVSRVSYENVFKKWIPELQHFAPGVPLVLVGTKLDLREDKHYLADHPGL  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
             PVTTAQGEELRK IGA YYIECSSKTQQNVKAVFD+A
Sbjct  138  SPVTTAQGEELRKLIGATYYIECSSKTQQNVKAVFDSA  175



>ref|XP_010028070.1| PREDICTED: rac-like GTP-binding protein ARAC8 [Eucalyptus grandis]
 gb|KCW83423.1| hypothetical protein EUGRSUZ_B00349 [Eucalyptus grandis]
Length=212

 Score =   314 bits (805),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 147/158 (93%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVV EG TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVEGITVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSLVSRASYEN+LKKWIPELQH APG P+VLVGTK+DLR+DKHY+ADHPGL
Sbjct  78   RGADVFVLAFSLVSRASYENVLKKWIPELQHHAPGIPLVLVGTKMDLRDDKHYMADHPGL  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VPVTTAQGEE+RKQIGA YYIECSSKTQQNVKAVFDAA
Sbjct  138  VPVTTAQGEEMRKQIGAMYYIECSSKTQQNVKAVFDAA  175



>emb|CDY00332.1| BnaA06g22330D [Brassica napus]
Length=215

 Score =   314 bits (805),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 147/158 (93%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSN FPTDYIPTVFDNFSANVV EGTTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNIFPTDYIPTVFDNFSANVVVEGTTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVL+FSLVSRASYEN+ KKWIPELQHFAPG P+VLVGTKLDLREDKHYLADHPGL
Sbjct  78   RGADVFVLSFSLVSRASYENVFKKWIPELQHFAPGVPLVLVGTKLDLREDKHYLADHPGL  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
             PVTTAQGEELRK IGA YYIECSSKTQQNVKAVFD+A
Sbjct  138  SPVTTAQGEELRKLIGATYYIECSSKTQQNVKAVFDSA  175



>gb|ACM68952.1| ROP3, partial [Eriobotrya japonica]
Length=196

 Score =   313 bits (802),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 147/155 (95%), Positives = 151/155 (97%), Gaps = 0/155 (0%)
 Frame = +3

Query  12   KTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSYRGA  191
            KTCMLICYTSNKFPTDYIPTVFDNFSANVV EGTTVNLGLWDTAGQEDYNRLRPLSYRGA
Sbjct  1    KTCMLICYTSNKFPTDYIPTVFDNFSANVVVEGTTVNLGLWDTAGQEDYNRLRPLSYRGA  60

Query  192  DVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGLVPV  371
            DVFVLAFSLVSRASYEN+LKKWIPELQH+APG PVVL GTKLDLREDKHY ADHPGLVPV
Sbjct  61   DVFVLAFSLVSRASYENVLKKWIPELQHYAPGVPVVLAGTKLDLREDKHYSADHPGLVPV  120

Query  372  TTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            TTAQGEELRKQIGA++YIECSSKTQQNVKAVFDAA
Sbjct  121  TTAQGEELRKQIGASFYIECSSKTQQNVKAVFDAA  155



>ref|XP_010515117.1| PREDICTED: rac-like GTP-binding protein ARAC8 isoform X2 [Camelina 
sativa]
Length=208

 Score =   313 bits (803),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 144/158 (91%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVV EG TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVEGITVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSL+S+ASYEN+ KKWIPELQHFAPG P+VLVGTK+DLREDKHYL+DHPGL
Sbjct  78   RGADVFVLAFSLISQASYENVFKKWIPELQHFAPGVPIVLVGTKMDLREDKHYLSDHPGL  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
             PVTT+QGEELRK IGA YYIECSSKTQQNVKAVFDAA
Sbjct  138  SPVTTSQGEELRKHIGATYYIECSSKTQQNVKAVFDAA  175



>ref|XP_009379967.1| PREDICTED: rac-like GTP-binding protein 3 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=201

 Score =   313 bits (802),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 143/158 (91%), Positives = 154/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTC+LICYTSN FPTDY+PTVFDNFSANV+AEG TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCLLICYTSNTFPTDYVPTVFDNFSANVIAEGRTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSLVSRASYEN+LKKW+PELQH+APG PVVLVGTKLDLRE+KHYLADHPG+
Sbjct  78   RGADVFVLAFSLVSRASYENVLKKWMPELQHYAPGVPVVLVGTKLDLRENKHYLADHPGM  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            +PVTT QGEELRKQIGAAYY+ECSS+TQQNVKAVFDAA
Sbjct  138  LPVTTVQGEELRKQIGAAYYVECSSRTQQNVKAVFDAA  175



>gb|KFK28015.1| hypothetical protein AALP_AA8G460400 [Arabis alpina]
Length=215

 Score =   313 bits (802),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 147/158 (93%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVV EGTTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVEGTTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVL+FSLVSRASYEN+ KKWIPELQHFAPG P+VLVGTKLDLREDKHYLADHPGL
Sbjct  78   RGADVFVLSFSLVSRASYENVFKKWIPELQHFAPGVPLVLVGTKLDLREDKHYLADHPGL  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
             PVTTAQGEELRK IGA YYIECSSKTQ NVKAVFD+A
Sbjct  138  SPVTTAQGEELRKLIGATYYIECSSKTQLNVKAVFDSA  175



>ref|XP_002875876.1| hypothetical protein ARALYDRAFT_485165 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52135.1| hypothetical protein ARALYDRAFT_485165 [Arabidopsis lyrata subsp. 
lyrata]
Length=209

 Score =   313 bits (802),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 145/158 (92%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVV EG TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVEGITVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSL+SRASYEN+ KKWIPELQHFAPG P+VLVGTK+DLREDKHYL+D PGL
Sbjct  78   RGADVFVLAFSLISRASYENVFKKWIPELQHFAPGVPIVLVGTKMDLREDKHYLSDQPGL  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
             PVTT+QGEELRK IGAAYYIECSSKTQQNVKAVFDAA
Sbjct  138  SPVTTSQGEELRKHIGAAYYIECSSKTQQNVKAVFDAA  175



>gb|EPS61580.1| hypothetical protein M569_13212, partial [Genlisea aurea]
Length=194

 Score =   312 bits (800),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 145/158 (92%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDY+PTVFDNFSANVV E TTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  15   AVGKTCMLICYTSNKFPTDYVPTVFDNFSANVVVENTTVNLGLWDTAGQEDYNRLRPLSY  74

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSLVSRASYEN+LKKWIPELQH+APG P+VL GTKLDLRED+HYL+DHPGL
Sbjct  75   RGADVFVLAFSLVSRASYENVLKKWIPELQHYAPGIPIVLAGTKLDLREDRHYLSDHPGL  134

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
             PVTTAQGEEL KQIG AYYIECSSKTQQNVKAVFDAA
Sbjct  135  TPVTTAQGEELCKQIGGAYYIECSSKTQQNVKAVFDAA  172



>ref|XP_009379959.1| PREDICTED: rac-like GTP-binding protein 3 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=213

 Score =   313 bits (801),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 143/158 (91%), Positives = 154/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTC+LICYTSN FPTDY+PTVFDNFSANV+AEG TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCLLICYTSNTFPTDYVPTVFDNFSANVIAEGRTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSLVSRASYEN+LKKW+PELQH+APG PVVLVGTKLDLRE+KHYLADHPG+
Sbjct  78   RGADVFVLAFSLVSRASYENVLKKWMPELQHYAPGVPVVLVGTKLDLRENKHYLADHPGM  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            +PVTT QGEELRKQIGAAYY+ECSS+TQQNVKAVFDAA
Sbjct  138  LPVTTVQGEELRKQIGAAYYVECSSRTQQNVKAVFDAA  175



>emb|CAB41135.1| rac GTP binding protein Arac8 [Arabidopsis thaliana]
Length=201

 Score =   312 bits (799),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 143/158 (91%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFS NVV EG TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYIPTVFDNFSVNVVVEGITVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSL+SRASYEN+ KKWIPELQHFAPG P+VLVGTK+DLRED+HYL+DHPGL
Sbjct  78   RGADVFVLAFSLISRASYENVFKKWIPELQHFAPGVPIVLVGTKMDLREDRHYLSDHPGL  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
             PVTT+QGEELRK IGA YYIECSSKTQQNVKAVFDAA
Sbjct  138  SPVTTSQGEELRKHIGATYYIECSSKTQQNVKAVFDAA  175



>ref|NP_566897.1| Rac-like GTP-binding protein ARAC8 [Arabidopsis thaliana]
 sp|Q9SU67.2|RAC8_ARATH RecName: Full=Rac-like GTP-binding protein ARAC8; AltName: Full=GTPase 
protein ROP10 [Arabidopsis thaliana]
 gb|AAF40247.1|AF115475_1 Arac8 [Arabidopsis thaliana]
 gb|AAC63015.1| rac GTP binding protein Arac8 [Arabidopsis thaliana]
 dbj|BAC41995.1| putative rac GTP binding protein Arac8 [Arabidopsis thaliana]
 gb|AAO63292.1| At3g48040 [Arabidopsis thaliana]
 gb|AEE78359.1| Rac-like GTP-binding protein ARAC8 [Arabidopsis thaliana]
Length=208

 Score =   312 bits (800),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 143/158 (91%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFS NVV EG TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYIPTVFDNFSVNVVVEGITVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSL+SRASYEN+ KKWIPELQHFAPG P+VLVGTK+DLRED+HYL+DHPGL
Sbjct  78   RGADVFVLAFSLISRASYENVFKKWIPELQHFAPGVPIVLVGTKMDLREDRHYLSDHPGL  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
             PVTT+QGEELRK IGA YYIECSSKTQQNVKAVFDAA
Sbjct  138  SPVTTSQGEELRKHIGATYYIECSSKTQQNVKAVFDAA  175



>gb|AAF43923.1|AF239751_1 Rac-like protein Rop1 [Tradescantia virginiana]
Length=212

 Score =   312 bits (799),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 144/158 (91%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVG+TCMLICYTSNKFPTDY+PTVFDNFSANV+ E TTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGETCMLICYTSNKFPTDYVPTVFDNFSANVIVENTTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSLVSRASYEN+LKKWIPELQH+APG P+VLVGTKLDLREDK YLADHPGL
Sbjct  78   RGADVFVLAFSLVSRASYENVLKKWIPELQHYAPGVPLVLVGTKLDLREDKQYLADHPGL  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            + V+TAQGEELRKQIGAAYY+ECSSKTQQNVKAVFDAA
Sbjct  138  MSVSTAQGEELRKQIGAAYYVECSSKTQQNVKAVFDAA  175



>ref|NP_001235733.1| uncharacterized protein LOC100527158 [Glycine max]
 gb|ACU16208.1| unknown [Glycine max]
Length=212

 Score =   311 bits (798),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 146/158 (92%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVV EG TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  19   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVEGITVNLGLWDTAGQEDYNRLRPLSY  78

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSLVSRASYEN+LKKWIPELQHFAPG P+VLVGTK DLREDKHY+ADHP L
Sbjct  79   RGADVFVLAFSLVSRASYENVLKKWIPELQHFAPGIPLVLVGTKSDLREDKHYMADHPSL  138

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VPVTT QGEELRK IGA YYIECSSKTQQN+KAVFDAA
Sbjct  139  VPVTTDQGEELRKHIGATYYIECSSKTQQNMKAVFDAA  176



>ref|NP_001241937.1| uncharacterized protein LOC100791566 [Glycine max]
 gb|ACU20468.1| unknown [Glycine max]
Length=205

 Score =   311 bits (797),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 145/158 (92%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVV E TTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVENTTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSLVS ASYEN+LKKW+PELQHFAPG PVVLVGTKLDLREDKHYLADHPGL
Sbjct  78   RGADVFVLAFSLVSHASYENVLKKWVPELQHFAPGVPVVLVGTKLDLREDKHYLADHPGL  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
             PVT+ QGEELRK +GA YYIECSSKTQQNVK+VFDAA
Sbjct  138  APVTSEQGEELRKLVGATYYIECSSKTQQNVKSVFDAA  175



>gb|KHN18479.1| Rac-like GTP-binding protein 3 [Glycine soja]
Length=226

 Score =   312 bits (799),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 145/158 (92%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVV E TTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVENTTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSLVS ASYEN+LKKW+PELQHFAPG PVVLVGTKLDLREDKHYLADHPGL
Sbjct  78   RGADVFVLAFSLVSHASYENVLKKWVPELQHFAPGVPVVLVGTKLDLREDKHYLADHPGL  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
             PVT+ QGEELRK +GA YYIECSSKTQQNVK+VFDAA
Sbjct  138  APVTSEQGEELRKLVGATYYIECSSKTQQNVKSVFDAA  175



>ref|XP_006655950.1| PREDICTED: rac-like GTP-binding protein 4-like [Oryza brachyantha]
Length=215

 Score =   311 bits (796),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 144/158 (91%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVV +GTTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVDGTTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSLVSRASYEN++KKW+PELQH+APG P+VLVGTKLDLREDKHYL DHP L
Sbjct  78   RGADVFVLAFSLVSRASYENVMKKWLPELQHYAPGVPIVLVGTKLDLREDKHYLLDHPSL  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VPVTTAQGEELRK IGA +YIECSSKTQQNVK VFDAA
Sbjct  138  VPVTTAQGEELRKHIGATFYIECSSKTQQNVKNVFDAA  175



>ref|XP_006600181.1| PREDICTED: uncharacterized protein LOC100791566 isoform X1 [Glycine 
max]
Length=270

 Score =   313 bits (801),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 145/158 (92%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVV E TTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  62   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVENTTVNLGLWDTAGQEDYNRLRPLSY  121

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSLVS ASYEN+LKKW+PELQHFAPG PVVLVGTKLDLREDKHYLADHPGL
Sbjct  122  RGADVFVLAFSLVSHASYENVLKKWVPELQHFAPGVPVVLVGTKLDLREDKHYLADHPGL  181

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
             PVT+ QGEELRK +GA YYIECSSKTQQNVK+VFDAA
Sbjct  182  APVTSEQGEELRKLVGATYYIECSSKTQQNVKSVFDAA  219



>gb|KDO69734.1| hypothetical protein CISIN_1g028362mg [Citrus sinensis]
Length=168

 Score =   308 bits (790),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 144/149 (97%), Positives = 148/149 (99%), Gaps = 0/149 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSLVSRASYEN+LKKWIPELQH++PG PVVLVGTKLDLREDKHYLADHPGL
Sbjct  78   RGADVFVLAFSLVSRASYENVLKKWIPELQHYSPGVPVVLVGTKLDLREDKHYLADHPGL  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQ  449
            VPVTTAQGEELRKQIGA+YYIECSSKTQQ
Sbjct  138  VPVTTAQGEELRKQIGASYYIECSSKTQQ  166



>ref|NP_001057236.1| Os06g0234200 [Oryza sativa Japonica Group]
 sp|Q67VP4.1|RAC4_ORYSJ RecName: Full=Rac-like GTP-binding protein 4; AltName: Full=GTPase 
protein ROP4; AltName: Full=OsRac4 [Oryza sativa Japonica 
Group]
 gb|AAK55445.1|AF380335_1 putative Rop family GTPase ROP4 [Oryza sativa]
 dbj|BAD37775.1| putative small GTP-binding protein OsRac3 [Oryza sativa Japonica 
Group]
 dbj|BAD37916.1| putative small GTP-binding protein OsRac3 [Oryza sativa Japonica 
Group]
 dbj|BAF19150.1| Os06g0234200 [Oryza sativa Japonica Group]
 dbj|BAG87727.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC80288.1| hypothetical protein OsI_22291 [Oryza sativa Indica Group]
 gb|EEE65396.1| hypothetical protein OsJ_20720 [Oryza sativa Japonica Group]
 gb|ADK25938.1| ROP [Musa acuminata AAA Group]
Length=215

 Score =   310 bits (794),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 144/158 (91%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDY+PTVFDNFSANVV +GTTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYVPTVFDNFSANVVVDGTTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSLVSRASYEN++KKW+PELQH+APG P+VLVGTKLDLREDKHYL DHP L
Sbjct  78   RGADVFVLAFSLVSRASYENVMKKWLPELQHYAPGVPIVLVGTKLDLREDKHYLLDHPSL  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VPVTTAQGEELRK IGA  YIECSSKTQQNVKAVFDAA
Sbjct  138  VPVTTAQGEELRKHIGATCYIECSSKTQQNVKAVFDAA  175



>ref|XP_006600182.1| PREDICTED: uncharacterized protein LOC100791566 isoform X2 [Glycine 
max]
Length=254

 Score =   311 bits (798),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 145/158 (92%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVV E TTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  62   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVENTTVNLGLWDTAGQEDYNRLRPLSY  121

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSLVS ASYEN+LKKW+PELQHFAPG PVVLVGTKLDLREDKHYLADHPGL
Sbjct  122  RGADVFVLAFSLVSHASYENVLKKWVPELQHFAPGVPVVLVGTKLDLREDKHYLADHPGL  181

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
             PVT+ QGEELRK +GA YYIECSSKTQQNVK+VFDAA
Sbjct  182  APVTSEQGEELRKLVGATYYIECSSKTQQNVKSVFDAA  219



>ref|NP_001167695.1| rac-like GTP-binding protein 4 [Zea mays]
 gb|ACG42308.1| rac-like GTP-binding protein 4 [Zea mays]
Length=215

 Score =   310 bits (794),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 144/158 (91%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVV +GTTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVDGTTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSLVSRASYEN++KKW+PELQH+APG P+VL GTKLDLREDKHYL DHPG 
Sbjct  78   RGADVFVLAFSLVSRASYENVMKKWLPELQHYAPGVPIVLAGTKLDLREDKHYLVDHPGA  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VPVTTAQGEELRK IGA  YIECSSKTQQNVKAVFDAA
Sbjct  138  VPVTTAQGEELRKHIGATCYIECSSKTQQNVKAVFDAA  175



>ref|XP_010928577.1| PREDICTED: rac-like GTP-binding protein 3 isoform X1 [Elaeis 
guineensis]
Length=221

 Score =   310 bits (794),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 148/166 (89%), Positives = 156/166 (94%), Gaps = 8/166 (5%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVV +GTTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVDGTTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSLVSRASYEN+LKKWIPELQH+APG PVVLVGTKLDLREDK++L+DHPG+
Sbjct  78   RGADVFVLAFSLVSRASYENVLKKWIPELQHYAPGVPVVLVGTKLDLREDKYFLSDHPGI  137

Query  363  VPVTTAQ--------GEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            +PVTTAQ        GEELRKQIGAAYYIECSSKTQQNVKAVFDAA
Sbjct  138  MPVTTAQVSYRLHCEGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  183



>ref|XP_006291853.1| hypothetical protein CARUB_v10018028mg [Capsella rubella]
 gb|EOA24751.1| hypothetical protein CARUB_v10018028mg [Capsella rubella]
Length=208

 Score =   309 bits (792),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 143/158 (91%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEG TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGITVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSL+SRASYEN+ KKWIPELQ F PG P+VLVGTK+DLREDKHYL+DHPGL
Sbjct  78   RGADVFVLAFSLISRASYENVFKKWIPELQRFTPGVPIVLVGTKMDLREDKHYLSDHPGL  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
             PVTT+QGEELRK IGA YYIECSSKTQQ+VKAVFDAA
Sbjct  138  SPVTTSQGEELRKHIGATYYIECSSKTQQSVKAVFDAA  175



>ref|XP_002436763.1| hypothetical protein SORBIDRAFT_10g008380 [Sorghum bicolor]
 gb|EER88130.1| hypothetical protein SORBIDRAFT_10g008380 [Sorghum bicolor]
Length=215

 Score =   310 bits (793),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 144/158 (91%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVV +GTTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVDGTTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSLVSRASYEN++KKW+PELQH+APG P+VL GTKLDLREDKHYL DHPG 
Sbjct  78   RGADVFVLAFSLVSRASYENVMKKWLPELQHYAPGVPIVLAGTKLDLREDKHYLLDHPGA  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VPVTTAQGEELRK IGA  YIECSSKTQQNVKAVFDAA
Sbjct  138  VPVTTAQGEELRKHIGATCYIECSSKTQQNVKAVFDAA  175



>ref|NP_001105737.1| Rho-related protein from plants 5 [Zea mays]
 emb|CAB96794.1| putative Rop family GTPase ROP5 [Zea mays]
 gb|AFW85214.1| rop family GTPase ROP5 isoform 1 [Zea mays]
 gb|AFW85215.1| rop family GTPase ROP5 isoform 2 [Zea mays]
Length=215

 Score =   309 bits (791),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 143/158 (91%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVV +GTTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVDGTTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSLVSRASYEN++KKW+PELQH+APG P+VL GTKLDLRED+HYL DHPG 
Sbjct  78   RGADVFVLAFSLVSRASYENVMKKWLPELQHYAPGVPIVLAGTKLDLREDRHYLVDHPGA  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VPVTTAQGEELRK IGA  YIECSSKTQQNVKAVFDAA
Sbjct  138  VPVTTAQGEELRKHIGATCYIECSSKTQQNVKAVFDAA  175



>ref|XP_010503426.1| PREDICTED: rac-like GTP-binding protein ARAC8 isoform X1 [Camelina 
sativa]
Length=213

 Score =   309 bits (791),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 145/163 (89%), Positives = 151/163 (93%), Gaps = 5/163 (3%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVV EG TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVEGITVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKL-----DLREDKHYLA  347
            RGADVFVLAFSL+SRASYEN+ KKWIPELQHFAPG P+VLVGTK+     DLREDKHYL+
Sbjct  78   RGADVFVLAFSLISRASYENVFKKWIPELQHFAPGVPIVLVGTKMVFRYIDLREDKHYLS  137

Query  348  DHPGLVPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            DHPGL PVTT+QGEELRK IGA YYIECSSKTQQNVKAVFDAA
Sbjct  138  DHPGLSPVTTSQGEELRKHIGATYYIECSSKTQQNVKAVFDAA  180



>gb|KJB53189.1| hypothetical protein B456_008G297200 [Gossypium raimondii]
Length=167

 Score =   306 bits (785),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 143/149 (96%), Positives = 147/149 (99%), Gaps = 0/149 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVV EGTTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVEGTTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSLVSRASYEN+LKKWIPELQH+APG PVVLVGTKLDLREDKHYLADHPGL
Sbjct  78   RGADVFVLAFSLVSRASYENVLKKWIPELQHYAPGVPVVLVGTKLDLREDKHYLADHPGL  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQ  449
            +PV+TAQGEELRKQIGAAYYIECSSKTQQ
Sbjct  138  LPVSTAQGEELRKQIGAAYYIECSSKTQQ  166



>ref|XP_004965072.1| PREDICTED: rac-like GTP-binding protein 4-like [Setaria italica]
Length=215

 Score =   307 bits (787),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 143/158 (91%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVV +GTTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVDGTTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSLVSRASYEN++KKW+PELQH+APG P+VL GTKLD REDKHYL DHPG 
Sbjct  78   RGADVFVLAFSLVSRASYENVMKKWLPELQHYAPGVPIVLAGTKLDCREDKHYLLDHPGA  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VPVTTAQGEELRK IGA  YIECSSKTQQNVKAVFDAA
Sbjct  138  VPVTTAQGEELRKHIGATCYIECSSKTQQNVKAVFDAA  175



>ref|XP_009601105.1| PREDICTED: rac-like GTP-binding protein 3 isoform X2 [Nicotiana 
tomentosiformis]
Length=199

 Score =   307 bits (786),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 144/151 (95%), Positives = 147/151 (97%), Gaps = 0/151 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDY+PTVFDNFSANVV EGTTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYVPTVFDNFSANVVVEGTTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSLVSRASYENILKKWIPELQH+APG PVVL GTKLDLREDKH+LADHPGL
Sbjct  78   RGADVFVLAFSLVSRASYENILKKWIPELQHYAPGIPVVLAGTKLDLREDKHFLADHPGL  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNV  455
            VPVTTAQGEELRKQIGAAYYIECSSKTQQ V
Sbjct  138  VPVTTAQGEELRKQIGAAYYIECSSKTQQVV  168



>ref|XP_008659034.1| PREDICTED: rho-related protein from plants 5 isoform X1 [Zea 
mays]
Length=301

 Score =   310 bits (795),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 143/158 (91%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVV +GTTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  104  AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVDGTTVNLGLWDTAGQEDYNRLRPLSY  163

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSLVSRASYEN++KKW+PELQH+APG P+VL GTKLDLRED+HYL DHPG 
Sbjct  164  RGADVFVLAFSLVSRASYENVMKKWLPELQHYAPGVPIVLAGTKLDLREDRHYLVDHPGA  223

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VPVTTAQGEELRK IGA  YIECSSKTQQNVKAVFDAA
Sbjct  224  VPVTTAQGEELRKHIGATCYIECSSKTQQNVKAVFDAA  261



>ref|XP_009786169.1| PREDICTED: rac-like GTP-binding protein 3 isoform X2 [Nicotiana 
sylvestris]
Length=199

 Score =   306 bits (784),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 143/151 (95%), Positives = 147/151 (97%), Gaps = 0/151 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDY+PTVFDNFSANVV EGTTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYVPTVFDNFSANVVVEGTTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSLVSRASYENILKKWIPELQH+APG PVVL GTKLDLREDKH+LADHPGL
Sbjct  78   RGADVFVLAFSLVSRASYENILKKWIPELQHYAPGIPVVLAGTKLDLREDKHFLADHPGL  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNV  455
            +PVTTAQGEELRKQIGAAYYIECSSKTQQ V
Sbjct  138  IPVTTAQGEELRKQIGAAYYIECSSKTQQVV  168



>ref|XP_010515115.1| PREDICTED: rac-like GTP-binding protein ARAC8 isoform X1 [Camelina 
sativa]
Length=213

 Score =   307 bits (786),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 144/163 (88%), Positives = 151/163 (93%), Gaps = 5/163 (3%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVV EG TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVEGITVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKL-----DLREDKHYLA  347
            RGADVFVLAFSL+S+ASYEN+ KKWIPELQHFAPG P+VLVGTK+     DLREDKHYL+
Sbjct  78   RGADVFVLAFSLISQASYENVFKKWIPELQHFAPGVPIVLVGTKMVFRYIDLREDKHYLS  137

Query  348  DHPGLVPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            DHPGL PVTT+QGEELRK IGA YYIECSSKTQQNVKAVFDAA
Sbjct  138  DHPGLSPVTTSQGEELRKHIGATYYIECSSKTQQNVKAVFDAA  180



>emb|CAD27896.1| putative ROP4 protein [Hordeum vulgare subsp. vulgare]
Length=213

 Score =   306 bits (783),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 141/158 (89%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDY+PTVFDNFSANVV +GTTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYVPTVFDNFSANVVVDGTTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVL+FSLVSRASYEN++KKW+PELQH APG P VLVGTKLDLREDK YL DHPG+
Sbjct  78   RGADVFVLSFSLVSRASYENVMKKWLPELQHHAPGVPTVLVGTKLDLREDKQYLLDHPGV  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VPVTTAQGEELRK IGA  Y+ECSSKTQQNVKAVFDAA
Sbjct  138  VPVTTAQGEELRKHIGATCYVECSSKTQQNVKAVFDAA  175



>dbj|BAJ90768.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=213

 Score =   305 bits (782),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 140/158 (89%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDY+PTVFDNFSANVV +GTTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYVPTVFDNFSANVVVDGTTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGAD+FVL+FSLVSRASYEN++KKW+PELQH APG P VLVGTKLDLREDK YL DHPG+
Sbjct  78   RGADIFVLSFSLVSRASYENVMKKWLPELQHHAPGVPTVLVGTKLDLREDKQYLLDHPGV  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VPVTTAQGEELRK IGA  Y+ECSSKTQQNVKAVFDAA
Sbjct  138  VPVTTAQGEELRKHIGATCYVECSSKTQQNVKAVFDAA  175



>ref|XP_011071817.1| PREDICTED: rac-like GTP-binding protein ARAC10 isoform X3 [Sesamum 
indicum]
Length=180

 Score =   304 bits (779),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 143/149 (96%), Positives = 145/149 (97%), Gaps = 0/149 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVV EGTTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVEGTTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSLVSRASYENI+KKWIPELQHFAPG PVVLVGTKLDLREDK YLADHPGL
Sbjct  78   RGADVFVLAFSLVSRASYENIVKKWIPELQHFAPGIPVVLVGTKLDLREDKRYLADHPGL  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQ  449
            VPVTTAQGEELRK IGA+YYIECSSKTQQ
Sbjct  138  VPVTTAQGEELRKHIGASYYIECSSKTQQ  166



>ref|XP_011071816.1| PREDICTED: rac-like GTP-binding protein ARAC10 isoform X2 [Sesamum 
indicum]
Length=194

 Score =   305 bits (780),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 143/149 (96%), Positives = 145/149 (97%), Gaps = 0/149 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVV EGTTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVEGTTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSLVSRASYENI+KKWIPELQHFAPG PVVLVGTKLDLREDK YLADHPGL
Sbjct  78   RGADVFVLAFSLVSRASYENIVKKWIPELQHFAPGIPVVLVGTKLDLREDKRYLADHPGL  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQ  449
            VPVTTAQGEELRK IGA+YYIECSSKTQQ
Sbjct  138  VPVTTAQGEELRKHIGASYYIECSSKTQQ  166



>ref|XP_007155397.1| hypothetical protein PHAVU_003G197900g [Phaseolus vulgaris]
 gb|ESW27391.1| hypothetical protein PHAVU_003G197900g [Phaseolus vulgaris]
Length=210

 Score =   304 bits (778),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 142/158 (90%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKT MLICYTSNKFPTDYIPTVFDNFSANVV EGTTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTSMLICYTSNKFPTDYIPTVFDNFSANVVVEGTTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSLVS ASYEN+LKKW+PELQHFAPG PVVLVGTKLDLREDK+YLA+HPG+
Sbjct  78   RGADVFVLAFSLVSHASYENVLKKWVPELQHFAPGIPVVLVGTKLDLREDKYYLAEHPGM  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            V VT+ QGEELRK +GA YYIECSSKTQQNVK+VFDAA
Sbjct  138  VAVTSEQGEELRKLVGATYYIECSSKTQQNVKSVFDAA  175



>gb|AFW73359.1| hypothetical protein ZEAMMB73_875041 [Zea mays]
Length=451

 Score =   311 bits (798),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 149/169 (88%), Positives = 153/169 (91%), Gaps = 11/169 (7%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVV +GTTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVDGTTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSLVSRASYENI+KKWIPELQH+APG PVVL GTKLDLREDKHYL DHPGL
Sbjct  78   RGADVFVLAFSLVSRASYENIMKKWIPELQHYAPGVPVVLAGTKLDLREDKHYLMDHPGL  137

Query  363  VPVTTA-----------QGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VPVTTA           QGEELR+QIGA YYIECSSKTQQNVKAVFDAA
Sbjct  138  VPVTTAQNFGDPAICTFQGEELRRQIGAMYYIECSSKTQQNVKAVFDAA  186



>gb|AFW85216.1| hypothetical protein ZEAMMB73_830829 [Zea mays]
Length=172

 Score =   301 bits (772),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 139/155 (90%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVV +GTTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVDGTTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSLVSRASYEN++KKW+PELQH+APG P+VL GTKLDLRED+HYL DHPG 
Sbjct  78   RGADVFVLAFSLVSRASYENVMKKWLPELQHYAPGVPIVLAGTKLDLREDRHYLVDHPGA  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVF  467
            VPVTTAQGEELRK IGA  YIECSSKTQQNVKAV 
Sbjct  138  VPVTTAQGEELRKHIGATCYIECSSKTQQNVKAVM  172



>gb|KHN16311.1| Rac-like GTP-binding protein ARAC8 [Glycine soja]
Length=188

 Score =   302 bits (773),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 141/152 (93%), Positives = 145/152 (95%), Gaps = 0/152 (0%)
 Frame = +3

Query  21   MLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSYRGADVF  200
            MLICYTSNKFPTDYIPTVFDNFSANVV EG TVNLGLWDTAGQEDYNRLRPLSYRGADVF
Sbjct  1    MLICYTSNKFPTDYIPTVFDNFSANVVVEGITVNLGLWDTAGQEDYNRLRPLSYRGADVF  60

Query  201  VLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGLVPVTTA  380
            VLAFSLVSRASYEN+LKKWIPELQHFAPG P+VLVGTKLDLRED+HY+ADHP LVPVTT 
Sbjct  61   VLAFSLVSRASYENVLKKWIPELQHFAPGIPLVLVGTKLDLREDRHYMADHPALVPVTTE  120

Query  381  QGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            QGEELRK IGA YYIECSSKTQQNVKAVFDAA
Sbjct  121  QGEELRKHIGATYYIECSSKTQQNVKAVFDAA  152



>gb|ADD23345.1| putative small GTP-binding protein [Triticum aestivum]
Length=213

 Score =   302 bits (773),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 140/158 (89%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDY+PTVFDNFSANVV +GTTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYVPTVFDNFSANVVVDGTTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSLVSRASYENI+KKW+PELQH AP  P+VLVGTK DLREDK YL DHPG+
Sbjct  78   RGADVFVLAFSLVSRASYENIMKKWLPELQHHAPSVPIVLVGTKYDLREDKQYLLDHPGV  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VPVT AQGEELRK IGA  Y+ECSSKTQQNVKAVFDAA
Sbjct  138  VPVTAAQGEELRKHIGATCYVECSSKTQQNVKAVFDAA  175



>gb|KJB53186.1| hypothetical protein B456_008G297200 [Gossypium raimondii]
Length=205

 Score =   301 bits (772),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 145/158 (92%), Positives = 149/158 (94%), Gaps = 6/158 (4%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVV EGTTVNLG      QEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVEGTTVNLG------QEDYNRLRPLSY  71

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSLVSRASYEN+LKKWIPELQH+APG PVVLVGTKLDLREDKHYLADHPGL
Sbjct  72   RGADVFVLAFSLVSRASYENVLKKWIPELQHYAPGVPVVLVGTKLDLREDKHYLADHPGL  131

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            +PV+TAQGEELRKQIGAAYYIECSSKTQQNVKAVFD A
Sbjct  132  LPVSTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDDA  169



>ref|XP_006281090.1| hypothetical protein CARUB_v10027121mg [Capsella rubella]
 gb|EOA13988.1| hypothetical protein CARUB_v10027121mg [Capsella rubella]
Length=172

 Score =   300 bits (768),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 140/149 (94%), Positives = 143/149 (96%), Gaps = 0/149 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVV EGTTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVEGTTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVL+FSLVSRASYEN+ KKWIPELQHFAPG P+VLVGTKLDLREDKHYLADHPGL
Sbjct  78   RGADVFVLSFSLVSRASYENVFKKWIPELQHFAPGVPLVLVGTKLDLREDKHYLADHPGL  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQ  449
             PVTTAQGEELRK IGA YYIECSSKTQQ
Sbjct  138  SPVTTAQGEELRKLIGATYYIECSSKTQQ  166



>gb|KJB53185.1| hypothetical protein B456_008G297200 [Gossypium raimondii]
Length=205

 Score =   300 bits (769),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 145/158 (92%), Positives = 149/158 (94%), Gaps = 6/158 (4%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVV EGTTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVEGTTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSLVSRASYEN+LKK      H+APG PVVLVGTKLDLREDKHYLADHPGL
Sbjct  78   RGADVFVLAFSLVSRASYENVLKK------HYAPGVPVVLVGTKLDLREDKHYLADHPGL  131

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            +PV+TAQGEELRKQIGAAYYIECSSKTQQNVKAVFD A
Sbjct  132  LPVSTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDDA  169



>ref|XP_008677774.1| PREDICTED: GTPase protein isoform X1 [Zea mays]
Length=174

 Score =   298 bits (764),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 139/149 (93%), Positives = 143/149 (96%), Gaps = 0/149 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVV +GTTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVDGTTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSLVSRASYENI+KKWIPELQH+A G PVVLVGTK DLREDKHYL DHPGL
Sbjct  78   RGADVFVLAFSLVSRASYENIMKKWIPELQHYARGVPVVLVGTKFDLREDKHYLMDHPGL  137

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQ  449
            VPVTTAQGEELR+QIGA YYIECSSKTQQ
Sbjct  138  VPVTTAQGEELRRQIGAMYYIECSSKTQQ  166



>ref|XP_007036139.1| RHO-related protein from plants 10 isoform 1 [Theobroma cacao]
 gb|EOY20640.1| RHO-related protein from plants 10 isoform 1 [Theobroma cacao]
Length=248

 Score =   300 bits (769),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 152/196 (78%), Positives = 156/196 (80%), Gaps = 38/196 (19%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAG------------  146
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVV EGTTVNLGLWDTAG            
Sbjct  18   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVEGTTVNLGLWDTAGINSTSSFILHFL  77

Query  147  -----------QEDYNRLRPLSYRGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTP  293
                       QEDYNRLRPLSYRGADVFVLAFSLVSRASYEN+LKKWIPELQH+APG P
Sbjct  78   KTVLKGVSFYRQEDYNRLRPLSYRGADVFVLAFSLVSRASYENVLKKWIPELQHYAPGVP  137

Query  294  VVLVGTKL---------------DLREDKHYLADHPGLVPVTTAQGEELRKQIGAAYYIE  428
            VVLVGTKL               DLREDKHYLADHPGL+PV+TAQGEELRKQIGAAYYIE
Sbjct  138  VVLVGTKLGALLNWDSNDPCPSKDLREDKHYLADHPGLLPVSTAQGEELRKQIGAAYYIE  197

Query  429  CSSKTQQNVKAVFDAA  476
            CSSKTQQNVKAVFDAA
Sbjct  198  CSSKTQQNVKAVFDAA  213



>sp|O04369.1|RAC1_LOTJA RecName: Full=Rac-like GTP-binding protein RAC1; Flags: Precursor 
[Lotus japonicus]
 emb|CAA98189.1| RAC1 [Lotus japonicus]
Length=197

 Score =   296 bits (758),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 135/158 (85%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTC+LI YTSN FPTDY+PTVFDNFSANVV +G+TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL+S+ASYENI KKWIPEL+H+APG P++LVGTKLDLR+DKH+LADHPG 
Sbjct  76   RGADVFILAFSLISKASYENIAKKWIPELRHYAPGVPIILVGTKLDLRDDKHFLADHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VP+TTAQGEELRK IGA  YIECSSKTQQNVKAVFDAA
Sbjct  136  VPITTAQGEELRKLIGAPAYIECSSKTQQNVKAVFDAA  173



>gb|AFK47488.1| unknown [Lotus japonicus]
Length=197

 Score =   296 bits (757),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 135/158 (85%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTC+LI YTSN FPTDY+PTVFDNFSANVV +G+TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL+S+ASYENI KKWIPEL+H+APG P++LVGTKLDLR+DKH+LADHPG 
Sbjct  76   RGADVFILAFSLISKASYENIAKKWIPELRHYAPGVPIILVGTKLDLRDDKHFLADHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VP+TTAQGEELRK IGA  YIECSSKTQQNVKAVFDAA
Sbjct  136  VPITTAQGEELRKLIGAPAYIECSSKTQQNVKAVFDAA  173



>ref|XP_008778044.1| PREDICTED: rac-like GTP-binding protein RAC2 isoform X2 [Phoenix 
dactylifera]
Length=196

 Score =   295 bits (756),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 135/158 (85%), Positives = 148/158 (94%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSN FPTDY+PTVFDNFSANVVA+G+TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCMLICYTSNTFPTDYVPTVFDNFSANVVADGSTVNLGLWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL+SRASYENI +KWIPEL+H+AP  P+VLVGTKLDLR+DK +L DHPG 
Sbjct  76   RGADVFLLAFSLISRASYENIYRKWIPELRHYAPNVPIVLVGTKLDLRDDKQFLIDHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
             P+TTAQGEEL+K IGAA YIECSSKTQQNVKAVFDAA
Sbjct  136  APITTAQGEELKKMIGAAVYIECSSKTQQNVKAVFDAA  173



>gb|ABK22108.1| unknown [Picea sitchensis]
Length=198

 Score =   295 bits (756),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 135/158 (85%), Positives = 148/158 (94%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLI YTSN FPTDY+PTVFDNFSANVV +GT+VNLGLWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGTSVNLGLWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL+SRASYEN+ KKWIPEL+H+APG P++LVGTKLDLREDK + ADHPG 
Sbjct  76   RGADVFILAFSLISRASYENVSKKWIPELRHYAPGVPIILVGTKLDLREDKQFYADHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            +PVTT QGEELRKQIGAA YIECSSKTQQN+KAVFDAA
Sbjct  136  LPVTTDQGEELRKQIGAAVYIECSSKTQQNIKAVFDAA  173



>ref|XP_004147042.1| PREDICTED: rac-like GTP-binding protein RAC1-like [Cucumis sativus]
 ref|XP_004158373.1| PREDICTED: rac-like GTP-binding protein RAC1-like [Cucumis sativus]
 ref|XP_008457691.1| PREDICTED: rac-like GTP-binding protein RAC1 [Cucumis melo]
 ref|XP_008457692.1| PREDICTED: rac-like GTP-binding protein RAC1 [Cucumis melo]
 gb|KGN61933.1| Rac-type small GTP-binding protein [Cucumis sativus]
Length=198

 Score =   295 bits (756),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 136/158 (86%), Positives = 148/158 (94%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLI YTSN FPTDY+PTVFDNFSANVV +G+TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL+SRASYEN+ KKWIPEL+H+APG PV+LVGTKLDLREDK YL +HPG+
Sbjct  76   RGADVFLLAFSLISRASYENVAKKWIPELRHYAPGVPVILVGTKLDLREDKQYLNEHPGI  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VP+TTAQGEELRK IGA  YIECSSKTQQNVKAVFDAA
Sbjct  136  VPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAA  173



>ref|XP_006600183.1| PREDICTED: uncharacterized protein LOC100791566 isoform X3 [Glycine 
max]
Length=217

 Score =   296 bits (757),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 137/149 (92%), Positives = 141/149 (95%), Gaps = 0/149 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVV E TTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  62   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVENTTVNLGLWDTAGQEDYNRLRPLSY  121

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSLVS ASYEN+LKKW+PELQHFAPG PVVLVGTKLDLREDKHYLADHPGL
Sbjct  122  RGADVFVLAFSLVSHASYENVLKKWVPELQHFAPGVPVVLVGTKLDLREDKHYLADHPGL  181

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQ  449
             PVT+ QGEELRK +GA YYIECSSKTQQ
Sbjct  182  APVTSEQGEELRKLVGATYYIECSSKTQQ  210



>ref|XP_006422604.1| hypothetical protein CICLE_v10029311mg [Citrus clementina]
 ref|XP_006486745.1| PREDICTED: rac-like GTP-binding protein ARAC3-like [Citrus sinensis]
 gb|ESR35844.1| hypothetical protein CICLE_v10029311mg [Citrus clementina]
 gb|KDO68062.1| hypothetical protein CISIN_1g029144mg [Citrus sinensis]
Length=198

 Score =   293 bits (750),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 148/158 (94%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLI YTSN FPTDY+PTVFDNFSANVV +G+TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL+S+ASYEN+ KKWIPEL+H+APG P++LVGTKLDLR+DK +LADHPG 
Sbjct  76   RGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFLADHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VP+TTAQGEELRK IGA  YIECSSKTQQNVKAVFDAA
Sbjct  136  VPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAA  173



>ref|XP_007136004.1| hypothetical protein PHAVU_009G009800g [Phaseolus vulgaris]
 gb|ESW07998.1| hypothetical protein PHAVU_009G009800g [Phaseolus vulgaris]
Length=197

 Score =   293 bits (749),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 148/158 (94%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTC+LI YTSN FPTDY+PTVFDNFSANVV +G+TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL+S+ASYENI KKWIPEL+H+APG P++LVGTKLDLR+DKH+L DHPG 
Sbjct  76   RGADVFILAFSLISKASYENIAKKWIPELRHYAPGVPIILVGTKLDLRDDKHFLVDHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VP++TAQGEELRK IGA  YIECSSKTQQNVKAVFDAA
Sbjct  136  VPISTAQGEELRKLIGAPAYIECSSKTQQNVKAVFDAA  173



>ref|XP_006404303.1| hypothetical protein EUTSA_v10010729mg [Eutrema salsugineum]
 gb|ESQ45756.1| hypothetical protein EUTSA_v10010729mg [Eutrema salsugineum]
Length=204

 Score =   293 bits (749),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 140/158 (89%), Positives = 145/158 (92%), Gaps = 5/158 (3%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVV EG TV+LGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVEGITVSLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSLVSRASYEN+ KKWIPELQHFAPG PVVLVGTK+ L     YL+DHPGL
Sbjct  78   RGADVFVLAFSLVSRASYENVFKKWIPELQHFAPGVPVVLVGTKMAL-----YLSDHPGL  132

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
             PVTT+QGEELRK IGA YYIECSSKTQQNVKAVFDAA
Sbjct  133  SPVTTSQGEELRKHIGATYYIECSSKTQQNVKAVFDAA  170



>ref|XP_002982092.1| Rop2, RHO family GTPase [Selaginella moellendorffii]
 ref|XP_002994630.1| Rop2, RHO family GTPase [Selaginella moellendorffii]
 gb|EFJ04304.1| Rop2, RHO family GTPase [Selaginella moellendorffii]
 gb|EFJ16760.1| Rop2, RHO family GTPase [Selaginella moellendorffii]
Length=196

 Score =   292 bits (748),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 135/158 (85%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLI YTSN FPTDY+PTVFDNFSANVV +G TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL+SRASYENI KKWIPEL+H+AP  PV+LVGTKLDLR+DK + ADHPG 
Sbjct  76   RGADVFLLAFSLISRASYENISKKWIPELKHYAPTVPVILVGTKLDLRDDKQFFADHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
             P+TT QGEELRKQIGAA YIECSSKTQQNVKAVFDAA
Sbjct  136  TPITTVQGEELRKQIGAAAYIECSSKTQQNVKAVFDAA  173



>gb|AGL44365.1| Rop2 [Hevea brasiliensis]
Length=197

 Score =   292 bits (748),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLI YTSN FPTDY+PTVFDNFSANVV +G+TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL+S+ASYEN+ KKWIPEL+H+APG PV+LVGTKLDLREDK +  DHPG 
Sbjct  76   RGADVFILAFSLISKASYENVAKKWIPELRHYAPGVPVILVGTKLDLREDKQFFIDHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VP+TTAQGEELRK IGA  YIECSSKTQQNVKAVFDAA
Sbjct  136  VPITTAQGEELRKLIGAPAYIECSSKTQQNVKAVFDAA  173



>ref|XP_010904883.1| PREDICTED: rac-like GTP-binding protein RAC13 [Elaeis guineensis]
Length=197

 Score =   291 bits (746),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSN FPTDY+PTVFDNFSANVV +G+TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  17   AVGKTCMLICYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSY  76

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL+S+ASYENI KKWIPEL+H+AP  P+VLVGTKLDLR+DK +L DHPG 
Sbjct  77   RGADVFLLAFSLISKASYENIYKKWIPELRHYAPNVPIVLVGTKLDLRDDKQFLIDHPGA  136

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
             P+TTAQGEEL++ IGAA YIECSSKTQQNVKAVFDAA
Sbjct  137  TPITTAQGEELKRMIGAAGYIECSSKTQQNVKAVFDAA  174



>ref|XP_003540385.1| PREDICTED: rac-like GTP-binding protein RAC2-like isoform X1 
[Glycine max]
 ref|XP_006592858.1| PREDICTED: rac-like GTP-binding protein RAC2-like isoform X2 
[Glycine max]
 gb|KHN27920.1| Rac-like GTP-binding protein RAC2 [Glycine soja]
Length=196

 Score =   291 bits (746),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 135/158 (85%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLI YTSN FPTDY+PTVFDNFSANVV +G+TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL+SRASYENI KKWIPEL+H+AP  P+VLVGTKLDLRED+ YL DHPG 
Sbjct  76   RGADVFLLAFSLLSRASYENISKKWIPELRHYAPTVPIVLVGTKLDLREDRQYLIDHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
             P+TTAQGEEL+K IGAA YIECSSKTQQNVKAVFDAA
Sbjct  136  TPITTAQGEELKKAIGAAVYIECSSKTQQNVKAVFDAA  173



>gb|KCW55525.1| hypothetical protein EUGRSUZ_I01414 [Eucalyptus grandis]
Length=229

 Score =   293 bits (749),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLI YTSN FPTDY+PTVFDNFSANVV +G+TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL+S+ASYEN+ KKWIPEL+H+APG P++LVGTKLDLR+DK +  DHPG 
Sbjct  76   RGADVFLLAFSLISKASYENVAKKWIPELRHYAPGIPIILVGTKLDLRDDKQFFLDHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VP+TTAQGEEL+K IGAA YIECSSKTQQNVKAVFDAA
Sbjct  136  VPITTAQGEELKKLIGAAAYIECSSKTQQNVKAVFDAA  173



>ref|XP_009406225.1| PREDICTED: rac-like GTP-binding protein 2 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=210

 Score =   292 bits (747),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 135/158 (85%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANV  +G+ VNLGLWDTAGQEDY+RLRPLSY
Sbjct  16   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVSVDGSIVNLGLWDTAGQEDYSRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGAD+FVLAFSL+SRASYEN+LKKW+PEL+ FAP  P+VLVGTKLDLREDK YLADHPG 
Sbjct  76   RGADIFVLAFSLISRASYENVLKKWMPELRRFAPNVPIVLVGTKLDLREDKGYLADHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
              +T AQGEELRKQIGAA YIECSSKTQQNVKAVFD A
Sbjct  136  TTITPAQGEELRKQIGAAAYIECSSKTQQNVKAVFDTA  173



>ref|XP_003540880.1| PREDICTED: rac-like GTP-binding protein RAC1-like [Glycine max]
 gb|KHN25471.1| Rac-like GTP-binding protein RAC1 [Glycine soja]
Length=197

 Score =   291 bits (745),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLI YTSN FPTDY+PTVFDNFSANVV +G+TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL+SRASYEN+ KKWIPEL+H+APG P++LVGTKLDLR+DK +  DHPG 
Sbjct  76   RGADVFLLAFSLISRASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFFQDHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VP+TTAQGEELRK IGA  YIECSSKTQQNVKAVFDAA
Sbjct  136  VPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAA  173



>ref|XP_002530817.1| rac gtpase, putative [Ricinus communis]
 gb|EEF31557.1| rac gtpase, putative [Ricinus communis]
Length=198

 Score =   291 bits (745),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLI YTSN FPTDY+PTVFDNFSANVV +G+TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL+S+ASYEN+ KKWIPEL+H+APG P++LVGTKLDLR+DK +L DHPG 
Sbjct  76   RGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFLIDHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VP+TTAQGEELRK IGA  YIECSSKTQQNVKAVFDAA
Sbjct  136  VPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAA  173



>gb|KHN39876.1| Rac-like GTP-binding protein RAC1 [Glycine soja]
Length=197

 Score =   291 bits (745),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLI YTSN FPTDY+PTVFDNFSANVV +G+TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL+SRASYEN+ KKWIPEL+H+APG P++LVGTKLDLR+DK +  DHPG 
Sbjct  76   RGADVFLLAFSLISRASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFFQDHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VP+TTAQGEELRK IGA  YIECSSKTQQNVKAVFDAA
Sbjct  136  VPITTAQGEELRKLIGAPIYIECSSKTQQNVKAVFDAA  173



>ref|XP_007136003.1| hypothetical protein PHAVU_009G009700g [Phaseolus vulgaris]
 gb|ESW07997.1| hypothetical protein PHAVU_009G009700g [Phaseolus vulgaris]
Length=197

 Score =   291 bits (745),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTC+LI YTSN FPTDY+PTVFDNFSANVV +G+TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL+S+ASYENI KKWIPEL+H+APG P++LVGTKLDLREDK +  DHPG 
Sbjct  76   RGADVFILAFSLISKASYENIAKKWIPELRHYAPGVPIILVGTKLDLREDKQFFMDHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VP+TTAQGEELRK IGA  YIECSSKTQQNVKAVFDAA
Sbjct  136  VPITTAQGEELRKLIGAPAYIECSSKTQQNVKAVFDAA  173



>ref|XP_009406224.1| PREDICTED: rac-like GTP-binding protein ARAC7 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=210

 Score =   291 bits (746),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 135/158 (85%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANV  +G+ VNLGLWDTAGQEDY+RLRPLSY
Sbjct  16   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVSVDGSIVNLGLWDTAGQEDYSRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGAD+FVLAFSL+SRASYEN+LKKW+PEL+ FAP  P+VLVGTKLDLREDK YLADHPG 
Sbjct  76   RGADIFVLAFSLISRASYENVLKKWMPELRRFAPNVPIVLVGTKLDLREDKGYLADHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
              +T AQGEELRKQIGAA YIECSSKTQQNVKAVFD A
Sbjct  136  TTITPAQGEELRKQIGAAAYIECSSKTQQNVKAVFDTA  173



>ref|XP_002510565.1| rac gtpase, putative [Ricinus communis]
 gb|EEF52752.1| rac gtpase, putative [Ricinus communis]
Length=197

 Score =   291 bits (744),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLI YTSN FPTDY+PTVFDNFSANVV +G+TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL+S+ASYEN+ KKWIPEL+H+APG P++LVGTKLDLREDK +  DHPG 
Sbjct  76   RGADVFILAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLREDKQFFIDHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VP+TTAQGEELRK IGA  YIECSSK+QQNVKAVFDAA
Sbjct  136  VPITTAQGEELRKLIGAPAYIECSSKSQQNVKAVFDAA  173



>ref|XP_009416501.1| PREDICTED: rac-like GTP-binding protein 2 [Musa acuminata subsp. 
malaccensis]
Length=210

 Score =   291 bits (744),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANV  +G+ VNLGLWDTAGQEDY+RLRPLSY
Sbjct  16   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVSVDGSIVNLGLWDTAGQEDYSRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGAD+FVLAFSL+SRASYEN+LKKW+PEL+ FAP  P+VLVGTKLDLREDK YLADHPG 
Sbjct  76   RGADIFVLAFSLISRASYENVLKKWMPELRRFAPNVPIVLVGTKLDLREDKAYLADHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
              +T AQGEELRKQ+GAA YIECSSKTQQN+KAVFD A
Sbjct  136  TTITPAQGEELRKQVGAAAYIECSSKTQQNIKAVFDTA  173



>ref|XP_010028726.1| PREDICTED: rac-like GTP-binding protein 5 [Eucalyptus grandis]
Length=198

 Score =   290 bits (743),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLI YTSN FPTDY+PTVFDNFSANVV +G+TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL+S+ASYEN+ KKWIPEL+H+APG P++LVGTKLDLR+DK +  DHPG 
Sbjct  76   RGADVFLLAFSLISKASYENVAKKWIPELRHYAPGIPIILVGTKLDLRDDKQFFLDHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VP+TTAQGEEL+K IGAA YIECSSKTQQNVKAVFDAA
Sbjct  136  VPITTAQGEELKKLIGAAAYIECSSKTQQNVKAVFDAA  173



>gb|AAF43429.1|AF233446_1 rac 1 protein [Physcomitrella patens]
Length=186

 Score =   290 bits (742),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLI YTSN FPTDY+PTVFDNFSANVV +G TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL+S+ASYENI KKWIPEL+H+AP  P++LVGTKLDLR+DK + ADHPG 
Sbjct  76   RGADVFLLAFSLISKASYENISKKWIPELRHYAPSVPIILVGTKLDLRDDKQFFADHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
             P+TT+QGEELRK IGAA YIECSSKTQQNVKAVFDAA
Sbjct  136  APITTSQGEELRKSIGAASYIECSSKTQQNVKAVFDAA  173



>ref|XP_010941321.1| PREDICTED: rac-like GTP-binding protein 5 [Elaeis guineensis]
 ref|XP_010941322.1| PREDICTED: rac-like GTP-binding protein 5 [Elaeis guineensis]
 ref|XP_010941323.1| PREDICTED: rac-like GTP-binding protein 5 [Elaeis guineensis]
Length=197

 Score =   290 bits (743),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLI YTSN FPTDY+PTVFDNFSANVV +G+TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL+S+ASYEN+ KKWIPEL+H+APG P++LVGTKLDLR+DK +  DHPG 
Sbjct  76   RGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFFIDHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VP+TTAQGEELRK IGA  YIECSSKTQQNVKAVFDAA
Sbjct  136  VPITTAQGEELRKAIGAPAYIECSSKTQQNVKAVFDAA  173



>ref|XP_010920122.1| PREDICTED: rac-like GTP-binding protein 5 [Elaeis guineensis]
Length=198

 Score =   290 bits (743),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLI YTSN FPTDY+PTVFDNFSANVV +G TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL+S+ASYEN+ KKWIPEL+H+APG P++LVGTKLDLR+DK Y  DHPG 
Sbjct  76   RGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQYFMDHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VP+TTAQGEELRK IGA  YIECSSKTQQNVKAVFDAA
Sbjct  136  VPITTAQGEELRKLIGAPIYIECSSKTQQNVKAVFDAA  173



>ref|NP_001045712.1| Os02g0120800 [Oryza sativa Japonica Group]
 ref|NP_001105197.1| Rho-related protein from plants 9 [Zea mays]
 ref|XP_002453210.1| hypothetical protein SORBIDRAFT_04g001690 [Sorghum bicolor]
 ref|XP_004952096.1| PREDICTED: rac-like GTP-binding protein 6-like [Setaria italica]
 sp|Q6ZHA3.1|RAC6_ORYSJ RecName: Full=Rac-like GTP-binding protein 6; AltName: Full=GTPase 
protein RacB; AltName: Full=OsRac6; Flags: Precursor [Oryza 
sativa Japonica Group]
 gb|AAF91343.1|AF250327_1 small GTP-binding protein RACBP [Oryza sativa]
 gb|AAO41289.1| putative ROP family GTPase ROP9 [Zea mays]
 gb|AAO41290.1| putative ROP family GTPase ROP9 [Zea mays]
 dbj|BAD08136.1| small GTP-binding protein RACBP [Oryza sativa Japonica Group]
 dbj|BAD07596.1| small GTP-binding protein RACBP [Oryza sativa Japonica Group]
 gb|AAT84075.1| small GTP-binding protein RacB [Oryza sativa]
 dbj|BAF07626.1| Os02g0120800 [Oryza sativa Japonica Group]
 dbj|BAG91434.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94793.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE56200.1| hypothetical protein OsJ_05161 [Oryza sativa Japonica Group]
 gb|EES06186.1| hypothetical protein SORBIDRAFT_04g001690 [Sorghum bicolor]
 gb|AFW69865.1| ROP family GTPase ROP9 [Zea mays]
Length=197

 Score =   290 bits (743),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLI YTSN FPTDY+PTVFDNFSANVV +G TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL+S+ASYEN+ KKWIPEL+H+APG P++LVGTKLDLR+DK +  DHPG 
Sbjct  76   RGADVFLLAFSLISKASYENVSKKWIPELKHYAPGVPIILVGTKLDLRDDKQFFVDHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VP+TTAQGEELRKQIGA YYIECSSKTQ NVK VFDAA
Sbjct  136  VPITTAQGEELRKQIGAPYYIECSSKTQLNVKGVFDAA  173



>gb|ACU23184.1| unknown [Glycine max]
Length=209

 Score =   291 bits (744),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLI YTSN FPTDY+PTVFDNFSANVV +G+TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL+SRASYEN+ KKWIPEL+H+APG P++LVGTKLDLR+DK +  DHPG 
Sbjct  76   RGADVFLLAFSLISRASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFFQDHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VP+TTAQGEELRK IGA  YIECSSKTQQNVKAVFDAA
Sbjct  136  VPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAA  173



>sp|Q6EP31.2|RAC5_ORYSJ RecName: Full=Rac-like GTP-binding protein 5; AltName: Full=GTPase 
protein RacD; AltName: Full=OsRac5; Flags: Precursor [Oryza 
sativa Japonica Group]
 gb|AAF28764.1|AF218381_1 small GTP binding protein RACDP [Oryza sativa Japonica Group]
 gb|AAK27450.1|AF329814_1 small GTP binding protein RACDP [Oryza sativa Japonica Group]
 dbj|BAD28463.1| putative RacD protein [Oryza sativa Japonica Group]
 dbj|BAD29588.1| putative RacD protein [Oryza sativa Japonica Group]
 dbj|BAG90452.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74314.1| hypothetical protein OsI_09587 [Oryza sativa Indica Group]
 gb|EEE58123.1| hypothetical protein OsJ_09018 [Oryza sativa Japonica Group]
Length=197

 Score =   290 bits (742),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLI YTSN FPTDY+PTVFDNFSANVV +G+TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL+S+ASYEN+ KKWIPEL+H+APG P++LVGTKLDLR+DK +  DHPG 
Sbjct  76   RGADVFLLAFSLISKASYENVSKKWIPELRHYAPGVPIILVGTKLDLRDDKQFFVDHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VP++TAQGEELRK IGAA YIECSSKTQQN+KAVFDAA
Sbjct  136  VPISTAQGEELRKLIGAAAYIECSSKTQQNIKAVFDAA  173



>gb|KJB47671.1| hypothetical protein B456_008G036100 [Gossypium raimondii]
Length=198

 Score =   290 bits (742),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTC+LI YTSN FPTDY+PTVFDNFSANVV +G TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL+S+ASYEN+ KKWIPEL+H+APG P++LVGTKLDLREDK +  DHPG 
Sbjct  76   RGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLREDKQFFIDHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VP+TTAQGEELRK IGA +YIECSSKTQQNVKAVFDAA
Sbjct  136  VPITTAQGEELRKLIGAPFYIECSSKTQQNVKAVFDAA  173



>ref|XP_010035828.1| PREDICTED: rac-like GTP-binding protein RAC2 [Eucalyptus grandis]
 gb|KCW47290.1| hypothetical protein EUGRSUZ_K01081 [Eucalyptus grandis]
Length=198

 Score =   290 bits (742),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLI YTSN FPTDY+PTVFDNFSANVV +G+TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL+S+ASYENI KKWIPEL+H+AP  P++LVGTKLDLRED+HYL +HPG 
Sbjct  76   RGADVFLLAFSLISKASYENIAKKWIPELRHYAPTVPIILVGTKLDLREDRHYLINHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
             P+TT QGEEL+K IGAA YIECSSKTQQNVKAVFDAA
Sbjct  136  TPITTVQGEELKKNIGAAAYIECSSKTQQNVKAVFDAA  173



>ref|XP_009631777.1| PREDICTED: rac-like GTP-binding protein 5 [Nicotiana tomentosiformis]
 ref|XP_009631837.1| PREDICTED: rac-like GTP-binding protein 5 [Nicotiana tomentosiformis]
 ref|XP_009631902.1| PREDICTED: rac-like GTP-binding protein 5 [Nicotiana tomentosiformis]
 ref|XP_009789715.1| PREDICTED: rac-like GTP-binding protein 5 [Nicotiana sylvestris]
 ref|XP_009789716.1| PREDICTED: rac-like GTP-binding protein 5 [Nicotiana sylvestris]
 ref|XP_009789717.1| PREDICTED: rac-like GTP-binding protein 5 [Nicotiana sylvestris]
 gb|AAD00118.1| NTGP3 [Nicotiana tabacum]
 emb|CAD42723.1| putative rac protein [Nicotiana tabacum]
Length=198

 Score =   290 bits (742),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTC+LI YTSN FPTDY+PTVFDNFSANVV +G+TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL+S+ASYEN+ KKWIPEL+H+APG P++LVGTKLDLREDK +  DHPG 
Sbjct  76   RGADVFILAFSLISKASYENVSKKWIPELRHYAPGVPIILVGTKLDLREDKQFFLDHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VP+TTAQGEELRK IGA+ YIECS+KTQQNVKAVFDAA
Sbjct  136  VPLTTAQGEELRKSIGASAYIECSAKTQQNVKAVFDAA  173



>sp|Q40220.1|RAC2_LOTJA RecName: Full=Rac-like GTP-binding protein RAC2; Flags: Precursor 
[Lotus japonicus]
 emb|CAA98190.1| RAC2 [Lotus japonicus]
Length=196

 Score =   290 bits (742),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLI YTSN FPTDY+PTVFDNFSANVV +G+TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL+SRASYENI KKWIPEL+H+AP  P+VLVGTKLDLRED+ YL DHPG 
Sbjct  76   RGADVFLLAFSLLSRASYENISKKWIPELRHYAPTVPIVLVGTKLDLREDRQYLIDHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
             P+TTAQGEEL+K IGAA Y+ECSSKTQQNVKAVFDAA
Sbjct  136  TPITTAQGEELKKAIGAAVYLECSSKTQQNVKAVFDAA  173



>ref|XP_002301960.1| RAC-like GTP binding protein ARAC4 [Populus trichocarpa]
 gb|EEE81233.1| RAC-like GTP binding protein ARAC4 [Populus trichocarpa]
Length=196

 Score =   290 bits (742),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLI YTSN FPTDY+PTVFDNFSANVV +G TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL+S+ASYEN+ KKWIPEL+H+APG P++LVGTKLDLREDK +  DHPG 
Sbjct  76   RGADVFILAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLREDKQFFVDHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VP+ TAQGEEL+K IGA +YIECSSKTQQNVKAVFDAA
Sbjct  136  VPINTAQGEELKKLIGAPFYIECSSKTQQNVKAVFDAA  173



>gb|AAD47828.2| RAC-like G-protein Rac1 [Gossypium hirsutum]
Length=198

 Score =   290 bits (742),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTC+LI YTSN FPTDY+PTVFDNFSANVV +G TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL+S+ASYEN+ KKWIPEL+H+APG P++LVGTKLDLREDK +  DHPG 
Sbjct  76   RGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLREDKQFFIDHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VP+TTAQGEELRK IGA +YIECSSKTQQNVKAVFDAA
Sbjct  136  VPITTAQGEELRKLIGAHFYIECSSKTQQNVKAVFDAA  173



>ref|XP_002306944.1| small GTPase Rac4 family protein [Populus trichocarpa]
 ref|XP_011003051.1| PREDICTED: rac-like GTP-binding protein ARAC1 [Populus euphratica]
 gb|ABK92514.1| unknown [Populus trichocarpa]
 gb|EEE93940.1| small GTPase Rac4 family protein [Populus trichocarpa]
Length=197

 Score =   290 bits (742),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLI YTSN FPTDY+PTVFDNFSANVV +G TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL+S+ASYEN+ KKWIPEL+H+APG P++LVGTKLDLREDK +  DHPG 
Sbjct  76   RGADVFILAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLREDKQFFVDHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VP+TTAQGEEL+K IGA +YIECSSKTQQNVK VFDAA
Sbjct  136  VPITTAQGEELKKLIGAPFYIECSSKTQQNVKGVFDAA  173



>ref|XP_009418310.1| PREDICTED: rac-like GTP-binding protein 5 [Musa acuminata subsp. 
malaccensis]
 gb|ABQ15204.1| rop [Musa acuminata]
Length=196

 Score =   290 bits (742),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLI YTSN FPTDY+PTVFDNFSANVV +G TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL+S+ASYEN+ KKWIPEL+H+APG P++LVGTKLDLR+++ +  DHPG 
Sbjct  76   RGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDEQQFFIDHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VP++TAQGEELRKQIGAA YIECSSKTQQNVKAVFDAA
Sbjct  136  VPISTAQGEELRKQIGAASYIECSSKTQQNVKAVFDAA  173



>ref|XP_008813511.1| PREDICTED: rac-like GTP-binding protein 5 [Phoenix dactylifera]
Length=198

 Score =   290 bits (742),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLI YTSN FPTDY+PTVFDNFSANVV +G TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL+S+ASYEN+ KKWIPEL+H+APG P++LVGTKLDLR+DK Y  DHPG 
Sbjct  76   RGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQYFMDHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VP+TTAQGEELRK IGA  YIECSSKTQQNVKAVFDAA
Sbjct  136  VPITTAQGEELRKLIGAPIYIECSSKTQQNVKAVFDAA  173



>ref|XP_008806608.1| PREDICTED: rac-like GTP-binding protein 5 [Phoenix dactylifera]
 ref|XP_008806609.1| PREDICTED: rac-like GTP-binding protein 5 [Phoenix dactylifera]
 ref|XP_008806611.1| PREDICTED: rac-like GTP-binding protein 5 [Phoenix dactylifera]
 ref|XP_008806612.1| PREDICTED: rac-like GTP-binding protein 5 [Phoenix dactylifera]
Length=197

 Score =   290 bits (742),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLI YTSN FPTDY+PTVFDNFSANVV +G+TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL+S+ASYEN+ KKWIPEL+H+APG P++LVGTKLDLR+DK +  DHPG 
Sbjct  76   RGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFFIDHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VP+TTAQGEELRK IGA  YIECSSKTQQNVKAVFDAA
Sbjct  136  VPITTAQGEELRKAIGAPAYIECSSKTQQNVKAVFDAA  173



>ref|XP_004231040.1| PREDICTED: rac-like GTP-binding protein 5 [Solanum lycopersicum]
 ref|XP_006359696.1| PREDICTED: rac-like GTP-binding protein 5-like [Solanum tuberosum]
Length=198

 Score =   290 bits (742),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTC+LI YTSN FPTDY+PTVFDNFSANVV +G+TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL+S+ASYEN+ KKWIPEL+H+APG P++LVGTKLDLREDK +  DHPG 
Sbjct  76   RGADVFILAFSLISKASYENVSKKWIPELRHYAPGVPIILVGTKLDLREDKQFFVDHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VP++TAQGEELRK IGAA YIECS+KTQQN+KAVFDAA
Sbjct  136  VPLSTAQGEELRKSIGAAAYIECSAKTQQNIKAVFDAA  173



>gb|ABE11611.1| Rac-like GTP-binding protein [Solanum chacoense]
Length=198

 Score =   290 bits (742),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTC+LI YTSN FPTDY+PTVFDNFSANVV +G+TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL+S+ASYEN+ KKWIPEL+H+APG P++LVGTKLDLREDK +  DHPG 
Sbjct  76   RGADVFILAFSLISKASYENVSKKWIPELRHYAPGVPIILVGTKLDLREDKQFFVDHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VP++TAQGEELRK IGAA YIECS+KTQQN+KAVFDAA
Sbjct  136  VPLSTAQGEELRKSIGAAAYIECSAKTQQNIKAVFDAA  173



>gb|KDP31764.1| hypothetical protein JCGZ_12225 [Jatropha curcas]
Length=196

 Score =   290 bits (742),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLI YTSN FPTDY+PTVFDNFSANVV +G+TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL+S+ASYENI KKWIPEL+H+AP  PVVLVGTKLDLR+DK YL DHPG 
Sbjct  76   RGADVFLLAFSLISKASYENISKKWIPELRHYAPTVPVVLVGTKLDLRDDKQYLIDHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
             P+TT+QGEEL+K IGAA YIECSSKTQQNVKAVFDAA
Sbjct  136  TPITTSQGEELKKMIGAAVYIECSSKTQQNVKAVFDAA  173



>gb|ABK21895.1| unknown [Picea sitchensis]
 gb|ADE76884.1| unknown [Picea sitchensis]
Length=196

 Score =   290 bits (742),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLI YTSN FPTDY+PTVFDNFSANVV +G+TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL+S+ASYENI KKWIPEL+H+AP  P++LVGTKLDLREDK + ADHPG 
Sbjct  76   RGADVFLLAFSLISKASYENISKKWIPELRHYAPSVPIILVGTKLDLREDKQFFADHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
             P++TAQGE+L++QIGAA YIECSSKTQQNVKAVFDAA
Sbjct  136  APISTAQGEDLKRQIGAAAYIECSSKTQQNVKAVFDAA  173



>ref|XP_010515533.1| PREDICTED: rac-like GTP-binding protein ARAC11 [Camelina sativa]
 ref|XP_010515534.1| PREDICTED: rac-like GTP-binding protein ARAC11 [Camelina sativa]
 ref|XP_010515535.1| PREDICTED: rac-like GTP-binding protein ARAC11 [Camelina sativa]
 ref|XP_010515536.1| PREDICTED: rac-like GTP-binding protein ARAC11 [Camelina sativa]
Length=197

 Score =   290 bits (742),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTC+LI YTSN FPTDY+PTVFDNFSANVV  G+TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVNGSTVNLGLWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL+S+ASYEN+ KKWIPEL+H+APG P+VLVGTKLDLR+DK +  DHPG 
Sbjct  76   RGADVFILAFSLISKASYENVFKKWIPELKHYAPGVPIVLVGTKLDLRDDKQFFIDHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VP+TTAQGEELRKQIG+  YIECSSKTQ+NVKAVFDAA
Sbjct  136  VPITTAQGEELRKQIGSPTYIECSSKTQENVKAVFDAA  173



>ref|XP_008811402.1| PREDICTED: rac-like GTP-binding protein 5 [Phoenix dactylifera]
 ref|XP_008811409.1| PREDICTED: rac-like GTP-binding protein 5 [Phoenix dactylifera]
 ref|XP_008811416.1| PREDICTED: rac-like GTP-binding protein 5 [Phoenix dactylifera]
Length=197

 Score =   290 bits (742),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLI YTSN FPTDY+PTVFDNFSANVV +G+TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL+S+ASYEN+ KKWIPEL+H+APG P++LVGTKLDLR+DK +  DHPG 
Sbjct  76   RGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFFIDHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VP+TTAQGEELRK IGA  YIECSSKTQQNVKAVFDAA
Sbjct  136  VPITTAQGEELRKAIGAPAYIECSSKTQQNVKAVFDAA  173



>ref|NP_001105615.1| Rho-related protein from plants2 [Zea mays]
 gb|AAD34356.1| Rop2 small GTP binding protein [Zea mays]
 gb|AAO41291.1| putative ROP family GTPase ROP2 [Zea mays]
 gb|ACF83299.1| unknown [Zea mays]
 gb|ACG32744.1| rac-like GTP-binding protein 6 [Zea mays]
 gb|ACG35157.1| rac-like GTP-binding protein 6 [Zea mays]
 gb|AFW66558.1| rho protein from plants2 [Zea mays]
Length=197

 Score =   290 bits (742),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLI YTSN FPTDY+PTVFDNFSANVV +G TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL+S+ASYEN+ KKWIPEL+H+APG P++LVGTKLDLR+DK +  DHPG 
Sbjct  76   RGADVFLLAFSLISKASYENVSKKWIPELKHYAPGVPIILVGTKLDLRDDKQFFVDHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VP+TTAQGEELRKQIGA YYIECSSKTQ NVK VFDAA
Sbjct  136  VPITTAQGEELRKQIGAPYYIECSSKTQLNVKGVFDAA  173



>ref|XP_006852540.1| hypothetical protein AMTR_s00021p00186910 [Amborella trichopoda]
 gb|ERN14007.1| hypothetical protein AMTR_s00021p00186910 [Amborella trichopoda]
Length=197

 Score =   290 bits (742),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLI YTSN FPTDY+PTVFDNFSANVV +G+TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  17   AVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSY  76

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL+S+ SYENI KKWIPEL+H+AP  P+VLVGTKLDLREDK +  DHPG 
Sbjct  77   RGADVFLLAFSLISKPSYENISKKWIPELRHYAPTVPIVLVGTKLDLREDKQFFIDHPGA  136

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
             P+TTAQGEEL+KQIGAA YIECSSKTQQNVKAVFDAA
Sbjct  137  TPITTAQGEELKKQIGAAMYIECSSKTQQNVKAVFDAA  174



>ref|XP_007149793.1| hypothetical protein PHAVU_005G099100g [Phaseolus vulgaris]
 gb|ESW21787.1| hypothetical protein PHAVU_005G099100g [Phaseolus vulgaris]
Length=196

 Score =   290 bits (741),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLI YTSN FPTDY+PTVFDNFSANVV +G+T+NLGLWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTINLGLWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL+SRASYENI KKWIPEL+H+AP  P+VLVGTKLDLRED+ YL DHPG 
Sbjct  76   RGADVFLLAFSLLSRASYENISKKWIPELRHYAPTVPIVLVGTKLDLREDRQYLIDHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
             P++TAQGEEL+K IGAA YIECSSKTQQNVKAVFDAA
Sbjct  136  TPISTAQGEELKKAIGAAVYIECSSKTQQNVKAVFDAA  173



>ref|XP_011088603.1| PREDICTED: rac-like GTP-binding protein 5 isoform X1 [Sesamum 
indicum]
 ref|XP_011088604.1| PREDICTED: rac-like GTP-binding protein 5 isoform X1 [Sesamum 
indicum]
Length=198

 Score =   290 bits (742),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTC+LI YTSN FPTDY+PTVFDNFSANVV +G+TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL+S+ASYENI KKWIPEL+H+APG P++LVGTKLDLREDK +  DHPG 
Sbjct  76   RGADVFILAFSLISKASYENIPKKWIPELRHYAPGVPIILVGTKLDLREDKQFFIDHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VP++TAQGEELRK IGAA YIECS+KTQQNVKAVFDAA
Sbjct  136  VPISTAQGEELRKLIGAAAYIECSAKTQQNVKAVFDAA  173



>ref|XP_010104154.1| Rac-like GTP-binding protein ARAC7 [Morus notabilis]
 gb|EXC47523.1| Rac-like GTP-binding protein ARAC7 [Morus notabilis]
Length=200

 Score =   290 bits (742),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 135/158 (85%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANV A+G  VNLGLWDTAGQEDY+RLRPLSY
Sbjct  16   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVAADGNIVNLGLWDTAGQEDYSRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSL+SRASYEN+LKKW+PEL+ FAP  P+VLVGTKLDLRED+ YLADH G 
Sbjct  76   RGADVFVLAFSLISRASYENVLKKWMPELRRFAPNVPIVLVGTKLDLREDRGYLADHMGS  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
              VT+AQGEELRKQIGAA YIECSSKTQQNVKAVFD +
Sbjct  136  NVVTSAQGEELRKQIGAAAYIECSSKTQQNVKAVFDTS  173



>ref|XP_010690370.1| PREDICTED: rac-like GTP-binding protein 5 [Beta vulgaris subsp. 
vulgaris]
Length=198

 Score =   290 bits (741),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 148/158 (94%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLI YTSN FPTDY+PTVFDNFSANVV +G+TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL+S+ASYEN+ KKWIPEL+H+APG P++LVGTKLDLR+DK +  DHPG 
Sbjct  76   RGADVFLLAFSLISKASYENVSKKWIPELRHYAPGVPIILVGTKLDLRDDKQFFLDHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VP+TTAQG+EL+KQIGAA YIECS+KTQQN+KAVFDAA
Sbjct  136  VPITTAQGDELKKQIGAAAYIECSAKTQQNIKAVFDAA  173



>gb|KDP29655.1| hypothetical protein JCGZ_18817 [Jatropha curcas]
Length=198

 Score =   290 bits (741),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLI YTSN FPTDY+PTVFDNFSANVV +G+TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL+S+ASYEN+ KKWIPEL+H+APG P++LVGTKLDLR+DK +  DHPG 
Sbjct  76   RGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFFIDHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VP+TTAQGEELRK IGA  YIECSSKTQQNVKAVFDAA
Sbjct  136  VPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAA  173



>ref|NP_001242570.1| uncharacterized protein LOC100805035 [Glycine max]
 gb|ACU13435.1| unknown [Glycine max]
Length=197

 Score =   290 bits (741),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLI YTSN FPTDY+PTVFDNFSANVV +G+TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGAD F+LAFSL+SRASYEN+ KKWIPEL+H+APG P++LVGTKLDLR+DK +  DHPG 
Sbjct  76   RGADAFLLAFSLISRASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFFQDHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VP+TTAQGEELRK IGA  YIECSSKTQQNVKAVFDAA
Sbjct  136  VPITTAQGEELRKLIGAPIYIECSSKTQQNVKAVFDAA  173



>ref|XP_011083464.1| PREDICTED: rac-like GTP-binding protein RAC1 [Sesamum indicum]
 ref|XP_011083465.1| PREDICTED: rac-like GTP-binding protein RAC1 [Sesamum indicum]
Length=195

 Score =   290 bits (741),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLI YTSN FPTDY+PTVFDNFSANVV +G+TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL+S+ASYENI KKWIPEL+H+APG P++LVGTKLDLR+DK Y  DHPG 
Sbjct  76   RGADVFLLAFSLISKASYENIAKKWIPELRHYAPGVPIILVGTKLDLRDDKQYFIDHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VP+TTAQGEEL+K IGA  Y+ECSSKTQQNVKAVFDAA
Sbjct  136  VPITTAQGEELKKLIGAPVYVECSSKTQQNVKAVFDAA  173



>ref|XP_001761909.1| rop-family small GTPase [Physcomitrella patens]
 ref|XP_001770483.1| predicted protein [Physcomitrella patens]
 gb|AAD26198.1|AF115476_1 rac-like GTP binding protein [Physcomitrella patens]
 gb|AAX58754.1| small rho-1 GTP-binding protein [Physcomitrella patens]
 gb|EDQ64652.1| predicted protein [Physcomitrella patens]
 gb|EDQ73350.1| rop-family small GTPase [Physcomitrella patens]
 dbj|BAO94212.1| Rop/RAC small GTPase [Physcomitrella patens]
Length=196

 Score =   290 bits (741),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLI YTSN FPTDY+PTVFDNFSANVV +G TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL+S+ASYENI KKWIPEL+H+AP  P++LVGTKLDLR+DK + ADHPG 
Sbjct  76   RGADVFLLAFSLISKASYENISKKWIPELRHYAPSVPIILVGTKLDLRDDKQFFADHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
             P+TT+QGEELRK IGAA YIECSSKTQQNVKAVFDAA
Sbjct  136  APITTSQGEELRKSIGAASYIECSSKTQQNVKAVFDAA  173



>ref|NP_190698.1| Rac-like GTP-binding protein ARAC11 [Arabidopsis thaliana]
 ref|XP_010503823.1| PREDICTED: rac-like GTP-binding protein ARAC11 [Camelina sativa]
 ref|XP_010503824.1| PREDICTED: rac-like GTP-binding protein ARAC11 [Camelina sativa]
 ref|XP_010503825.1| PREDICTED: rac-like GTP-binding protein ARAC11 [Camelina sativa]
 sp|P92978.2|RAC11_ARATH RecName: Full=Rac-like GTP-binding protein ARAC11; AltName: Full=GTPase 
protein ROP1; Flags: Precursor [Arabidopsis thaliana]
 gb|AAK52996.1|AF375412_1 AT3g51300/F24M12_340 [Arabidopsis thaliana]
 gb|AAC78390.1| GTP binding protein Rop1At [Arabidopsis thaliana]
 gb|AAC35850.1| rac-like GTP binding protein Arac11 [Arabidopsis thaliana]
 emb|CAB62652.1| rac-like GTP binding protein Arac11 [Arabidopsis thaliana]
 gb|AAL47421.1| AT3g51300/F24M12_340 [Arabidopsis thaliana]
 gb|AEE78776.1| Rac-like GTP-binding protein ARAC11 [Arabidopsis thaliana]
Length=197

 Score =   290 bits (741),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTC+LI YTSN FPTDY+PTVFDNFSANVV  G+TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVNGSTVNLGLWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL+S+ASYEN+ KKWIPEL+H+APG P+VLVGTKLDLR+DK +  DHPG 
Sbjct  76   RGADVFILAFSLISKASYENVSKKWIPELKHYAPGVPIVLVGTKLDLRDDKQFFIDHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VP+TTAQGEELRKQIGA  YIECSSKTQ+NVKAVFDAA
Sbjct  136  VPITTAQGEELRKQIGAPTYIECSSKTQENVKAVFDAA  173



>ref|XP_010935113.1| PREDICTED: rac-like GTP-binding protein 5 [Elaeis guineensis]
 ref|XP_010935114.1| PREDICTED: rac-like GTP-binding protein 5 [Elaeis guineensis]
 ref|XP_010935115.1| PREDICTED: rac-like GTP-binding protein 5 [Elaeis guineensis]
Length=197

 Score =   290 bits (741),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLI YTSN FPTDY+PTVFDNFSANVV +G+TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL+S+ASYEN+ KKWIPEL+H+APG P++LVGTKLDLR+DK +  DHPG 
Sbjct  76   RGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFFIDHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VP+TTAQGEELRK IGA  YIECSSKTQQNVKAVFDAA
Sbjct  136  VPITTAQGEELRKAIGAPAYIECSSKTQQNVKAVFDAA  173



>ref|XP_004303136.1| PREDICTED: rac-like GTP-binding protein RAC2 [Fragaria vesca 
subsp. vesca]
Length=196

 Score =   290 bits (741),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLI YTSN FPTDY+PTVFDNFSANVV +G+TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL+S+ASYENI KKWIPEL+H+AP  P+VLVGTKLDLR+DK YL DHPG 
Sbjct  76   RGADVFLLAFSLISKASYENIAKKWIPELRHYAPTVPIVLVGTKLDLRDDKQYLIDHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
             P++TAQGEEL+K IGAA YIECSSKTQQNVKAVFDAA
Sbjct  136  TPISTAQGEELKKTIGAAVYIECSSKTQQNVKAVFDAA  173



>gb|ACF83636.1| unknown [Zea mays]
 gb|ACG40961.1| rac-like GTP-binding protein 5 [Zea mays]
 gb|AFW74173.1| rop4 small GTP binding protein [Zea mays]
Length=197

 Score =   290 bits (741),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLI YTSN FPTDY+PTVFDNFSANVV +G+TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL+S+ASYEN+ KKW+PEL+H+APG P++LVGTKLDLR+DK +  DHPG 
Sbjct  76   RGADVFLLAFSLISKASYENVSKKWVPELRHYAPGVPIILVGTKLDLRDDKQFFVDHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VP++TAQGEELRK IGAA YIECSSKTQQN+KAVFDAA
Sbjct  136  VPISTAQGEELRKLIGAAAYIECSSKTQQNIKAVFDAA  173



>ref|XP_004289869.1| PREDICTED: rac-like GTP-binding protein 5 [Fragaria vesca subsp. 
vesca]
Length=198

 Score =   290 bits (741),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLI YTSN FPTDY+PTVFDNFSANVV +G+TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL+S+ASYEN+ KKWIPEL+H+APG P++LVGTKLDLR+DK +  DHPG 
Sbjct  76   RGADVFLLAFSLISKASYENVAKKWIPELKHYAPGVPIILVGTKLDLRDDKQFFTDHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VP+TTAQGEEL+K IGA  YIECSSKTQQNVKAVFDAA
Sbjct  136  VPITTAQGEELKKTIGAPIYIECSSKTQQNVKAVFDAA  173



>ref|XP_010316434.1| PREDICTED: rac-like GTP-binding protein RHO1 [Solanum lycopersicum]
Length=197

 Score =   290 bits (741),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTC+LI YTSN FPTDY+PTVFDNFSANVV  G+TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVNGSTVNLGLWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL+S+ASYEN+ KKWIPEL+H+APG P+VLVGTKLDLR+DK +  DHPG 
Sbjct  76   RGADVFILAFSLISKASYENVAKKWIPELKHYAPGVPIVLVGTKLDLRDDKQFFVDHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VP+TTAQGEELRK IGA  YIECSSKTQQNVKAVFDAA
Sbjct  136  VPITTAQGEELRKTIGAPAYIECSSKTQQNVKAVFDAA  173



>ref|XP_010477239.1| PREDICTED: rac-like GTP-binding protein ARAC5 [Camelina sativa]
Length=196

 Score =   289 bits (740),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLI YTSN FPTDY+PTVFDNFSANVV +G TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL+S+ASYENI KKWIPEL+H+APG P++LVGTKLDLR+DK +  DHPG 
Sbjct  76   RGADVFILAFSLISKASYENIAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFFIDHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VP+TT+QGEEL+K IG+A YIECSSKTQQNVKAVFDAA
Sbjct  136  VPITTSQGEELKKLIGSAVYIECSSKTQQNVKAVFDAA  173



>ref|NP_001232850.1| rac-like GTP-binding protein 6 [Zea mays]
 gb|ACG36489.1| rac-like GTP-binding protein 6 [Zea mays]
Length=197

 Score =   290 bits (741),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLI YTSN FPTDY+PTVFDNFSANVV +G TVNLGLWDTAGQ+DYNRLRPLSY
Sbjct  16   AVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWDTAGQZDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL+S+ASYEN+ KKWIPEL+H+APG P++LVGTKLDLR+DK +  DHPG 
Sbjct  76   RGADVFLLAFSLISKASYENVSKKWIPELKHYAPGVPIILVGTKLDLRDDKQFFVDHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VP+TTAQGEELRKQIGA YYIECSSKTQ NVK VFDAA
Sbjct  136  VPITTAQGEELRKQIGAPYYIECSSKTQLNVKGVFDAA  173



>ref|XP_006379285.1| small GTPase Rac4 family protein [Populus trichocarpa]
 ref|XP_011046252.1| PREDICTED: rac-like GTP-binding protein 5 [Populus euphratica]
 gb|ERP57082.1| small GTPase Rac4 family protein [Populus trichocarpa]
Length=198

 Score =   290 bits (741),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLI YTSN FPTDY+PTVFDNFSANVV +G+TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL+S+ASYEN+ KKWIPEL+H+APG P++LVGTKLDLR+DK +  DHPG 
Sbjct  76   RGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFFIDHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VP+TTAQGEELRK IGA  YIECSSKTQQNVKAVFDAA
Sbjct  136  VPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAA  173



>ref|XP_001773666.1| rop-family small GTPase [Physcomitrella patens]
 gb|AAD44768.1|AF146340_1 Rac-like GTP binding protein [Physcomitrella patens]
 gb|AAD44769.1|AF146341_1 Rac-like GTP binding protein [Physcomitrella patens]
 gb|EDQ61554.1| rop-family small GTPase [Physcomitrella patens]
 dbj|BAO94211.1| Rop/RAC small GTPase [Physcomitrella patens]
Length=196

 Score =   289 bits (740),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLI YTSN FPTDY+PTVFDNFSANVV +G TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL+S+ASYENI KKWIPEL+H+AP  P++LVGTKLDLR+DK + ADHPG 
Sbjct  76   RGADVFLLAFSLISKASYENISKKWIPELRHYAPSVPIILVGTKLDLRDDKQFFADHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
             P+TT+QGEELRK IGAA YIECSSKTQQNVKAVFDAA
Sbjct  136  APITTSQGEELRKAIGAASYIECSSKTQQNVKAVFDAA  173



>gb|AFW78696.1| hypothetical protein ZEAMMB73_559671 [Zea mays]
Length=202

 Score =   290 bits (741),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 135/158 (85%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANV  +G+ VNLGLWDTAGQEDY+RLRPLSY
Sbjct  16   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVSVDGSIVNLGLWDTAGQEDYSRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSL+SRASYEN+LKKW+PEL+ FAP  PVVLVGTKLDLR+ + YLADHPG 
Sbjct  76   RGADVFVLAFSLISRASYENVLKKWVPELRRFAPNVPVVLVGTKLDLRDHRAYLADHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
              VTTAQGEELRKQIGAA YIECSSKTQQNVK+VFD A
Sbjct  136  SAVTTAQGEELRKQIGAAAYIECSSKTQQNVKSVFDTA  173



>ref|XP_002278788.1| PREDICTED: rac-like GTP-binding protein RAC2 [Vitis vinifera]
 emb|CBI21938.3| unnamed protein product [Vitis vinifera]
Length=196

 Score =   289 bits (740),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLI YTSN FPTDY+PTVFDNFSANVV +G+TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL+S+ASYENI KKWIPEL+H+AP  P+VLVGTKLDLREDK +L DHPG 
Sbjct  76   RGADVFLLAFSLISKASYENISKKWIPELRHYAPTVPIVLVGTKLDLREDKQFLIDHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
             P+TTAQGE+L+K IGAA YIECSSKTQQNVKAVFDAA
Sbjct  136  TPITTAQGEDLKKMIGAAVYIECSSKTQQNVKAVFDAA  173



>ref|XP_004151903.1| PREDICTED: rac-like GTP-binding protein 7-like [Cucumis sativus]
 ref|XP_004172211.1| PREDICTED: rac-like GTP-binding protein 7-like [Cucumis sativus]
 gb|KGN63214.1| hypothetical protein Csa_2G415560 [Cucumis sativus]
Length=196

 Score =   289 bits (740),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLI YTSN FPTDY+PTVFDNFSANVV +G+TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL+S+ASYENI KKWIPEL+H+AP  P+VLVGTKLDLR+DK +L  HPG 
Sbjct  76   RGADVFLLAFSLISKASYENISKKWIPELRHYAPTVPIVLVGTKLDLRDDKQFLTSHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VP+TTAQGEEL+K IGAA YIECSSKTQQNVKAVFDAA
Sbjct  136  VPITTAQGEELKKSIGAAVYIECSSKTQQNVKAVFDAA  173



>ref|NP_001238503.1| uncharacterized protein LOC100499696 [Glycine max]
 gb|ACU13278.1| unknown [Glycine max]
 gb|KHN45934.1| Rac-like GTP-binding protein RAC1 [Glycine soja]
Length=196

 Score =   289 bits (740),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTC+LI YTSN FPTDY+PTVFDNFSANVV +G+TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL+S+ASYENI KKWIPEL+H+APG P++LVGTKLDLR+DK +  DHPG 
Sbjct  76   RGADVFILAFSLISKASYENIAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFFMDHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VP+TTAQGEELRK IGA  YIECSSKTQQNVKAVFDAA
Sbjct  136  VPITTAQGEELRKLIGAPAYIECSSKTQQNVKAVFDAA  173



>ref|XP_002272532.1| PREDICTED: rac-like GTP-binding protein 5 [Vitis vinifera]
 ref|XP_010664844.1| PREDICTED: rac-like GTP-binding protein 5 [Vitis vinifera]
 ref|XP_010664845.1| PREDICTED: rac-like GTP-binding protein 5 [Vitis vinifera]
 ref|XP_010664846.1| PREDICTED: rac-like GTP-binding protein 5 [Vitis vinifera]
 emb|CAN71069.1| hypothetical protein VITISV_031709 [Vitis vinifera]
 emb|CBI19900.3| unnamed protein product [Vitis vinifera]
Length=197

 Score =   289 bits (740),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLI YTSN FPTDY+PTVFDNFSANVV +G+TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL+S+ASYEN+ KKWIPEL+H+APG P++LVGTKLDLR+DK +  DHPG 
Sbjct  76   RGADVFILAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFFVDHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VP+TTAQGEEL+K IGA  YIECSSKTQQNVKAVFDAA
Sbjct  136  VPITTAQGEELKKVIGAPAYIECSSKTQQNVKAVFDAA  173



>ref|NP_001105134.1| rop6 protein [Zea mays]
 emb|CAB96793.1| putative Rop family GTPase, ROP6 [Zea mays]
 gb|AAO41292.1| putative ROP family GTPase ROP6 [Zea mays]
 gb|ACG24516.1| rac-like GTP-binding protein 2 [Zea mays]
 gb|ACG43021.1| rac-like GTP-binding protein 2 [Zea mays]
 gb|AFW78695.1| GTPase, ROP6Rac-like GTP-binding protein 2 , Rop family [Zea 
mays]
Length=212

 Score =   290 bits (741),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 135/158 (85%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANV  +G+ VNLGLWDTAGQEDY+RLRPLSY
Sbjct  16   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVSVDGSIVNLGLWDTAGQEDYSRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSL+SRASYEN+LKKW+PEL+ FAP  PVVLVGTKLDLR+ + YLADHPG 
Sbjct  76   RGADVFVLAFSLISRASYENVLKKWVPELRRFAPNVPVVLVGTKLDLRDHRAYLADHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
              VTTAQGEELRKQIGAA YIECSSKTQQNVK+VFD A
Sbjct  136  SAVTTAQGEELRKQIGAAAYIECSSKTQQNVKSVFDTA  173



>ref|XP_009355676.1| PREDICTED: rac-like GTP-binding protein 5 [Pyrus x bretschneideri]
Length=197

 Score =   289 bits (740),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLI YTSN FPTDY+PTVFDNFSANVV +G+TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL+S+ASYEN+ KKW+PEL+H+APG P++LVGTKLDLR+DK +  DHPG 
Sbjct  76   RGADVFLLAFSLISKASYENVAKKWVPELRHYAPGVPIILVGTKLDLRDDKQFFVDHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VP+TTAQGEELRK IGA  YIECSSKTQQNVKAVFDAA
Sbjct  136  VPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAA  173



>ref|XP_006435212.1| hypothetical protein CICLE_v10002551mg [Citrus clementina]
 ref|XP_006473689.1| PREDICTED: rac-like GTP-binding protein 5-like [Citrus sinensis]
 gb|ESR48452.1| hypothetical protein CICLE_v10002551mg [Citrus clementina]
 gb|KDO84911.1| hypothetical protein CISIN_1g029215mg [Citrus sinensis]
Length=197

 Score =   289 bits (740),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLI YTSN FPTDY+PTVFDNFSANVV +G+TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL+S+ASYEN+ KKWIPEL+H+APG P++LVGTKLDLR+DK +  DHPG 
Sbjct  76   RGADVFILAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFFIDHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VP+TTAQGEELRK IG+  YIECSSKTQQNVKAVFDAA
Sbjct  136  VPITTAQGEELRKLIGSPAYIECSSKTQQNVKAVFDAA  173



>gb|EMS48866.1| Rac-like GTP-binding protein 3 [Triticum urartu]
Length=189

 Score =   289 bits (739),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 143/158 (91%), Gaps = 12/158 (8%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVA+GTTVNLGLWDTAGQEDYNRLRPLSY
Sbjct  18   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVADGTTVNLGLWDTAGQEDYNRLRPLSY  77

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSL            WIPELQH+APG PVVLVGTKLDLREDKHYL DHPG+
Sbjct  78   RGADVFVLAFSL------------WIPELQHYAPGVPVVLVGTKLDLREDKHYLLDHPGM  125

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            +PVTTAQGEELRKQ+GA YYIECSSKTQQNVKAVFDAA
Sbjct  126  IPVTTAQGEELRKQVGALYYIECSSKTQQNVKAVFDAA  163



>ref|XP_002876081.1| hypothetical protein ARALYDRAFT_906477 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_006293293.1| hypothetical protein CARUB_v10019628mg [Capsella rubella]
 gb|EFH52340.1| hypothetical protein ARALYDRAFT_906477 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EOA26191.1| hypothetical protein CARUB_v10019628mg [Capsella rubella]
Length=197

 Score =   289 bits (740),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTC+LI YTSN FPTDY+PTVFDNFSANVV  G+TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVNGSTVNLGLWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL+S+ASYEN+ KKWIPEL+H+APG P++LVGTKLDLR+DK +  DHPG 
Sbjct  76   RGADVFILAFSLISKASYENVSKKWIPELKHYAPGVPIILVGTKLDLRDDKQFFIDHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VP+TTAQGEELRKQIGA  YIECSSKTQ+NVKAVFDAA
Sbjct  136  VPITTAQGEELRKQIGAPTYIECSSKTQENVKAVFDAA  173



>ref|XP_003543315.1| PREDICTED: rac-like GTP-binding protein RAC2-like [Glycine max]
 gb|KHN36675.1| Rac-like GTP-binding protein RAC2 [Glycine soja]
Length=196

 Score =   289 bits (740),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLI YTSN FPTDY+PTVFDNFSANVV +G+TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVIDGSTVNLGLWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL+SRASYENI KKWIPEL+H+AP  P+VLVGTKLDLRED+ YL DHP  
Sbjct  76   RGADVFLLAFSLLSRASYENISKKWIPELRHYAPIVPIVLVGTKLDLREDRQYLIDHPAA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
             P+TTAQGEEL+K+IGAA YIECSSKTQQNVKAVFDAA
Sbjct  136  TPITTAQGEELKKEIGAAVYIECSSKTQQNVKAVFDAA  173



>ref|NP_001236429.1| uncharacterized protein LOC100527464 [Glycine max]
 gb|ACU16556.1| unknown [Glycine max]
 gb|KHN45933.1| Rac-like GTP-binding protein RAC1 [Glycine soja]
Length=197

 Score =   289 bits (740),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTC+LI YTSN FPTDY+PTVFDNFSANVV +G+TVNL LWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLALWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL+S+ASYENI KKWIPEL+H+APG P++LVGTKLDLREDK +  DHPG 
Sbjct  76   RGADVFILAFSLISKASYENIAKKWIPELRHYAPGVPIILVGTKLDLREDKQFFMDHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VP+TTAQGEELRK IGA  YIECSSKTQQNVKAVFDAA
Sbjct  136  VPITTAQGEELRKLIGAPAYIECSSKTQQNVKAVFDAA  173



>ref|XP_002278595.1| PREDICTED: rac-like GTP-binding protein 5 [Vitis vinifera]
 emb|CAN73627.1| hypothetical protein VITISV_026639 [Vitis vinifera]
 emb|CBI37875.3| unnamed protein product [Vitis vinifera]
Length=198

 Score =   289 bits (740),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLI YTSN FPTDY+PTVFDNFSANVV +G+TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL+S+ASYEN+ KKWIPEL+H+APG P++LVGTKLDLR+DK +  DHPG 
Sbjct  76   RGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFFIDHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VP+TTAQGEELRK IGA  YIECSSKTQQNVKAVFDAA
Sbjct  136  VPITTAQGEELRKLIGAPAYIECSSKTQQNVKAVFDAA  173



>gb|KJB11994.1| hypothetical protein B456_002G197500 [Gossypium raimondii]
Length=198

 Score =   289 bits (740),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLI YTSN FPTDY+PTVFDNFSANVV +G TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL+S+ASYEN+ KKWIPEL+H+APG P++LVGTKLDLR+DK +  DHPG 
Sbjct  76   RGADVFLLAFSLISKASYENVSKKWIPELRHYAPGVPIILVGTKLDLRDDKQFFVDHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VP+TTAQGEELRK IGA  YIECSSKTQQNVKAVFDAA
Sbjct  136  VPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAA  173



>ref|XP_007041844.1| RAC-like 3 [Theobroma cacao]
 gb|EOX97675.1| RAC-like 3 [Theobroma cacao]
Length=198

 Score =   289 bits (740),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLI YTSN FPTDY+PTVFDNFSANVV +G TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL+S+ASYEN+ KKWIPEL+H+APG P++LVGTKLDLR+DK +  DHPG 
Sbjct  76   RGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFFIDHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VP+TTAQGEELRK IGA  YIECSSKTQQNVKAVFDAA
Sbjct  136  VPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAA  173



>ref|XP_006340764.1| PREDICTED: rac-like GTP-binding protein RHO1-like [Solanum tuberosum]
Length=197

 Score =   289 bits (739),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTC+LI YTSN FPTDY+PTVFDNFSANVV  G+TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVNGSTVNLGLWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL+S+ASYEN+ KKWIPEL+H+APG P+VLVGTKLDLR+DK +  DHPG 
Sbjct  76   RGADVFILAFSLISKASYENVAKKWIPELKHYAPGVPIVLVGTKLDLRDDKQFFIDHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VP+TTAQGEELRK IGA  YIECSSKTQQNVKAVFDAA
Sbjct  136  VPITTAQGEELRKTIGAPAYIECSSKTQQNVKAVFDAA  173



>gb|ACI03398.1| rac-like small GTP-binding protein [Scoparia dulcis]
Length=196

 Score =   289 bits (739),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLI YTSN FPTDY+PTVFDNFSANVV +G+TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL+S+ASYENI KKWIPEL+H+APG PV+LVGTKLDLR+DK +  DHPG 
Sbjct  76   RGADVFLLAFSLISKASYENIAKKWIPELRHYAPGVPVILVGTKLDLRDDKQFFIDHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            +P++TAQGEELRK IGA  YIECSSKTQQNVKAVFDAA
Sbjct  136  IPISTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAA  173



>ref|XP_002987330.1| RHO family GTPase [Selaginella moellendorffii]
 ref|XP_002989171.1| RHO family GTPase [Selaginella moellendorffii]
 gb|EFJ09765.1| RHO family GTPase [Selaginella moellendorffii]
 gb|EFJ11645.1| RHO family GTPase [Selaginella moellendorffii]
Length=196

 Score =   289 bits (739),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLI YTSN FPTDY+PTVFDNFSANVV +G TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL+SRASYENI KKWIPEL+H+A   PV+LVGTKLDLR+DKH+  DHPG 
Sbjct  76   RGADVFLLAFSLISRASYENISKKWIPELRHYASTVPVILVGTKLDLRDDKHFFNDHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
              +TTAQGEELRKQIGAA YIECSSKTQQNVKAVFDAA
Sbjct  136  TAITTAQGEELRKQIGAAAYIECSSKTQQNVKAVFDAA  173



>gb|ACM07419.1| Rac/Rop-like small GTPase [Scoparia dulcis]
Length=197

 Score =   289 bits (739),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTC+LI YTSN FPTDY+PTVFDNFSANVV  G+TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVNGSTVNLGLWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL+S+ASYEN+ KKWIPEL+H+APG P+VLVGTKLDLR+DK +  DHPG 
Sbjct  76   RGADVFILAFSLISKASYENVSKKWIPELKHYAPGVPIVLVGTKLDLRDDKQFFIDHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VP+TTAQGEELRK IGA  YIECSSKTQQNVKAVFDAA
Sbjct  136  VPITTAQGEELRKMIGAPAYIECSSKTQQNVKAVFDAA  173



>ref|XP_004487185.1| PREDICTED: rac-like GTP-binding protein RAC2-like [Cicer arietinum]
 ref|XP_004487186.1| PREDICTED: rac-like GTP-binding protein RAC2-like [Cicer arietinum]
Length=196

 Score =   289 bits (739),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLI YTSN FPTDY+PTVFDNFSANVV +G+TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL+SRASYENI KKWIPEL+H+AP  P+VLVGTKLDLRED+ YL DHPG 
Sbjct  76   RGADVFLLAFSLLSRASYENISKKWIPELRHYAPTVPIVLVGTKLDLREDRQYLIDHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
             P+TTAQGEEL++ IGAA Y+ECSSKTQQNVKAVFDAA
Sbjct  136  TPITTAQGEELKRAIGAAVYLECSSKTQQNVKAVFDAA  173



>ref|XP_010266823.1| PREDICTED: rac-like GTP-binding protein 5 [Nelumbo nucifera]
 ref|XP_010266824.1| PREDICTED: rac-like GTP-binding protein 5 [Nelumbo nucifera]
Length=199

 Score =   289 bits (739),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLI YTSN FPTDY+PTVFDNFSANVV +G TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL+S+ASYEN+ KKWIPEL+H+APG P++LVGTKLDLR+DK +  DHPG 
Sbjct  76   RGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFFVDHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VP++TAQGEEL+KQIGA  YIECSSKTQQNVKAVFDAA
Sbjct  136  VPISTAQGEELKKQIGAPAYIECSSKTQQNVKAVFDAA  173



>ref|XP_004961513.1| PREDICTED: rac-like GTP-binding protein 2-like [Setaria italica]
Length=212

 Score =   290 bits (741),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 135/158 (85%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANV  +G  VNLGLWDTAGQEDY+RLRPLSY
Sbjct  16   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVSVDGNIVNLGLWDTAGQEDYSRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSL+SRASYEN+LKKW+PEL+ FAP  PVVLVGTKLDLR+ + YLADHPG 
Sbjct  76   RGADVFVLAFSLISRASYENVLKKWMPELRRFAPNVPVVLVGTKLDLRDHRAYLADHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
              +TTAQGEELRKQIGAA YIECSSKTQQNVKAVFD A
Sbjct  136  STITTAQGEELRKQIGAAAYIECSSKTQQNVKAVFDTA  173



>ref|NP_001240094.1| uncharacterized protein LOC100798550 [Glycine max]
 gb|ACU13791.1| unknown [Glycine max]
 gb|KHN09078.1| Rac-like GTP-binding protein RAC1 [Glycine soja]
Length=197

 Score =   289 bits (739),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTC+LI YTSN FPTDY+PTVFDNFSANVV +G+TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL+S+ASYENI KKWIPEL+H+APG P++LVGTKLDLREDK +  DHPG 
Sbjct  76   RGADVFILAFSLISKASYENIAKKWIPELRHYAPGVPIILVGTKLDLREDKQFFIDHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VP+TT QGEELRK IGA  YIECSSKTQQNVKAVFDAA
Sbjct  136  VPITTTQGEELRKLIGAPAYIECSSKTQQNVKAVFDAA  173



>ref|XP_009612580.1| PREDICTED: rac-like GTP-binding protein RHO1 [Nicotiana tomentosiformis]
 ref|XP_009797560.1| PREDICTED: rac-like GTP-binding protein RHO1 [Nicotiana sylvestris]
 gb|AAK31299.1| Rac-like GTPase 1 [Nicotiana tabacum]
Length=197

 Score =   289 bits (739),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTC+LI YTSN FPTDY+PTVFDNFSANVV  G+TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVNGSTVNLGLWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL+S+ASYEN+ KKWIPEL+H+APG P+VLVGTKLDLR+DK +  DHPG 
Sbjct  76   RGADVFILAFSLISKASYENVSKKWIPELKHYAPGVPIVLVGTKLDLRDDKQFFIDHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VP+TTAQGEELRK IGA  YIECSSKTQQNVKAVFDAA
Sbjct  136  VPITTAQGEELRKTIGAPAYIECSSKTQQNVKAVFDAA  173



>gb|AAC32124.1| Rac-like GTP binding protein [Picea mariana]
Length=198

 Score =   289 bits (739),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLI YTSN FPTDY+PTVFDNFSANVV +G TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL+S+ASYENI+KKW+ EL+HFAPG P+VLVGTKLDLR+DK +  DHP  
Sbjct  76   RGADVFILAFSLISKASYENIMKKWLLELRHFAPGVPIVLVGTKLDLRDDKQFFTDHPSA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VP+TTAQGEEL+KQIGAA YIECSSKTQQN+KAVFD+A
Sbjct  136  VPITTAQGEELKKQIGAAAYIECSSKTQQNIKAVFDSA  173



>ref|XP_011046692.1| PREDICTED: rac-like GTP-binding protein 5 [Populus euphratica]
Length=198

 Score =   289 bits (739),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLI YTSN FPTDY+PTVFDNFSANVV +G+TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGAD+F+LAFSL+S+ASYEN+ KKWIPEL+H+APG P++LVGTKLDLR+DK +  DHPG 
Sbjct  76   RGADIFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFFLDHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VP+TTAQGEELRK IGA  YIECSSKTQQNVKAVFDAA
Sbjct  136  VPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAA  173



>ref|XP_010692498.1| PREDICTED: rac-like GTP-binding protein 5 [Beta vulgaris subsp. 
vulgaris]
Length=196

 Score =   289 bits (739),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLI YTSN FPTDY+PTVFDNFSANVV +G TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL+S+ASYEN+ KKWIPEL+H+APG P++LVGTKLDLR+DK +  DHPG 
Sbjct  76   RGADVFILAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFFVDHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VP++T QGEELRK IGA YYIECSSKTQQNVKAVFDAA
Sbjct  136  VPISTQQGEELRKVIGAPYYIECSSKTQQNVKAVFDAA  173



>ref|XP_006451199.1| hypothetical protein CICLE_v10009470mg [Citrus clementina]
 ref|XP_006475657.1| PREDICTED: rac-like GTP-binding protein ARAC7-like [Citrus sinensis]
 gb|ESR64439.1| hypothetical protein CICLE_v10009470mg [Citrus clementina]
 gb|KDO42249.1| hypothetical protein CISIN_1g028239mg [Citrus sinensis]
Length=211

 Score =   289 bits (740),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANV  +G+ VNLGLWDTAGQEDY+RLRPLSY
Sbjct  16   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVAVDGSIVNLGLWDTAGQEDYSRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGAD+FVLAFSL+SRASYEN+LKKW+PEL+ FAP  P+VLVGTKLDLRED+ YLADH G 
Sbjct  76   RGADIFVLAFSLISRASYENVLKKWMPELRRFAPNVPIVLVGTKLDLREDRGYLADHVGS  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
              +TTAQGEELRKQIGAA YIECSSKTQQNVKAVFD A
Sbjct  136  NVITTAQGEELRKQIGAAAYIECSSKTQQNVKAVFDTA  173



>ref|XP_001779421.1| rop-family small GTPase [Physcomitrella patens]
 gb|EDQ55811.1| rop-family small GTPase [Physcomitrella patens]
Length=196

 Score =   288 bits (738),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLI YTSN FPTDY+PTVFDNFSANVV +G TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL+S+ASYENI KKWIPEL+H+AP  P++LVGTKLDLR+DK + ADHPG 
Sbjct  76   RGADVFLLAFSLISKASYENISKKWIPELRHYAPSVPIILVGTKLDLRDDKQFFADHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
             P+TT+QGEELR+ IGAA YIECSSKTQQNVKAVFDAA
Sbjct  136  APITTSQGEELRRSIGAASYIECSSKTQQNVKAVFDAA  173



>gb|ADE75718.1| unknown [Picea sitchensis]
 gb|ADE76598.1| unknown [Picea sitchensis]
Length=196

 Score =   288 bits (738),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLI YTSN FPTDY+PTVFDNFSANVV +G TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL+S+ASYENI KKWIPEL+H+AP  P++LVGTKLDLR+DK + ADHPG 
Sbjct  76   RGADVFLLAFSLISKASYENISKKWIPELRHYAPNVPIILVGTKLDLRDDKQFFADHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
             P+TT QGEEL+KQIGAA YIECSSKTQQNVKAVFDAA
Sbjct  136  APITTPQGEELKKQIGAAAYIECSSKTQQNVKAVFDAA  173



>ref|XP_002284205.1| PREDICTED: rac-like GTP-binding protein ARAC7 isoform X2 [Vitis 
vinifera]
 emb|CAN73708.1| hypothetical protein VITISV_023715 [Vitis vinifera]
 emb|CBI28044.3| unnamed protein product [Vitis vinifera]
Length=210

 Score =   289 bits (740),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANV  +G+ VNLGLWDTAGQEDY+RLRPLSY
Sbjct  16   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVAVDGSIVNLGLWDTAGQEDYSRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGAD+FVLAFSL+SRASYEN+LKKW+PEL+ FAP  P+VLVGTKLDLREDK YLADH G 
Sbjct  76   RGADIFVLAFSLISRASYENVLKKWMPELRRFAPNVPIVLVGTKLDLREDKGYLADHMGS  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
              +T+AQGEELRKQIGAA YIECSSKTQQNVKAVFD A
Sbjct  136  NVITSAQGEELRKQIGAAAYIECSSKTQQNVKAVFDTA  173



>ref|XP_007213176.1| hypothetical protein PRUPE_ppa027013mg [Prunus persica]
 ref|XP_008244853.1| PREDICTED: rac-like GTP-binding protein RAC2 [Prunus mume]
 gb|EMJ14375.1| hypothetical protein PRUPE_ppa027013mg [Prunus persica]
Length=196

 Score =   288 bits (738),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLI YTSN FPTDY+PTVFDNFSANVV +G+TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL+S+ASYENI KKWIPEL+H+AP  P+VLVGTKLDLREDK YL DHPG 
Sbjct  76   RGADVFLLAFSLISKASYENIAKKWIPELRHYAPTVPIVLVGTKLDLREDKEYLIDHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
             P++ AQGEEL+K IGAA YIECSSKTQQNVKAVFDAA
Sbjct  136  TPISIAQGEELKKAIGAAVYIECSSKTQQNVKAVFDAA  173



>ref|XP_010426684.1| PREDICTED: rac-like GTP-binding protein ARAC11 [Camelina sativa]
 ref|XP_010426685.1| PREDICTED: rac-like GTP-binding protein ARAC11 [Camelina sativa]
Length=197

 Score =   288 bits (738),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTC+LI YTSN FPTDY+PTVFDNFSANVV  G+TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVNGSTVNLGLWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL+S+ASYEN+ KKWIPEL+H+APG P+VLVGTKLDLR+DK +  DHPG 
Sbjct  76   RGADVFILAFSLISKASYENVSKKWIPELKHYAPGVPIVLVGTKLDLRDDKQFFIDHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VP+TTAQGEELRKQIG+  YIECSSKTQ+NVKAVFDAA
Sbjct  136  VPITTAQGEELRKQIGSPTYIECSSKTQENVKAVFDAA  173



>ref|XP_010656299.1| PREDICTED: rac-like GTP-binding protein ARAC7 isoform X1 [Vitis 
vinifera]
Length=215

 Score =   289 bits (740),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANV  +G+ VNLGLWDTAGQEDY+RLRPLSY
Sbjct  16   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVAVDGSIVNLGLWDTAGQEDYSRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGAD+FVLAFSL+SRASYEN+LKKW+PEL+ FAP  P+VLVGTKLDLREDK YLADH G 
Sbjct  76   RGADIFVLAFSLISRASYENVLKKWMPELRRFAPNVPIVLVGTKLDLREDKGYLADHMGS  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
              +T+AQGEELRKQIGAA YIECSSKTQQNVKAVFD A
Sbjct  136  NVITSAQGEELRKQIGAAAYIECSSKTQQNVKAVFDTA  173



>emb|CDO96917.1| unnamed protein product [Coffea canephora]
Length=198

 Score =   288 bits (738),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTC+LI YTSN FPTDY+PTVFDNFSANVV +G+TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSLVS+ASYEN+ KKWIPEL+H+APG PV+LVGTKLDLR+DK +  DHPG 
Sbjct  76   RGADVFILAFSLVSKASYENVSKKWIPELRHYAPGVPVILVGTKLDLRDDKQFFVDHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VP+TTAQGEELRK IGAA YIECS+KTQQNVK VFDAA
Sbjct  136  VPITTAQGEELRKLIGAASYIECSAKTQQNVKGVFDAA  173



>ref|XP_009614505.1| PREDICTED: rac-like GTP-binding protein RHO1 [Nicotiana tomentosiformis]
 ref|XP_009614506.1| PREDICTED: rac-like GTP-binding protein RHO1 [Nicotiana tomentosiformis]
 ref|XP_009614507.1| PREDICTED: rac-like GTP-binding protein RHO1 [Nicotiana tomentosiformis]
 ref|XP_009793499.1| PREDICTED: rac-like GTP-binding protein RHO1 [Nicotiana sylvestris]
 ref|XP_009793505.1| PREDICTED: rac-like GTP-binding protein RHO1 [Nicotiana sylvestris]
 ref|XP_009793512.1| PREDICTED: rac-like GTP-binding protein RHO1 [Nicotiana sylvestris]
 gb|AAD00117.1| NTGP2 [Nicotiana tabacum]
 emb|CAB57818.1| putative rac protein [Nicotiana tabacum]
Length=197

 Score =   288 bits (738),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTC+LI YTSN FPTDY+PTVFDNFSANVV  G+TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVNGSTVNLGLWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL+S+ASYEN+ KKWIPEL+H+APG P+VLVGTKLDLR+DK +  DHPG 
Sbjct  76   RGADVFILAFSLISKASYENVSKKWIPELKHYAPGVPIVLVGTKLDLRDDKQFFIDHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VP+TTAQGEELRK IGA  YIECSSKTQQNVKAVFDAA
Sbjct  136  VPITTAQGEELRKTIGAPAYIECSSKTQQNVKAVFDAA  173



>ref|XP_007200549.1| hypothetical protein PRUPE_ppa011737mg [Prunus persica]
 gb|EMJ01748.1| hypothetical protein PRUPE_ppa011737mg [Prunus persica]
Length=198

 Score =   288 bits (738),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLI YTSN FPTDY+PTVFDNFSANVV +G+TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL+S+ASYENI KKW+PEL+H+APG P++LVGTKLDLR+DK +  DHPG 
Sbjct  76   RGADVFLLAFSLISKASYENIAKKWVPELRHYAPGVPIILVGTKLDLRDDKQFFVDHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VP+TTAQGEEL+K IGA  YIECSSKTQQNVKAVFDAA
Sbjct  136  VPITTAQGEELKKLIGAPVYIECSSKTQQNVKAVFDAA  173



>gb|AEQ62559.1| Rac/Rop GTPase 2 [Aquilaria microcarpa]
Length=198

 Score =   288 bits (738),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTC+LI YTSN FPTDY+PTVFDNFSANVV +G TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL+S+ASYEN+ KKWIPEL+H+APG P++LVGTK+DLREDK +  DHPG 
Sbjct  76   RGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKMDLREDKQFFIDHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VP+TTAQGEELRK IGA  YIECSSKTQQNVKAVFDAA
Sbjct  136  VPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAA  173



>ref|XP_011093614.1| PREDICTED: rac-like GTP-binding protein ARAC7 isoform X3 [Sesamum 
indicum]
Length=200

 Score =   288 bits (738),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANV  +G  VNLGLWDTAGQEDY+RLRPLSY
Sbjct  16   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVAVDGNIVNLGLWDTAGQEDYSRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGAD+FVLAFSL+SRASYEN+LKKW+PEL+ FAP  P+VLVGTKLDLRED+ Y+ADH G 
Sbjct  76   RGADIFVLAFSLISRASYENVLKKWMPELRRFAPNVPIVLVGTKLDLREDRGYMADHMGS  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
              +TTAQGEELRKQIGAA YIECSSKTQQNVKAVFD A
Sbjct  136  NIITTAQGEELRKQIGAAAYIECSSKTQQNVKAVFDTA  173



>ref|XP_008455937.1| PREDICTED: rac-like GTP-binding protein RAC2 [Cucumis melo]
Length=196

 Score =   288 bits (737),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLI YTSN FPTDY+PTVFDNFSANV+ +G+TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCMLISYTSNTFPTDYVPTVFDNFSANVMVDGSTVNLGLWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL+S+ASYENI KKWIPEL+H+AP  P+VLVGTKLDLR+DK +L  HPG 
Sbjct  76   RGADVFLLAFSLISKASYENISKKWIPELRHYAPTVPIVLVGTKLDLRDDKQFLTSHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VP+TTAQGEEL+K IGAA YIECSSKTQQNVKAVFDAA
Sbjct  136  VPITTAQGEELKKSIGAAVYIECSSKTQQNVKAVFDAA  173



>ref|XP_009391005.1| PREDICTED: rac-like GTP-binding protein 5 [Musa acuminata subsp. 
malaccensis]
Length=198

 Score =   288 bits (737),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLI YTSN FPTDY+PTVFDNFSANVV +G+TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL+S+ASYEN+ KKWIPEL+H+APG P++LVGTKLDLR+DK +  DHPG 
Sbjct  76   RGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFFIDHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            +P++TAQGEELRK IGAA YIECSSKTQQNVKAVFD A
Sbjct  136  MPISTAQGEELRKLIGAAAYIECSSKTQQNVKAVFDTA  173



>ref|XP_010249660.1| PREDICTED: rac-like GTP-binding protein ARAC7 [Nelumbo nucifera]
Length=209

 Score =   288 bits (738),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANV  +G+ VNLGLWDTAGQEDY+RLRPLSY
Sbjct  16   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVAVDGSIVNLGLWDTAGQEDYSRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSL+SRASYEN+LKKW+PEL+ FAP  P+VLVGTKLDLR+DK YLADH G 
Sbjct  76   RGADVFVLAFSLLSRASYENVLKKWMPELRRFAPNVPIVLVGTKLDLRDDKGYLADHVGS  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
              +T+AQGEELRKQIGAA YIECSSKTQQN+KAVFD A
Sbjct  136  AAITSAQGEELRKQIGAAAYIECSSKTQQNIKAVFDTA  173



>emb|CDP01867.1| unnamed protein product [Coffea canephora]
Length=197

 Score =   288 bits (737),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTC+LI YTSN FPTDY+PTVFDNFSANVV  G+TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVNGSTVNLGLWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL+S+ASYEN+ KKWIPEL+H+APG P+VLVGTKLDLR+DK +  DHPG 
Sbjct  76   RGADVFILAFSLISKASYENVSKKWIPELKHYAPGVPIVLVGTKLDLRDDKQFFIDHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VP+TTAQGEELRK IGA  YIECSSKTQQNVK+VFDAA
Sbjct  136  VPITTAQGEELRKMIGAPAYIECSSKTQQNVKSVFDAA  173



>ref|NP_001266008.1| rac-like GTP-binding protein RAC1-like [Cicer arietinum]
 dbj|BAA76424.1| rac-type small GTP-binding protein [Cicer arietinum]
Length=197

 Score =   288 bits (737),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTC+LI YTSN FPTDY+PTVFDNFSANVV +G+T+NLGLWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVDGSTINLGLWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL+SRASYENI KKWIPEL+H+APG P++LVGTKLDLR+DK +  DHPG 
Sbjct  76   RGADVFLLAFSLISRASYENIAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFFQDHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VP+TTAQGEELRK IGA  YIECSSKTQ+NVKAVFDAA
Sbjct  136  VPITTAQGEELRKLIGAPVYIECSSKTQKNVKAVFDAA  173



>gb|AFK45598.1| unknown [Lotus japonicus]
Length=197

 Score =   288 bits (737),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTC+LI YTSN FPTDY+PTVFDNFSANVV +G+TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL+S+ASYEN+ KKWIPEL+H+APG P++LVGTKLDLR+DK +  DHPG 
Sbjct  76   RGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFFQDHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VP+TTAQGEELRK IGA  YIECSSKTQQN+KAVFDAA
Sbjct  136  VPITTAQGEELRKLIGAPMYIECSSKTQQNIKAVFDAA  173



>ref|XP_010920642.1| PREDICTED: rac-like GTP-binding protein 2 isoform X2 [Elaeis 
guineensis]
Length=211

 Score =   288 bits (738),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANV  +G+ VNLGLWDTAGQEDY+RLRPLSY
Sbjct  16   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVSVDGSIVNLGLWDTAGQEDYSRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGAD+FVLAFSL+SRASYEN+LKKW+PEL+ FAP  P++LVGTKLDLRED+ YLA+HPG 
Sbjct  76   RGADIFVLAFSLISRASYENVLKKWMPELRRFAPNVPIILVGTKLDLREDRGYLAEHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
              +T AQGEELRKQIGAA YIECSSKTQQNVKAVFD A
Sbjct  136  STITPAQGEELRKQIGAAAYIECSSKTQQNVKAVFDTA  173



>ref|XP_006376405.1| hypothetical protein POPTR_0013s12760g [Populus trichocarpa]
 ref|XP_011037428.1| PREDICTED: rac-like GTP-binding protein RAC2 [Populus euphratica]
 gb|ABK92572.1| unknown [Populus trichocarpa]
 gb|ERP54202.1| hypothetical protein POPTR_0013s12760g [Populus trichocarpa]
Length=197

 Score =   288 bits (737),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLI YTSN FPTDY+PTVFDNFSANVV +G+TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL+S+ASYENI KKWI EL+H+AP  PVVLVGTKLDLR DK YL DHPG 
Sbjct  76   RGADVFLLAFSLISKASYENIAKKWISELRHYAPTVPVVLVGTKLDLRNDKQYLIDHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
             P+TTAQGEEL+K IGAA YIECSSKTQQNVKAVFDAA
Sbjct  136  TPITTAQGEELKKMIGAAVYIECSSKTQQNVKAVFDAA  173



>gb|KHG13478.1| Rac-like GTP-binding protein 5 [Gossypium arboreum]
Length=196

 Score =   288 bits (737),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 128/158 (81%), Positives = 148/158 (94%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTC+LI YTSN FPTDY+PTVFDNFSANVV +G+TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL+S+ASYEN+ KKWIPEL+H+APG P+VLVGTKLDLR+D+ +  DHPG 
Sbjct  76   RGADVFILAFSLISKASYENVTKKWIPELKHYAPGVPIVLVGTKLDLRDDQQFFVDHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VP++TAQGEELRKQ+G++ YIECSSKTQQNVKAVFD+A
Sbjct  136  VPISTAQGEELRKQVGSSAYIECSSKTQQNVKAVFDSA  173



>ref|XP_010498441.1| PREDICTED: rac-like GTP-binding protein ARAC5 [Camelina sativa]
Length=196

 Score =   288 bits (737),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLI YTSN FPTDY+PTVFDNFSANVV +G TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL+S+ASYENI KKWIPEL+H+APG P++LVGTKLDLR+DK +  DHPG 
Sbjct  76   RGADVFILAFSLISKASYENIAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFFIDHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VP+TT QGEEL+K IG+A YIECSSKTQQNVKAVFDAA
Sbjct  136  VPITTNQGEELKKLIGSAVYIECSSKTQQNVKAVFDAA  173



>ref|XP_010066279.1| PREDICTED: rac-like GTP-binding protein 5 isoform X1 [Eucalyptus 
grandis]
 gb|KCW64123.1| hypothetical protein EUGRSUZ_G01779 [Eucalyptus grandis]
 gb|KCW64124.1| hypothetical protein EUGRSUZ_G01779 [Eucalyptus grandis]
Length=198

 Score =   288 bits (737),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLI YTSN FPTDY+PTVFDNFSANVV +G+TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL S+ASYEN+ KKWIPEL+H+APG PV+LVGTKLDLR+DK +  DHPG 
Sbjct  76   RGADVFLLAFSLTSKASYENVAKKWIPELRHYAPGVPVILVGTKLDLRDDKQFFLDHPGT  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VP+TTAQGEEL+K IGAA YIECSSKTQQNVK VFDAA
Sbjct  136  VPITTAQGEELKKLIGAAAYIECSSKTQQNVKVVFDAA  173



>ref|XP_009418766.1| PREDICTED: rac-like GTP-binding protein 5 [Musa acuminata subsp. 
malaccensis]
Length=197

 Score =   288 bits (737),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLI YTSN FPTDY+PTVFDNFSANVV +G TVN+GLWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNIGLWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL+S+ASYEN+ KKWIPEL H+APG P++LVGTKLDLR+DK +  DHPG 
Sbjct  76   RGADVFLLAFSLISKASYENVAKKWIPELSHYAPGVPIILVGTKLDLRDDKQFFIDHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VP++TAQGEELRK IGAA YIECSSKTQQNVKAVFDAA
Sbjct  136  VPMSTAQGEELRKLIGAAAYIECSSKTQQNVKAVFDAA  173



>ref|XP_002440067.1| hypothetical protein SORBIDRAFT_09g025400 [Sorghum bicolor]
 gb|EES18497.1| hypothetical protein SORBIDRAFT_09g025400 [Sorghum bicolor]
Length=212

 Score =   288 bits (738),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLICYTSNKFPTDYIPTVFDNFSANV  +G  VNLGLWDTAGQEDY+RLRPLSY
Sbjct  16   AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVSVDGNIVNLGLWDTAGQEDYSRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVFVLAFSL+SRASYEN+LKKW+PEL+ FAP  PVVLVGTKLDLR+ + YLADHPG 
Sbjct  76   RGADVFVLAFSLISRASYENVLKKWMPELRRFAPNVPVVLVGTKLDLRDHRAYLADHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
              +TTAQGEELRKQIGAA YIECSSKTQQNVK+VFD A
Sbjct  136  STITTAQGEELRKQIGAAAYIECSSKTQQNVKSVFDTA  173



>ref|XP_007017852.1| RAC-like 3 [Theobroma cacao]
 gb|EOY15077.1| RAC-like 3 [Theobroma cacao]
Length=197

 Score =   288 bits (736),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 129/158 (82%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSY  182
            AVGKTCMLI YTSN FPTDY+PTVFDNFSANVV +G+TVNLGLWDTAGQEDYNRLRPLSY
Sbjct  16   AVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSY  75

Query  183  RGADVFVLAFSLVSRASYENILKKWIPELQHFAPGTPVVLVGTKLDLREDKHYLADHPGL  362
            RGADVF+LAFSL+S+ASYEN+ KKWIPEL+H+APG P++LVGTKLDLR+D+ +  DHPG 
Sbjct  76   RGADVFILAFSLISKASYENVAKKWIPELKHYAPGVPIILVGTKLDLRDDQQFFVDHPGA  135

Query  363  VPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAA  476
            VP++ AQGEELRKQIG+  YIECSSKTQQNVKAVFDAA
Sbjct  136  VPISAAQGEELRKQIGSPAYIECSSKTQQNVKAVFDAA  173



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 552245584395