BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002C15

Length=496
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009793120.1|  PREDICTED: protein GRIP-like isoform X2            172   9e-48   Nicotiana sylvestris
ref|XP_006341360.1|  PREDICTED: myosin-9-like                           172   3e-47   Solanum tuberosum [potatoes]
ref|XP_004235934.1|  PREDICTED: factor of DNA methylation 1             172   4e-47   Solanum lycopersicum
ref|XP_009793116.1|  PREDICTED: protein MLP1-like isoform X1            172   6e-47   Nicotiana sylvestris
ref|XP_009605543.1|  PREDICTED: myb-like protein X isoform X1           169   7e-46   Nicotiana tomentosiformis
ref|XP_009605544.1|  PREDICTED: myb-like protein X isoform X2           168   1e-45   Nicotiana tomentosiformis
ref|XP_009626788.1|  PREDICTED: coiled-coil domain-containing pro...    160   5e-43   Nicotiana tomentosiformis
ref|XP_009763380.1|  PREDICTED: myosin type-2 heavy chain 1-like        157   8e-42   Nicotiana sylvestris
emb|CDO98219.1|  unnamed protein product                                157   1e-41   Coffea canephora [robusta coffee]
ref|XP_011073344.1|  PREDICTED: factor of DNA methylation 1             153   2e-40   Sesamum indicum [beniseed]
gb|KJB56538.1|  hypothetical protein B456_009G124400                    152   7e-40   Gossypium raimondii
gb|KHG15531.1|  suppressor of gene silencing 3                          152   7e-40   Gossypium arboreum [tree cotton]
gb|KJB56539.1|  hypothetical protein B456_009G124400                    152   8e-40   Gossypium raimondii
gb|KJB56540.1|  hypothetical protein B456_009G124400                    150   2e-39   Gossypium raimondii
emb|CAN62667.1|  hypothetical protein VITISV_028278                     150   2e-39   Vitis vinifera
ref|XP_002267670.1|  PREDICTED: factor of DNA methylation 1 isofo...    150   4e-39   Vitis vinifera
ref|XP_010656778.1|  PREDICTED: factor of DNA methylation 1 isofo...    150   5e-39   Vitis vinifera
emb|CAN83544.1|  hypothetical protein VITISV_021077                     149   5e-39   Vitis vinifera
ref|XP_007214938.1|  hypothetical protein PRUPE_ppa002776mg             149   1e-38   Prunus persica
ref|XP_007023402.1|  XH/XS domain-containing protein                    148   2e-38   
ref|XP_008228782.1|  PREDICTED: interaptin-like                         147   4e-38   Prunus mume [ume]
ref|XP_002267381.1|  PREDICTED: factor of DNA methylation 1             145   1e-37   Vitis vinifera
gb|EYU21722.1|  hypothetical protein MIMGU_mgv1a002818mg                144   4e-37   Erythranthe guttata [common monkey flower]
gb|KDO42995.1|  hypothetical protein CISIN_1g006762mg                   140   1e-35   Citrus sinensis [apfelsine]
ref|XP_003530299.1|  PREDICTED: structural maintenance of chromos...    140   2e-35   Glycine max [soybeans]
gb|KDO42997.1|  hypothetical protein CISIN_1g006762mg                   138   3e-35   Citrus sinensis [apfelsine]
ref|XP_006465197.1|  PREDICTED: myosin-10-like                          139   5e-35   Citrus sinensis [apfelsine]
ref|XP_006427593.1|  hypothetical protein CICLE_v10025142mg             138   5e-35   
ref|XP_008361182.1|  PREDICTED: putative leucine-rich repeat-cont...    138   9e-35   Malus domestica [apple tree]
ref|XP_008375509.1|  PREDICTED: putative leucine-rich repeat-cont...    138   9e-35   Malus domestica [apple tree]
ref|XP_003531733.1|  PREDICTED: protein MLP1-like isoform X1            137   1e-34   Glycine max [soybeans]
ref|XP_010063555.1|  PREDICTED: CAP-Gly domain-containing linker ...    137   2e-34   Eucalyptus grandis [rose gum]
ref|XP_007135808.1|  hypothetical protein PHAVU_010G160300g             135   6e-34   Phaseolus vulgaris [French bean]
ref|XP_007135809.1|  hypothetical protein PHAVU_010G160300g             135   7e-34   Phaseolus vulgaris [French bean]
gb|KDP41984.1|  hypothetical protein JCGZ_27002                         135   8e-34   Jatropha curcas
ref|XP_002527307.1|  conserved hypothetical protein                     134   2e-33   Ricinus communis
gb|AES86419.2|  XH/XS domain protein                                    132   8e-33   Medicago truncatula
ref|XP_003604222.1|  hypothetical protein MTR_4g006760                  132   1e-32   
ref|XP_008375623.1|  PREDICTED: uncharacterized protein LOC103438859    129   2e-32   
ref|XP_011467028.1|  PREDICTED: factor of DNA methylation 1             130   4e-32   Fragaria vesca subsp. vesca
ref|XP_003610367.1|  hypothetical protein MTR_4g131350                  130   7e-32   
ref|XP_010265647.1|  PREDICTED: factor of DNA methylation 1-like ...    129   1e-31   Nelumbo nucifera [Indian lotus]
ref|XP_010265646.1|  PREDICTED: factor of DNA methylation 1-like ...    129   1e-31   Nelumbo nucifera [Indian lotus]
gb|KEH32486.1|  XH/XS domain protein                                    129   1e-31   Medicago truncatula
ref|XP_010678967.1|  PREDICTED: factor of DNA methylation 1-like        129   2e-31   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010092186.1|  hypothetical protein L484_013504                   127   6e-31   Morus notabilis
ref|XP_010265641.1|  PREDICTED: factor of DNA methylation 1-like ...    127   6e-31   Nelumbo nucifera [Indian lotus]
ref|XP_010101455.1|  hypothetical protein L484_012877                   126   1e-30   Morus notabilis
ref|XP_004510284.1|  PREDICTED: uncharacterized protein PFB0145c-...    125   3e-30   
ref|XP_010537880.1|  PREDICTED: factor of DNA methylation 1-like        125   3e-30   Tarenaya hassleriana [spider flower]
emb|CBI40115.3|  unnamed protein product                                124   7e-30   Vitis vinifera
ref|XP_002303841.1|  XH domain-containing family protein                124   1e-29   Populus trichocarpa [western balsam poplar]
gb|EPS59185.1|  hypothetical protein M569_15623                         122   4e-29   Genlisea aurea
ref|XP_006416865.1|  hypothetical protein EUTSA_v10007054mg             121   8e-29   Eutrema salsugineum [saltwater cress]
gb|KGN44516.1|  hypothetical protein Csa_7G323110                       120   9e-29   Cucumis sativus [cucumbers]
emb|CDX81740.1|  BnaC08g38610D                                          119   2e-28   
ref|XP_004139640.1|  PREDICTED: uncharacterized protein LOC101205093    120   2e-28   Cucumis sativus [cucumbers]
ref|XP_008461480.1|  PREDICTED: putative leucine-rich repeat-cont...    120   3e-28   Cucumis melo [Oriental melon]
ref|XP_008454606.1|  PREDICTED: putative leucine-rich repeat-cont...    119   4e-28   Cucumis melo [Oriental melon]
ref|XP_008454609.1|  PREDICTED: putative leucine-rich repeat-cont...    119   5e-28   Cucumis melo [Oriental melon]
ref|XP_010678965.1|  PREDICTED: factor of DNA methylation 1-like        115   2e-26   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010497500.1|  PREDICTED: factor of DNA methylation 1             113   1e-25   Camelina sativa [gold-of-pleasure]
ref|XP_009117794.1|  PREDICTED: myosin-11-like                          113   1e-25   Brassica rapa
emb|CDY52860.1|  BnaA09g56520D                                          113   1e-25   Brassica napus [oilseed rape]
dbj|BAE99100.1|  hypothetical protein                                   110   3e-25   Arabidopsis thaliana [mouse-ear cress]
ref|NP_178194.1|  FACTOR OF DNA METHYLATION 5                           109   2e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010459126.1|  PREDICTED: factor of DNA methylation 1-like        108   2e-24   Camelina sativa [gold-of-pleasure]
ref|XP_003610364.1|  hypothetical protein MTR_4g131310                  106   4e-24   
emb|CDX79353.1|  BnaC06g19500D                                          107   9e-24   
ref|NP_173043.1|  factor of DNA methylation 1                           107   1e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010476691.1|  PREDICTED: factor of DNA methylation 1-like        107   1e-23   
ref|XP_006389833.1|  hypothetical protein EUTSA_v10018261mg             107   1e-23   Eutrema salsugineum [saltwater cress]
ref|XP_009104485.1|  PREDICTED: myosin-9-like                           106   2e-23   Brassica rapa
emb|CDX67967.1|  BnaA07g20070D                                          106   3e-23   
ref|XP_006300858.1|  hypothetical protein CARUB_v10019950mg             103   1e-22   
ref|XP_002890136.1|  XH/XS domain-containing protein                    103   1e-22   
ref|XP_006300857.1|  hypothetical protein CARUB_v10019950mg             103   2e-22   Capsella rubella
ref|XP_010937610.1|  PREDICTED: factor of DNA methylation 1-like        101   1e-21   
ref|NP_567176.2|  XH/XS domain-containing protein                       101   1e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006306990.1|  hypothetical protein CARUB_v10008566mg             101   2e-21   Capsella rubella
gb|AAF02798.1|AF195115_18  F5I10.22 gene product                        101   2e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009149026.1|  PREDICTED: nuclear mitotic apparatus protein 1   99.8    6e-21   Brassica rapa
ref|XP_010472874.1|  PREDICTED: factor of DNA methylation 5-like      99.4    8e-21   Camelina sativa [gold-of-pleasure]
ref|XP_010429902.1|  PREDICTED: factor of DNA methylation 5-like      99.0    9e-21   Camelina sativa [gold-of-pleasure]
ref|XP_010417660.1|  PREDICTED: factor of DNA methylation 5-like      98.2    2e-20   Camelina sativa [gold-of-pleasure]
ref|XP_006391023.1|  hypothetical protein EUTSA_v10019728mg           97.8    3e-20   
ref|XP_008799862.1|  PREDICTED: MAR-binding filament-like protein 1   97.1    5e-20   Phoenix dactylifera
ref|XP_010910789.1|  PREDICTED: factor of DNA methylation 1-like      96.7    5e-20   
emb|CDY33370.1|  BnaC05g12130D                                        96.7    1e-19   Brassica napus [oilseed rape]
ref|XP_008784591.1|  PREDICTED: uncharacterized protein LOC103703501  95.9    1e-19   Phoenix dactylifera
emb|CDY35897.1|  BnaA07g00900D                                        90.1    1e-19   Brassica napus [oilseed rape]
ref|XP_010256908.1|  PREDICTED: protein INVOLVED IN DE NOVO 2-like    95.5    2e-19   Nelumbo nucifera [Indian lotus]
ref|XP_010067411.1|  PREDICTED: coiled-coil domain-containing pro...  94.4    4e-19   Eucalyptus grandis [rose gum]
gb|KCW65539.1|  hypothetical protein EUGRSUZ_G02937                   94.4    5e-19   Eucalyptus grandis [rose gum]
gb|EEC75682.1|  hypothetical protein OsI_12489                        91.7    2e-18   Oryza sativa Indica Group [Indian rice]
gb|AAO60001.1|  putative XS domain containing protein                 90.1    7e-18   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008802711.1|  PREDICTED: paramyosin, long form-like            89.4    2e-17   Phoenix dactylifera
gb|KHN04171.1|  hypothetical protein glysoja_032667                   87.8    4e-17   Glycine soja [wild soybean]
ref|XP_002443867.1|  hypothetical protein SORBIDRAFT_07g003550        88.2    5e-17   
ref|XP_006659121.1|  PREDICTED: putative leucine-rich repeat-cont...  88.2    5e-17   Oryza brachyantha
ref|XP_007163408.1|  hypothetical protein PHAVU_001G232400g           88.2    5e-17   Phaseolus vulgaris [French bean]
ref|XP_011091511.1|  PREDICTED: protein INVOLVED IN DE NOVO 2         87.8    6e-17   Sesamum indicum [beniseed]
gb|KDO41499.1|  hypothetical protein CISIN_1g047081mg                 86.3    1e-16   Citrus sinensis [apfelsine]
ref|XP_006431941.1|  hypothetical protein CICLE_v10000571mg           86.7    1e-16   
ref|XP_006491885.1|  PREDICTED: calponin homology domain-containi...  86.3    2e-16   
gb|EMT06773.1|  hypothetical protein F775_17939                       86.7    2e-16   
ref|XP_006435547.1|  hypothetical protein CICLE_v10030937mg           86.3    2e-16   
gb|KDO69293.1|  hypothetical protein CISIN_1g0065972mg                86.3    2e-16   Citrus sinensis [apfelsine]
ref|XP_006486475.1|  PREDICTED: intracellular protein transport p...  86.3    2e-16   
ref|XP_010658558.1|  PREDICTED: protein INVOLVED IN DE NOVO 2 iso...  86.7    2e-16   Vitis vinifera
ref|XP_006431940.1|  hypothetical protein CICLE_v10000571mg           86.3    2e-16   Citrus clementina [clementine]
ref|XP_002278500.1|  PREDICTED: protein INVOLVED IN DE NOVO 2 iso...  86.3    3e-16   Vitis vinifera
ref|XP_011089483.1|  PREDICTED: protein INVOLVED IN DE NOVO 2-like    83.2    3e-16   Sesamum indicum [beniseed]
ref|XP_006435548.1|  hypothetical protein CICLE_v10030937mg           85.9    3e-16   Citrus clementina [clementine]
ref|XP_006491884.1|  PREDICTED: calponin homology domain-containi...  85.9    4e-16   Citrus sinensis [apfelsine]
gb|KDO69291.1|  hypothetical protein CISIN_1g0065972mg                85.9    4e-16   Citrus sinensis [apfelsine]
gb|EAY85442.1|  hypothetical protein OsI_06823                        85.1    4e-16   Oryza sativa Indica Group [Indian rice]
gb|EMT17491.1|  hypothetical protein F775_14734                       85.5    7e-16   
gb|EMS54623.1|  hypothetical protein TRIUR3_33647                     85.1    7e-16   Triticum urartu
ref|XP_009416142.1|  PREDICTED: uncharacterized protein LOC103996844  84.7    7e-16   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN17925.1|  hypothetical protein glysoja_017976                   84.7    8e-16   Glycine soja [wild soybean]
ref|XP_003538408.1|  PREDICTED: putative leucine-rich repeat-cont...  84.7    8e-16   
gb|EEE56772.1|  hypothetical protein OsJ_06333                        85.1    8e-16   Oryza sativa Japonica Group [Japonica rice]
dbj|BAD21477.1|  putative X1                                          84.7    8e-16   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001168342.1|  putative XH domain family protein                84.7    9e-16   Zea mays [maize]
ref|XP_002533154.1|  conserved hypothetical protein                   84.0    1e-15   Ricinus communis
ref|XP_006362467.1|  PREDICTED: myosin-2 heavy chain-like isoform X2  84.0    2e-15   Solanum tuberosum [potatoes]
ref|XP_006362466.1|  PREDICTED: myosin-2 heavy chain-like isoform X1  84.0    2e-15   
ref|XP_004972827.1|  PREDICTED: synaptonemal complex protein 1-li...  83.6    2e-15   
gb|EMT14402.1|  hypothetical protein F775_20219                       84.0    2e-15   
ref|XP_004972828.1|  PREDICTED: synaptonemal complex protein 1-li...  83.6    2e-15   Setaria italica
ref|XP_010678966.1|  PREDICTED: factor of DNA methylation 5-like      83.2    2e-15   Beta vulgaris subsp. vulgaris [field beet]
gb|KGN50554.1|  hypothetical protein Csa_5G182100                     83.6    2e-15   Cucumis sativus [cucumbers]
ref|XP_006846222.1|  hypothetical protein AMTR_s00012p00230440        83.2    3e-15   Amborella trichopoda
gb|KDP44945.1|  hypothetical protein JCGZ_01445                       82.8    4e-15   Jatropha curcas
ref|XP_007156380.1|  hypothetical protein PHAVU_003G281400g           82.8    4e-15   Phaseolus vulgaris [French bean]
tpg|DAA50216.1|  TPA: putative XH domain family protein               82.8    4e-15   
ref|XP_006585879.1|  PREDICTED: myosin heavy chain, clone 203-lik...  82.4    5e-15   Glycine max [soybeans]
ref|XP_004968083.1|  PREDICTED: synaptonemal complex protein 1-like   82.4    5e-15   Setaria italica
emb|CDP00105.1|  unnamed protein product                              82.4    5e-15   Coffea canephora [robusta coffee]
ref|XP_004147687.1|  PREDICTED: uncharacterized protein LOC101219429  82.0    7e-15   Cucumis sativus [cucumbers]
ref|XP_004161917.1|  PREDICTED: uncharacterized LOC101219429          82.0    7e-15   
ref|XP_004240949.1|  PREDICTED: protein INVOLVED IN DE NOVO 2         82.0    7e-15   Solanum lycopersicum
gb|ACF22790.1|  gene X-like protein                                   82.0    8e-15   Brachypodium distachyon [annual false brome]
ref|XP_010234408.1|  PREDICTED: factor of DNA methylation 1-like ...  81.6    8e-15   Brachypodium distachyon [annual false brome]
ref|XP_010234409.1|  PREDICTED: factor of DNA methylation 1-like ...  81.6    8e-15   Brachypodium distachyon [annual false brome]
gb|KHN07563.1|  hypothetical protein glysoja_019670                   81.3    1e-14   Glycine soja [wild soybean]
ref|XP_010922973.1|  PREDICTED: protein INVOLVED IN DE NOVO 2-like    80.5    2e-14   
ref|XP_008461675.1|  PREDICTED: flagellar attachment zone protein 1   80.9    2e-14   Cucumis melo [Oriental melon]
gb|KHN27026.1|  hypothetical protein glysoja_039182                   80.5    2e-14   Glycine soja [wild soybean]
ref|XP_003559697.1|  PREDICTED: factor of DNA methylation 4-like      80.5    2e-14   Brachypodium distachyon [annual false brome]
ref|XP_007009302.1|  XH/XS domain-containing protein isoform 5        80.1    3e-14   
ref|XP_007009300.1|  XH/XS domain-containing protein, putative is...  80.1    3e-14   
ref|XP_007009301.1|  XH/XS domain-containing protein, putative is...  80.1    3e-14   
ref|XP_007009298.1|  XH/XS domain-containing protein, putative is...  80.1    3e-14   
ref|XP_007009299.1|  XH/XS domain-containing protein, putative is...  80.1    3e-14   
ref|XP_010690719.1|  PREDICTED: protein INVOLVED IN DE NOVO 2         79.7    4e-14   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006599359.1|  PREDICTED: uncharacterized protein PFB0765w-...  79.3    6e-14   
emb|CDY08088.1|  BnaA06g16380D                                        78.6    1e-13   Brassica napus [oilseed rape]
ref|XP_004307495.1|  PREDICTED: protein INVOLVED IN DE NOVO 2         78.2    1e-13   Fragaria vesca subsp. vesca
emb|CAN81646.1|  hypothetical protein VITISV_010798                   76.6    2e-13   Vitis vinifera
ref|XP_009149803.1|  PREDICTED: myosin-11                             77.4    3e-13   Brassica rapa
ref|XP_007220898.1|  hypothetical protein PRUPE_ppa002712mg           77.4    3e-13   Prunus persica
ref|XP_009343557.1|  PREDICTED: myosin heavy chain, cardiac muscl...  77.4    3e-13   
ref|XP_002464269.1|  hypothetical protein SORBIDRAFT_01g015250        77.4    3e-13   
ref|XP_006846214.1|  hypothetical protein AMTR_s00012p00226630        77.4    3e-13   Amborella trichopoda
gb|KHG15173.1|  Forkhead-associated domain-containing 1               77.4    3e-13   Gossypium arboreum [tree cotton]
ref|XP_004503147.1|  PREDICTED: myosin-11-like isoform X1             77.4    3e-13   Cicer arietinum [garbanzo]
gb|KJB76093.1|  hypothetical protein B456_012G071000                  77.4    3e-13   Gossypium raimondii
ref|XP_011027214.1|  PREDICTED: protein INVOLVED IN DE NOVO 2         77.4    3e-13   Populus euphratica
ref|XP_008354129.1|  PREDICTED: myosin-2 heavy chain-like             77.0    3e-13   
ref|XP_008343538.1|  PREDICTED: myosin-2 heavy chain-like             77.0    3e-13   
ref|XP_010940184.1|  PREDICTED: factor of DNA methylation 1-like      77.4    4e-13   
gb|EYU18986.1|  hypothetical protein MIMGU_mgv1a011844mg              74.3    4e-13   Erythranthe guttata [common monkey flower]
gb|KJB67635.1|  hypothetical protein B456_010G201400                  77.0    4e-13   Gossypium raimondii
ref|XP_009387522.1|  PREDICTED: uncharacterized protein LOC103974422  77.0    4e-13   
ref|XP_009357740.1|  PREDICTED: myosin heavy chain, cardiac muscl...  76.3    6e-13   Pyrus x bretschneideri [bai li]
emb|CDY05861.1|  BnaC08g20380D                                        76.6    6e-13   
gb|KEH34701.1|  XH/XS domain protein                                  76.3    6e-13   Medicago truncatula
gb|EYU43462.1|  hypothetical protein MIMGU_mgv1a002657mg              76.3    6e-13   Erythranthe guttata [common monkey flower]
gb|KHG06632.1|  KilA-N domain-containing protein                      76.3    7e-13   Gossypium arboreum [tree cotton]
gb|KJB67636.1|  hypothetical protein B456_010G201400                  75.5    8e-13   Gossypium raimondii
gb|EMS45500.1|  hypothetical protein TRIUR3_12203                     75.9    9e-13   Triticum urartu
ref|XP_008371804.1|  PREDICTED: WEB family protein At4g27595, chl...  75.5    1e-12   Malus domestica [apple tree]
ref|NP_001043655.1|  Os01g0633200                                     75.1    2e-12   
gb|EEC71144.1|  hypothetical protein OsI_02969                        74.7    2e-12   Oryza sativa Indica Group [Indian rice]
ref|XP_002316281.2|  XH/XS domain-containing family protein           75.1    2e-12   Populus trichocarpa [western balsam poplar]
ref|XP_010426360.1|  PREDICTED: protein INVOLVED IN DE NOVO 2         74.3    3e-12   Camelina sativa [gold-of-pleasure]
ref|XP_006292435.1|  hypothetical protein CARUB_v10018651mg           74.3    3e-12   Capsella rubella
ref|XP_010651011.1|  PREDICTED: protein INVOLVED IN DE NOVO 2         73.9    4e-12   
ref|XP_006404228.1|  hypothetical protein EUTSA_v10010188mg           73.6    5e-12   Eutrema salsugineum [saltwater cress]
emb|CDX77918.1|  BnaC03g53010D                                        72.8    8e-12   
ref|XP_010520104.1|  PREDICTED: protein INVOLVED IN DE NOVO 2-like    72.8    9e-12   Tarenaya hassleriana [spider flower]
ref|XP_006644407.1|  PREDICTED: intracellular protein transport p...  72.8    1e-11   Oryza brachyantha
ref|XP_002875916.1|  XH/XS domain-containing protein                  72.4    1e-11   
ref|XP_009799105.1|  PREDICTED: golgin candidate 4                    72.0    2e-11   Nicotiana sylvestris
ref|XP_009150181.1|  PREDICTED: uncharacterized protein LOC103873521  72.0    2e-11   Brassica rapa
emb|CAB62356.1|  putative protein                                     71.6    2e-11   Arabidopsis thaliana [mouse-ear cress]
ref|NP_190436.2|  XH/XS domain-containing protein                     71.6    3e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010503501.1|  PREDICTED: protein INVOLVED IN DE NOVO 2-like    71.2    3e-11   Camelina sativa [gold-of-pleasure]
ref|XP_003569414.1|  PREDICTED: factor of DNA methylation 1-like      70.9    4e-11   Brachypodium distachyon [annual false brome]
emb|CDY37917.1|  BnaA06g19000D                                        70.9    4e-11   Brassica napus [oilseed rape]
ref|XP_008233634.1|  PREDICTED: LOW QUALITY PROTEIN: CAP-Gly doma...  70.9    5e-11   Prunus mume [ume]
ref|XP_010108755.1|  hypothetical protein L484_011413                 70.9    5e-11   
gb|AGT17258.1|  X1 protein                                            70.1    7e-11   Saccharum hybrid cultivar R570
ref|XP_002456013.1|  hypothetical protein SORBIDRAFT_03g028860        70.1    8e-11   Sorghum bicolor [broomcorn]
ref|XP_009589398.1|  PREDICTED: golgin candidate 4                    69.7    9e-11   Nicotiana tomentosiformis
gb|EYU37790.1|  hypothetical protein MIMGU_mgv1a002821mg              69.7    9e-11   Erythranthe guttata [common monkey flower]
gb|AGT16789.1|  hypothetical protein SHCRBa_009_B01_R_10              69.7    1e-10   Saccharum hybrid cultivar R570
gb|AGT16810.1|  transcription factor                                  68.6    3e-10   Saccharum hybrid cultivar R570
ref|XP_003569416.1|  PREDICTED: factor of DNA methylation 1-like      68.2    3e-10   Brachypodium distachyon [annual false brome]
ref|XP_006595902.1|  PREDICTED: uncharacterized protein LOC100790...  68.6    3e-10   
ref|XP_003545257.1|  PREDICTED: uncharacterized protein LOC100790...  68.2    4e-10   Glycine max [soybeans]
gb|KHN20923.1|  hypothetical protein glysoja_009231                   68.2    4e-10   Glycine soja [wild soybean]
gb|KHN41100.1|  hypothetical protein glysoja_013442                   67.8    6e-10   Glycine soja [wild soybean]
ref|XP_006575506.1|  PREDICTED: uncharacterized protein LOC100806...  67.8    6e-10   Glycine max [soybeans]
ref|XP_006575505.1|  PREDICTED: uncharacterized protein LOC100806...  67.4    7e-10   
ref|XP_006575503.1|  PREDICTED: uncharacterized protein LOC100806...  67.4    7e-10   Glycine max [soybeans]
ref|XP_003616411.1|  Transcription factor X1-like protein             67.4    8e-10   Medicago truncatula
ref|XP_004490889.1|  PREDICTED: uncharacterized protein LOC101499...  67.0    1e-09   Cicer arietinum [garbanzo]
emb|CDY35048.1|  BnaA06g10580D                                        66.6    1e-09   Brassica napus [oilseed rape]
gb|EMT16668.1|  hypothetical protein F775_11900                       66.2    1e-09   
gb|EPS61376.1|  hypothetical protein M569_13419                       65.5    3e-09   Genlisea aurea
ref|XP_010520107.1|  PREDICTED: protein INVOLVED IN DE NOVO 2-like    65.1    3e-09   Tarenaya hassleriana [spider flower]
ref|XP_010685748.1|  PREDICTED: factor of DNA methylation 4           64.7    4e-09   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006584160.1|  PREDICTED: aquaporin NIP3-3-like                 63.2    4e-09   
ref|NP_001054677.1|  Os05g0153200                                     64.7    5e-09   
gb|EAY96594.1|  hypothetical protein OsI_18500                        64.3    5e-09   Oryza sativa Indica Group [Indian rice]
ref|XP_009610603.1|  PREDICTED: uncharacterized protein LOC104104...  64.7    6e-09   Nicotiana tomentosiformis
ref|XP_009791219.1|  PREDICTED: uncharacterized protein LOC104238...  64.7    6e-09   Nicotiana sylvestris
ref|XP_009610609.1|  PREDICTED: uncharacterized protein LOC104104...  64.7    6e-09   Nicotiana tomentosiformis
ref|XP_009791212.1|  PREDICTED: uncharacterized protein LOC104238...  64.7    6e-09   Nicotiana sylvestris
ref|XP_009791210.1|  PREDICTED: uncharacterized protein LOC104238...  64.7    6e-09   Nicotiana sylvestris
ref|XP_009610604.1|  PREDICTED: uncharacterized protein LOC104104...  64.7    6e-09   Nicotiana tomentosiformis
ref|XP_009791213.1|  PREDICTED: uncharacterized protein LOC104238...  64.7    6e-09   Nicotiana sylvestris
gb|KHN12113.1|  hypothetical protein glysoja_048283                   62.0    6e-09   Glycine soja [wild soybean]
ref|XP_009610608.1|  PREDICTED: uncharacterized protein LOC104104...  64.7    6e-09   Nicotiana tomentosiformis
ref|XP_006424841.1|  hypothetical protein CICLE_v10029911mg           64.3    6e-09   
ref|XP_009791218.1|  PREDICTED: uncharacterized protein LOC104238...  64.7    6e-09   Nicotiana sylvestris
ref|XP_008660210.1|  PREDICTED: uncharacterized protein LOC103639...  63.9    6e-09   
ref|XP_009610606.1|  PREDICTED: uncharacterized protein LOC104104...  64.7    6e-09   Nicotiana tomentosiformis
gb|EEE62370.1|  hypothetical protein OsJ_17159                        64.3    7e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008660211.1|  PREDICTED: uncharacterized protein LOC103639...  63.2    8e-09   
ref|XP_007141865.1|  hypothetical protein PHAVU_008G232300g           63.2    2e-08   Phaseolus vulgaris [French bean]
ref|XP_003568908.1|  PREDICTED: factor of DNA methylation 1-like      62.8    2e-08   
ref|XP_003568833.1|  PREDICTED: factor of DNA methylation 1-like      62.8    2e-08   Brachypodium distachyon [annual false brome]
ref|XP_006407322.1|  hypothetical protein EUTSA_v10020282mg           62.4    2e-08   Eutrema salsugineum [saltwater cress]
ref|XP_002455202.1|  hypothetical protein SORBIDRAFT_03g006150        62.4    3e-08   Sorghum bicolor [broomcorn]
gb|AAB94013.1|  gene X-like protein                                   62.4    3e-08   Sorghum bicolor [broomcorn]
ref|XP_010106492.1|  hypothetical protein L484_025250                 61.6    4e-08   Morus notabilis
ref|XP_008673715.1|  PREDICTED: intraflagellar transport protein ...  62.0    4e-08   Zea mays [maize]
ref|XP_009146609.1|  PREDICTED: uncharacterized protein LOC103870246  61.6    4e-08   Brassica rapa
emb|CDY42155.1|  BnaC05g40640D                                        61.6    4e-08   Brassica napus [oilseed rape]
ref|XP_003557426.1|  PREDICTED: factor of DNA methylation 1-like      61.6    5e-08   Brachypodium distachyon [annual false brome]
emb|CDP09063.1|  unnamed protein product                              61.2    6e-08   Coffea canephora [robusta coffee]
emb|CDM82421.1|  unnamed protein product                              61.2    6e-08   Triticum aestivum [Canadian hard winter wheat]
gb|KDO72840.1|  hypothetical protein CISIN_1g038527mg                 61.2    6e-08   Citrus sinensis [apfelsine]
gb|KHG17770.1|  suppressor of gene silencing 3 -like protein          61.6    6e-08   Gossypium arboreum [tree cotton]
ref|XP_006488337.1|  PREDICTED: myosin-2 heavy chain-like isoform X1  61.2    7e-08   Citrus sinensis [apfelsine]
emb|CDY08424.1|  BnaA05g26600D                                        60.8    9e-08   Brassica napus [oilseed rape]
gb|EMT07790.1|  hypothetical protein F775_28070                       60.5    1e-07   
gb|ABB89773.1|  At3g12550-like protein                                60.1    2e-07   Boechera stricta
ref|XP_010486975.1|  PREDICTED: factor of DNA methylation 3           60.1    2e-07   Camelina sativa [gold-of-pleasure]
gb|KJB67632.1|  hypothetical protein B456_010G201300                  60.1    2e-07   Gossypium raimondii
gb|EYU17877.1|  hypothetical protein MIMGU_mgv1a002871mg              59.7    2e-07   Erythranthe guttata [common monkey flower]
ref|XP_004968205.1|  PREDICTED: uncharacterized protein LOC101778142  59.7    2e-07   Setaria italica
gb|KJB67633.1|  hypothetical protein B456_010G201300                  59.7    2e-07   Gossypium raimondii
gb|EMS64523.1|  hypothetical protein TRIUR3_35150                     59.7    2e-07   Triticum urartu
dbj|BAJ97190.1|  predicted protein                                    59.3    2e-07   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ90280.1|  predicted protein                                    59.3    2e-07   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAG51004.1|AC069474_3  unknown protein; 49125-46422                59.3    2e-07   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001042014.1|  Os01g0147700                                     59.3    2e-07   
gb|EAZ10533.1|  hypothetical protein OsJ_00365                        59.3    2e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002440617.1|  hypothetical protein SORBIDRAFT_09g004150        59.3    3e-07   
ref|XP_006655910.1|  PREDICTED: myosin-9-like                         59.3    3e-07   Oryza brachyantha
gb|EAY72526.1|  hypothetical protein OsI_00387                        59.3    3e-07   Oryza sativa Indica Group [Indian rice]
gb|EMT16997.1|  hypothetical protein F775_14651                       59.3    3e-07   
ref|XP_004239795.1|  PREDICTED: protein INVOLVED IN DE NOVO 2-like    58.9    4e-07   
ref|XP_008655632.1|  PREDICTED: centrosomal protein of 128 kDa-like   58.5    4e-07   Zea mays [maize]
ref|XP_001783710.1|  predicted protein                                58.5    5e-07   
ref|XP_002882779.1|  hypothetical protein ARALYDRAFT_318024           58.5    5e-07   
ref|XP_010499136.1|  PREDICTED: factor of DNA methylation 3-like      57.8    7e-07   
gb|EMS57088.1|  hypothetical protein TRIUR3_02882                     57.8    8e-07   
gb|AAL35831.2|AF434705_1  putative transcription factor X1            57.8    9e-07   
ref|XP_010465028.1|  PREDICTED: factor of DNA methylation 3-like      57.8    9e-07   
ref|XP_002526601.1|  conserved hypothetical protein                   57.4    1e-06   
ref|NP_187861.2|  XH/XS domain-containing protein                     57.4    1e-06   
ref|XP_006345968.1|  PREDICTED: uncharacterized protein LOC102583...  57.4    1e-06   
ref|XP_006345966.1|  PREDICTED: uncharacterized protein LOC102583...  57.4    1e-06   
ref|NP_001146275.1|  putative transcription factor                    57.0    1e-06   
ref|XP_008384852.1|  PREDICTED: calponin homology domain-containi...  57.0    1e-06   
tpg|DAA58436.1|  TPA: putative XH domain family protein               56.6    1e-06   
ref|XP_006297188.1|  hypothetical protein CARUB_v10013193mg           55.8    3e-06   
ref|XP_009353657.1|  PREDICTED: uncharacterized protein LOC103944909  55.5    5e-06   
gb|EPS62632.1|  hypothetical protein M569_12161                       54.3    5e-06   
ref|XP_006378650.1|  XH/XS domain-containing family protein           55.1    6e-06   
gb|EMT02372.1|  hypothetical protein F775_12527                       54.3    8e-06   
ref|XP_010476407.1|  PREDICTED: factor of DNA methylation 4-like ...  54.3    1e-05   
ref|XP_006369526.1|  hypothetical protein POPTR_0001s24750g           53.9    1e-05   
ref|XP_010321721.1|  PREDICTED: protein INVOLVED IN DE NOVO 2-like    53.9    1e-05   
gb|EMS65455.1|  hypothetical protein TRIUR3_13658                     53.9    1e-05   
ref|XP_006366492.1|  PREDICTED: interaptin-like                       53.9    2e-05   
ref|XP_006345969.1|  PREDICTED: uncharacterized protein LOC102583...  53.5    2e-05   
ref|XP_011035877.1|  PREDICTED: factor of DNA methylation 4           53.1    3e-05   
emb|CDP10823.1|  unnamed protein product                              52.0    6e-05   
ref|XP_004145335.1|  PREDICTED: uncharacterized LOC101207144          51.6    9e-05   
ref|XP_004165825.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  51.2    1e-04   
gb|KGN65727.1|  hypothetical protein Csa_1G522530                     51.6    1e-04   
ref|XP_004154410.1|  PREDICTED: uncharacterized protein LOC101207144  51.2    1e-04   
ref|XP_010476408.1|  PREDICTED: factor of DNA methylation 4-like ...  51.2    1e-04   
ref|XP_010911107.1|  PREDICTED: factor of DNA methylation 5-like      50.1    1e-04   
gb|EMT18771.1|  Pumilio domain-containing-like protein                49.7    3e-04   
ref|XP_001763767.1|  predicted protein                                49.3    3e-04   
ref|XP_002890022.1|  XH/XS domain-containing protein                  49.7    3e-04   
ref|XP_007206603.1|  hypothetical protein PRUPE_ppa020716mg           49.7    4e-04   
ref|XP_008223681.1|  PREDICTED: uncharacterized protein PFB0765w      49.7    4e-04   
gb|EYU18979.1|  hypothetical protein MIMGU_mgv1a025152mg              49.3    4e-04   
ref|XP_006306867.1|  hypothetical protein CARUB_v10008414mg           48.9    7e-04   
ref|XP_001777897.1|  predicted protein                                48.5    0.001   



>ref|XP_009793120.1| PREDICTED: protein GRIP-like isoform X2 [Nicotiana sylvestris]
Length=501

 Score =   172 bits (437),  Expect = 9e-48, Method: Composition-based stats.
 Identities = 92/130 (71%), Positives = 111/130 (85%), Gaps = 5/130 (4%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            I E+KEKPYEELR+GK +VKGPNG LRCPFCAGKKKQDYKYKDLLQHATGVGKGSANR  
Sbjct  30   IYEFKEKPYEELRTGKLRVKGPNGSLRCPFCAGKKKQDYKYKDLLQHATGVGKGSANRRA  89

Query  302  KQKANHVALAKYLEIDLGDQAEPLPQRAVA-----PEDNNLYCWPWTGIVVNVSKDNANG  466
            KQKANH+ALAKYL+ DL ++A+P+P RAV      PE   L+CWPWTG+VVN+SK+ ANG
Sbjct  90   KQKANHLALAKYLQTDLVNEADPIPARAVTPERSEPEKTELFCWPWTGVVVNISKEAANG  149

Query  467  TAVEEEDYWL  496
             ++++++YWL
Sbjct  150  RSLDDKEYWL  159



>ref|XP_006341360.1| PREDICTED: myosin-9-like [Solanum tuberosum]
Length=635

 Score =   172 bits (437),  Expect = 3e-47, Method: Composition-based stats.
 Identities = 96/130 (74%), Positives = 110/130 (85%), Gaps = 5/130 (4%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            I E+KEKPYEELR GK KVKGPNG LRCPFCAGKKKQDYKYKDLLQHATGVGKGSANRS 
Sbjct  16   IFEFKEKPYEELRKGKLKVKGPNGSLRCPFCAGKKKQDYKYKDLLQHATGVGKGSANRSA  75

Query  302  KQKANHVALAKYLEIDLGDQAEPLPQRAVAP-----EDNNLYCWPWTGIVVNVSKDNANG  466
            KQKANH+ALAKYLE DL ++AEP+P+RAV P     E + L+ WPWTGI VNVSK+ ANG
Sbjct  76   KQKANHLALAKYLETDLVNEAEPIPKRAVTPERSESEKDELFFWPWTGIFVNVSKETANG  135

Query  467  TAVEEEDYWL  496
             + ++++YWL
Sbjct  136  RSPDDKEYWL  145



>ref|XP_004235934.1| PREDICTED: factor of DNA methylation 1 [Solanum lycopersicum]
 ref|XP_010318733.1| PREDICTED: factor of DNA methylation 1 [Solanum lycopersicum]
Length=634

 Score =   172 bits (436),  Expect = 4e-47, Method: Composition-based stats.
 Identities = 96/130 (74%), Positives = 111/130 (85%), Gaps = 5/130 (4%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            I E+KEKPYEELR+GK KVKGPNG LRCPFCAGKKKQDYKYKDLLQHATGVGKGSANRS 
Sbjct  16   IFEFKEKPYEELRTGKLKVKGPNGSLRCPFCAGKKKQDYKYKDLLQHATGVGKGSANRSA  75

Query  302  KQKANHVALAKYLEIDLGDQAEPLPQRAVAP-----EDNNLYCWPWTGIVVNVSKDNANG  466
            KQKANH+ALAKYLE DL ++AEP+P+RAV P     E + L+ WPWTGI VNVSK+ ANG
Sbjct  76   KQKANHLALAKYLETDLVNEAEPIPKRAVTPEHSEAEKDKLFFWPWTGIFVNVSKETANG  135

Query  467  TAVEEEDYWL  496
             + ++++YWL
Sbjct  136  RSPDDKEYWL  145



>ref|XP_009793116.1| PREDICTED: protein MLP1-like isoform X1 [Nicotiana sylvestris]
 ref|XP_009793117.1| PREDICTED: protein MLP1-like isoform X1 [Nicotiana sylvestris]
 ref|XP_009793118.1| PREDICTED: protein MLP1-like isoform X1 [Nicotiana sylvestris]
 ref|XP_009793119.1| PREDICTED: protein MLP1-like isoform X1 [Nicotiana sylvestris]
Length=635

 Score =   172 bits (435),  Expect = 6e-47, Method: Composition-based stats.
 Identities = 92/130 (71%), Positives = 111/130 (85%), Gaps = 5/130 (4%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            I E+KEKPYEELR+GK +VKGPNG LRCPFCAGKKKQDYKYKDLLQHATGVGKGSANR  
Sbjct  16   IYEFKEKPYEELRTGKLRVKGPNGSLRCPFCAGKKKQDYKYKDLLQHATGVGKGSANRRA  75

Query  302  KQKANHVALAKYLEIDLGDQAEPLPQRAVA-----PEDNNLYCWPWTGIVVNVSKDNANG  466
            KQKANH+ALAKYL+ DL ++A+P+P RAV      PE   L+CWPWTG+VVN+SK+ ANG
Sbjct  76   KQKANHLALAKYLQTDLVNEADPIPARAVTPERSEPEKTELFCWPWTGVVVNISKEAANG  135

Query  467  TAVEEEDYWL  496
             ++++++YWL
Sbjct  136  RSLDDKEYWL  145



>ref|XP_009605543.1| PREDICTED: myb-like protein X isoform X1 [Nicotiana tomentosiformis]
Length=647

 Score =   169 bits (427),  Expect = 7e-46, Method: Composition-based stats.
 Identities = 91/130 (70%), Positives = 109/130 (84%), Gaps = 5/130 (4%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            I E+KEKPYEELR+ K +VKGPNG LRCPFCAGKKKQDYKYKDLLQHATGVGKGSANR  
Sbjct  28   IYEFKEKPYEELRTEKLRVKGPNGSLRCPFCAGKKKQDYKYKDLLQHATGVGKGSANRRA  87

Query  302  KQKANHVALAKYLEIDLGDQAEPLPQRAVA-----PEDNNLYCWPWTGIVVNVSKDNANG  466
            KQKANH+ALAKYL+ DL ++ EP+P RAV      PE   L+CWPWTG+VVN+SK+ ANG
Sbjct  88   KQKANHLALAKYLQTDLVNEVEPIPARAVTPERSEPEKTELFCWPWTGVVVNISKEAANG  147

Query  467  TAVEEEDYWL  496
             ++++++YWL
Sbjct  148  RSLDDKEYWL  157



>ref|XP_009605544.1| PREDICTED: myb-like protein X isoform X2 [Nicotiana tomentosiformis]
 ref|XP_009605546.1| PREDICTED: myb-like protein X isoform X2 [Nicotiana tomentosiformis]
Length=635

 Score =   168 bits (426),  Expect = 1e-45, Method: Composition-based stats.
 Identities = 91/130 (70%), Positives = 109/130 (84%), Gaps = 5/130 (4%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            I E+KEKPYEELR+ K +VKGPNG LRCPFCAGKKKQDYKYKDLLQHATGVGKGSANR  
Sbjct  16   IYEFKEKPYEELRTEKLRVKGPNGSLRCPFCAGKKKQDYKYKDLLQHATGVGKGSANRRA  75

Query  302  KQKANHVALAKYLEIDLGDQAEPLPQRAVA-----PEDNNLYCWPWTGIVVNVSKDNANG  466
            KQKANH+ALAKYL+ DL ++ EP+P RAV      PE   L+CWPWTG+VVN+SK+ ANG
Sbjct  76   KQKANHLALAKYLQTDLVNEVEPIPARAVTPERSEPEKTELFCWPWTGVVVNISKEAANG  135

Query  467  TAVEEEDYWL  496
             ++++++YWL
Sbjct  136  RSLDDKEYWL  145



>ref|XP_009626788.1| PREDICTED: coiled-coil domain-containing protein 150-like [Nicotiana 
tomentosiformis]
Length=632

 Score =   160 bits (406),  Expect = 5e-43, Method: Composition-based stats.
 Identities = 85/130 (65%), Positives = 106/130 (82%), Gaps = 6/130 (5%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            IN+Y EKPY+ELR+GKYKVKGPNG LRCPFCAG+KKQDYKY +LLQHA+G GKG A    
Sbjct  15   INDYIEKPYQELRTGKYKVKGPNGSLRCPFCAGRKKQDYKYNELLQHASGAGKG-ARLGA  73

Query  302  KQKANHVALAKYLEIDLGDQAEPLPQRAVAP-----EDNNLYCWPWTGIVVNVSKDNANG  466
            KQKANH+ALAKYLE DL ++AEP+P RAV P     E   ++CWPWT +VVN+SK+ A+G
Sbjct  74   KQKANHLALAKYLESDLANEAEPVPPRAVTPERTEAEQTEVFCWPWTAVVVNISKETADG  133

Query  467  TAVEEEDYWL  496
             +V++++YWL
Sbjct  134  ESVDDKEYWL  143



>ref|XP_009763380.1| PREDICTED: myosin type-2 heavy chain 1-like [Nicotiana sylvestris]
 ref|XP_009763381.1| PREDICTED: myosin type-2 heavy chain 1-like [Nicotiana sylvestris]
Length=632

 Score =   157 bits (398),  Expect = 8e-42, Method: Composition-based stats.
 Identities = 85/130 (65%), Positives = 105/130 (81%), Gaps = 6/130 (5%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            IN+Y EKPY+ELR+GKYKVKGPNG LRCPFCAG+KKQDYKYK+LLQHA+G GKG A    
Sbjct  15   INDYIEKPYQELRTGKYKVKGPNGSLRCPFCAGRKKQDYKYKELLQHASGAGKG-ARLGA  73

Query  302  KQKANHVALAKYLEIDLGDQAEPLPQRAVAP-----EDNNLYCWPWTGIVVNVSKDNANG  466
            KQKANH+ALA YLE DL ++AEP+P RAV P     E   ++CWPWT +VVN+SK+ A+G
Sbjct  74   KQKANHLALAMYLESDLANEAEPVPPRAVTPERTEAEQTEVFCWPWTAVVVNMSKETADG  133

Query  467  TAVEEEDYWL  496
             +V+ ++YWL
Sbjct  134  ESVDNKEYWL  143



>emb|CDO98219.1| unnamed protein product [Coffea canephora]
Length=677

 Score =   157 bits (397),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 88/131 (67%), Positives = 101/131 (77%), Gaps = 6/131 (5%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            I +YKEKP EEL+SGK+KVKGPNG LRCPFCAGKKKQDYKYKDLLQHATGV KGSANRS 
Sbjct  61   IKDYKEKPLEELKSGKFKVKGPNGTLRCPFCAGKKKQDYKYKDLLQHATGVSKGSANRSA  120

Query  302  KQKANHVALAKYLEIDLGDQAEPLPQRAVAP------EDNNLYCWPWTGIVVNVSKDNAN  463
             QKA H+ALA+YLE DL ++AEP P R   P      E N LYCWPWTG+VVN+  +  +
Sbjct  121  IQKAKHLALAEYLETDLVNEAEPQPLRVTPPAVADTSEQNELYCWPWTGVVVNILNETKS  180

Query  464  GTAVEEEDYWL  496
            G AV+   +WL
Sbjct  181  GKAVDSSAFWL  191



>ref|XP_011073344.1| PREDICTED: factor of DNA methylation 1 [Sesamum indicum]
Length=635

 Score =   153 bits (387),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 84/130 (65%), Positives = 96/130 (74%), Gaps = 5/130 (4%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            INEYKEKPYE L++G YKVKGPNG LRCPFCAGKKKQDY+Y  LLQHA GV KGSA+RS 
Sbjct  16   INEYKEKPYELLKAGTYKVKGPNGSLRCPFCAGKKKQDYQYNHLLQHAIGVAKGSASRSA  75

Query  302  KQKANHVALAKYLEIDLGDQAEPLPQR-----AVAPEDNNLYCWPWTGIVVNVSKDNANG  466
            KQKANH+ALA +LE DL ++AEPLPQ      A  PE + LYCWPW GIV N+  +  N 
Sbjct  76   KQKANHLALATFLENDLANEAEPLPQHTAPLPAAKPEKSELYCWPWVGIVANILNEPKNS  135

Query  467  TAVEEEDYWL  496
              +    YWL
Sbjct  136  DCLASRGYWL  145



>gb|KJB56538.1| hypothetical protein B456_009G124400 [Gossypium raimondii]
 gb|KJB56541.1| hypothetical protein B456_009G124400 [Gossypium raimondii]
 gb|KJB56542.1| hypothetical protein B456_009G124400 [Gossypium raimondii]
 gb|KJB56543.1| hypothetical protein B456_009G124400 [Gossypium raimondii]
 gb|KJB56544.1| hypothetical protein B456_009G124400 [Gossypium raimondii]
Length=633

 Score =   152 bits (383),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 87/131 (66%), Positives = 102/131 (78%), Gaps = 6/131 (5%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            INEYKEKPYEE+RSGKYKVK  NG LRCPFCAGKKKQDYKYKDLLQHA+GVGKGSANRS 
Sbjct  16   INEYKEKPYEEIRSGKYKVKALNGSLRCPFCAGKKKQDYKYKDLLQHASGVGKGSANRSA  75

Query  302  KQKANHVALAKYLEIDLGDQAE----PLPQRAV--APEDNNLYCWPWTGIVVNVSKDNAN  463
            KQ+ANH+ALAKYLEIDL  +A+    P   +AV   PE   LY WPW GI++N+  ++ N
Sbjct  76   KQRANHLALAKYLEIDLASEADETSRPTVPQAVDQTPEQTELYVWPWMGIIMNIVAESKN  135

Query  464  GTAVEEEDYWL  496
               + ++ YWL
Sbjct  136  IDTLHDKGYWL  146



>gb|KHG15531.1| suppressor of gene silencing 3 [Gossypium arboreum]
Length=633

 Score =   152 bits (383),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 85/131 (65%), Positives = 100/131 (76%), Gaps = 6/131 (5%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            INEYKEKPYEE+RSGKYKVK  NG LRCPFCAGKKKQDYKYKDLLQHA+GVGKGSANRS 
Sbjct  16   INEYKEKPYEEIRSGKYKVKALNGSLRCPFCAGKKKQDYKYKDLLQHASGVGKGSANRSA  75

Query  302  KQKANHVALAKYLEIDLGDQAEPLPQRAV------APEDNNLYCWPWTGIVVNVSKDNAN  463
            KQ+ANH+ALAKYLEIDL  +A+   +  V       PE   LY WPW GI++N+  ++ N
Sbjct  76   KQRANHLALAKYLEIDLASEADETSRPTVPQVVDQTPEQTELYVWPWMGIIMNIVAESKN  135

Query  464  GTAVEEEDYWL  496
               + ++ YWL
Sbjct  136  IDTLHDKGYWL  146



>gb|KJB56539.1| hypothetical protein B456_009G124400 [Gossypium raimondii]
Length=617

 Score =   152 bits (383),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 87/131 (66%), Positives = 102/131 (78%), Gaps = 6/131 (5%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            INEYKEKPYEE+RSGKYKVK  NG LRCPFCAGKKKQDYKYKDLLQHA+GVGKGSANRS 
Sbjct  16   INEYKEKPYEEIRSGKYKVKALNGSLRCPFCAGKKKQDYKYKDLLQHASGVGKGSANRSA  75

Query  302  KQKANHVALAKYLEIDLGDQAE----PLPQRAV--APEDNNLYCWPWTGIVVNVSKDNAN  463
            KQ+ANH+ALAKYLEIDL  +A+    P   +AV   PE   LY WPW GI++N+  ++ N
Sbjct  76   KQRANHLALAKYLEIDLASEADETSRPTVPQAVDQTPEQTELYVWPWMGIIMNIVAESKN  135

Query  464  GTAVEEEDYWL  496
               + ++ YWL
Sbjct  136  IDTLHDKGYWL  146



>gb|KJB56540.1| hypothetical protein B456_009G124400 [Gossypium raimondii]
Length=537

 Score =   150 bits (379),  Expect = 2e-39, Method: Composition-based stats.
 Identities = 87/131 (66%), Positives = 102/131 (78%), Gaps = 6/131 (5%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            INEYKEKPYEE+RSGKYKVK  NG LRCPFCAGKKKQDYKYKDLLQHA+GVGKGSANRS 
Sbjct  16   INEYKEKPYEEIRSGKYKVKALNGSLRCPFCAGKKKQDYKYKDLLQHASGVGKGSANRSA  75

Query  302  KQKANHVALAKYLEIDLGDQAE----PLPQRAV--APEDNNLYCWPWTGIVVNVSKDNAN  463
            KQ+ANH+ALAKYLEIDL  +A+    P   +AV   PE   LY WPW GI++N+  ++ N
Sbjct  76   KQRANHLALAKYLEIDLASEADETSRPTVPQAVDQTPEQTELYVWPWMGIIMNIVAESKN  135

Query  464  GTAVEEEDYWL  496
               + ++ YWL
Sbjct  136  IDTLHDKGYWL  146



>emb|CAN62667.1| hypothetical protein VITISV_028278 [Vitis vinifera]
Length=626

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 84/132 (64%), Positives = 101/132 (77%), Gaps = 8/132 (6%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            I EYKEKPYE+L++GKYKVKG NG LRCPFCAGKKKQDY+YKDLLQHA+GV KGSANRS 
Sbjct  16   IVEYKEKPYEQLKTGKYKVKGTNGTLRCPFCAGKKKQDYRYKDLLQHASGVAKGSANRSA  75

Query  302  KQKANHVALAKYLEIDLGDQAEPLPQRAVAP-------EDNNLYCWPWTGIVVNVSKDNA  460
            KQKANH+ALAKYLE DL  +++  P RAV P       E ++L+ WPWTGI+ N+  +  
Sbjct  76   KQKANHLALAKYLETDLASESDQAP-RAVEPKPVTRTQEQDDLFVWPWTGIITNIVTEQK  134

Query  461  NGTAVEEEDYWL  496
            NG  + +  YWL
Sbjct  135  NGNDLGDSAYWL  146



>ref|XP_002267670.1| PREDICTED: factor of DNA methylation 1 isoform X2 [Vitis vinifera]
Length=633

 Score =   150 bits (378),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 83/132 (63%), Positives = 100/132 (76%), Gaps = 8/132 (6%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            I EYKEKPYE+L++GKYKVKG NG LRCPFCAGKKKQDY+YKDLLQHA+GV KGSANRS 
Sbjct  16   IVEYKEKPYEQLKTGKYKVKGTNGTLRCPFCAGKKKQDYRYKDLLQHASGVAKGSANRSA  75

Query  302  KQKANHVALAKYLEIDLGDQAEPLPQRAVAP-------EDNNLYCWPWTGIVVNVSKDNA  460
            KQK NH+ALAKYLE DL  +++  P RAV P       E ++L+ WPWTGI+ N+  +  
Sbjct  76   KQKVNHLALAKYLETDLASESDQAP-RAVEPKPVTRTQEQDDLFVWPWTGIITNIVTEQM  134

Query  461  NGTAVEEEDYWL  496
            NG  + +  YWL
Sbjct  135  NGNDLGDSAYWL  146



>ref|XP_010656778.1| PREDICTED: factor of DNA methylation 1 isoform X1 [Vitis vinifera]
 ref|XP_010656779.1| PREDICTED: factor of DNA methylation 1 isoform X1 [Vitis vinifera]
Length=657

 Score =   150 bits (378),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 83/132 (63%), Positives = 100/132 (76%), Gaps = 8/132 (6%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            I EYKEKPYE+L++GKYKVKG NG LRCPFCAGKKKQDY+YKDLLQHA+GV KGSANRS 
Sbjct  40   IVEYKEKPYEQLKTGKYKVKGTNGTLRCPFCAGKKKQDYRYKDLLQHASGVAKGSANRSA  99

Query  302  KQKANHVALAKYLEIDLGDQAEPLPQRAVAP-------EDNNLYCWPWTGIVVNVSKDNA  460
            KQK NH+ALAKYLE DL  +++  P RAV P       E ++L+ WPWTGI+ N+  +  
Sbjct  100  KQKVNHLALAKYLETDLASESDQAP-RAVEPKPVTRTQEQDDLFVWPWTGIITNIVTEQM  158

Query  461  NGTAVEEEDYWL  496
            NG  + +  YWL
Sbjct  159  NGNDLGDSAYWL  170



>emb|CAN83544.1| hypothetical protein VITISV_021077 [Vitis vinifera]
Length=633

 Score =   149 bits (377),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 83/132 (63%), Positives = 99/132 (75%), Gaps = 8/132 (6%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            I EYKEKPYE+L++GKYKVKG NG LRCPFCAGKKKQDY YKDLLQHA+GV KGSANRS 
Sbjct  16   IVEYKEKPYEQLKTGKYKVKGTNGTLRCPFCAGKKKQDYXYKDLLQHASGVAKGSANRSA  75

Query  302  KQKANHVALAKYLEIDLGDQAEPLPQRAVAP-------EDNNLYCWPWTGIVVNVSKDNA  460
            KQK NH+ALAKYLE DL  +++  P RAV P       E ++L+ WPWTGI+ N+  +  
Sbjct  76   KQKVNHLALAKYLETDLASESDQAP-RAVEPKPVTRTQEQDDLFVWPWTGIITNIVTEQM  134

Query  461  NGTAVEEEDYWL  496
            NG  + +  YWL
Sbjct  135  NGNDLGDSAYWL  146



>ref|XP_007214938.1| hypothetical protein PRUPE_ppa002776mg [Prunus persica]
 gb|EMJ16137.1| hypothetical protein PRUPE_ppa002776mg [Prunus persica]
Length=635

 Score =   149 bits (375),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 85/131 (65%), Positives = 100/131 (76%), Gaps = 7/131 (5%)
 Frame = +2

Query  125  NEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVK  304
            N+YK+KPYE+LR GKYKVKGPNG LRCPFCAGKKKQDYK+KDL QHA+GVGKGSANRS K
Sbjct  17   NDYKDKPYEQLREGKYKVKGPNGTLRCPFCAGKKKQDYKFKDLFQHASGVGKGSANRSAK  76

Query  305  QKANHVALAKYLEIDLGDQAE----PLPQRAVAP---EDNNLYCWPWTGIVVNVSKDNAN  463
            QKANH+ALA YLE DL  +A+    PL    VAP   ++ +LY WPWTGIVVN+     +
Sbjct  77   QKANHIALAIYLENDLASEADQIQRPLLPTPVAPQEKQEEDLYVWPWTGIVVNIVSQPKD  136

Query  464  GTAVEEEDYWL  496
            G  + +  YWL
Sbjct  137  GKDLLDSRYWL  147



>ref|XP_007023402.1| XH/XS domain-containing protein [Theobroma cacao]
 gb|EOY26024.1| XH/XS domain-containing protein [Theobroma cacao]
Length=633

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 83/131 (63%), Positives = 102/131 (78%), Gaps = 6/131 (5%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            IN+Y EKPYE+L+SGKY+VK  NG LRCPFCAGKKKQDYKYKDLLQHA+GVGKGSANRS 
Sbjct  16   INDYIEKPYEQLKSGKYQVKALNGSLRCPFCAGKKKQDYKYKDLLQHASGVGKGSANRSA  75

Query  302  KQKANHVALAKYLEIDLGDQAEPLPQRAV------APEDNNLYCWPWTGIVVNVSKDNAN  463
             QKANH+ALAKYLEIDL  +A+   + AV       PE N+LY WPW GI++N+  ++ +
Sbjct  76   IQKANHLALAKYLEIDLASEADQTLRPAVPRPVNQTPEQNDLYVWPWMGIILNIVAESKD  135

Query  464  GTAVEEEDYWL  496
              A+ ++ YWL
Sbjct  136  KNALHDQGYWL  146



>ref|XP_008228782.1| PREDICTED: interaptin-like [Prunus mume]
 ref|XP_008228783.1| PREDICTED: interaptin-like [Prunus mume]
Length=635

 Score =   147 bits (371),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 85/131 (65%), Positives = 100/131 (76%), Gaps = 7/131 (5%)
 Frame = +2

Query  125  NEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVK  304
            N+YK+KPYE+LR GKYKVKGPNG LRCPFCAGKKKQDYK+KDL QHA+GVGKGSANRS K
Sbjct  17   NDYKDKPYEQLREGKYKVKGPNGTLRCPFCAGKKKQDYKFKDLFQHASGVGKGSANRSAK  76

Query  305  QKANHVALAKYLEIDLGDQAE----PLPQRAVAP---EDNNLYCWPWTGIVVNVSKDNAN  463
            QKANH+ALA YLE DL  +A+    PL    VAP   ++ +LY WPWTGIVVN+     +
Sbjct  77   QKANHLALAIYLENDLASEADQIQRPLLPTPVAPQEKQEEDLYVWPWTGIVVNIVIQPKD  136

Query  464  GTAVEEEDYWL  496
            G  + +  YWL
Sbjct  137  GKDLLDSRYWL  147



>ref|XP_002267381.1| PREDICTED: factor of DNA methylation 1 [Vitis vinifera]
 ref|XP_010656777.1| PREDICTED: factor of DNA methylation 1 [Vitis vinifera]
Length=626

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 83/132 (63%), Positives = 98/132 (74%), Gaps = 15/132 (11%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            I EYKEKPYE+L++GKYKVKG NG LRCPFCAGKKKQDY+YKDLLQHA+GV KGSANRS 
Sbjct  16   IVEYKEKPYEQLKTGKYKVKGTNGTLRCPFCAGKKKQDYRYKDLLQHASGVAKGSANRSA  75

Query  302  KQKANHVALAKYLEIDLGDQAEPLPQRAVAP-------EDNNLYCWPWTGIVVNVSKDNA  460
            KQKANH+ALAKYLE DL  +++  P RAV P       E ++L+ WPWTGI+ N+  +  
Sbjct  76   KQKANHLALAKYLETDLASESDQAP-RAVEPKPVTRTQEQDDLFVWPWTGIITNIVTEQK  134

Query  461  NGTAVEEEDYWL  496
            N        YWL
Sbjct  135  NA-------YWL  139



>gb|EYU21722.1| hypothetical protein MIMGU_mgv1a002818mg [Erythranthe guttata]
Length=634

 Score =   144 bits (363),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 94/129 (73%), Gaps = 5/129 (4%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            INEYKEKPYE L++G +KV+GPNG  RCPFCAGKKKQDY++  L QHA GV KGSA+R  
Sbjct  16   INEYKEKPYELLKAGTHKVRGPNGSFRCPFCAGKKKQDYQFNHLYQHAIGVAKGSASRGA  75

Query  302  KQKANHVALAKYLEIDLGDQA-----EPLPQRAVAPEDNNLYCWPWTGIVVNVSKDNANG  466
            KQKANH+ALA +LE DL ++A       +P  A  PE + LYCWPW GIVVN+ K+  NG
Sbjct  76   KQKANHLALATFLENDLANEAPPQPQPTVPVPAAKPEQSELYCWPWVGIVVNILKEAKNG  135

Query  467  TAVEEEDYW  493
              V+  DYW
Sbjct  136  DCVDSSDYW  144



>gb|KDO42995.1| hypothetical protein CISIN_1g006762mg [Citrus sinensis]
Length=632

 Score =   140 bits (353),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 83/132 (63%), Positives = 98/132 (74%), Gaps = 9/132 (7%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            INEY EKPYEELR+GKYKV+  NG LRCPFC+GKKKQDYK+KDLLQHA+GVGKGSANRS 
Sbjct  16   INEYLEKPYEELRAGKYKVR-VNGTLRCPFCSGKKKQDYKHKDLLQHASGVGKGSANRSA  74

Query  302  KQKANHVALAKYLEIDLGDQAEPLPQRAVA-------PEDNNLYCWPWTGIVVNVSKDNA  460
            KQKANH+ALAKYLE+DL    +  PQR V        PE  +LY WPW GI+VN+  +  
Sbjct  75   KQKANHLALAKYLEVDLAGGVDK-PQRPVLPQPVNQNPEQEDLYVWPWMGIIVNIVMETK  133

Query  461  NGTAVEEEDYWL  496
            +  +  +  YWL
Sbjct  134  DRGSFLDSGYWL  145



>ref|XP_003530299.1| PREDICTED: structural maintenance of chromosomes protein 2-like 
isoform X1 [Glycine max]
 ref|XP_006583096.1| PREDICTED: structural maintenance of chromosomes protein 2-like 
isoform X2 [Glycine max]
Length=629

 Score =   140 bits (352),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 83/131 (63%), Positives = 98/131 (75%), Gaps = 12/131 (9%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            I EY EKPYE+LR+GKYKVK  NG LRCP+CAGKKKQ++KYKDLLQHA+GVGKGSANRS 
Sbjct  16   IEEYAEKPYEQLRAGKYKVKNLNGTLRCPYCAGKKKQEFKYKDLLQHASGVGKGSANRSA  75

Query  302  KQKANHVALAKYLEIDLGDQAEP-----LPQRAVAP-EDNNLYCWPWTGIVVNVSKDNAN  463
            +QKANH+ALAKYLE DL  +AEP     LPQ    P    +LY WPWTGI+VN+      
Sbjct  76   QQKANHLALAKYLETDLACEAEPIQRPALPQAVNQPLHQEDLYVWPWTGIIVNIK-----  130

Query  464  GTAVEEEDYWL  496
            G ++ +  YWL
Sbjct  131  GKSI-DSGYWL  140



>gb|KDO42997.1| hypothetical protein CISIN_1g006762mg [Citrus sinensis]
Length=557

 Score =   138 bits (348),  Expect = 3e-35, Method: Composition-based stats.
 Identities = 83/132 (63%), Positives = 98/132 (74%), Gaps = 9/132 (7%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            INEY EKPYEELR+GKYKV+  NG LRCPFC+GKKKQDYK+KDLLQHA+GVGKGSANRS 
Sbjct  16   INEYLEKPYEELRAGKYKVR-VNGTLRCPFCSGKKKQDYKHKDLLQHASGVGKGSANRSA  74

Query  302  KQKANHVALAKYLEIDLGDQAEPLPQRAVA-------PEDNNLYCWPWTGIVVNVSKDNA  460
            KQKANH+ALAKYLE+DL    +  PQR V        PE  +LY WPW GI+VN+  +  
Sbjct  75   KQKANHLALAKYLEVDLAGGVDK-PQRPVLPQPVNQNPEQEDLYVWPWMGIIVNIVMETK  133

Query  461  NGTAVEEEDYWL  496
            +  +  +  YWL
Sbjct  134  DRGSFLDSGYWL  145



>ref|XP_006465197.1| PREDICTED: myosin-10-like [Citrus sinensis]
 gb|KDO42996.1| hypothetical protein CISIN_1g006762mg [Citrus sinensis]
Length=632

 Score =   139 bits (349),  Expect = 5e-35, Method: Composition-based stats.
 Identities = 83/132 (63%), Positives = 98/132 (74%), Gaps = 9/132 (7%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            INEY EKPYEELR+GKYKV+  NG LRCPFC+GKKKQDYK+KDLLQHA+GVGKGSANRS 
Sbjct  16   INEYLEKPYEELRAGKYKVR-VNGTLRCPFCSGKKKQDYKHKDLLQHASGVGKGSANRSA  74

Query  302  KQKANHVALAKYLEIDLGDQAEPLPQRAVA-------PEDNNLYCWPWTGIVVNVSKDNA  460
            KQKANH+ALAKYLE+DL    +  PQR V        PE  +LY WPW GI+VN+  +  
Sbjct  75   KQKANHLALAKYLEVDLAGGVDK-PQRPVLPQPVNQNPEQEDLYVWPWMGIIVNIVMETK  133

Query  461  NGTAVEEEDYWL  496
            +  +  +  YWL
Sbjct  134  DRGSFLDSGYWL  145



>ref|XP_006427593.1| hypothetical protein CICLE_v10025142mg [Citrus clementina]
 ref|XP_006427594.1| hypothetical protein CICLE_v10025142mg [Citrus clementina]
 gb|ESR40833.1| hypothetical protein CICLE_v10025142mg [Citrus clementina]
 gb|ESR40834.1| hypothetical protein CICLE_v10025142mg [Citrus clementina]
Length=634

 Score =   138 bits (348),  Expect = 5e-35, Method: Composition-based stats.
 Identities = 83/132 (63%), Positives = 98/132 (74%), Gaps = 9/132 (7%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            INEY EKPYEELR+GKYKV+  NG LRCPFC+GKKKQDYK+KDLLQHA+GVGKGSANRS 
Sbjct  16   INEYLEKPYEELRAGKYKVR-VNGTLRCPFCSGKKKQDYKHKDLLQHASGVGKGSANRSA  74

Query  302  KQKANHVALAKYLEIDLGDQAEPLPQRAVA-------PEDNNLYCWPWTGIVVNVSKDNA  460
            KQKANH+ALAKYLE+DL    +  PQR V        PE  +LY WPW GI+VN+  +  
Sbjct  75   KQKANHLALAKYLEVDLAGGVDK-PQRPVLPQPVNQNPEQEDLYVWPWMGIIVNIVMETK  133

Query  461  NGTAVEEEDYWL  496
            +  +  +  YWL
Sbjct  134  DRGSFLDSGYWL  145



>ref|XP_008361182.1| PREDICTED: putative leucine-rich repeat-containing protein DDB_G0290503 
[Malus domestica]
 ref|XP_008361190.1| PREDICTED: putative leucine-rich repeat-containing protein DDB_G0290503 
[Malus domestica]
Length=634

 Score =   138 bits (347),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 83/132 (63%), Positives = 98/132 (74%), Gaps = 8/132 (6%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            I+EYK+KPYE+LR GKYKVKGPNG LRCPFCAGKKKQDYK+KDLLQHA+GV KGSA R+ 
Sbjct  16   IHEYKDKPYEQLREGKYKVKGPNGTLRCPFCAGKKKQDYKFKDLLQHASGVAKGSALRNA  75

Query  302  KQKANHVALAKYLEIDL---GDQAE----PLPQRAVAPEDNNLYCWPWTGIVVNVSKDNA  460
            KQKANH+ALA YLE DL   GDQ +    P P  A   +  +LY WPWTGIVVN+     
Sbjct  76   KQKANHLALALYLENDLASEGDQVQRPTLPAPV-AQQEKQEDLYVWPWTGIVVNIVSQPK  134

Query  461  NGTAVEEEDYWL  496
            +G  + +  YW+
Sbjct  135  DGKDLLDSGYWM  146



>ref|XP_008375509.1| PREDICTED: putative leucine-rich repeat-containing protein DDB_G0290503 
[Malus domestica]
Length=634

 Score =   138 bits (347),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 95/132 (72%), Gaps = 8/132 (6%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            I+EYK+KPYE LR GKYKVKGPNG LRCPFCAGKKKQDYK+ +L QHA+GV KGSA R+ 
Sbjct  16   IHEYKDKPYELLREGKYKVKGPNGTLRCPFCAGKKKQDYKFNELFQHASGVAKGSALRNA  75

Query  302  KQKANHVALAKYLEIDLGDQAEPLPQRAVAP-------EDNNLYCWPWTGIVVNVSKDNA  460
            KQKANH+ALA YLE DL  + E + QR + P       +  +LY WPWTGIVVN+     
Sbjct  76   KQKANHLALAIYLENDLASEGEQI-QRPILPAPVTQQEKQEDLYVWPWTGIVVNIVSQPK  134

Query  461  NGTAVEEEDYWL  496
            +G  + +  YW+
Sbjct  135  DGKDLLDSGYWM  146



>ref|XP_003531733.1| PREDICTED: protein MLP1-like isoform X1 [Glycine max]
 ref|XP_006585612.1| PREDICTED: protein MLP1-like isoform X2 [Glycine max]
 gb|KHN38029.1| hypothetical protein glysoja_007071 [Glycine soja]
Length=629

 Score =   137 bits (346),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 98/132 (74%), Gaps = 14/132 (11%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            I EY EKPYE+LR+GKYKVK  NG LRCP+CAGKKKQ++KYKDLLQHA+GVGKGSANRS 
Sbjct  16   IEEYAEKPYEQLRAGKYKVKNLNGTLRCPYCAGKKKQEFKYKDLLQHASGVGKGSANRSA  75

Query  302  KQKANHVALAKYLEIDLGDQAEPLPQRAVAPE-------DNNLYCWPWTGIVVNVSKDNA  460
            +QKANH+ALAKYLE DL  +AE + QR   P+         +LY WPWTGI+VN+     
Sbjct  76   QQKANHLALAKYLETDLASEAESI-QRPAPPQAVNQPLLQEDLYVWPWTGIIVNIK----  130

Query  461  NGTAVEEEDYWL  496
             G ++ +  YWL
Sbjct  131  -GKSI-DSGYWL  140



>ref|XP_010063555.1| PREDICTED: CAP-Gly domain-containing linker protein 1-like [Eucalyptus 
grandis]
 ref|XP_010063556.1| PREDICTED: CAP-Gly domain-containing linker protein 1-like [Eucalyptus 
grandis]
 ref|XP_010063557.1| PREDICTED: CAP-Gly domain-containing linker protein 1-like [Eucalyptus 
grandis]
 ref|XP_010063558.1| PREDICTED: CAP-Gly domain-containing linker protein 1-like [Eucalyptus 
grandis]
 ref|XP_010063559.1| PREDICTED: CAP-Gly domain-containing linker protein 1-like [Eucalyptus 
grandis]
 gb|KCW70793.1| hypothetical protein EUGRSUZ_F03952 [Eucalyptus grandis]
 gb|KCW70794.1| hypothetical protein EUGRSUZ_F03952 [Eucalyptus grandis]
Length=633

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 97/131 (74%), Gaps = 6/131 (5%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            I ++ +KPY+ELRSGK+KVKGPNG LRCPFC GKKKQDY+YK+L QHA GVGKGSANRS 
Sbjct  16   ILDHVDKPYDELRSGKFKVKGPNGSLRCPFCTGKKKQDYRYKELYQHAAGVGKGSANRSG  75

Query  302  KQKANHVALAKYLEIDLGDQAEPLPQR------AVAPEDNNLYCWPWTGIVVNVSKDNAN  463
            KQKANH+ALAKYLE DL  +A+  PQ       A  P+ + ++ WPWTG++ N+  D ++
Sbjct  76   KQKANHLALAKYLETDLASEADQPPQPVVPQPSAQTPQQDEVFVWPWTGVIANILVDKSS  135

Query  464  GTAVEEEDYWL  496
               + +  YWL
Sbjct  136  EKELVDSAYWL  146



>ref|XP_007135808.1| hypothetical protein PHAVU_010G160300g [Phaseolus vulgaris]
 gb|ESW07802.1| hypothetical protein PHAVU_010G160300g [Phaseolus vulgaris]
Length=640

 Score =   135 bits (341),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 80/115 (70%), Positives = 91/115 (79%), Gaps = 7/115 (6%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            I +Y EKPYE LR+GKYKVK  NG LRCP+CAGKKKQDYKYKDLLQHA+GVGKGSANRS 
Sbjct  27   IYDYSEKPYELLRAGKYKVKNLNGTLRCPYCAGKKKQDYKYKDLLQHASGVGKGSANRSA  86

Query  302  KQKANHVALAKYLEIDLGDQAEP-----LPQRAVAP--EDNNLYCWPWTGIVVNV  445
            KQKANH+ALAKYLE DL  +AEP     LPQ    P  +++  Y WPWTGI+VN+
Sbjct  87   KQKANHLALAKYLETDLASEAEPIQNPALPQAVNQPSQQEDLYYVWPWTGIIVNI  141



>ref|XP_007135809.1| hypothetical protein PHAVU_010G160300g [Phaseolus vulgaris]
 gb|ESW07803.1| hypothetical protein PHAVU_010G160300g [Phaseolus vulgaris]
Length=629

 Score =   135 bits (340),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 80/115 (70%), Positives = 91/115 (79%), Gaps = 7/115 (6%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            I +Y EKPYE LR+GKYKVK  NG LRCP+CAGKKKQDYKYKDLLQHA+GVGKGSANRS 
Sbjct  16   IYDYSEKPYELLRAGKYKVKNLNGTLRCPYCAGKKKQDYKYKDLLQHASGVGKGSANRSA  75

Query  302  KQKANHVALAKYLEIDLGDQAEP-----LPQRAVAP--EDNNLYCWPWTGIVVNV  445
            KQKANH+ALAKYLE DL  +AEP     LPQ    P  +++  Y WPWTGI+VN+
Sbjct  76   KQKANHLALAKYLETDLASEAEPIQNPALPQAVNQPSQQEDLYYVWPWTGIIVNI  130



>gb|KDP41984.1| hypothetical protein JCGZ_27002 [Jatropha curcas]
Length=636

 Score =   135 bits (340),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 100/133 (75%), Gaps = 10/133 (8%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            IN+YK+KPYEEL+SGKYKVK  NG LRCPFCAGKKKQDYKYKDLLQHA+GV KGSANRS 
Sbjct  16   INDYKDKPYEELKSGKYKVK-VNGSLRCPFCAGKKKQDYKYKDLLQHASGVAKGSANRSG  74

Query  302  KQKANHVALAKYLEIDLGDQAEPLPQRAVAP--------EDNNLYCWPWTGIVVNVSKDN  457
            KQKANH+ALA YLE DL D+ +   QR V P        ++ +++ WPW GIVVN+  + 
Sbjct  75   KQKANHLALAIYLETDLTDEVDQ-SQRPVLPQPVNPTPEQEMDVFVWPWMGIVVNIVNEA  133

Query  458  ANGTAVEEEDYWL  496
             +  A+++  YWL
Sbjct  134  KDRNALQDSGYWL  146



>ref|XP_002527307.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF35059.1| conserved hypothetical protein [Ricinus communis]
Length=637

 Score =   134 bits (338),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 83/131 (63%), Positives = 98/131 (75%), Gaps = 7/131 (5%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            IN+YKEKPY EL+SGKYKVK  NG LRCPFCAGKKKQDYKYKDLLQHATGVGKGSANRS 
Sbjct  16   INDYKEKPYGELKSGKYKVK-VNGTLRCPFCAGKKKQDYKYKDLLQHATGVGKGSANRSA  74

Query  302  KQKANHVALAKYLEIDLGDQAEPLPQRAV------APEDNNLYCWPWTGIVVNVSKDNAN  463
            KQKANHVALA YLE DL D+++   + A+       P+  +L+  PW GIVVN+  +  +
Sbjct  75   KQKANHVALAIYLENDLADESDQSHRPALPKPVNPTPQQVDLFVKPWMGIVVNIVTEGKD  134

Query  464  GTAVEEEDYWL  496
              A+ +  YWL
Sbjct  135  SNALHDNAYWL  145



>gb|AES86419.2| XH/XS domain protein [Medicago truncatula]
Length=626

 Score =   132 bits (332),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 74/114 (65%), Positives = 91/114 (80%), Gaps = 5/114 (4%)
 Frame = +2

Query  140  KPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVKQKANH  319
            KPYEELR+GKYKVK  NG LRCP+C+GKKKQ++KYKDLLQHA+GVGKGSANRS KQKANH
Sbjct  22   KPYEELRAGKYKVKNNNGTLRCPYCSGKKKQEFKYKDLLQHASGVGKGSANRSTKQKANH  81

Query  320  VALAKYLEIDLGDQAEPLPQRA-----VAPEDNNLYCWPWTGIVVNVSKDNANG  466
            +ALAK+L  DL ++A+ +P+ A     V P     Y WPWTGI+VN+SK + +G
Sbjct  82   LALAKFLRTDLANEADQVPRPALTVAVVQPVQVENYVWPWTGILVNISKSHDSG  135



>ref|XP_003604222.1| hypothetical protein MTR_4g006760 [Medicago truncatula]
Length=657

 Score =   132 bits (332),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 74/114 (65%), Positives = 91/114 (80%), Gaps = 5/114 (4%)
 Frame = +2

Query  140  KPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVKQKANH  319
            KPYEELR+GKYKVK  NG LRCP+C+GKKKQ++KYKDLLQHA+GVGKGSANRS KQKANH
Sbjct  53   KPYEELRAGKYKVKNNNGTLRCPYCSGKKKQEFKYKDLLQHASGVGKGSANRSTKQKANH  112

Query  320  VALAKYLEIDLGDQAEPLPQRA-----VAPEDNNLYCWPWTGIVVNVSKDNANG  466
            +ALAK+L  DL ++A+ +P+ A     V P     Y WPWTGI+VN+SK + +G
Sbjct  113  LALAKFLRTDLANEADQVPRPALTVAVVQPVQVENYVWPWTGILVNISKSHDSG  166



>ref|XP_008375623.1| PREDICTED: uncharacterized protein LOC103438859 [Malus domestica]
Length=379

 Score =   129 bits (325),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 91/131 (69%), Gaps = 7/131 (5%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            IN+YK+KPYE LR G Y VK PNG LRCPFC GKKKQDYK+K+L QHA+GV KGSANRS 
Sbjct  16   INDYKDKPYERLREGMYMVKCPNGALRCPFCVGKKKQDYKFKELFQHASGVAKGSANRSA  75

Query  302  KQKANHVALAKYLEIDLGDQAEP-----LPQRAVAPE-DNNLYCWPWTGIVVNVSKDNAN  463
            KQKANH+ALA YLE DL  +A+P     LP      E + +LY WPWTGI+ N+     +
Sbjct  76   KQKANHLALAIYLETDLASEADPTELPVLPTPVAHQEKEEDLYVWPWTGIIANIVSQPKD  135

Query  464  GTAVEEEDYWL  496
               ++   YWL
Sbjct  136  PKDLDSR-YWL  145



>ref|XP_011467028.1| PREDICTED: factor of DNA methylation 1 [Fragaria vesca subsp. 
vesca]
 ref|XP_011467029.1| PREDICTED: factor of DNA methylation 1 [Fragaria vesca subsp. 
vesca]
Length=640

 Score =   130 bits (328),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 83/134 (62%), Positives = 97/134 (72%), Gaps = 11/134 (8%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            INEYK+KPYE+LRSGK KVKGP G LRCPFCAGKKKQDYKYKDLLQH++GV KGSANRS 
Sbjct  21   INEYKDKPYEQLRSGKLKVKGPYGTLRCPFCAGKKKQDYKYKDLLQHSSGVAKGSANRSA  80

Query  302  KQKANHVALAKYLEIDLGDQAE----PLPQRAVA----PEDNNLYCWPWTGIVVNVSKDN  457
             QKANH+ALA YLE +L  +A+    P P + V     PED  LY WPWTG+V N+    
Sbjct  81   VQKANHLALALYLEKELASEADHIQRPAPPKPVVNDEKPED--LYVWPWTGVVANILLSQ  138

Query  458  -ANGTAVEEEDYWL  496
              +G  + +  YWL
Sbjct  139  PKDGKDLLDSGYWL  152



>ref|XP_003610367.1| hypothetical protein MTR_4g131350 [Medicago truncatula]
 gb|AES92564.1| XH/XS domain protein [Medicago truncatula]
Length=682

 Score =   130 bits (327),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 96/129 (74%), Gaps = 14/129 (11%)
 Frame = +2

Query  131  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVKQK  310
            Y +KPY+EL+ GKYKVK  NG LRCP+CAGKKKQ++KYKDL+QHATGV KGSANR+ KQK
Sbjct  72   YSDKPYKELKDGKYKVKNLNGTLRCPYCAGKKKQEFKYKDLMQHATGVSKGSANRNAKQK  131

Query  311  ANHVALAKYLEIDLGDQAEPLPQRAVA-------PEDNNLYCWPWTGIVVNVSKDNANGT  469
            ANH+ALAKYLE DL ++A+ +P  A+A       P+  N Y WPWTGI+VN+ K N N +
Sbjct  132  ANHLALAKYLETDLVNEADQIPPPALAEAVNQPVPQVEN-YVWPWTGIIVNI-KSNFNDS  189

Query  470  AVEEEDYWL  496
                  YWL
Sbjct  190  G-----YWL  193



>ref|XP_010265647.1| PREDICTED: factor of DNA methylation 1-like isoform X3 [Nelumbo 
nucifera]
Length=556

 Score =   129 bits (323),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 78/125 (62%), Positives = 94/125 (75%), Gaps = 10/125 (8%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            IN+YK+KPYE+L++G +KVK  +   RCPFC G+KKQDY+YKDLLQHA+GVGKGS+NRS 
Sbjct  16   INDYKDKPYEQLKAGMHKVKYSDVAFRCPFCKGRKKQDYRYKDLLQHASGVGKGSSNRSA  75

Query  302  KQKANHVALAKYLEIDLGDQAEPLPQRAVA-------PEDNNLYCWPWTGIVVNV-SKDN  457
            KQKANH+ALAKYLEIDL D   P P + V        PE  +LY WPWTGIVVN+ +K N
Sbjct  76   KQKANHLALAKYLEIDLADA--PGPSQPVTELKPSEHPEHGDLYIWPWTGIVVNILAKQN  133

Query  458  ANGTA  472
              G A
Sbjct  134  EEGRA  138



>ref|XP_010265646.1| PREDICTED: factor of DNA methylation 1-like isoform X2 [Nelumbo 
nucifera]
Length=578

 Score =   129 bits (323),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 78/125 (62%), Positives = 94/125 (75%), Gaps = 10/125 (8%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            IN+YK+KPYE+L++G +KVK  +   RCPFC G+KKQDY+YKDLLQHA+GVGKGS+NRS 
Sbjct  16   INDYKDKPYEQLKAGMHKVKYSDVAFRCPFCKGRKKQDYRYKDLLQHASGVGKGSSNRSA  75

Query  302  KQKANHVALAKYLEIDLGDQAEPLPQRAVA-------PEDNNLYCWPWTGIVVNV-SKDN  457
            KQKANH+ALAKYLEIDL D   P P + V        PE  +LY WPWTGIVVN+ +K N
Sbjct  76   KQKANHLALAKYLEIDLADA--PGPSQPVTELKPSEHPEHGDLYIWPWTGIVVNILAKQN  133

Query  458  ANGTA  472
              G A
Sbjct  134  EEGRA  138



>gb|KEH32486.1| XH/XS domain protein [Medicago truncatula]
Length=629

 Score =   129 bits (324),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 79/130 (61%), Positives = 97/130 (75%), Gaps = 16/130 (12%)
 Frame = +2

Query  131  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVKQK  310
            Y +KPY+EL+ GKYKVK  NG LRCP+CAGKKKQ++KYKDL+QHATGV KGSANR+ KQK
Sbjct  19   YSDKPYKELKDGKYKVKNLNGTLRCPYCAGKKKQEFKYKDLMQHATGVSKGSANRNAKQK  78

Query  311  ANHVALAKYLEIDLGDQAEPLP----QRAV---APEDNNLYCWPWTGIVVNV-SKDNANG  466
            ANH+ALAK+LE DL ++A+ +P      AV   AP+  N Y WPWTGI+VN+ SK N +G
Sbjct  79   ANHLALAKFLETDLANEADQIPPPPLTEAVNQPAPQVEN-YVWPWTGIIVNIKSKLNDSG  137

Query  467  TAVEEEDYWL  496
                   YWL
Sbjct  138  -------YWL  140



>ref|XP_010678967.1| PREDICTED: factor of DNA methylation 1-like [Beta vulgaris subsp. 
vulgaris]
Length=631

 Score =   129 bits (323),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 72/132 (55%), Positives = 92/132 (70%), Gaps = 9/132 (7%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            I EY EKPY+ LR+G YKVK  NG L+CPFCAGKKKQ+Y +KDL QHA+GV KG+A+RS 
Sbjct  16   IEEYVEKPYQALRTGTYKVKNANGTLKCPFCAGKKKQEYGFKDLYQHASGVAKGAAHRSA  75

Query  302  KQKANHVALAKYLEIDLG-------DQAEPLPQRAVAPEDNNLYCWPWTGIVVNVSKDNA  460
            KQKA H+ALA+YLE+D+G         AEP PQ     E+  +YCWPW G+VVN+  D  
Sbjct  76   KQKAIHLALARYLEVDMGFGSAQNSGAAEPEPQPIEQKEE--VYCWPWIGVVVNIVDDGK  133

Query  461  NGTAVEEEDYWL  496
             G  + +  +W+
Sbjct  134  AGKQLADGGFWM  145



>ref|XP_010092186.1| hypothetical protein L484_013504 [Morus notabilis]
 gb|EXB50412.1| hypothetical protein L484_013504 [Morus notabilis]
Length=632

 Score =   127 bits (320),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 94/129 (73%), Gaps = 6/129 (5%)
 Frame = +2

Query  128  EYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVKQ  307
            +Y EKPY +LR G YKVKG NG L+CPFCAGKKKQDYK+KDLLQHA+GV KGSANRS KQ
Sbjct  18   DYAEKPYGQLRDGTYKVKGANGTLKCPFCAGKKKQDYKFKDLLQHASGVSKGSANRSAKQ  77

Query  308  KANHVALAKYLEIDL-GDQAE---PLPQRAVA--PEDNNLYCWPWTGIVVNVSKDNANGT  469
            KANH+ALAKYLE +L G+ A+   P+  R V    E +N Y WPWTGI+VN+     +G 
Sbjct  78   KANHLALAKYLEAELAGEVAQTELPVVSRPVLQHTEQDNRYVWPWTGIIVNIVGGGNDGL  137

Query  470  AVEEEDYWL  496
            +     +WL
Sbjct  138  SFPNSSHWL  146



>ref|XP_010265641.1| PREDICTED: factor of DNA methylation 1-like isoform X1 [Nelumbo 
nucifera]
 ref|XP_010265643.1| PREDICTED: factor of DNA methylation 1-like isoform X1 [Nelumbo 
nucifera]
 ref|XP_010265644.1| PREDICTED: factor of DNA methylation 1-like isoform X1 [Nelumbo 
nucifera]
 ref|XP_010265645.1| PREDICTED: factor of DNA methylation 1-like isoform X1 [Nelumbo 
nucifera]
Length=633

 Score =   127 bits (319),  Expect = 6e-31, Method: Composition-based stats.
 Identities = 78/125 (62%), Positives = 94/125 (75%), Gaps = 10/125 (8%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            IN+YK+KPYE+L++G +KVK  +   RCPFC G+KKQDY+YKDLLQHA+GVGKGS+NRS 
Sbjct  16   INDYKDKPYEQLKAGMHKVKYSDVAFRCPFCKGRKKQDYRYKDLLQHASGVGKGSSNRSA  75

Query  302  KQKANHVALAKYLEIDLGDQAEPLPQRAVA-------PEDNNLYCWPWTGIVVNV-SKDN  457
            KQKANH+ALAKYLEIDL D   P P + V        PE  +LY WPWTGIVVN+ +K N
Sbjct  76   KQKANHLALAKYLEIDLADA--PGPSQPVTELKPSEHPEHGDLYIWPWTGIVVNILAKQN  133

Query  458  ANGTA  472
              G A
Sbjct  134  EEGRA  138



>ref|XP_010101455.1| hypothetical protein L484_012877 [Morus notabilis]
 gb|EXB88438.1| hypothetical protein L484_012877 [Morus notabilis]
Length=632

 Score =   126 bits (317),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 74/128 (58%), Positives = 90/128 (70%), Gaps = 6/128 (5%)
 Frame = +2

Query  131  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVKQK  310
            Y EKPY +LR G YKVKG NG LRCPFCAGKKKQDYK+KDLLQHA+GV KGSANRS KQK
Sbjct  19   YAEKPYGQLRGGTYKVKGANGTLRCPFCAGKKKQDYKFKDLLQHASGVSKGSANRSAKQK  78

Query  311  ANHVALAKYLEIDLGDQAEPLPQRAVA------PEDNNLYCWPWTGIVVNVSKDNANGTA  472
            ANH+ALAKYL+ +L  +       A++       E +N Y WPWTGI+VN+     +G +
Sbjct  79   ANHLALAKYLDAELAGEVARTELPAISRPVLQHTEQDNQYVWPWTGIIVNIVGGGNDGLS  138

Query  473  VEEEDYWL  496
              +  +WL
Sbjct  139  FPDSSHWL  146



>ref|XP_004510284.1| PREDICTED: uncharacterized protein PFB0145c-like [Cicer arietinum]
Length=586

 Score =   125 bits (313),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 76/126 (60%), Positives = 94/126 (75%), Gaps = 14/126 (11%)
 Frame = +2

Query  140  KPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVKQKANH  319
            KPYE+L++GKYKVK  NG LRCP+C+GKKKQDYKYKDLLQHA+GVGKGSANRS KQKANH
Sbjct  22   KPYEQLKAGKYKVKNFNGTLRCPYCSGKKKQDYKYKDLLQHASGVGKGSANRSAKQKANH  81

Query  320  VALAKYLEIDLGDQAEPLPQRAVA-------PEDNNLYCWPWTGIVVNVSKDNANGTAVE  478
            +ALAKYLE DL ++A+ +P+ A          +D N Y WPWTGI+VN+       + + 
Sbjct  82   LALAKYLETDLANEADQIPRPASTQAVNQPVQQDEN-YVWPWTGIIVNIK------SQLH  134

Query  479  EEDYWL  496
            +  YWL
Sbjct  135  DSRYWL  140



>ref|XP_010537880.1| PREDICTED: factor of DNA methylation 1-like [Tarenaya hassleriana]
Length=633

 Score =   125 bits (314),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 93/131 (71%), Gaps = 7/131 (5%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            I+EY EKPY+ L+SGK+KVK  NG LRCPFC+GKKKQDYKYK+L  HA+GV +GSANRS 
Sbjct  16   IDEYSEKPYKLLQSGKFKVK-VNGTLRCPFCSGKKKQDYKYKELFAHASGVARGSANRSA  74

Query  302  KQKANHVALAKYLEIDLGDQAEPLP------QRAVAPEDNNLYCWPWTGIVVNVSKDNAN  463
            KQKANH+ALA YLE DL   AE LP       + + P+  ++Y WPW GIVVN    + +
Sbjct  75   KQKANHLALANYLEKDLAGDAERLPCPPVPLSKQLEPKPGDIYVWPWMGIVVNPVNRSDD  134

Query  464  GTAVEEEDYWL  496
              ++ +  YWL
Sbjct  135  KESLLDSGYWL  145



>emb|CBI40115.3| unnamed protein product [Vitis vinifera]
Length=579

 Score =   124 bits (310),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 78/128 (61%), Positives = 92/128 (72%), Gaps = 18/128 (14%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            I EYKEKPYE+L++GKYKVKG NG LRCPFCAGKKKQDY+YKDLLQHA+GV KGSANRS 
Sbjct  16   IVEYKEKPYEQLKTGKYKVKGTNGTLRCPFCAGKKKQDYRYKDLLQHASGVAKGSANRSA  75

Query  302  KQKANHVALAKYLEIDLGDQAEPLPQRAVAP-------EDNNLYCW--PWTGIVVNVSKD  454
            KQK NH+ALAKYLE DL  +++  P RAV P       E ++L+ +   WTG +      
Sbjct  76   KQKVNHLALAKYLETDLASESDQAP-RAVEPKPVTRTQEQDDLFVFNNDWTGFM------  128

Query  455  NANGTAVE  478
              N TA E
Sbjct  129  --NATAFE  134



>ref|XP_002303841.1| XH domain-containing family protein [Populus trichocarpa]
 gb|EEE78820.1| XH domain-containing family protein [Populus trichocarpa]
Length=626

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 76/128 (59%), Positives = 94/128 (73%), Gaps = 14/128 (11%)
 Frame = +2

Query  131  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVKQK  310
            YK+KP E+LRSG  +VK  NG LRCPFCAGKKKQDYKYKDLLQHATGV KGSA+RS KQK
Sbjct  19   YKDKPLEDLRSGNLRVK-VNGFLRCPFCAGKKKQDYKYKDLLQHATGVSKGSASRSGKQK  77

Query  311  ANHVALAKYLEIDLGDQAEPLPQRAV------APEDNNLYCWPWTGIVVNVSKDNANGTA  472
            ANH+ALA+YLEI+L ++AE  P++ V       PE   L+ WPW GI+VN+++   N   
Sbjct  78   ANHLALARYLEIELANEAEQTPRQVVPQPIKPPPEQQELFVWPWMGILVNLTEQRDN---  134

Query  473  VEEEDYWL  496
                +YW+
Sbjct  135  ----EYWM  138



>gb|EPS59185.1| hypothetical protein M569_15623 [Genlisea aurea]
Length=616

 Score =   122 bits (306),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 91/131 (69%), Gaps = 9/131 (7%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            I+EYK KPYE L+SG YK+KGPNG LRCPFCAGKKKQDY+Y  L QHA GV KG+A +S 
Sbjct  34   IDEYKAKPYELLKSGFYKIKGPNGVLRCPFCAGKKKQDYQYNHLYQHAIGVAKGTA-KSA  92

Query  302  KQKANHVALAKYLEIDLGDQAEPL-----PQRAVAPEDNNLYCWPWTGIVVNVSKDNANG  466
            KQ+ANH+ALA YLE D   +AEP+     P+++   E   LYCWPW GI+VN+ +    G
Sbjct  93   KQRANHLALANYLEHDKPAEAEPMILPAPPEKSEQGE--LLYCWPWIGIIVNIRRRGQIG  150

Query  467  TA-VEEEDYWL  496
               +    YWL
Sbjct  151  EGNLGSTSYWL  161



>ref|XP_006416865.1| hypothetical protein EUTSA_v10007054mg [Eutrema salsugineum]
 gb|ESQ35218.1| hypothetical protein EUTSA_v10007054mg [Eutrema salsugineum]
Length=633

 Score =   121 bits (304),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 74/128 (58%), Positives = 91/128 (71%), Gaps = 7/128 (5%)
 Frame = +2

Query  131  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVKQK  310
            Y E PY  L++GKYKVK  NG LRCPFC+GKKKQDYKYK+L+ HA+GV KGSANRS KQK
Sbjct  19   YSEIPYLMLQTGKYKVK-VNGNLRCPFCSGKKKQDYKYKELIAHASGVSKGSANRSAKQK  77

Query  311  ANHVALAKYLEIDLGDQAEPLPQRAVAPEDN------NLYCWPWTGIVVNVSKDNANGTA  472
            ANH+ALAKYLE +L   AEP+P+  V   D       ++Y WPW GIV+N  K+  +  A
Sbjct  78   ANHLALAKYLENELAGDAEPVPRPPVPQLDESEAKPGDIYVWPWMGIVINPLKETDDKEA  137

Query  473  VEEEDYWL  496
            + +  YWL
Sbjct  138  LLDSAYWL  145



>gb|KGN44516.1| hypothetical protein Csa_7G323110 [Cucumis sativus]
Length=561

 Score =   120 bits (302),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 91/130 (70%), Gaps = 6/130 (5%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            IN+Y EKPYE+LR+GK  VK  NG LRCPFC GKKKQDYKYKDLLQHA+GV KGS NR+ 
Sbjct  16   INDYAEKPYEQLRTGKLVVKTANGILRCPFCMGKKKQDYKYKDLLQHASGVSKGSKNRNA  75

Query  302  KQKANHVALAKYLEIDLGDQAE----PLPQRAVAPE-DNNLYCWPWTGIVVNVSKDNANG  466
            KQKANH+ALAKYLE +L  +A+    P P   ++ + +  LY WPW G++VN+       
Sbjct  76   KQKANHLALAKYLENELASEADQTQRPTPPTPISQDSEQELYVWPWMGVIVNIEAGEDRN  135

Query  467  TAVEEEDYWL  496
            T  +   YW+
Sbjct  136  TVCDSA-YWI  144



>emb|CDX81740.1| BnaC08g38610D [Brassica napus]
Length=515

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 91/129 (71%), Gaps = 7/129 (5%)
 Frame = +2

Query  131  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVKQK  310
            Y +KPY +L++G YKVK  NG LRCPFC+GKKKQDYKYK+L+ HA+GV KGS +RS KQK
Sbjct  21   YSQKPYLKLQTGHYKVKKVNGTLRCPFCSGKKKQDYKYKELMAHASGVSKGSVSRSAKQK  80

Query  311  ANHVALAKYLEIDLG--DQAEPLPQR----AVAPEDNNLYCWPWTGIVVNVSKD-NANGT  469
            ANH+ALAKYLE +L     AEPLP+R       P+   +Y WPW GIV+N  K+ + +  
Sbjct  81   ANHLALAKYLETELAGSGHAEPLPRRPQLKETEPKPGEVYVWPWMGIVMNPLKETDDDKE  140

Query  470  AVEEEDYWL  496
             + +  YWL
Sbjct  141  VILDSGYWL  149



>ref|XP_004139640.1| PREDICTED: uncharacterized protein LOC101205093 [Cucumis sativus]
 ref|XP_004168328.1| PREDICTED: uncharacterized LOC101205093 [Cucumis sativus]
Length=632

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 91/130 (70%), Gaps = 6/130 (5%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            IN+Y EKPYE+LR+GK  VK  NG LRCPFC GKKKQDYKYKDLLQHA+GV KGS NR+ 
Sbjct  16   INDYAEKPYEQLRTGKLVVKTANGILRCPFCMGKKKQDYKYKDLLQHASGVSKGSKNRNA  75

Query  302  KQKANHVALAKYLEIDLGDQAE----PLPQRAVAPE-DNNLYCWPWTGIVVNVSKDNANG  466
            KQKANH+ALAKYLE +L  +A+    P P   ++ + +  LY WPW G++VN+       
Sbjct  76   KQKANHLALAKYLENELASEADQTQRPTPPTPISQDSEQELYVWPWMGVIVNIEAGEDRN  135

Query  467  TAVEEEDYWL  496
            T  +   YW+
Sbjct  136  TVCDSA-YWI  144



>ref|XP_008461480.1| PREDICTED: putative leucine-rich repeat-containing protein DDB_G0290503 
[Cucumis melo]
 ref|XP_008461481.1| PREDICTED: putative leucine-rich repeat-containing protein DDB_G0290503 
[Cucumis melo]
Length=632

 Score =   120 bits (300),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 71/114 (62%), Positives = 84/114 (74%), Gaps = 7/114 (6%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            IN+Y EKPYE+LR+GK  VK  NG LRCPFC GKKKQDYKYKDLLQHA+GV KGS NR+ 
Sbjct  16   INDYAEKPYEQLRTGKLVVKTANGILRCPFCMGKKKQDYKYKDLLQHASGVSKGSKNRNA  75

Query  302  KQKANHVALAKYLEIDLGDQAEPLPQRAVAP------EDNNLYCWPWTGIVVNV  445
            KQKANH+ALAKYLE +L  +A+   QR   P       +  LY WPW G++VN+
Sbjct  76   KQKANHLALAKYLENELASEADQ-TQRPTPPTPSSQDSEKELYVWPWMGVIVNI  128



>ref|XP_008454606.1| PREDICTED: putative leucine-rich repeat-containing protein DDB_G0290503 
isoform X1 [Cucumis melo]
 ref|XP_008454607.1| PREDICTED: putative leucine-rich repeat-containing protein DDB_G0290503 
isoform X1 [Cucumis melo]
Length=633

 Score =   119 bits (299),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 91/130 (70%), Gaps = 6/130 (5%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            IN+Y EKPYE+LR+GK  VK  NG LRCPFC GKKKQDYKYKDLLQHA+GV KGS NR+ 
Sbjct  17   INDYAEKPYEQLRTGKLVVKTANGILRCPFCMGKKKQDYKYKDLLQHASGVSKGSKNRNA  76

Query  302  KQKANHVALAKYLEIDLGDQAE----PLPQRAVAPE-DNNLYCWPWTGIVVNVSKDNANG  466
            KQKANH+ALAKYLE +L  +A+    P P   ++ + +  LY WPW G+++N+       
Sbjct  77   KQKANHLALAKYLENELASEADQTQRPTPPTPISQDSEKELYVWPWMGVILNIEAGEDRN  136

Query  467  TAVEEEDYWL  496
            T  +   YW+
Sbjct  137  TVCDSA-YWI  145



>ref|XP_008454609.1| PREDICTED: putative leucine-rich repeat-containing protein DDB_G0290503 
isoform X2 [Cucumis melo]
Length=632

 Score =   119 bits (299),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 91/130 (70%), Gaps = 6/130 (5%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            IN+Y EKPYE+LR+GK  VK  NG LRCPFC GKKKQDYKYKDLLQHA+GV KGS NR+ 
Sbjct  16   INDYAEKPYEQLRTGKLVVKTANGILRCPFCMGKKKQDYKYKDLLQHASGVSKGSKNRNA  75

Query  302  KQKANHVALAKYLEIDLGDQAE----PLPQRAVAPE-DNNLYCWPWTGIVVNVSKDNANG  466
            KQKANH+ALAKYLE +L  +A+    P P   ++ + +  LY WPW G+++N+       
Sbjct  76   KQKANHLALAKYLENELASEADQTQRPTPPTPISQDSEKELYVWPWMGVILNIEAGEDRN  135

Query  467  TAVEEEDYWL  496
            T  +   YW+
Sbjct  136  TVCDSA-YWI  144



>ref|XP_010678965.1| PREDICTED: factor of DNA methylation 1-like [Beta vulgaris subsp. 
vulgaris]
Length=633

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 82/130 (63%), Gaps = 5/130 (4%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            I EY E PYE LRSG Y V    G LRCPFCAGKKKQ+Y  KDL QHA+GV KG+A+RS 
Sbjct  16   IEEYAEIPYEALRSGTYNVWSIRGALRCPFCAGKKKQEYALKDLHQHASGVAKGAAHRSA  75

Query  302  KQKANHVALAKYLEIDLGDQAEPLPQ-----RAVAPEDNNLYCWPWTGIVVNVSKDNANG  466
             QKA H+ALA+YLE+DLG  +    Q           +  L CWPW GIVVN+  +   G
Sbjct  76   IQKATHLALARYLEVDLGFGSVQASQPAEPKPEPDEPEEELLCWPWIGIVVNIMNEAETG  135

Query  467  TAVEEEDYWL  496
              + + ++W+
Sbjct  136  KQLADSEFWM  145



>ref|XP_010497500.1| PREDICTED: factor of DNA methylation 1 [Camelina sativa]
 ref|XP_010497504.1| PREDICTED: factor of DNA methylation 1 [Camelina sativa]
Length=636

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 89/134 (66%), Gaps = 10/134 (7%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            I++Y E PY  L++G YKVK  NG LRCPFC+GKKKQDYKYK+L  HA+GV KGSA RS 
Sbjct  16   IDDYSETPYMLLQNGSYKVK-VNGQLRCPFCSGKKKQDYKYKELYAHASGVSKGSATRSA  74

Query  302  KQKANHVALAKYLEIDLGDQAEPLP---------QRAVAPEDNNLYCWPWTGIVVNVSKD  454
            KQKANH+ALAK+LE +L   AEP P         +  V P   ++Y WPW GIV+N   D
Sbjct  75   KQKANHLALAKFLENELAGHAEPAPRPPPVPPQFEETVEPNPRDVYVWPWMGIVLNPLTD  134

Query  455  NANGTAVEEEDYWL  496
              +  A+   +YWL
Sbjct  135  TDDKEALLSSEYWL  148



>ref|XP_009117794.1| PREDICTED: myosin-11-like [Brassica rapa]
 ref|XP_009117795.1| PREDICTED: myosin-11-like [Brassica rapa]
 ref|XP_009117796.1| PREDICTED: myosin-11-like [Brassica rapa]
Length=638

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 91/130 (70%), Gaps = 9/130 (7%)
 Frame = +2

Query  131  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVKQK  310
            Y +KPY +L++G YKVK  NG LRCPFC+GKKKQDYKYK+L+ HA+GV KGS +RS KQK
Sbjct  21   YSQKPYLKLQTGHYKVK-VNGTLRCPFCSGKKKQDYKYKELIAHASGVSKGSVSRSAKQK  79

Query  311  ANHVALAKYLEIDL-GDQAEPLPQ------RAVAPEDNNLYCWPWTGIVVNVSKDNANGT  469
            ANH+ALAKYLE +L GD AE LP+          P+  ++Y WPW GIV+N  K+  +  
Sbjct  80   ANHLALAKYLETELAGDHAEGLPRPYLPLSNESEPKPGDVYVWPWMGIVMNPLKETDDDK  139

Query  470  AVEEED-YWL  496
             V  +  YWL
Sbjct  140  EVLLDSWYWL  149



>emb|CDY52860.1| BnaA09g56520D [Brassica napus]
Length=638

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 91/130 (70%), Gaps = 9/130 (7%)
 Frame = +2

Query  131  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVKQK  310
            Y +KPY +L++G YKVK  NG LRCPFC+GKKKQDYKYK+L+ HA+GV KGS +RS KQK
Sbjct  21   YSQKPYLKLQTGHYKVK-VNGTLRCPFCSGKKKQDYKYKELIAHASGVSKGSVSRSAKQK  79

Query  311  ANHVALAKYLEIDL-GDQAEPLPQ------RAVAPEDNNLYCWPWTGIVVNVSKDNANGT  469
            ANH+ALAKYLE +L GD AE LP+          P+  ++Y WPW GIV+N  K+  +  
Sbjct  80   ANHLALAKYLETELAGDHAEGLPRPYLPLSNESEPKPGDVYVWPWMGIVMNPLKETDDDK  139

Query  470  AVEEED-YWL  496
             V  +  YWL
Sbjct  140  EVLLDSWYWL  149



>dbj|BAE99100.1| hypothetical protein [Arabidopsis thaliana]
Length=439

 Score =   110 bits (274),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 86/129 (67%), Gaps = 8/129 (6%)
 Frame = +2

Query  131  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVKQK  310
            Y EKPYE+L +G YKVK  +   RCPFCAGKKKQ YKYK+LL HA+GV KGSA+RS KQK
Sbjct  19   YYEKPYEKLMNGDYKVKVKD-TFRCPFCAGKKKQHYKYKELLAHASGVAKGSASRSAKQK  77

Query  311  ANHVALAKYLEIDL-GDQAEPLPQRAVAPED------NNLYCWPWTGIVVNVSKDNANGT  469
            ANH ALAKY+E +L GD   P PQ   +  +      +++Y WPW GIV+N  +   N  
Sbjct  78   ANHFALAKYMENELAGDADVPRPQIPSSSTEQSQAVVDDIYVWPWMGIVINPVRRTDNKN  137

Query  470  AVEEEDYWL  496
             + +  YWL
Sbjct  138  VLLDSAYWL  146



>ref|NP_178194.1| FACTOR OF DNA METHYLATION 5 [Arabidopsis thaliana]
 sp|Q9SAI1.1|FDM5_ARATH RecName: Full=Factor of DNA methylation 5 [Arabidopsis thaliana]
 gb|AAF14667.1|AC011713_15 Contains similarity to gb|AF136530 transcriptional regulator 
from Zea mays [Arabidopsis thaliana]
 gb|AEE36451.1| XH/XS domain-containing protein [Arabidopsis thaliana]
Length=634

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 86/129 (67%), Gaps = 8/129 (6%)
 Frame = +2

Query  131  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVKQK  310
            Y EKPYE+L +G YKVK  +   RCPFCAGKKKQ YKYK+LL HA+GV KGSA+RS KQK
Sbjct  19   YYEKPYEKLMNGDYKVKVKD-TFRCPFCAGKKKQHYKYKELLAHASGVAKGSASRSAKQK  77

Query  311  ANHVALAKYLEIDL-GDQAEPLPQRAVAPED------NNLYCWPWTGIVVNVSKDNANGT  469
            ANH ALAKY+E +L GD   P PQ   +  +      +++Y WPW GIV+N  +   N  
Sbjct  78   ANHFALAKYMENELAGDADVPRPQIPSSSTEQSQAVVDDIYVWPWMGIVINPVRRTDNKN  137

Query  470  AVEEEDYWL  496
             + +  YWL
Sbjct  138  VLLDSAYWL  146



>ref|XP_010459126.1| PREDICTED: factor of DNA methylation 1-like [Camelina sativa]
Length=510

 Score =   108 bits (269),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 89/133 (67%), Gaps = 10/133 (8%)
 Frame = +2

Query  125  NEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVK  304
            ++Y E PY  L++G YKVK  NG LRCPFC+GKKKQDYKYK+L  HA+GV KGSA RS K
Sbjct  17   DDYSETPYMLLQNGSYKVK-VNGQLRCPFCSGKKKQDYKYKELYAHASGVSKGSATRSAK  75

Query  305  QKANHVALAKYLEIDLGDQAEPLP---------QRAVAPEDNNLYCWPWTGIVVNVSKDN  457
            QKANH+ALAK+LE +L   AEP+P         +  V P   ++Y WPW GIV+N     
Sbjct  76   QKANHLALAKFLENELAAHAEPVPRPPPVPPQFEETVEPNPRDVYVWPWMGIVLNPLTAT  135

Query  458  ANGTAVEEEDYWL  496
             +  A+ + +YWL
Sbjct  136  DDKEALLDSEYWL  148



>ref|XP_003610364.1| hypothetical protein MTR_4g131310 [Medicago truncatula]
 gb|AES92561.1| XH/XS domain protein [Medicago truncatula]
Length=458

 Score =   106 bits (265),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 60/87 (69%), Positives = 74/87 (85%), Gaps = 0/87 (0%)
 Frame = +2

Query  131  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVKQK  310
            Y +KPY+EL+ GKYKVK  NG LRCP+CAGKKKQ++KYKDL+QH TGV KGSANR+ KQK
Sbjct  19   YSDKPYKELKDGKYKVKNLNGTLRCPYCAGKKKQEFKYKDLMQHETGVSKGSANRNAKQK  78

Query  311  ANHVALAKYLEIDLGDQAEPLPQRAVA  391
            ANH+ALAKYLE DL ++A+ +P  A+A
Sbjct  79   ANHLALAKYLETDLVNEADQIPPPALA  105



>emb|CDX79353.1| BnaC06g19500D [Brassica napus]
Length=639

 Score =   107 bits (268),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 66/132 (50%), Positives = 88/132 (67%), Gaps = 7/132 (5%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            I +Y EKPY++LR G+ KVK      +CPFC+GKKKQ YKYK+LL HATGV KGSA R+ 
Sbjct  16   IADYSEKPYKQLRDGELKVKLKLDTFKCPFCSGKKKQHYKYKELLAHATGVAKGSAARNC  75

Query  302  KQKANHVALAKYLEIDLGDQAEP--LPQRAVAPEDN-----NLYCWPWTGIVVNVSKDNA  460
            KQKANH+AL+KYL+ +L   AEP  L     + + N     ++Y WPW GIV++  + N 
Sbjct  76   KQKANHLALSKYLKNELAGDAEPPRLQLTVYSSKQNQAVVSDMYVWPWMGIVISPLRGND  135

Query  461  NGTAVEEEDYWL  496
            + T + +  YWL
Sbjct  136  DKTLLLDSAYWL  147



>ref|NP_173043.1| factor of DNA methylation 1 [Arabidopsis thaliana]
 sp|Q9S9P3.1|FDM1_ARATH RecName: Full=Factor of DNA methylation 1; AltName: Full=Protein 
IDN2 PARALOG 1; AltName: Full=Protein IDN2-LIKE 1 [Arabidopsis 
thaliana]
 gb|AAF18488.1|AC010924_1 Contains similarity to gb|AF136530 transcriptional regulator 
from Zea mays. ESTs gb|F14071, gb|Z26823, gb|AI998935 come from 
this gene [Arabidopsis thaliana]
 gb|AEE29382.1| factor of DNA methylation 1 [Arabidopsis thaliana]
Length=634

 Score =   107 bits (267),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 72/131 (55%), Positives = 85/131 (65%), Gaps = 9/131 (7%)
 Frame = +2

Query  128  EYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVKQ  307
            +Y E PY  LR G YKVK  NG LRCPFCAGKKKQDYKYK+L  HATGV KGSA RS  Q
Sbjct  17   DYSETPYRLLRDGTYKVK-VNGQLRCPFCAGKKKQDYKYKELYAHATGVSKGSATRSALQ  75

Query  308  KANHVALAKYLEIDLGDQAEPLPQRA--------VAPEDNNLYCWPWTGIVVNVSKDNAN  463
            KANH+ALA +LE +L   AEP+P+            P  +N+Y WPW GIVVN  K+  +
Sbjct  76   KANHLALAMFLENELAGYAEPVPRPPVVPPQLDETEPNPHNVYVWPWMGIVVNPLKEADD  135

Query  464  GTAVEEEDYWL  496
               + +  YWL
Sbjct  136  KELLLDSAYWL  146



>ref|XP_010476691.1| PREDICTED: factor of DNA methylation 1-like [Camelina sativa]
Length=636

 Score =   107 bits (267),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 70/131 (53%), Positives = 86/131 (66%), Gaps = 10/131 (8%)
 Frame = +2

Query  131  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVKQK  310
            Y E PY  L++G YKV   NG LRCPFC+GKKKQDYKYK+L  HATGV KGSA RS KQK
Sbjct  19   YSETPYLLLQNGSYKV-IVNGQLRCPFCSGKKKQDYKYKELYAHATGVSKGSATRSAKQK  77

Query  311  ANHVALAKYLEIDLGDQAEPLP---------QRAVAPEDNNLYCWPWTGIVVNVSKDNAN  463
            ANH+ALAK+LE +L   AEP+P         +  + P   ++Y WPW GIV+N   D  +
Sbjct  78   ANHLALAKFLENELAGHAEPVPRPPPVPPQLEETLEPNPRDVYVWPWMGIVLNPLTDTDD  137

Query  464  GTAVEEEDYWL  496
              A+   +YWL
Sbjct  138  KEALLSSEYWL  148



>ref|XP_006389833.1| hypothetical protein EUTSA_v10018261mg [Eutrema salsugineum]
 gb|ESQ27119.1| hypothetical protein EUTSA_v10018261mg [Eutrema salsugineum]
Length=634

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 85/126 (67%), Gaps = 6/126 (5%)
 Frame = +2

Query  137  EKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVKQKAN  316
            EKPY+ L++GKYKVK      RCPFC+GKKKQ YKYK+LL HATGV KGSA+RS KQKAN
Sbjct  22   EKPYKLLKNGKYKVKLREDTFRCPFCSGKKKQHYKYKELLAHATGVAKGSASRSAKQKAN  81

Query  317  HVALAKYLEIDL-GDQAEPLPQRAV---APE--DNNLYCWPWTGIVVNVSKDNANGTAVE  478
            H+AL KY+E +L GD   P  Q  +    PE  D+++Y WPW GIV+   +   +   + 
Sbjct  82   HLALRKYMENELAGDAQLPRLQLILYKKQPEAVDSDIYVWPWMGIVIRPLRTTDDKNLLL  141

Query  479  EEDYWL  496
            +  YWL
Sbjct  142  DSFYWL  147



>ref|XP_009104485.1| PREDICTED: myosin-9-like [Brassica rapa]
 ref|XP_009104486.1| PREDICTED: myosin-9-like [Brassica rapa]
 ref|XP_009104487.1| PREDICTED: myosin-9-like [Brassica rapa]
Length=639

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 66/132 (50%), Positives = 88/132 (67%), Gaps = 7/132 (5%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            I +Y EKPY++LR G+ KVK      +CPFC+GKKKQ YKYK+LL HATGV KGSA R+ 
Sbjct  16   IADYSEKPYKQLRDGELKVKVKVDTFKCPFCSGKKKQHYKYKELLAHATGVAKGSAARNC  75

Query  302  KQKANHVALAKYLEIDL-GDQAEPLPQRAVAPED------NNLYCWPWTGIVVNVSKDNA  460
            KQKANH+AL+KYL+ +L GD   P  Q  V   +      N++Y WPW GIV++  + N 
Sbjct  76   KQKANHLALSKYLKNELAGDAEPPRLQLTVYSANQSQAVVNDMYVWPWMGIVISPLRGND  135

Query  461  NGTAVEEEDYWL  496
            + + + +  YWL
Sbjct  136  DKSLLLDSAYWL  147



>emb|CDX67967.1| BnaA07g20070D [Brassica napus]
Length=639

 Score =   106 bits (264),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 66/132 (50%), Positives = 88/132 (67%), Gaps = 7/132 (5%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            I +Y EKPY++LR G+ KVK      +CPFC+GKKKQ YKYK+LL HATGV KGSA R+ 
Sbjct  16   IADYSEKPYKQLRDGELKVKLKVDTFKCPFCSGKKKQHYKYKELLAHATGVSKGSAARNC  75

Query  302  KQKANHVALAKYLEIDL-GDQAEPLPQRAVAPED------NNLYCWPWTGIVVNVSKDNA  460
            KQKANH+AL+KYL+ +L GD   P  Q  V   +      N++Y WPW GIV++  + N 
Sbjct  76   KQKANHLALSKYLKNELAGDAEPPRLQLTVYSANQSQAVVNDMYVWPWMGIVISPLRGND  135

Query  461  NGTAVEEEDYWL  496
            + + + +  YWL
Sbjct  136  DKSLLLDSAYWL  147



>ref|XP_006300858.1| hypothetical protein CARUB_v10019950mg [Capsella rubella]
 ref|XP_006300859.1| hypothetical protein CARUB_v10019950mg [Capsella rubella]
 gb|EOA33756.1| hypothetical protein CARUB_v10019950mg [Capsella rubella]
 gb|EOA33757.1| hypothetical protein CARUB_v10019950mg [Capsella rubella]
Length=568

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 66/132 (50%), Positives = 87/132 (66%), Gaps = 14/132 (11%)
 Frame = +2

Query  131  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVKQK  310
            Y +KPYE +++G YKVK  +   RCPFC+GKKKQ YKYK+LL HA+GV KGSA+RS KQK
Sbjct  19   YSDKPYELIKNGHYKVKVKD-TFRCPFCSGKKKQHYKYKELLAHASGVAKGSASRSAKQK  77

Query  311  ANHVALAKYLEIDLGDQAE-PLPQ---------RAVAPEDNNLYCWPWTGIVVNVSKDNA  460
            ANH ALAKY++ +L   A+ P PQ         +AV    +++Y WPW GIV+N  +   
Sbjct  78   ANHFALAKYMQNELAADADVPRPQIPSSSSKQGQAVV---DDIYVWPWMGIVINPVRRTD  134

Query  461  NGTAVEEEDYWL  496
            N   + +  YWL
Sbjct  135  NNKLLLDSAYWL  146



>ref|XP_002890136.1| XH/XS domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66395.1| XH/XS domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=635

 Score =   103 bits (258),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 69/130 (53%), Positives = 87/130 (67%), Gaps = 9/130 (7%)
 Frame = +2

Query  131  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVKQK  310
            Y E PY  LR+G YKVK  NG LRCPFC+GKKKQDYKYK+L  HATGV KGSA+RS KQK
Sbjct  19   YSETPYLLLRNGSYKVK-VNGQLRCPFCSGKKKQDYKYKELYAHATGVSKGSASRSAKQK  77

Query  311  ANHVALAKYLEIDLGDQAEPLPQRA--------VAPEDNNLYCWPWTGIVVNVSKDNANG  466
            ANH+ALAK+LE +L   AEP+P+            P  +++Y WPW  IV+N  K+  + 
Sbjct  78   ANHLALAKFLENELAGYAEPVPRPPVVPPQFDETEPNPHDVYVWPWMAIVLNPLKETDDK  137

Query  467  TAVEEEDYWL  496
              + +  +WL
Sbjct  138  ELLLDSAFWL  147



>ref|XP_006300857.1| hypothetical protein CARUB_v10019950mg [Capsella rubella]
 gb|EOA33755.1| hypothetical protein CARUB_v10019950mg [Capsella rubella]
Length=635

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 66/132 (50%), Positives = 87/132 (66%), Gaps = 14/132 (11%)
 Frame = +2

Query  131  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVKQK  310
            Y +KPYE +++G YKVK  +   RCPFC+GKKKQ YKYK+LL HA+GV KGSA+RS KQK
Sbjct  19   YSDKPYELIKNGHYKVKVKD-TFRCPFCSGKKKQHYKYKELLAHASGVAKGSASRSAKQK  77

Query  311  ANHVALAKYLEIDLGDQAE-PLPQ---------RAVAPEDNNLYCWPWTGIVVNVSKDNA  460
            ANH ALAKY++ +L   A+ P PQ         +AV    +++Y WPW GIV+N  +   
Sbjct  78   ANHFALAKYMQNELAADADVPRPQIPSSSSKQGQAVV---DDIYVWPWMGIVINPVRRTD  134

Query  461  NGTAVEEEDYWL  496
            N   + +  YWL
Sbjct  135  NNKLLLDSAYWL  146



>ref|XP_010937610.1| PREDICTED: factor of DNA methylation 1-like [Elaeis guineensis]
Length=631

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 63/126 (50%), Positives = 83/126 (66%), Gaps = 8/126 (6%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            I++Y+ K Y+ L+SGK+KVK  +   RCPFC G+KKQDY++ +LLQHATGV  G++NR  
Sbjct  16   IDDYETKLYQLLKSGKFKVKNEDNTFRCPFCVGRKKQDYRHNELLQHATGV--GASNREA  73

Query  302  KQKANHVALAKYLEIDLGDQAEPLPQRAVAPEDN------NLYCWPWTGIVVNVSKDNAN  463
            K KANH ALAK L+ DL D A PL Q     +D+      + + WPW GI+VNV  +  N
Sbjct  74   KVKANHRALAKLLKDDLADAAGPLKQLISIEQDSTSKPKQDQFVWPWMGILVNVPTEWKN  133

Query  464  GTAVEE  481
            G  V E
Sbjct  134  GKQVGE  139



>ref|NP_567176.2| XH/XS domain-containing protein [Arabidopsis thaliana]
 sp|F4JH53.1|FDM2_ARATH RecName: Full=Factor of DNA methylation 2; AltName: Full=Protein 
IDN2 PARALOG 2; AltName: Full=Protein IDN2-LIKE 2 [Arabidopsis 
thaliana]
 gb|AEE81871.1| XH/XS domain-containing protein [Arabidopsis thaliana]
Length=635

 Score =   101 bits (251),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 69/130 (53%), Positives = 81/130 (62%), Gaps = 8/130 (6%)
 Frame = +2

Query  131  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVKQK  310
            Y + PY  LRS  Y     NG LRCPFC GKKKQDYKYK+L  HATGV KGSA RS  QK
Sbjct  18   YSKTPYHLLRSETYYKVKVNGRLRCPFCVGKKKQDYKYKELHAHATGVSKGSATRSALQK  77

Query  311  ANHVALAKYLEIDLGDQAEPLPQRA--------VAPEDNNLYCWPWTGIVVNVSKDNANG  466
            +NH+ALAK+LE DL   AEPLP+            P  +N+Y WPW GIVVN  K+  + 
Sbjct  78   SNHLALAKFLENDLAGYAEPLPRPPVVPPLLDETEPNPHNVYVWPWMGIVVNPLKETDDK  137

Query  467  TAVEEEDYWL  496
              + +  YWL
Sbjct  138  ELLLDSVYWL  147



>ref|XP_006306990.1| hypothetical protein CARUB_v10008566mg [Capsella rubella]
 ref|XP_006306991.1| hypothetical protein CARUB_v10008566mg [Capsella rubella]
 gb|EOA39888.1| hypothetical protein CARUB_v10008566mg [Capsella rubella]
 gb|EOA39889.1| hypothetical protein CARUB_v10008566mg [Capsella rubella]
Length=633

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 68/128 (53%), Positives = 81/128 (63%), Gaps = 7/128 (5%)
 Frame = +2

Query  131  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVKQK  310
            Y E PY  L++G YKVK  NG LRCPFC+GKKKQDYKYK+L  HA+GV KGSA RS KQK
Sbjct  19   YSETPYLLLQNGSYKVK-VNGQLRCPFCSGKKKQDYKYKELYAHASGVSKGSATRSAKQK  77

Query  311  ANHVALAKYLEIDLGDQAEPLPQRA------VAPEDNNLYCWPWTGIVVNVSKDNANGTA  472
            ANH+ALAK+L+ +L   AEP+P           P    +Y WPW GIV+N  KD      
Sbjct  78   ANHLALAKFLDNELAGHAEPVPPPPVPQLDKTKPNPGEVYVWPWMGIVLNPLKDADEKEV  137

Query  473  VEEEDYWL  496
            +    YW 
Sbjct  138  LLTSAYWF  145



>gb|AAF02798.1|AF195115_18 F5I10.22 gene product [Arabidopsis thaliana]
 gb|AAB62840.1| A_IG005I10.22 gene product [Arabidopsis thaliana]
 emb|CAB80796.1| AT4g00380 [Arabidopsis thaliana]
Length=662

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 69/130 (53%), Positives = 81/130 (62%), Gaps = 8/130 (6%)
 Frame = +2

Query  131  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVKQK  310
            Y + PY  LRS  Y     NG LRCPFC GKKKQDYKYK+L  HATGV KGSA RS  QK
Sbjct  18   YSKTPYHLLRSETYYKVKVNGRLRCPFCVGKKKQDYKYKELHAHATGVSKGSATRSALQK  77

Query  311  ANHVALAKYLEIDLGDQAEPLPQRA--------VAPEDNNLYCWPWTGIVVNVSKDNANG  466
            +NH+ALAK+LE DL   AEPLP+            P  +N+Y WPW GIVVN  K+  + 
Sbjct  78   SNHLALAKFLENDLAGYAEPLPRPPVVPPLLDETEPNPHNVYVWPWMGIVVNPLKETDDK  137

Query  467  TAVEEEDYWL  496
              + +  YWL
Sbjct  138  ELLLDSVYWL  147



>ref|XP_009149026.1| PREDICTED: nuclear mitotic apparatus protein 1 [Brassica rapa]
 ref|XP_009149027.1| PREDICTED: nuclear mitotic apparatus protein 1 [Brassica rapa]
Length=636

 Score = 99.8 bits (247),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 66/132 (50%), Positives = 85/132 (64%), Gaps = 13/132 (10%)
 Frame = +2

Query  131  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVKQK  310
            Y E PY  L++GKYKVK  NG LRCPFC+ KKKQDYKYK+L+ HA+GV KGSA+RS KQK
Sbjct  19   YSETPYLLLQNGKYKVK-VNGTLRCPFCSNKKKQDYKYKELMAHASGVSKGSASRSAKQK  77

Query  311  ANHVALAKYLEIDLGDQAE----------PLPQRAVAPEDNNLYCWPWTGIVVNVSKDNA  460
            ANH+ALA+YL+ +L   AE           L +    P    +Y WPW GI+V+  K+  
Sbjct  78   ANHLALARYLQNELAGDAEPLPRPPPVPPQLNESEAKP--GEVYVWPWMGIIVSPLKETD  135

Query  461  NGTAVEEEDYWL  496
            +  A+ +   WL
Sbjct  136  DKEALLDSACWL  147



>ref|XP_010472874.1| PREDICTED: factor of DNA methylation 5-like [Camelina sativa]
Length=636

 Score = 99.4 bits (246),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 65/131 (50%), Positives = 85/131 (65%), Gaps = 14/131 (11%)
 Frame = +2

Query  131  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVKQK  310
            Y EKPYE +++G YKVK  +   RCPFC+GKKKQ YKYK+LL HA+GV KGS++RS KQK
Sbjct  20   YAEKPYELMKNGNYKVKVKD-TFRCPFCSGKKKQHYKYKELLAHASGVAKGSSSRSAKQK  78

Query  311  ANHVALAKYLEIDL-GDQAEPLPQ---------RAVAPEDNNLYCWPWTGIVVNVSKDNA  460
            ANH ALAKY++ +L GD   P PQ         +AV    +++Y WPW GIV+   +   
Sbjct  79   ANHFALAKYMQNELAGDSDVPRPQIPSSSSKQSQAVV---DDVYVWPWMGIVIYPVRRTD  135

Query  461  NGTAVEEEDYW  493
            N   + +  YW
Sbjct  136  NNYYLLDSAYW  146



>ref|XP_010429902.1| PREDICTED: factor of DNA methylation 5-like [Camelina sativa]
 ref|XP_010429903.1| PREDICTED: factor of DNA methylation 5-like [Camelina sativa]
Length=636

 Score = 99.0 bits (245),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 65/131 (50%), Positives = 85/131 (65%), Gaps = 14/131 (11%)
 Frame = +2

Query  131  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVKQK  310
            Y EKPYE +++G YKVK  +   RCPFC+GKKKQ YKYK+LL HA+GV KGS++RS KQK
Sbjct  20   YAEKPYELMKNGTYKVKVKD-TFRCPFCSGKKKQHYKYKELLAHASGVAKGSSSRSAKQK  78

Query  311  ANHVALAKYLEIDL-GDQAEPLPQ---------RAVAPEDNNLYCWPWTGIVVNVSKDNA  460
            ANH ALAKY++ +L GD   P PQ         +AV    +++Y WPW GIV+   +   
Sbjct  79   ANHFALAKYMQNELAGDSDLPRPQIPSSSSKQSQAVV---DDVYVWPWMGIVIYPVRRTD  135

Query  461  NGTAVEEEDYW  493
            N   + +  YW
Sbjct  136  NNYYLLDSAYW  146



>ref|XP_010417660.1| PREDICTED: factor of DNA methylation 5-like [Camelina sativa]
Length=636

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 79/113 (70%), Gaps = 14/113 (12%)
 Frame = +2

Query  131  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVKQK  310
            Y EKPYE +++G YKVK  +   RCPFC+GKKKQ YKYK+LL HA+GV KGS++RS KQK
Sbjct  20   YAEKPYELMKNGNYKVKVKD-TFRCPFCSGKKKQHYKYKELLAHASGVAKGSSSRSAKQK  78

Query  311  ANHVALAKYLEIDL-GDQAEPLPQ---------RAVAPEDNNLYCWPWTGIVV  439
            ANH ALAKY++ +L GD   P PQ         +AV    +++Y WPW GIV+
Sbjct  79   ANHFALAKYMQNELAGDSDLPRPQIPSSSSKQSQAVV---DDVYVWPWMGIVI  128



>ref|XP_006391023.1| hypothetical protein EUTSA_v10019728mg [Eutrema salsugineum]
 gb|ESQ28309.1| hypothetical protein EUTSA_v10019728mg [Eutrema salsugineum]
Length=621

 Score = 97.8 bits (242),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 62/126 (49%), Positives = 83/126 (66%), Gaps = 6/126 (5%)
 Frame = +2

Query  137  EKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVKQKAN  316
            E PY+ L+ G YKVK      RCPFC+GKKKQ YKYKDLL HATG+  GSA+RS KQKAN
Sbjct  22   EYPYKLLKKGDYKVKLKEDTFRCPFCSGKKKQHYKYKDLLAHATGLAIGSASRSAKQKAN  81

Query  317  HVALAKYLEIDL-GDQAEPLPQRAV-----APEDNNLYCWPWTGIVVNVSKDNANGTAVE  478
            H+AL KY+E +L G  A  +P+  +     + + +++Y WPW GIV+N  + N +   + 
Sbjct  82   HLALRKYMENELAGGDAHQVPRLQIITSSSSKQSSDIYVWPWMGIVINPLRRNDDKNLLL  141

Query  479  EEDYWL  496
            +  YWL
Sbjct  142  DSAYWL  147



>ref|XP_008799862.1| PREDICTED: MAR-binding filament-like protein 1 [Phoenix dactylifera]
Length=632

 Score = 97.1 bits (240),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 60/128 (47%), Positives = 86/128 (67%), Gaps = 11/128 (9%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            I++Y+ K YE L+SGK+KVK  +   RCPFC G+KKQDY++ +LLQHATG+  G++NR  
Sbjct  16   IDDYETKLYELLKSGKFKVKNEDNTFRCPFCVGRKKQDYRHNELLQHATGL--GASNREA  73

Query  302  KQKANHVALAKYLEIDLGDQAEPLPQRAVA--------PEDNNLYCWPWTGIVVNVSKDN  457
              KANH ALAK L+ DL D+A P P++ ++        P+ ++ + WPW GI+VNV  + 
Sbjct  74   IVKANHRALAKLLKDDLADEAGP-PKQLISIEQNSTSKPKQDDQFVWPWMGILVNVPTEW  132

Query  458  ANGTAVEE  481
             +G  V E
Sbjct  133  KDGRQVGE  140



>ref|XP_010910789.1| PREDICTED: factor of DNA methylation 1-like [Elaeis guineensis]
Length=625

 Score = 96.7 bits (239),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 59/115 (51%), Positives = 80/115 (70%), Gaps = 8/115 (7%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            ++EY+E  Y  L++GK +V+ P+G  RCPFCAGKKKQ+Y YKDLLQHATGVG  S +R  
Sbjct  16   LDEYEEDYYRVLKTGKQRVRNPDGTFRCPFCAGKKKQEYLYKDLLQHATGVG-ASNSRRA  74

Query  302  KQKANHVALAKYLEIDLGDQA-----EPL--PQRAVAPEDNNLYCWPWTGIVVNV  445
            K+KA H A A++L+ DL D A      P+   Q+A  P D+ L+ WPW G+++NV
Sbjct  75   KEKATHRAFARFLKTDLADAAGCSQFAPVEQEQQAPKPSDDELFVWPWMGVLINV  129



>emb|CDY33370.1| BnaC05g12130D [Brassica napus]
Length=1005

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 87/130 (67%), Gaps = 9/130 (7%)
 Frame = +2

Query  131  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVKQK  310
            Y E PY  L++GKYKVK  NG LRCPFC+ KKKQDYKYK+L+ HA+GV KGSA+RS KQK
Sbjct  367  YSETPYLLLQNGKYKVK-VNGTLRCPFCSNKKKQDYKYKELMAHASGVSKGSASRSAKQK  425

Query  311  ANHVALAKYLEIDLGDQAEPLPQRAVAPEDNN--------LYCWPWTGIVVNVSKDNANG  466
            ANH+ALA+YL+ +L   AEPLP+    P   N        +Y WPW GI+++   +  + 
Sbjct  426  ANHLALARYLQNELAGDAEPLPRPPPVPPQLNESEAKPGEVYVWPWMGIIISPLNETDDK  485

Query  467  TAVEEEDYWL  496
             A+ +   WL
Sbjct  486  EALLDPACWL  495



>ref|XP_008784591.1| PREDICTED: uncharacterized protein LOC103703501 [Phoenix dactylifera]
 ref|XP_008784593.1| PREDICTED: uncharacterized protein LOC103703501 [Phoenix dactylifera]
Length=625

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 59/115 (51%), Positives = 80/115 (70%), Gaps = 8/115 (7%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            ++EY+E  Y  L++G ++VK P+G  RCPFCAGKKKQ+Y YKDLLQHATGVG  S +R  
Sbjct  16   LDEYEEDYYIVLKTGNHRVKNPDGTFRCPFCAGKKKQEYLYKDLLQHATGVG-ASNSRRA  74

Query  302  KQKANHVALAKYLEIDLGD-----QAEPLPQRAVAPE--DNNLYCWPWTGIVVNV  445
            K+KA H A A++L+ DL D     Q  P+ Q   AP+  D+ L+ WPW G+++NV
Sbjct  75   KEKATHRAFARFLKTDLADAAGSSQLSPVEQEQHAPKPCDDELFVWPWMGLLINV  129



>emb|CDY35897.1| BnaA07g00900D [Brassica napus]
Length=139

 Score = 90.1 bits (222),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 76/116 (66%), Gaps = 5/116 (4%)
 Frame = +2

Query  140  KPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVKQKANH  319
            KPY++LR G+ KVK      +CPFC+ +KKQ YK K+LL HAT V K S  R+ KQKANH
Sbjct  16   KPYKQLRDGELKVKLKEETFKCPFCSERKKQRYKDKELLAHATAVAK-STTRNCKQKANH  74

Query  320  VALAKYLEIDLGDQAEPL----PQRAVAPEDNNLYCWPWTGIVVNVSKDNANGTAV  475
            +AL+KYL  DL   AEP+     Q+  A  ++++Y WPW GIV++  + N +  ++
Sbjct  75   LALSKYLHKDLAGDAEPVISLSKQKQAAVVNDDMYVWPWMGIVISPLRGNDDDKSL  130



>ref|XP_010256908.1| PREDICTED: protein INVOLVED IN DE NOVO 2-like [Nelumbo nucifera]
 ref|XP_010256909.1| PREDICTED: protein INVOLVED IN DE NOVO 2-like [Nelumbo nucifera]
 ref|XP_010256910.1| PREDICTED: protein INVOLVED IN DE NOVO 2-like [Nelumbo nucifera]
Length=642

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 59/125 (47%), Positives = 82/125 (66%), Gaps = 5/125 (4%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            I E+++K Y++L++G Y+VK      RCPFC GK+K+DY Y ++LQHA G+G GS NRSV
Sbjct  16   IEEHEDKSYKKLKNGNYQVKTSGESFRCPFCPGKRKRDYLYMEILQHAAGLGTGSHNRSV  75

Query  302  KQKANHVALAKYLEIDLGDQAEPLPQRAVA--PEDNN---LYCWPWTGIVVNVSKDNANG  466
            KQKANH+AL KYL+ ++     P  + A    P  +N    + WPWTGIVVN+  +  +G
Sbjct  76   KQKANHLALXKYLKTEIAPVGGPSERAAETKPPTGHNHDEKFVWPWTGIVVNLPIEWKDG  135

Query  467  TAVEE  481
              V E
Sbjct  136  RYVGE  140



>ref|XP_010067411.1| PREDICTED: coiled-coil domain-containing protein 39 [Eucalyptus 
grandis]
 gb|KCW65540.1| hypothetical protein EUGRSUZ_G02937 [Eucalyptus grandis]
Length=645

 Score = 94.4 bits (233),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 58/112 (52%), Positives = 78/112 (70%), Gaps = 6/112 (5%)
 Frame = +2

Query  128  EYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RSVK  304
            +YKEK YEEL+SG ++VK  +    CP+C  K+K+DY+Y +LLQHA+GVGK S+  RS K
Sbjct  22   DYKEKSYEELKSGNHQVKVSDEAFACPYCPKKRKRDYQYNELLQHASGVGKSSSEKRSAK  81

Query  305  QKANHVALAKYLEIDLGDQAEP--LPQRAVAP---EDNNLYCWPWTGIVVNV  445
            +KANH+ALAKYLE DL D A P  L     AP     ++ + WPW G+V+N+
Sbjct  82   EKANHLALAKYLEKDLSDVAGPSKLVDEGKAPIGCSHDDKFVWPWKGVVMNI  133



>gb|KCW65539.1| hypothetical protein EUGRSUZ_G02937 [Eucalyptus grandis]
Length=646

 Score = 94.4 bits (233),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 58/112 (52%), Positives = 78/112 (70%), Gaps = 6/112 (5%)
 Frame = +2

Query  128  EYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RSVK  304
            +YKEK YEEL+SG ++VK  +    CP+C  K+K+DY+Y +LLQHA+GVGK S+  RS K
Sbjct  22   DYKEKSYEELKSGNHQVKVSDEAFACPYCPKKRKRDYQYNELLQHASGVGKSSSEKRSAK  81

Query  305  QKANHVALAKYLEIDLGDQAEP--LPQRAVAP---EDNNLYCWPWTGIVVNV  445
            +KANH+ALAKYLE DL D A P  L     AP     ++ + WPW G+V+N+
Sbjct  82   EKANHLALAKYLEKDLSDVAGPSKLVDEGKAPIGCSHDDKFVWPWKGVVMNI  133



>gb|EEC75682.1| hypothetical protein OsI_12489 [Oryza sativa Indica Group]
Length=568

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 73/112 (65%), Gaps = 5/112 (4%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            I  ++EK Y +LR+GK KVK  N   RCPFC GKKKQDY  KDLLQHA+GVG  S +++ 
Sbjct  16   IGVHEEKTYNQLRAGKVKVKHGNNTFRCPFCPGKKKQDYSSKDLLQHASGVGAASKHKA-  74

Query  302  KQKANHVALAKYLEIDLGDQAEPLPQRAVA----PEDNNLYCWPWTGIVVNV  445
            K KA H+ALA+YL++DL    E  PQ A      P     Y WPW GI+VN+
Sbjct  75   KVKATHLALARYLKVDLAGSLESSPQLATVEHQPPGSEEKYVWPWMGILVNL  126



>gb|AAO60001.1| putative XS domain containing protein [Oryza sativa Japonica 
Group]
 gb|ABF97445.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=475

 Score = 90.1 bits (222),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 70/112 (63%), Gaps = 5/112 (4%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            I  ++EK Y +LR+ K KVK  N   RCPFC GKKKQDY  KDLLQHA+GVG  S  R  
Sbjct  16   IGVHEEKTYNQLRAEKVKVKHGNNTFRCPFCPGKKKQDYSSKDLLQHASGVGAAS-KRKA  74

Query  302  KQKANHVALAKYLEIDLGDQAEPLPQRAVA----PEDNNLYCWPWTGIVVNV  445
            K KA H+ALA+YL++DL    E  PQ A      P     Y WPW GI+VN+
Sbjct  75   KVKATHLALARYLKVDLAGSLESSPQLATVEHQPPGSEEKYVWPWMGILVNL  126



>ref|XP_008802711.1| PREDICTED: paramyosin, long form-like [Phoenix dactylifera]
 ref|XP_008802712.1| PREDICTED: paramyosin, long form-like [Phoenix dactylifera]
Length=631

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 60/125 (48%), Positives = 80/125 (64%), Gaps = 8/125 (6%)
 Frame = +2

Query  125  NEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVK  304
            ++Y+EK Y  L+ GK KVK  +   +CPFCAGKKKQDY YKDLLQHA GV  G++NR+ K
Sbjct  17   DDYEEKFYLYLKDGKLKVKNTDSTYKCPFCAGKKKQDYNYKDLLQHANGV--GASNRTAK  74

Query  305  QKANHVALAKYLEIDLGDQAEPLPQRAVA------PEDNNLYCWPWTGIVVNVSKDNANG  466
             KA+H ALA+YL+ D  + +    Q  +       P+D + + WPW GI+VNV  +  NG
Sbjct  75   VKADHRALARYLKNDFAEASSSSMQLMIVQHHPFKPKDEDQFVWPWMGILVNVPTEYKNG  134

Query  467  TAVEE  481
              V E
Sbjct  135  RYVGE  139



>gb|KHN04171.1| hypothetical protein glysoja_032667 [Glycine soja]
Length=491

 Score = 87.8 bits (216),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 57/85 (67%), Gaps = 12/85 (14%)
 Frame = +2

Query  260  HATGVGKGSANRSVKQKANHVALAKYLEIDLGDQAEP-----LPQRAVAP-EDNNLYCWP  421
            HA+GVGKGSANRS +QKANH+ALAKYLE DL  +AEP     LPQ    P    +LY WP
Sbjct  20   HASGVGKGSANRSAQQKANHLALAKYLETDLACEAEPIQRPALPQAVNQPLHQEDLYVWP  79

Query  422  WTGIVVNVSKDNANGTAVEEEDYWL  496
            WTGI+VN+      G ++ +  YWL
Sbjct  80   WTGIIVNIK-----GKSI-DSGYWL  98



>ref|XP_002443867.1| hypothetical protein SORBIDRAFT_07g003550 [Sorghum bicolor]
 gb|EES13362.1| hypothetical protein SORBIDRAFT_07g003550 [Sorghum bicolor]
Length=626

 Score = 88.2 bits (217),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 80/123 (65%), Gaps = 10/123 (8%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            I++Y EK Y +L++GK+  +  +   RCPFC GKKKQDY+Y +LLQHA GV  G++NR+ 
Sbjct  16   IDDYAEKSYADLKAGKFVARLGSDRFRCPFCPGKKKQDYRYNELLQHAVGV--GASNRAA  73

Query  302  KQKANHVALAKYLEIDLGDQAEP-LPQRAVA-------PEDNNLYCWPWTGIVVNVSKDN  457
            K KANH ALAK L++D  D A   LP++A+A        +D  ++ WPW GI+ NV  + 
Sbjct  74   KVKANHQALAKLLKVDHADAAATLLPRQAIALSNPPKPVQDLEVFVWPWMGILANVPAEQ  133

Query  458  ANG  466
              G
Sbjct  134  TQG  136



>ref|XP_006659121.1| PREDICTED: putative leucine-rich repeat-containing protein DDB_G0290503-like 
[Oryza brachyantha]
Length=626

 Score = 88.2 bits (217),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 60/123 (49%), Positives = 78/123 (63%), Gaps = 10/123 (8%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            I++Y +K Y +L+SGK  V+  N   RCPFC GKKKQDY+Y +LLQHA GV  G++NR+ 
Sbjct  15   IDDYVDKSYMDLKSGKNVVRLGNEKFRCPFCLGKKKQDYRYNELLQHAVGV--GASNRAP  72

Query  302  KQKANHVALAKYLEIDLGDQAEPLP-QRAVAPE-------DNNLYCWPWTGIVVNVSKDN  457
            K +ANH+ALA  L+ D  D A  LP Q+ VAP        D  +Y WPW GI+ NV  + 
Sbjct  73   KVRANHMALANLLKNDYTDAAGSLPSQQVVAPSNPPRPLPDQEVYVWPWMGILANVPAEQ  132

Query  458  ANG  466
              G
Sbjct  133  TEG  135



>ref|XP_007163408.1| hypothetical protein PHAVU_001G232400g [Phaseolus vulgaris]
 ref|XP_007163409.1| hypothetical protein PHAVU_001G232400g [Phaseolus vulgaris]
 ref|XP_007163410.1| hypothetical protein PHAVU_001G232400g [Phaseolus vulgaris]
 ref|XP_007163411.1| hypothetical protein PHAVU_001G232400g [Phaseolus vulgaris]
 gb|ESW35402.1| hypothetical protein PHAVU_001G232400g [Phaseolus vulgaris]
 gb|ESW35403.1| hypothetical protein PHAVU_001G232400g [Phaseolus vulgaris]
 gb|ESW35404.1| hypothetical protein PHAVU_001G232400g [Phaseolus vulgaris]
 gb|ESW35405.1| hypothetical protein PHAVU_001G232400g [Phaseolus vulgaris]
Length=641

 Score = 88.2 bits (217),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 56/128 (44%), Positives = 83/128 (65%), Gaps = 8/128 (6%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RS  298
            I+EY++K YEEL+SG   +K P+    CP+C  K+K+DY YK+LLQHA+GVG+ S+  R 
Sbjct  17   ISEYEDKSYEELKSGSQNLKTPDETFTCPYCPKKRKRDYLYKELLQHASGVGQSSSQKRK  76

Query  299  VKQKANHVALAKYLEIDL------GDQAEPLPQRAVAPEDNNLYCWPWTGIVVNV-SKDN  457
             + KANH+AL KYLE DL       + ++P+ +   +   N+ + WPW GIVVN+ ++  
Sbjct  77   ARDKANHLALVKYLENDLMNVDVPSNNSKPVDESDSSVNSNDQFVWPWVGIVVNIPTRRT  136

Query  458  ANGTAVEE  481
             +G  V E
Sbjct  137  EDGRCVGE  144



>ref|XP_011091511.1| PREDICTED: protein INVOLVED IN DE NOVO 2 [Sesamum indicum]
Length=641

 Score = 87.8 bits (216),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 57/124 (46%), Positives = 83/124 (67%), Gaps = 6/124 (5%)
 Frame = +2

Query  128  EYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RSVK  304
            +Y+EK YEEL+SGK++VK  +    CP+C  K+K+D++YK+LLQHA+ +G  S++ R+ +
Sbjct  22   DYQEKAYEELKSGKHQVKISDQAYTCPYCPKKRKRDFQYKELLQHASAIGSCSSHKRTAR  81

Query  305  QKANHVALAKYLE----IDLGDQAEPLPQRAVAPED-NNLYCWPWTGIVVNVSKDNANGT  469
             KANH+ALAKYLE    +D G         A+A +D + L+ WPW GIVVN+  D  +G 
Sbjct  82   DKANHLALAKYLENDTAVDAGPSKPSAEVDALADQDRDELFVWPWIGIVVNIPTDFKDGR  141

Query  470  AVEE  481
             V E
Sbjct  142  YVGE  145



>gb|KDO41499.1| hypothetical protein CISIN_1g047081mg [Citrus sinensis]
Length=432

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 82/123 (67%), Gaps = 6/123 (5%)
 Frame = +2

Query  128  EYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVKQ  307
            +Y+++ YE+L+SG Y VK  +    CP+C  K+K DY YKDLLQHA+G+G  S+ RS K+
Sbjct  18   DYEDRSYEKLKSGNYNVKISDETFTCPYCPKKRKHDYLYKDLLQHASGIG-NSSKRSAKE  76

Query  308  KANHVALAKYLEIDLGD-QAEPLPQRAVAPED---NNLYCWPWTGIVVNV-SKDNANGTA  472
            KANH+ALAK+LE DL D  ++  P   V P +   +  + WPW GIVVN+ ++   +G +
Sbjct  77   KANHLALAKFLETDLSDVGSQSKPVNGVDPLNVCSDGKFVWPWIGIVVNIPTRRGQDGRS  136

Query  473  VEE  481
            V E
Sbjct  137  VGE  139



>ref|XP_006431941.1| hypothetical protein CICLE_v10000571mg [Citrus clementina]
 gb|ESR45181.1| hypothetical protein CICLE_v10000571mg [Citrus clementina]
Length=564

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 58/123 (47%), Positives = 83/123 (67%), Gaps = 6/123 (5%)
 Frame = +2

Query  128  EYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVKQ  307
            +Y++K YE+L+SG Y VK  +    CP+C  K+K DY+YKDLLQHA+G+G  S+ RS K+
Sbjct  18   DYEDKSYEKLKSGNYNVKISDETFTCPYCPKKRKHDYRYKDLLQHASGIGN-SSKRSAKE  76

Query  308  KANHVALAKYLEIDLGD-QAEPLPQRAVAPED---NNLYCWPWTGIVVNV-SKDNANGTA  472
            KANH+ALAK+LE DL D  ++  P   V P +   +  + WPW GIVVN+ ++   +G +
Sbjct  77   KANHLALAKFLETDLSDVGSQSKPVNGVDPLNVCSDGKFVWPWIGIVVNIPTRRGQDGRS  136

Query  473  VEE  481
            V E
Sbjct  137  VGE  139



>ref|XP_006491885.1| PREDICTED: calponin homology domain-containing protein DDB_G0272472-like 
isoform X2 [Citrus sinensis]
Length=497

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 57/123 (46%), Positives = 82/123 (67%), Gaps = 6/123 (5%)
 Frame = +2

Query  128  EYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVKQ  307
            +Y+++ YE+L+SG Y VK  +    CP+C  K+K DY YKDLLQHA+G+G  S+ RS K+
Sbjct  18   DYEDRSYEKLKSGNYNVKISDETFTCPYCPKKRKHDYLYKDLLQHASGIGN-SSKRSAKE  76

Query  308  KANHVALAKYLEIDLGD-QAEPLPQRAVAPED---NNLYCWPWTGIVVNV-SKDNANGTA  472
            KANH+ALAK+LE DL D  ++  P   V P +   +  + WPW GIVVN+ ++   +G +
Sbjct  77   KANHLALAKFLETDLSDVGSQSKPVNGVDPLNVCSDGKFVWPWIGIVVNIPTRRGQDGRS  136

Query  473  VEE  481
            V E
Sbjct  137  VGE  139



>gb|EMT06773.1| hypothetical protein F775_17939 [Aegilops tauschii]
Length=631

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 61/127 (48%), Positives = 82/127 (65%), Gaps = 6/127 (5%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            I+EYK+K Y +LRSGK +V+     LRCPFC GKKKQDY  KDLLQHA+G+G  S  R  
Sbjct  18   IDEYKDKMYAQLRSGKMRVRYGEKALRCPFCLGKKKQDYNGKDLLQHASGIGVAS-KRKP  76

Query  302  KQKANHVALAKYLEIDLGDQAEPLPQRAV----APEDNNL-YCWPWTGIVVNVSKDNANG  466
             ++A H+ALA+YL+ DLG   +P  Q A+     P++  + Y  PWTGI+VN+  D  + 
Sbjct  77   MERAGHLALAEYLKNDLGISLKPPSQLAIIEHKPPKNEEVKYVCPWTGILVNLPNDLKDI  136

Query  467  TAVEEED  487
              V E +
Sbjct  137  DCVRENE  143



>ref|XP_006435547.1| hypothetical protein CICLE_v10030937mg [Citrus clementina]
 gb|ESR48787.1| hypothetical protein CICLE_v10030937mg [Citrus clementina]
Length=574

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 60/125 (48%), Positives = 81/125 (65%), Gaps = 7/125 (6%)
 Frame = +2

Query  128  EYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RSVK  304
            +Y++K Y++L+SG + VK  +    CP+C  K+KQ+Y YKDLLQHA+GVG  ++N RS K
Sbjct  18   KYEDKSYKKLKSGNHSVKISDEAFTCPYCPKKRKQEYLYKDLLQHASGVGNSTSNKRSAK  77

Query  305  QKANHVALAKYLEIDLGDQAEPL-PQRAVAP----EDNNLYCWPWTGIVVNVSKDNA-NG  466
            +KANH+ALAKYLE DL D   P  P     P      +  + WPWTGIVVN+    A +G
Sbjct  78   EKANHLALAKYLEKDLRDAGSPSKPVNEGDPLTGCSHDEKFVWPWTGIVVNIPTRRAEDG  137

Query  467  TAVEE  481
             +V E
Sbjct  138  RSVGE  142



>gb|KDO69293.1| hypothetical protein CISIN_1g0065972mg [Citrus sinensis]
Length=574

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 60/125 (48%), Positives = 81/125 (65%), Gaps = 7/125 (6%)
 Frame = +2

Query  128  EYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RSVK  304
            +Y++K Y++L+SG + VK  +    CP+C  K+KQ+Y YKDLLQHA+GVG  ++N RS K
Sbjct  18   KYEDKSYKKLKSGNHSVKISDEAFTCPYCPKKRKQEYLYKDLLQHASGVGNSTSNKRSAK  77

Query  305  QKANHVALAKYLEIDLGDQAEP-LPQRAVAP----EDNNLYCWPWTGIVVNVSKDNA-NG  466
            +KANH+ALAKYLE DL D   P  P     P      +  + WPWTGIVVN+    A +G
Sbjct  78   EKANHLALAKYLEKDLRDAGSPSKPVNEGDPLTGCSHDEKFVWPWTGIVVNIPTRRAEDG  137

Query  467  TAVEE  481
             +V E
Sbjct  138  RSVGE  142



>ref|XP_006486475.1| PREDICTED: intracellular protein transport protein USO1-like 
isoform X2 [Citrus sinensis]
Length=597

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 60/125 (48%), Positives = 81/125 (65%), Gaps = 7/125 (6%)
 Frame = +2

Query  128  EYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RSVK  304
            +Y++K Y++L+SG + VK  +    CP+C  K+KQ+Y YKDLLQHA+GVG  ++N RS K
Sbjct  18   KYEDKSYKKLKSGNHSVKISDEAFTCPYCPKKRKQEYLYKDLLQHASGVGNSTSNKRSAK  77

Query  305  QKANHVALAKYLEIDLGDQAEP-LPQRAVAP----EDNNLYCWPWTGIVVNVSKDNA-NG  466
            +KANH+ALAKYLE DL D   P  P     P      +  + WPWTGIVVN+    A +G
Sbjct  78   EKANHLALAKYLEKDLRDAGSPSKPVNEGDPLTGCSHDEKFVWPWTGIVVNIPTRRAEDG  137

Query  467  TAVEE  481
             +V E
Sbjct  138  RSVGE  142



>ref|XP_010658558.1| PREDICTED: protein INVOLVED IN DE NOVO 2 isoform X1 [Vitis vinifera]
Length=656

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 54/118 (46%), Positives = 78/118 (66%), Gaps = 8/118 (7%)
 Frame = +2

Query  137  EKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSA-NRSVKQKA  313
            +K YEEL++G + VK       CP+C+ KKK+DY YK+LLQHA GVGK S+  RS+K KA
Sbjct  23   DKSYEELKNGNHHVKTSGESFSCPYCSKKKKRDYLYKELLQHAIGVGKSSSEKRSMKDKA  82

Query  314  NHVALAKYLEIDL-------GDQAEPLPQRAVAPEDNNLYCWPWTGIVVNVSKDNANG  466
            NH+ALAKYLE D+       G  ++P  +  +  + + ++ WPWTG+VVN+  +  +G
Sbjct  83   NHLALAKYLEKDIMDVDGPSGGPSKPKSEAPLGCDHDEMFVWPWTGVVVNIPTELRDG  140



>ref|XP_006431940.1| hypothetical protein CICLE_v10000571mg [Citrus clementina]
 gb|ESR45180.1| hypothetical protein CICLE_v10000571mg [Citrus clementina]
Length=633

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 58/123 (47%), Positives = 83/123 (67%), Gaps = 6/123 (5%)
 Frame = +2

Query  128  EYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVKQ  307
            +Y++K YE+L+SG Y VK  +    CP+C  K+K DY+YKDLLQHA+G+G  S+ RS K+
Sbjct  18   DYEDKSYEKLKSGNYNVKISDETFTCPYCPKKRKHDYRYKDLLQHASGIGN-SSKRSAKE  76

Query  308  KANHVALAKYLEIDLGD-QAEPLPQRAVAPED---NNLYCWPWTGIVVNV-SKDNANGTA  472
            KANH+ALAK+LE DL D  ++  P   V P +   +  + WPW GIVVN+ ++   +G +
Sbjct  77   KANHLALAKFLETDLSDVGSQSKPVNGVDPLNVCSDGKFVWPWIGIVVNIPTRRGQDGRS  136

Query  473  VEE  481
            V E
Sbjct  137  VGE  139



>ref|XP_002278500.1| PREDICTED: protein INVOLVED IN DE NOVO 2 isoform X2 [Vitis vinifera]
 emb|CBI31664.3| unnamed protein product [Vitis vinifera]
Length=641

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 54/118 (46%), Positives = 78/118 (66%), Gaps = 8/118 (7%)
 Frame = +2

Query  137  EKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSA-NRSVKQKA  313
            +K YEEL++G + VK       CP+C+ KKK+DY YK+LLQHA GVGK S+  RS+K KA
Sbjct  23   DKSYEELKNGNHHVKTSGESFSCPYCSKKKKRDYLYKELLQHAIGVGKSSSEKRSMKDKA  82

Query  314  NHVALAKYLEIDL-------GDQAEPLPQRAVAPEDNNLYCWPWTGIVVNVSKDNANG  466
            NH+ALAKYLE D+       G  ++P  +  +  + + ++ WPWTG+VVN+  +  +G
Sbjct  83   NHLALAKYLEKDIMDVDGPSGGPSKPKSEAPLGCDHDEMFVWPWTGVVVNIPTELRDG  140



>ref|XP_011089483.1| PREDICTED: protein INVOLVED IN DE NOVO 2-like [Sesamum indicum]
 ref|XP_011089484.1| PREDICTED: protein INVOLVED IN DE NOVO 2-like [Sesamum indicum]
Length=284

 Score = 83.2 bits (204),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 73/120 (61%), Gaps = 6/120 (5%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            ++EY ++ YE+L+ G  KVK  +   RCP+C GKKK  Y  KDLLQHA+ VGKGS NR +
Sbjct  16   LDEYVDRCYEQLKDGSRKVKFSDEVYRCPYCPGKKKLVYALKDLLQHASDVGKGSQNRDI  75

Query  302  KQKANHVALAKYLEIDLG--DQAEPLPQRAV-APEDN---NLYCWPWTGIVVNVSKDNAN  463
            K K  H+ L +Y++ DL   D +  L   A+  P  N    L+ WPW GI+ NV  + ++
Sbjct  76   KHKGKHLGLVRYIKDDLAQEDLSSELAGLALEVPTGNGVSELFVWPWMGILANVDAEKSS  135



>ref|XP_006435548.1| hypothetical protein CICLE_v10030937mg [Citrus clementina]
 ref|XP_006486474.1| PREDICTED: intracellular protein transport protein USO1-like 
isoform X1 [Citrus sinensis]
 gb|ESR48788.1| hypothetical protein CICLE_v10030937mg [Citrus clementina]
Length=639

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 60/125 (48%), Positives = 81/125 (65%), Gaps = 7/125 (6%)
 Frame = +2

Query  128  EYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RSVK  304
            +Y++K Y++L+SG + VK  +    CP+C  K+KQ+Y YKDLLQHA+GVG  ++N RS K
Sbjct  18   KYEDKSYKKLKSGNHSVKISDEAFTCPYCPKKRKQEYLYKDLLQHASGVGNSTSNKRSAK  77

Query  305  QKANHVALAKYLEIDLGDQAEP-LPQRAVAP----EDNNLYCWPWTGIVVNVSKDNA-NG  466
            +KANH+ALAKYLE DL D   P  P     P      +  + WPWTGIVVN+    A +G
Sbjct  78   EKANHLALAKYLEKDLRDAGSPSKPVNEGDPLTGCSHDEKFVWPWTGIVVNIPTRRAEDG  137

Query  467  TAVEE  481
             +V E
Sbjct  138  RSVGE  142



>ref|XP_006491884.1| PREDICTED: calponin homology domain-containing protein DDB_G0272472-like 
isoform X1 [Citrus sinensis]
Length=633

 Score = 85.9 bits (211),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 57/123 (46%), Positives = 82/123 (67%), Gaps = 6/123 (5%)
 Frame = +2

Query  128  EYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVKQ  307
            +Y+++ YE+L+SG Y VK  +    CP+C  K+K DY YKDLLQHA+G+G  S+ RS K+
Sbjct  18   DYEDRSYEKLKSGNYNVKISDETFTCPYCPKKRKHDYLYKDLLQHASGIGN-SSKRSAKE  76

Query  308  KANHVALAKYLEIDLGD-QAEPLPQRAVAPED---NNLYCWPWTGIVVNV-SKDNANGTA  472
            KANH+ALAK+LE DL D  ++  P   V P +   +  + WPW GIVVN+ ++   +G +
Sbjct  77   KANHLALAKFLETDLSDVGSQSKPVNGVDPLNVCSDGKFVWPWIGIVVNIPTRRGQDGRS  136

Query  473  VEE  481
            V E
Sbjct  137  VGE  139



>gb|KDO69291.1| hypothetical protein CISIN_1g0065972mg [Citrus sinensis]
 gb|KDO69292.1| hypothetical protein CISIN_1g0065972mg [Citrus sinensis]
Length=639

 Score = 85.9 bits (211),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 60/125 (48%), Positives = 81/125 (65%), Gaps = 7/125 (6%)
 Frame = +2

Query  128  EYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RSVK  304
            +Y++K Y++L+SG + VK  +    CP+C  K+KQ+Y YKDLLQHA+GVG  ++N RS K
Sbjct  18   KYEDKSYKKLKSGNHSVKISDEAFTCPYCPKKRKQEYLYKDLLQHASGVGNSTSNKRSAK  77

Query  305  QKANHVALAKYLEIDLGDQAEP-LPQRAVAP----EDNNLYCWPWTGIVVNVSKDNA-NG  466
            +KANH+ALAKYLE DL D   P  P     P      +  + WPWTGIVVN+    A +G
Sbjct  78   EKANHLALAKYLEKDLRDAGSPSKPVNEGDPLTGCSHDEKFVWPWTGIVVNIPTRRAEDG  137

Query  467  TAVEE  481
             +V E
Sbjct  138  RSVGE  142



>gb|EAY85442.1| hypothetical protein OsI_06823 [Oryza sativa Indica Group]
Length=537

 Score = 85.1 bits (209),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 74/116 (64%), Gaps = 10/116 (9%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            I++Y +K Y +L+SGK  V   N   RCPFC GKKKQDY+Y +LLQHA GV  G++NR+ 
Sbjct  15   IDDYADKCYMDLKSGKPVVSLGNEKFRCPFCLGKKKQDYRYNELLQHAIGV--GASNRAP  72

Query  302  KQKANHVALAKYLEIDLGDQAEPLPQR-AVAP-------EDNNLYCWPWTGIVVNV  445
            K KANH+ALA  L+ D  D A  LP R AV P       +D   Y WPW GI+ NV
Sbjct  73   KVKANHMALANLLKNDYADAAGSLPSRQAVGPSNPPRPLQDQEAYVWPWMGILANV  128



>gb|EMT17491.1| hypothetical protein F775_14734 [Aegilops tauschii]
Length=1285

 Score = 85.5 bits (210),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 59/116 (51%), Positives = 74/116 (64%), Gaps = 10/116 (9%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            I++Y EK Y +L+SGK   +      RCPFC GKKKQDY+Y +LLQHA GV  G++NR+ 
Sbjct  16   IDDYAEKAYTDLKSGKLVARFGADRFRCPFCPGKKKQDYRYNELLQHAIGV--GASNRAA  73

Query  302  KQKANHVALAKYLEIDLGDQAEPLPQR-AVA-------PEDNNLYCWPWTGIVVNV  445
            K KANH ALA +L+ D  D A  LP R AVA        +D  L+ WPW GI+ NV
Sbjct  74   KVKANHQALASHLKTDHADAAGSLPPRQAVALINPPKPVQDQELFVWPWMGILANV  129



>gb|EMS54623.1| hypothetical protein TRIUR3_33647 [Triticum urartu]
Length=693

 Score = 85.1 bits (209),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 56/116 (48%), Positives = 71/116 (61%), Gaps = 10/116 (9%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            I++Y EK Y +L+SGK   +      RCPFC GKKKQDY+Y +LLQHA GV  G++NR+ 
Sbjct  84   IDDYAEKAYTDLKSGKLVARFGADRFRCPFCPGKKKQDYRYNELLQHAIGV--GASNRAA  141

Query  302  KQKANHVALAKYLEIDLGDQAEPLPQRAVAP--------EDNNLYCWPWTGIVVNV  445
            K KANH ALA +L+ D  D A  LP R            +D  L+ WPW GI+ NV
Sbjct  142  KVKANHQALASHLKTDHADAAGSLPPRQAEALINPPKPVQDQELFVWPWMGILANV  197



>ref|XP_009416142.1| PREDICTED: uncharacterized protein LOC103996844 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009416143.1| PREDICTED: uncharacterized protein LOC103996844 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009416144.1| PREDICTED: uncharacterized protein LOC103996844 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009416145.1| PREDICTED: uncharacterized protein LOC103996844 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009416146.1| PREDICTED: uncharacterized protein LOC103996844 [Musa acuminata 
subsp. malaccensis]
Length=630

 Score = 84.7 bits (208),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 61/129 (47%), Positives = 81/129 (63%), Gaps = 14/129 (11%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            + EY+EK Y  L++G++ V+  +   RCPFC+GKKKQDY YKDLLQHATG+  G++NR  
Sbjct  15   VPEYEEKIYLRLKAGQFIVRNTDKTCRCPFCSGKKKQDYNYKDLLQHATGI--GASNRKG  72

Query  302  KQKANHVALAKYLEIDLGDQA---------EPLPQRAVAPEDNNLYCWPWTGIVVNVSKD  454
            K KA H ALAKYL  D+ D           +P P ++ + ED   + WPW G+VVNV  +
Sbjct  73   KVKATHRALAKYLNNDITDTTCSSEQLVVFQPKPSKSTS-EDQ--FVWPWMGVVVNVPTE  129

Query  455  NANGTAVEE  481
              NG  V E
Sbjct  130  FKNGQYVGE  138



>gb|KHN17925.1| hypothetical protein glysoja_017976 [Glycine soja]
Length=640

 Score = 84.7 bits (208),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 58/130 (45%), Positives = 81/130 (62%), Gaps = 12/130 (9%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RS  298
            I+EY++K YEEL+SG   VK  +    CP+C  K+K+DY YK+LLQHA+GVG+ S+  R 
Sbjct  17   ISEYEDKSYEELKSGSQDVKTSDETFTCPYCPKKRKRDYLYKELLQHASGVGQSSSQKRK  76

Query  299  VKQKANHVALAKYLEIDLGDQAEPLPQRAVAPED--------NNLYCWPWTGIVVNV-SK  451
             + KANH+AL KYLE DL +    +P     PED        N+ + WPW G+VVN+ ++
Sbjct  77   ARDKANHLALLKYLEKDLMNV--DVPSNDSKPEDESDPSVNSNDQFAWPWIGVVVNIPTR  134

Query  452  DNANGTAVEE  481
               +G  V E
Sbjct  135  RTEDGRCVGE  144



>ref|XP_003538408.1| PREDICTED: putative leucine-rich repeat-containing protein DDB_G0290503-like 
isoform X1 [Glycine max]
 ref|XP_006591339.1| PREDICTED: putative leucine-rich repeat-containing protein DDB_G0290503-like 
isoform X2 [Glycine max]
 ref|XP_006591340.1| PREDICTED: putative leucine-rich repeat-containing protein DDB_G0290503-like 
isoform X3 [Glycine max]
Length=640

 Score = 84.7 bits (208),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 58/130 (45%), Positives = 81/130 (62%), Gaps = 12/130 (9%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RS  298
            I+EY++K YEEL+SG   VK  +    CP+C  K+K+DY YK+LLQHA+GVG+ S+  R 
Sbjct  17   ISEYEDKSYEELKSGSQDVKTSDETFTCPYCPKKRKRDYLYKELLQHASGVGQSSSQKRK  76

Query  299  VKQKANHVALAKYLEIDLGDQAEPLPQRAVAPED--------NNLYCWPWTGIVVNV-SK  451
             + KANH+AL KYLE DL +    +P     PED        N+ + WPW G+VVN+ ++
Sbjct  77   ARDKANHLALLKYLEKDLMNV--DVPSNDSKPEDESDPSVNSNDQFVWPWIGVVVNIPTR  134

Query  452  DNANGTAVEE  481
               +G  V E
Sbjct  135  RTEDGRCVGE  144



>gb|EEE56772.1| hypothetical protein OsJ_06333 [Oryza sativa Japonica Group]
Length=720

 Score = 85.1 bits (209),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 59/116 (51%), Positives = 74/116 (64%), Gaps = 10/116 (9%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            I++Y +K Y +L+SGK  V   N   RCPFC GKKKQDY+Y +LLQHA GV  G++NR+ 
Sbjct  107  IDDYADKCYMDLKSGKPVVSLGNEKFRCPFCLGKKKQDYRYNELLQHAIGV--GASNRAP  164

Query  302  KQKANHVALAKYLEIDLGDQAEPLPQR-AVAP-------EDNNLYCWPWTGIVVNV  445
            K KANH+ALA  L+ D  D A  LP R A+ P       +D   Y WPW GI+ NV
Sbjct  165  KVKANHMALANLLKNDYADAAGSLPSRQAIGPSNPPRPLQDQEAYVWPWMGILANV  220



>dbj|BAD21477.1| putative X1 [Oryza sativa Japonica Group]
 dbj|BAH01332.1| unnamed protein product [Oryza sativa Japonica Group]
Length=628

 Score = 84.7 bits (208),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 59/116 (51%), Positives = 74/116 (64%), Gaps = 10/116 (9%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            I++Y +K Y +L+SGK  V   N   RCPFC GKKKQDY+Y +LLQHA GV  G++NR+ 
Sbjct  15   IDDYADKCYMDLKSGKPVVSLGNEKFRCPFCLGKKKQDYRYNELLQHAIGV--GASNRAP  72

Query  302  KQKANHVALAKYLEIDLGDQAEPLPQR-AVAP-------EDNNLYCWPWTGIVVNV  445
            K KANH+ALA  L+ D  D A  LP R A+ P       +D   Y WPW GI+ NV
Sbjct  73   KVKANHMALANLLKNDYADAAGSLPSRQAIGPSNPPRPLQDQEAYVWPWMGILANV  128



>ref|NP_001168342.1| putative XH domain family protein [Zea mays]
 gb|ACN27880.1| unknown [Zea mays]
 gb|AFW57328.1| putative XH domain family protein [Zea mays]
Length=626

 Score = 84.7 bits (208),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 57/121 (47%), Positives = 77/121 (64%), Gaps = 10/121 (8%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            I++Y +K Y +L+SGK+  +  +   RCPFC GKKKQDY+Y +LLQHA GV  G++NR+ 
Sbjct  16   IDDYADKSYSDLKSGKFVARLGSDRFRCPFCPGKKKQDYRYSELLQHAVGV--GASNRAA  73

Query  302  KQKANHVALAKYLEIDLGDQAEPLPQ-RAVA-------PEDNNLYCWPWTGIVVNVSKDN  457
            K KANH ALAK L+ D  D A  LP  +A+A        +D   + WPWTG++ NV    
Sbjct  74   KVKANHQALAKLLKEDHADAAATLPAWQAIALSNAPKPAQDQEAFVWPWTGVLANVPAGQ  133

Query  458  A  460
            A
Sbjct  134  A  134



>ref|XP_002533154.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF29235.1| conserved hypothetical protein [Ricinus communis]
Length=640

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 54/119 (45%), Positives = 76/119 (64%), Gaps = 6/119 (5%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGK-GSANRS  298
            ++EY+ + YEEL++G + VK  +    CP+C  K+K++Y Y+DLLQHA+GVG+  S  RS
Sbjct  20   LDEYEAQCYEELKNGTHHVKISDETFTCPYCPKKRKREYLYRDLLQHASGVGRSASKKRS  79

Query  299  VKQKANHVALAKYLEIDLGDQAEP-LPQRAVAPED----NNLYCWPWTGIVVNVSKDNA  460
             K+KANH+AL KYLE D+ D   P  P+    P D    +    WPWTGIV+N+    A
Sbjct  80   TKEKANHLALVKYLEKDIADLGSPSKPKGESDPLDSCNHDEKIVWPWTGIVINIPTTKA  138



>ref|XP_006362467.1| PREDICTED: myosin-2 heavy chain-like isoform X2 [Solanum tuberosum]
Length=638

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 81/130 (62%), Gaps = 10/130 (8%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RS  298
            I EY EK YE+L+SG + +K  +    CP+C  K+K+D+ YK+L+QHA+GVG  S+N R+
Sbjct  16   IEEYGEKSYEDLKSGSHSLKISDVAYTCPYCPKKRKRDFLYKELIQHASGVGSCSSNKRT  75

Query  299  VKQKANHVALAKYLEID---LGDQAEP--LPQRAVAP----EDNNLYCWPWTGIVVNVSK  451
             ++KANH+ LAKYLE D     D ++P   P     P    + + ++ WPW GIVVN+  
Sbjct  76   AREKANHLGLAKYLETDAAVAADSSKPDAEPDSQTDPLADHDRDEMFVWPWIGIVVNIPT  135

Query  452  DNANGTAVEE  481
            +  +G  V E
Sbjct  136  EFKDGRNVGE  145



>ref|XP_006362466.1| PREDICTED: myosin-2 heavy chain-like isoform X1 [Solanum tuberosum]
Length=653

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 81/130 (62%), Gaps = 10/130 (8%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RS  298
            I EY EK YE+L+SG + +K  +    CP+C  K+K+D+ YK+L+QHA+GVG  S+N R+
Sbjct  31   IEEYGEKSYEDLKSGSHSLKISDVAYTCPYCPKKRKRDFLYKELIQHASGVGSCSSNKRT  90

Query  299  VKQKANHVALAKYLEID---LGDQAEP--LPQRAVAP----EDNNLYCWPWTGIVVNVSK  451
             ++KANH+ LAKYLE D     D ++P   P     P    + + ++ WPW GIVVN+  
Sbjct  91   AREKANHLGLAKYLETDAAVAADSSKPDAEPDSQTDPLADHDRDEMFVWPWIGIVVNIPT  150

Query  452  DNANGTAVEE  481
            +  +G  V E
Sbjct  151  EFKDGRNVGE  160



>ref|XP_004972827.1| PREDICTED: synaptonemal complex protein 1-like isoform X1 [Setaria 
italica]
Length=630

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 58/123 (47%), Positives = 76/123 (62%), Gaps = 10/123 (8%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            I++Y EK Y  L+SGK   +  +   RCPFC GKKKQDY+Y +LLQHA GV  G++NR+ 
Sbjct  20   IDDYSEKSYLNLKSGKLVARLGSDRFRCPFCPGKKKQDYRYNELLQHAVGV--GASNRAA  77

Query  302  KQKANHVALAKYLEIDLGDQAEPL-PQRAVA-------PEDNNLYCWPWTGIVVNVSKDN  457
            K KANH ALAK L+ D  D A  L P +A+A        +D  ++ WPW GI+ NV  + 
Sbjct  78   KVKANHQALAKLLKEDHADAAATLPPLQAIALSNPPKSVKDEEVFVWPWMGILTNVPAEQ  137

Query  458  ANG  466
              G
Sbjct  138  TQG  140



>gb|EMT14402.1| hypothetical protein F775_20219 [Aegilops tauschii]
Length=845

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 56/127 (44%), Positives = 79/127 (62%), Gaps = 6/127 (5%)
 Frame = +2

Query  131  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVKQK  310
            YK+K Y +LRS K KV+      RCPFC GKKK+DY  KDLLQHA+G+G  +  R  + +
Sbjct  228  YKDKIYAQLRSQKLKVQYGEKIFRCPFCLGKKKRDYNVKDLLQHASGIG-AAQKRKPRVR  286

Query  311  ANHVALAKYLEIDLGDQAEPLPQRAVA----PE-DNNLYCWPWTGIVVNVSKDNANGTAV  475
            A H+ALA+Y++ DLG   EP  Q A+     P+ + + + WPW GI+VN+  D  +   V
Sbjct  287  AAHLALAEYVKNDLGSSLEPSLQLAIVEYKPPKIEQDKFVWPWMGILVNIPADLMDTNFV  346

Query  476  EEEDYWL  496
             E ++ L
Sbjct  347  RESEHML  353



>ref|XP_004972828.1| PREDICTED: synaptonemal complex protein 1-like isoform X2 [Setaria 
italica]
Length=626

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 58/123 (47%), Positives = 76/123 (62%), Gaps = 10/123 (8%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            I++Y EK Y  L+SGK   +  +   RCPFC GKKKQDY+Y +LLQHA GV  G++NR+ 
Sbjct  16   IDDYSEKSYLNLKSGKLVARLGSDRFRCPFCPGKKKQDYRYNELLQHAVGV--GASNRAA  73

Query  302  KQKANHVALAKYLEIDLGDQAEPL-PQRAVA-------PEDNNLYCWPWTGIVVNVSKDN  457
            K KANH ALAK L+ D  D A  L P +A+A        +D  ++ WPW GI+ NV  + 
Sbjct  74   KVKANHQALAKLLKEDHADAAATLPPLQAIALSNPPKSVKDEEVFVWPWMGILTNVPAEQ  133

Query  458  ANG  466
              G
Sbjct  134  TQG  136



>ref|XP_010678966.1| PREDICTED: factor of DNA methylation 5-like [Beta vulgaris subsp. 
vulgaris]
Length=555

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 46/78 (59%), Positives = 55/78 (71%), Gaps = 0/78 (0%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            I EY EK Y+  + G Y V+ P G  RCPFC  KKKQ   +K LLQHA+GVG+GSA R  
Sbjct  16   IEEYSEKVYQAFQIGTYIVQNPGGNFRCPFCPDKKKQACSFKTLLQHASGVGRGSARRRA  75

Query  302  KQKANHVALAKYLEIDLG  355
             QKA H+ALA+YLE+DLG
Sbjct  76   DQKARHLALARYLEVDLG  93



>gb|KGN50554.1| hypothetical protein Csa_5G182100 [Cucumis sativus]
Length=781

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 73/116 (63%), Gaps = 8/116 (7%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RS  298
            ++E + K Y+EL++GK  VK  +    CP+C  K+K+D+ YKDLLQHA+GVGK  +N RS
Sbjct  157  MDERESKSYDELKNGKRIVKLSHETFTCPYCTKKRKRDFLYKDLLQHASGVGKSPSNKRS  216

Query  299  VKQKANHVALAKYLEIDLGDQAEPLPQRAVAPEDNNLYC-------WPWTGIVVNV  445
             K+KANH+AL KYLE DL D   P      +  D  + C       WPW GIVVN+
Sbjct  217  TKEKANHLALLKYLEKDLADAVGPSKPATASNNDPVMDCNHDEKFVWPWRGIVVNI  272



>ref|XP_006846222.1| hypothetical protein AMTR_s00012p00230440 [Amborella trichopoda]
 gb|ERN07897.1| hypothetical protein AMTR_s00012p00230440 [Amborella trichopoda]
Length=641

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 55/117 (47%), Positives = 78/117 (67%), Gaps = 7/117 (6%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            I+E  E  Y EL+SGK+ +K  +G  RCPFC GKKKQDY++KDLLQHATGVG  S+NR  
Sbjct  16   IDECVENIYSELKSGKHLIKNYDGTFRCPFCKGKKKQDYRHKDLLQHATGVG-ASSNRGT  74

Query  302  KQKANHVALAKYLEIDLGD------QAEPLPQRAVAPEDNNLYCWPWTGIVVNVSKD  454
            ++KA H AL K+L+ ++ D      + + LP+     + ++L  +PW GI+VN+  D
Sbjct  75   EEKAKHQALGKFLKEEVPDEPGHSNEQKELPKPLTMSKSDDLLVFPWMGIIVNIETD  131



>gb|KDP44945.1| hypothetical protein JCGZ_01445 [Jatropha curcas]
Length=636

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 57/114 (50%), Positives = 72/114 (63%), Gaps = 6/114 (5%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RS  298
            + EY+ + YEEL++G   VK  +    CP+C  K+K+DY YKDLLQHA GVGK  +N RS
Sbjct  16   MEEYEAQSYEELKNGTRSVKISDEIFSCPYCPKKRKRDYLYKDLLQHAVGVGKSPSNKRS  75

Query  299  VKQKANHVALAKYLEIDLGDQAEPL-PQRAVAP----EDNNLYCWPWTGIVVNV  445
             K+KANH+AL KYLE DLG    P  P+    P    +      WPWTGIVVN+
Sbjct  76   AKEKANHLALVKYLEKDLGATGSPSEPKSDTDPLSECDHYEKLVWPWTGIVVNL  129



>ref|XP_007156380.1| hypothetical protein PHAVU_003G281400g [Phaseolus vulgaris]
 gb|ESW28374.1| hypothetical protein PHAVU_003G281400g [Phaseolus vulgaris]
Length=636

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 61/130 (47%), Positives = 79/130 (61%), Gaps = 10/130 (8%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVK--GPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-  292
            I+EY++K YEELR+G   VK    NG   CP+C  K+KQDY Y +LLQHA+GVG+ S+  
Sbjct  17   ISEYEDKTYEELRNGVQNVKTSNENGTFICPYCPRKRKQDYLYNELLQHASGVGQSSSKK  76

Query  293  RSVKQKANHVALAKYLEIDLGDQAEPLPQRAVAPE-DNNLYC-----WPWTGIVVNV-SK  451
            R  + KANH+AL KYLE DL D   P        E D+++ C     WPW GIVVN+ + 
Sbjct  77   RKARDKANHLALVKYLEKDLVDVDAPAKDSKPTDESDSSVNCDEQFVWPWIGIVVNIPTS  136

Query  452  DNANGTAVEE  481
               +G  V E
Sbjct  137  QTVDGRCVGE  146



>tpg|DAA50216.1| TPA: putative XH domain family protein [Zea mays]
Length=687

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 57/112 (51%), Positives = 72/112 (64%), Gaps = 6/112 (5%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            I E+KE+   +LR+GK  VK      RCPFC GKK+QDY  KDLLQHATG+G  S  RS 
Sbjct  100  IAEHKEEICAQLRAGKLNVKRGEA-FRCPFCPGKKRQDYNLKDLLQHATGIGAAS-KRSA  157

Query  302  KQKANHVALAKYLEIDLGDQAE-PL---PQRAVAPEDNNLYCWPWTGIVVNV  445
            K KA+H+ LA +LE D+    E PL   P +   P+D  ++ WPW GIVVN+
Sbjct  158  KVKASHLGLAMFLEKDIASTLEQPLQIVPYKPKTPKDEEIFVWPWMGIVVNL  209



>ref|XP_006585879.1| PREDICTED: myosin heavy chain, clone 203-like isoform X1 [Glycine 
max]
 ref|XP_006585880.1| PREDICTED: myosin heavy chain, clone 203-like isoform X2 [Glycine 
max]
 ref|XP_006585881.1| PREDICTED: myosin heavy chain, clone 203-like isoform X3 [Glycine 
max]
 gb|KHN37146.1| hypothetical protein glysoja_038766 [Glycine soja]
Length=641

 Score = 82.4 bits (202),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 54/131 (41%), Positives = 77/131 (59%), Gaps = 13/131 (10%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdl-lqHATGVGKGSA-NR  295
            I+EYK+K Y+EL+SG  KVK  +    CP+C  ++K+D       LQHA+GVG+ S+  R
Sbjct  17   ISEYKDKTYQELKSGSQKVKNLDETFTCPYCPKRRKRDDYSYKELLQHASGVGRSSSKKR  76

Query  296  SVKQKANHVALAKYLEIDLGDQAEPLPQRAVAPED--------NNLYCWPWTGIVVNV-S  448
              + KANH+AL KYLE DL   +  +P     PED        +  + WPW GIVVN+ +
Sbjct  77   KARDKANHLALVKYLEKDL--VSVDIPAEVSKPEDESGTSVNSDEQFVWPWIGIVVNIPT  134

Query  449  KDNANGTAVEE  481
            +   +G +V E
Sbjct  135  RLTGDGHSVGE  145



>ref|XP_004968083.1| PREDICTED: synaptonemal complex protein 1-like [Setaria italica]
Length=631

 Score = 82.4 bits (202),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 58/126 (46%), Positives = 74/126 (59%), Gaps = 8/126 (6%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            I+E + + YE+L+SG  KVK       CPFC  K+K+DY   +LLQHATGVG  +ANR  
Sbjct  16   IDEREAEVYEQLKSGNIKVKDREA-YSCPFCRDKRKKDYSKSNLLQHATGVGS-AANRQA  73

Query  302  KQKANHVALAKYLEIDLGDQAEPLPQRAVAPEDNNL------YCWPWTGIVVNVSKDNAN  463
            K KA H ALAKYL+ +    +EP  Q  V  E  NL      + WPW G++VNV  +  N
Sbjct  74   KDKATHRALAKYLKDESARSSEPQTQLTVLIEPQNLGNRDDQFVWPWMGVLVNVPTEWKN  133

Query  464  GTAVEE  481
            G  V E
Sbjct  134  GRQVGE  139



>emb|CDP00105.1| unnamed protein product [Coffea canephora]
Length=658

 Score = 82.4 bits (202),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 55/119 (46%), Positives = 76/119 (64%), Gaps = 6/119 (5%)
 Frame = +2

Query  137  EKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKG-SANRSVKQKA  313
            +K Y+ L+SGK +VK  +G   CP+C  K+K D+ YKD+LQHA+GVG   S  RS + KA
Sbjct  42   DKSYQALKSGKKEVKVSDGAFTCPYCPKKRKADFLYKDILQHASGVGSSTSKKRSARDKA  101

Query  314  NHVALAKYLEIDLGDQAEP----LPQRAVAPED-NNLYCWPWTGIVVNVSKDNANGTAV  475
            NH+ALAKYLE D+   A P    +    +A  D + ++ WPW GIVVN++ D  +G  V
Sbjct  102  NHLALAKYLEKDMSVTAGPSQATVEVDPLADHDRDEMFVWPWIGIVVNLATDFKDGRYV  160



>ref|XP_004147687.1| PREDICTED: uncharacterized protein LOC101219429 [Cucumis sativus]
Length=643

 Score = 82.0 bits (201),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 55/116 (47%), Positives = 73/116 (63%), Gaps = 8/116 (7%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RS  298
            ++E + K Y+EL++GK  VK  +    CP+C  K+K+D+ YKDLLQHA+GVGK  +N RS
Sbjct  19   MDERESKSYDELKNGKRIVKLSHETFTCPYCTKKRKRDFLYKDLLQHASGVGKSPSNKRS  78

Query  299  VKQKANHVALAKYLEIDLGDQAEPLPQRAVAPEDNNLYC-------WPWTGIVVNV  445
             K+KANH+AL KYLE DL D   P      +  D  + C       WPW GIVVN+
Sbjct  79   TKEKANHLALLKYLEKDLADAVGPSKPATASNNDPVMDCNHDEKFVWPWRGIVVNI  134



>ref|XP_004161917.1| PREDICTED: uncharacterized LOC101219429 [Cucumis sativus]
Length=631

 Score = 82.0 bits (201),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 55/116 (47%), Positives = 73/116 (63%), Gaps = 8/116 (7%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RS  298
            ++E + K Y+EL++GK  VK  +    CP+C  K+K+D+ YKDLLQHA+GVGK  +N RS
Sbjct  19   MDERESKSYDELKNGKRIVKLSHETFTCPYCTKKRKRDFLYKDLLQHASGVGKSPSNKRS  78

Query  299  VKQKANHVALAKYLEIDLGDQAEPLPQRAVAPEDNNLYC-------WPWTGIVVNV  445
             K+KANH+AL KYLE DL D   P      +  D  + C       WPW GIVVN+
Sbjct  79   TKEKANHLALLKYLEKDLADAVGPSKPATASNNDPVMDCNHDEKFVWPWRGIVVNI  134



>ref|XP_004240949.1| PREDICTED: protein INVOLVED IN DE NOVO 2 [Solanum lycopersicum]
Length=638

 Score = 82.0 bits (201),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 54/130 (42%), Positives = 80/130 (62%), Gaps = 10/130 (8%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RS  298
            I EY EK YE+L+SG   +K  +    CP+C  K+K+D+ YK+L+QHA+GVG  S+N R+
Sbjct  16   IEEYGEKSYEDLKSGSRSLKISDVAYTCPYCPKKRKRDFLYKELVQHASGVGSCSSNKRT  75

Query  299  VKQKANHVALAKYLEID---LGDQAEP--LPQRAVAP----EDNNLYCWPWTGIVVNVSK  451
             ++KANH+ LAKYLE D     D ++P   P     P    + + ++ WPW G+VVN+  
Sbjct  76   AREKANHLGLAKYLETDAAVAADSSKPDAEPDTQTDPLADHDRDEMFVWPWIGVVVNIPT  135

Query  452  DNANGTAVEE  481
            +  +G  V E
Sbjct  136  EYKDGRNVGE  145



>gb|ACF22790.1| gene X-like protein, partial [Brachypodium distachyon]
Length=813

 Score = 82.0 bits (201),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 56/116 (48%), Positives = 72/116 (62%), Gaps = 10/116 (9%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            I++Y E+ Y  L+SGK   +      RCPFC GKKKQDY+Y +LLQHA GVG  ++NR+ 
Sbjct  258  IDDYAEQTYLNLKSGKLVARYGADRFRCPFCLGKKKQDYRYNELLQHAVGVG--ASNRAA  315

Query  302  KQKANHVALAKYLEIDLGDQAEPLPQRA----VAP----EDNNLYCWPWTGIVVNV  445
            K KANH+ALA  L+ D  D A  LP R     + P    +D  L+ WPW GI+ NV
Sbjct  316  KVKANHLALANLLKNDYSDAAGSLPSRQADALINPPKPVQDQELFVWPWMGILANV  371



>ref|XP_010234408.1| PREDICTED: factor of DNA methylation 1-like isoform X1 [Brachypodium 
distachyon]
Length=632

 Score = 81.6 bits (200),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 56/116 (48%), Positives = 72/116 (62%), Gaps = 10/116 (9%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            I++Y E+ Y  L+SGK   +      RCPFC GKKKQDY+Y +LLQHA GVG  ++NR+ 
Sbjct  22   IDDYAEQTYLNLKSGKLVARYGADRFRCPFCLGKKKQDYRYNELLQHAVGVG--ASNRAA  79

Query  302  KQKANHVALAKYLEIDLGDQAEPLPQRA----VAP----EDNNLYCWPWTGIVVNV  445
            K KANH+ALA  L+ D  D A  LP R     + P    +D  L+ WPW GI+ NV
Sbjct  80   KVKANHLALANLLKNDYSDAAGSLPSRQADALINPPKPVQDQELFVWPWMGILANV  135



>ref|XP_010234409.1| PREDICTED: factor of DNA methylation 1-like isoform X2 [Brachypodium 
distachyon]
 ref|XP_010234410.1| PREDICTED: factor of DNA methylation 1-like isoform X2 [Brachypodium 
distachyon]
Length=631

 Score = 81.6 bits (200),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 56/116 (48%), Positives = 72/116 (62%), Gaps = 10/116 (9%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            I++Y E+ Y  L+SGK   +      RCPFC GKKKQDY+Y +LLQHA GVG  ++NR+ 
Sbjct  21   IDDYAEQTYLNLKSGKLVARYGADRFRCPFCLGKKKQDYRYNELLQHAVGVG--ASNRAA  78

Query  302  KQKANHVALAKYLEIDLGDQAEPLPQRA----VAP----EDNNLYCWPWTGIVVNV  445
            K KANH+ALA  L+ D  D A  LP R     + P    +D  L+ WPW GI+ NV
Sbjct  79   KVKANHLALANLLKNDYSDAAGSLPSRQADALINPPKPVQDQELFVWPWMGILANV  134



>gb|KHN07563.1| hypothetical protein glysoja_019670 [Glycine soja]
Length=566

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 56/130 (43%), Positives = 80/130 (62%), Gaps = 12/130 (9%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RS  298
            I+EY++K YEEL++G   V+       CP+C  K+KQDY YK+LLQHA+GVG+ S+  R 
Sbjct  17   ISEYEDKSYEELKNGSQDVRTSGKTFTCPYCPKKRKQDYLYKELLQHASGVGQSSSQKRK  76

Query  299  VKQKANHVALAKYLEIDLGDQAEPLPQRAVAPED--------NNLYCWPWTGIVVNV-SK  451
             + KANH+AL KYL+ DL +    +P     PED        N+ + WPW G+VVN+ ++
Sbjct  77   ARDKANHLALVKYLKKDLMNV--DVPSNDSKPEDESDPSVNSNDQFVWPWIGVVVNIPTR  134

Query  452  DNANGTAVEE  481
               +G  V E
Sbjct  135  RTEDGRCVGE  144



>ref|XP_010922973.1| PREDICTED: protein INVOLVED IN DE NOVO 2-like [Elaeis guineensis]
Length=491

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 61/125 (49%), Positives = 79/125 (63%), Gaps = 8/125 (6%)
 Frame = +2

Query  125  NEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVK  304
            ++Y+EK Y  L+ GK KVK  +   +CPFCAGKKKQDY YKDLLQHA GV  G++NR  K
Sbjct  17   DDYEEKFYLHLKDGKLKVKNTDSIYKCPFCAGKKKQDYNYKDLLQHANGV--GTSNRKAK  74

Query  305  QKANHVALAKYLEIDLGDQAEPLPQRAVA------PEDNNLYCWPWTGIVVNVSKDNANG  466
             KA H ALA+YL+ DL + +    Q  +       P+D + + WPW GI+VNV  +  NG
Sbjct  75   VKAKHXALARYLKNDLAEASSSSMQLMIVQHHPFKPKDEDQFVWPWMGILVNVPTEYKNG  134

Query  467  TAVEE  481
              V E
Sbjct  135  RYVGE  139



>ref|XP_008461675.1| PREDICTED: flagellar attachment zone protein 1 [Cucumis melo]
 ref|XP_008461676.1| PREDICTED: flagellar attachment zone protein 1 [Cucumis melo]
Length=643

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 54/116 (47%), Positives = 73/116 (63%), Gaps = 8/116 (7%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RS  298
            ++E + K Y+EL++GK  VK  +    CP+C  K+K+D+ YKDLLQHA+GVG   +N RS
Sbjct  19   MDERESKSYDELKNGKRIVKLSHETFTCPYCTKKRKRDFLYKDLLQHASGVGNSPSNKRS  78

Query  299  VKQKANHVALAKYLEIDLGDQAEPLPQRAVAPEDNNLYC-------WPWTGIVVNV  445
             K+KANH+AL KYLE DL D   P      + +D  + C       WPW GIVVN+
Sbjct  79   TKEKANHLALLKYLEKDLADTVGPSKPATASNKDPVMDCNHDEKFVWPWRGIVVNI  134



>gb|KHN27026.1| hypothetical protein glysoja_039182 [Glycine soja]
Length=637

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 52/117 (44%), Positives = 71/117 (61%), Gaps = 11/117 (9%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRS-  298
            I+EY++K YEEL +G   VK  +    CP+C  K+K+DY Y +LLQHA+GVG+ S+  + 
Sbjct  17   ISEYEDKSYEELNNGSQNVKTSDETFTCPYCPKKRKRDYLYNELLQHASGVGQNSSQMTK  76

Query  299  VKQKANHVALAKYLEIDLGDQAEPLPQRAVAPEDNN--------LYCWPWTGIVVNV  445
             + KANH+AL KYLE DL      +P +   P D N         + WPW GIVVN+
Sbjct  77   ARDKANHLALVKYLEKDL--MTVDVPSKDSKPVDENEPSVNSDEQFVWPWIGIVVNI  131



>ref|XP_003559697.1| PREDICTED: factor of DNA methylation 4-like [Brachypodium distachyon]
Length=637

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 56/125 (45%), Positives = 75/125 (60%), Gaps = 6/125 (5%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            I+E K+K Y +L++GK KVK      RCPFC GKKKQDY  KDLLQHATG+G  +  R  
Sbjct  16   IDECKDKIYAQLQAGKMKVKHSEKTFRCPFCLGKKKQDYNGKDLLQHATGIG-AAPQRKA  74

Query  302  KQKANHVALAKYLEIDLGDQAEPLPQRAVA-----PEDNNLYCWPWTGIVVNVSKDNANG  466
            + +A H+ALA+Y++ DL    EP  Q A+        +   + WPW GI+VNV  +  + 
Sbjct  75   RVRAEHLALAEYMKNDLESLLEPSLQLAIVDYEPLKNEEEKFVWPWMGILVNVPTEGHDV  134

Query  467  TAVEE  481
              V E
Sbjct  135  NFVSE  139



>ref|XP_007009302.1| XH/XS domain-containing protein isoform 5 [Theobroma cacao]
 gb|EOY18112.1| XH/XS domain-containing protein isoform 5 [Theobroma cacao]
Length=561

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 59/129 (46%), Positives = 81/129 (63%), Gaps = 11/129 (9%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKG-SANRS  298
            + EY++K YE+L++GK+ +K       CP+C  KKK+DY YK+LLQHA+GVG   S  RS
Sbjct  1    MEEYEDKSYEKLKNGKHNIKVSEETYTCPYCPKKKKRDYLYKELLQHASGVGNSNSEKRS  60

Query  299  VKQKANHVALAKYLEIDLGDQAEPLPQRAVAPED-------NNLYCWPWTGIVVNV-SKD  454
             K+KANH+AL KYLE DL   A     +  A ED       +    WPWTGIVVN+ ++ 
Sbjct  61   AKEKANHLALVKYLEKDL--VAVGSSSKTAAEEDPLSGYDHDEKIVWPWTGIVVNIPTRR  118

Query  455  NANGTAVEE  481
            + +G +V E
Sbjct  119  SEDGRSVGE  127



>ref|XP_007009300.1| XH/XS domain-containing protein, putative isoform 3 [Theobroma 
cacao]
 gb|EOY18110.1| XH/XS domain-containing protein, putative isoform 3 [Theobroma 
cacao]
Length=566

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 59/129 (46%), Positives = 81/129 (63%), Gaps = 11/129 (9%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKG-SANRS  298
            + EY++K YE+L++GK+ +K       CP+C  KKK+DY YK+LLQHA+GVG   S  RS
Sbjct  16   MEEYEDKSYEKLKNGKHNIKVSEETYTCPYCPKKKKRDYLYKELLQHASGVGNSNSEKRS  75

Query  299  VKQKANHVALAKYLEIDLGDQAEPLPQRAVAPED-------NNLYCWPWTGIVVNV-SKD  454
             K+KANH+AL KYLE DL   A     +  A ED       +    WPWTGIVVN+ ++ 
Sbjct  76   AKEKANHLALVKYLEKDL--VAVGSSSKTAAEEDPLSGYDHDEKIVWPWTGIVVNIPTRR  133

Query  455  NANGTAVEE  481
            + +G +V E
Sbjct  134  SEDGRSVGE  142



>ref|XP_007009301.1| XH/XS domain-containing protein, putative isoform 4, partial 
[Theobroma cacao]
 gb|EOY18111.1| XH/XS domain-containing protein, putative isoform 4, partial 
[Theobroma cacao]
Length=567

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 59/129 (46%), Positives = 81/129 (63%), Gaps = 11/129 (9%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKG-SANRS  298
            + EY++K YE+L++GK+ +K       CP+C  KKK+DY YK+LLQHA+GVG   S  RS
Sbjct  12   MEEYEDKSYEKLKNGKHNIKVSEETYTCPYCPKKKKRDYLYKELLQHASGVGNSNSEKRS  71

Query  299  VKQKANHVALAKYLEIDLGDQAEPLPQRAVAPED-------NNLYCWPWTGIVVNV-SKD  454
             K+KANH+AL KYLE DL   A     +  A ED       +    WPWTGIVVN+ ++ 
Sbjct  72   AKEKANHLALVKYLEKDL--VAVGSSSKTAAEEDPLSGYDHDEKIVWPWTGIVVNIPTRR  129

Query  455  NANGTAVEE  481
            + +G +V E
Sbjct  130  SEDGRSVGE  138



>ref|XP_007009298.1| XH/XS domain-containing protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOY18108.1| XH/XS domain-containing protein, putative isoform 1 [Theobroma 
cacao]
Length=640

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 59/129 (46%), Positives = 81/129 (63%), Gaps = 11/129 (9%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKG-SANRS  298
            + EY++K YE+L++GK+ +K       CP+C  KKK+DY YK+LLQHA+GVG   S  RS
Sbjct  16   MEEYEDKSYEKLKNGKHNIKVSEETYTCPYCPKKKKRDYLYKELLQHASGVGNSNSEKRS  75

Query  299  VKQKANHVALAKYLEIDLGDQAEPLPQRAVAPED-------NNLYCWPWTGIVVNV-SKD  454
             K+KANH+AL KYLE DL   A     +  A ED       +    WPWTGIVVN+ ++ 
Sbjct  76   AKEKANHLALVKYLEKDL--VAVGSSSKTAAEEDPLSGYDHDEKIVWPWTGIVVNIPTRR  133

Query  455  NANGTAVEE  481
            + +G +V E
Sbjct  134  SEDGRSVGE  142



>ref|XP_007009299.1| XH/XS domain-containing protein, putative isoform 2 [Theobroma 
cacao]
 gb|EOY18109.1| XH/XS domain-containing protein, putative isoform 2 [Theobroma 
cacao]
Length=638

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 59/129 (46%), Positives = 81/129 (63%), Gaps = 11/129 (9%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKG-SANRS  298
            + EY++K YE+L++GK+ +K       CP+C  KKK+DY YK+LLQHA+GVG   S  RS
Sbjct  16   MEEYEDKSYEKLKNGKHNIKVSEETYTCPYCPKKKKRDYLYKELLQHASGVGNSNSEKRS  75

Query  299  VKQKANHVALAKYLEIDLGDQAEPLPQRAVAPED-------NNLYCWPWTGIVVNV-SKD  454
             K+KANH+AL KYLE DL   A     +  A ED       +    WPWTGIVVN+ ++ 
Sbjct  76   AKEKANHLALVKYLEKDL--VAVGSSSKTAAEEDPLSGYDHDEKIVWPWTGIVVNIPTRR  133

Query  455  NANGTAVEE  481
            + +G +V E
Sbjct  134  SEDGRSVGE  142



>ref|XP_010690719.1| PREDICTED: protein INVOLVED IN DE NOVO 2 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010690724.1| PREDICTED: protein INVOLVED IN DE NOVO 2 [Beta vulgaris subsp. 
vulgaris]
Length=633

 Score = 79.7 bits (195),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 54/127 (43%), Positives = 81/127 (64%), Gaps = 7/127 (6%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKG-SANRS  298
            I+EY +K +EEL+ G  ++K       CP+C GK+K+DY+YK+LLQHA+G+G   S  R 
Sbjct  16   IDEYGDKTFEELKKGSSELKVAEEKYTCPYCPGKRKRDYQYKELLQHASGIGNANSKKRR  75

Query  299  VKQKANHVALAKYLEIDLGDQAEPLPQ--RAVAP----EDNNLYCWPWTGIVVNVSKDNA  460
             ++KANH+ LAK+LE ++ +QA    Q     AP    + ++ + WPWTGIVVN+   + 
Sbjct  76   AREKANHLGLAKFLEEEVQNQASSSKQVNNGDAPIAGGDHDDKFVWPWTGIVVNIPTLHK  135

Query  461  NGTAVEE  481
            +G  V E
Sbjct  136  DGRYVGE  142



>ref|XP_006599359.1| PREDICTED: uncharacterized protein PFB0765w-like [Glycine max]
Length=659

 Score = 79.3 bits (194),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 52/127 (41%), Positives = 76/127 (60%), Gaps = 7/127 (6%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRS-  298
            I+EY++K YEEL +G   VK  +    CP+C  K+K+DY Y +LLQHA+GVG+ S+  + 
Sbjct  38   ISEYEDKSYEELNNGSQNVKTSDETFTCPYCPKKRKRDYLYNELLQHASGVGQNSSQMTK  97

Query  299  VKQKANHVALAKYLEIDL------GDQAEPLPQRAVAPEDNNLYCWPWTGIVVNVSKDNA  460
             + KANH+AL KYLE DL         ++P+ +   +   +  + WPW GIVVN+     
Sbjct  98   ARDKANHLALVKYLEKDLMTVDVPSKDSKPVDENEPSVNSDEQFVWPWIGIVVNIPTRWI  157

Query  461  NGTAVEE  481
            +G  V E
Sbjct  158  DGHYVGE  164



>emb|CDY08088.1| BnaA06g16380D [Brassica napus]
Length=697

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 60/131 (46%), Positives = 79/131 (60%), Gaps = 12/131 (9%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RS  298
            + EY +K Y  L+SGK KVK       CP+C  KKK  ++YKDLLQHA+GVG  +++ RS
Sbjct  71   MEEYGDKIYLSLKSGKLKVKLSPHSFTCPYCPNKKKPSFQYKDLLQHASGVGNSNSDKRS  130

Query  299  VKQKANHVALAKYLEIDLGD--QAEPLPQRAVA-------PEDNNLYCWPWTGIVVNV-S  448
             K+KA+H+ALAKYL+ DL D  QAEP  +R           +D  L C PW G+VVN+ +
Sbjct  131  AKEKASHLALAKYLQQDLADDSQAEPSSKRRKTGDPIQDCDQDEKLVC-PWKGVVVNIPT  189

Query  449  KDNANGTAVEE  481
                NG    E
Sbjct  190  TKTENGRTAGE  200



>ref|XP_004307495.1| PREDICTED: protein INVOLVED IN DE NOVO 2 [Fragaria vesca subsp. 
vesca]
Length=647

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 53/121 (44%), Positives = 77/121 (64%), Gaps = 10/121 (8%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RS  298
            ++E  E+   EL++GK++VKG +G   CPFC  K+K+D+  KDLLQHA+GVGK +++ RS
Sbjct  21   LDEEVEQYLGELKNGKHRVKGADGVFMCPFCQRKRKRDFNLKDLLQHASGVGKSNSDKRS  80

Query  299  VKQKANHVALAKYLEIDLGDQAEPLPQRAVAPEDNNLYC-------WPWTGIVVNVSKDN  457
              +KA H+AL+KYLE DL   AE  P +  A ++  + C       WPW G+V N+    
Sbjct  81   TDEKAKHLALSKYLENDL--IAEGGPSKPAAEDEPPVDCDHDEKLVWPWIGVVANIPTTR  138

Query  458  A  460
            A
Sbjct  139  A  139



>emb|CAN81646.1| hypothetical protein VITISV_010798 [Vitis vinifera]
Length=349

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 73/124 (59%), Gaps = 4/124 (3%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            +++Y+ + Y EL++G  +VK  +   RCP+C  K  +DY+ ++LLQHA+ VG+ S +  V
Sbjct  61   LDDYRYRYYRELQNGSVRVKISDTTFRCPYCPSKDDRDYRCRELLQHASRVGRDSGSGDV  120

Query  302  KQKANHVALAKYLEIDLGDQAEPLPQR----AVAPEDNNLYCWPWTGIVVNVSKDNANGT  469
            K+KA H+AL KYL+  L  +  P   +    + A + +  + WPW GI+ N+     +G 
Sbjct  121  KEKARHLALMKYLDKYLDTKQSPASTKDTESSTANDADGHFVWPWVGIIANIPVQRIDGR  180

Query  470  AVEE  481
             V E
Sbjct  181  YVGE  184



>ref|XP_009149803.1| PREDICTED: myosin-11 [Brassica rapa]
Length=647

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 59/131 (45%), Positives = 79/131 (60%), Gaps = 12/131 (9%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RS  298
            + EY +K Y  L+SGK KVK       CP+C  KKK  ++YKDLLQHA+GVG  +++ R+
Sbjct  21   MEEYGDKIYLSLKSGKLKVKLSPHSFTCPYCPNKKKPSFQYKDLLQHASGVGNSNSDKRT  80

Query  299  VKQKANHVALAKYLEIDLGD--QAEPLPQRAVA-------PEDNNLYCWPWTGIVVNV-S  448
             K+KA+H+ALAKYL+ DL D  QAEP  +R           +D  L C PW G+VVN+ +
Sbjct  81   AKEKASHLALAKYLQQDLADDSQAEPSSKRRKTGDPIQDCDQDEKLVC-PWKGVVVNIPT  139

Query  449  KDNANGTAVEE  481
                NG    E
Sbjct  140  TKTENGRTAGE  150



>ref|XP_007220898.1| hypothetical protein PRUPE_ppa002712mg [Prunus persica]
 gb|EMJ22097.1| hypothetical protein PRUPE_ppa002712mg [Prunus persica]
Length=641

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 54/111 (49%), Positives = 69/111 (62%), Gaps = 10/111 (9%)
 Frame = +2

Query  155  LRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKG-SANRSVKQKANHVALA  331
            L++GK+ V+  +G   CPFC  KKK+D+  KDLLQHA+GVGK  S  RS ++KA H ALA
Sbjct  31   LKNGKHSVRSSDGTYICPFCPKKKKRDFVLKDLLQHASGVGKSNSEKRSTEEKAKHSALA  90

Query  332  KYLEIDLGDQAEPLPQRAVAPEDNNLYC-------WPWTGIVVNVSKDNAN  463
            KYLE DL    E  P + V  ED  + C       WPWTG+VVN+    A+
Sbjct  91   KYLEKDLA--TEGGPSKPVGEEDPPIDCDHDEKLVWPWTGVVVNIPTRRAD  139



>ref|XP_009343557.1| PREDICTED: myosin heavy chain, cardiac muscle isoform-like [Pyrus 
x bretschneideri]
Length=646

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 52/112 (46%), Positives = 69/112 (62%), Gaps = 9/112 (8%)
 Frame = +2

Query  155  LRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGK-GSANRSVKQKANHVALA  331
            L++GK+ V+  +G   CPFC  KKK+ +  KDLLQHA+GVGK  S  RS ++KA H+A+ 
Sbjct  31   LKNGKHSVRNSDGTYTCPFCPNKKKRGFVRKDLLQHASGVGKRTSEKRSTEEKAKHLAVV  90

Query  332  KYLEIDL-GDQAEPLPQRAVAPEDNNLYC-------WPWTGIVVNVSKDNAN  463
            KYLE DL  + AE  P + V  E   + C       WPWTG+VVN+    AN
Sbjct  91   KYLENDLAAEAAEGGPSKPVGEEKPPIDCDQDEKLVWPWTGVVVNIPTRRAN  142



>ref|XP_002464269.1| hypothetical protein SORBIDRAFT_01g015250 [Sorghum bicolor]
 gb|EER91267.1| hypothetical protein SORBIDRAFT_01g015250 [Sorghum bicolor]
Length=600

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 55/125 (44%), Positives = 76/125 (61%), Gaps = 6/125 (5%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            I E+KEK Y ++R+GK KVK       CPFC G+K+QDY  KDLLQHATG+G  S+  + 
Sbjct  16   IAEHKEKIYAQIRAGKLKVKRGQA-FGCPFCPGRKRQDYNLKDLLQHATGIG-ASSKHTA  73

Query  302  KQKANHVALAKYLEIDLGDQAE-PL---PQRAVAPEDNNLYCWPWTGIVVNVSKDNANGT  469
            K +A+H+ LA +LE D+    + PL   P +   P+D +L+  PW GIVVN+  +   G 
Sbjct  74   KVRASHLGLAMFLEKDIASSLDKPLQIVPYKPKTPKDEDLFVSPWMGIVVNLQCELMKGK  133

Query  470  AVEEE  484
                E
Sbjct  134  EFSRE  138



>ref|XP_006846214.1| hypothetical protein AMTR_s00012p00226630 [Amborella trichopoda]
 gb|ERN07889.1| hypothetical protein AMTR_s00012p00226630 [Amborella trichopoda]
Length=638

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 49/106 (46%), Positives = 70/106 (66%), Gaps = 7/106 (7%)
 Frame = +2

Query  146  YEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVKQKANHVA  325
            YEEL SGK+ ++  NG  RCPFC GKKKQ Y YKDLLQHA+GVG  S++R  ++K  H A
Sbjct  24   YEELTSGKHFLRNSNGTFRCPFCIGKKKQAYAYKDLLQHASGVGS-SSSRKTQEKGKHRA  82

Query  326  LAKYLEIDLGDQAEP------LPQRAVAPEDNNLYCWPWTGIVVNV  445
            LAK+L+ ++ D  EP      + +       ++++ +PW GI+VN+
Sbjct  83   LAKFLKAEVADDPEPSNGSKEIQKPLSKSASDDIFVYPWMGIIVNI  128



>gb|KHG15173.1| Forkhead-associated domain-containing 1 [Gossypium arboreum]
Length=645

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 56/123 (46%), Positives = 77/123 (63%), Gaps = 19/123 (15%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RS  298
            + EY++K YE+L++G YK+K  N    CPFC  KKKQD+ YKDLLQHA+GVGK +++ RS
Sbjct  16   MEEYEDKYYEKLKNGNYKIKVSNEKYTCPFCPKKKKQDFLYKDLLQHASGVGKSNSDKRS  75

Query  299  VKQKANHVALAKYLEIDL--------------GDQAEPLPQRAVAPEDNNLYCWPWTGIV  436
             ++KANH+AL KYLE DL               +  +PL       + +    WPWTG+V
Sbjct  76   AREKANHLALFKYLENDLRGTVGSSSSSAAAAAEVEDPLS----GCDHDEKIVWPWTGVV  131

Query  437  VNV  445
            VN+
Sbjct  132  VNI  134



>ref|XP_004503147.1| PREDICTED: myosin-11-like isoform X1 [Cicer arietinum]
 ref|XP_004503148.1| PREDICTED: myosin-11-like isoform X2 [Cicer arietinum]
 ref|XP_004503149.1| PREDICTED: myosin-11-like isoform X3 [Cicer arietinum]
Length=635

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 49/119 (41%), Positives = 74/119 (62%), Gaps = 6/119 (5%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RS  298
            I++Y++K YEEL++G   VK  +    CP+C  K+K+DY Y +LLQHA+GVG+ S+  R 
Sbjct  16   ISDYEDKCYEELKNGSQNVKTSDEKFTCPYCPKKRKRDYLYNELLQHASGVGQSSSQKRK  75

Query  299  VKQKANHVALAKYLEIDL-----GDQAEPLPQRAVAPEDNNLYCWPWTGIVVNVSKDNA  460
             ++KA H+AL KYL+ DL       + EP  +   A + +  + WPW GI+VN+    A
Sbjct  76   AREKATHLALVKYLQKDLMSVDAPSEPEPADKTDNAIDSDEQFVWPWIGIIVNIPTSRA  134



>gb|KJB76093.1| hypothetical protein B456_012G071000 [Gossypium raimondii]
Length=645

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 56/123 (46%), Positives = 77/123 (63%), Gaps = 19/123 (15%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RS  298
            + EY++K YE+L++G YK+K  N    CPFC  KKKQD+ YKDLLQHA+GVGK +++ RS
Sbjct  16   MEEYEDKYYEKLKNGNYKIKISNEKYTCPFCPKKKKQDFLYKDLLQHASGVGKSNSDKRS  75

Query  299  VKQKANHVALAKYLEIDL--------------GDQAEPLPQRAVAPEDNNLYCWPWTGIV  436
             ++KANH+AL KYLE DL               +  +PL       + +    WPWTG+V
Sbjct  76   AREKANHLALFKYLENDLRGTVGSSSSSAAAAAEAEDPLS----GCDHDEKIVWPWTGVV  131

Query  437  VNV  445
            VN+
Sbjct  132  VNI  134



>ref|XP_011027214.1| PREDICTED: protein INVOLVED IN DE NOVO 2 [Populus euphratica]
Length=749

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 48/120 (40%), Positives = 72/120 (60%), Gaps = 7/120 (6%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdl-lqHATGVGKG-SANR  295
            ++ Y+++ YEEL++G ++VK  +    CP+C  KK++        LQHATGVGK  S  R
Sbjct  127  MDNYEDRSYEELKNGNHQVKISDETFACPYCPTKKRKRDYVYQDLLQHATGVGKSLSEKR  186

Query  296  SVKQKANHVALAKYLEIDL---GDQAEPL--PQRAVAPEDNNLYCWPWTGIVVNVSKDNA  460
            + K+KA+H+AL KYLE DL   G  ++P    +   +   N+ + WPWTGI VN+    A
Sbjct  187  TAKEKADHLALVKYLEKDLAAAGSSSKPAGKTENPSSCSQNDKFVWPWTGIAVNLPTRRA  246


 Score = 68.9 bits (167),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 45/78 (58%), Positives = 56/78 (72%), Gaps = 1/78 (1%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKG-SANRS  298
            ++EY+ + YEEL+ GK +VK  +    CPFC  KK+Q   YKDLLQHA+GVGK  S  RS
Sbjct  18   MDEYENEAYEELKDGKLRVKISDETFACPFCPQKKRQACLYKDLLQHASGVGKSRSEKRS  77

Query  299  VKQKANHVALAKYLEIDL  352
             K+KANH+AL KYLE DL
Sbjct  78   TKEKANHLALVKYLEKDL  95



>ref|XP_008354129.1| PREDICTED: myosin-2 heavy chain-like [Malus domestica]
Length=643

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 51/110 (46%), Positives = 67/110 (61%), Gaps = 10/110 (9%)
 Frame = +2

Query  158  RSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKG-SANRSVKQKANHVALAK  334
            ++GK+ V+  +G   CPFC  KKK+    KDLLQHA+GVGK  S  RS ++KA H+A+ K
Sbjct  32   KNGKHSVRNSDGTYTCPFCPNKKKRGSVRKDLLQHASGVGKSTSEKRSTEEKAKHLAVVK  91

Query  335  YLEIDLGDQAEPLPQRAVAPEDNNLYC-------WPWTGIVVNVSKDNAN  463
            YLE DL   AE  P + V  E+  + C       WPWTG+VVN+    AN
Sbjct  92   YLENDLA--AEGGPSKRVGEEEPPIDCDHDEKLVWPWTGVVVNIPTRRAN  139



>ref|XP_008343538.1| PREDICTED: myosin-2 heavy chain-like [Malus domestica]
Length=643

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 51/110 (46%), Positives = 67/110 (61%), Gaps = 10/110 (9%)
 Frame = +2

Query  158  RSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKG-SANRSVKQKANHVALAK  334
            ++GK+ V+  +G   CPFC  KKK+    KDLLQHA+GVGK  S  RS ++KA H+A+ K
Sbjct  32   KNGKHSVRNSDGTYTCPFCPNKKKRGSVRKDLLQHASGVGKSTSEKRSTEEKAKHLAVVK  91

Query  335  YLEIDLGDQAEPLPQRAVAPEDNNLYC-------WPWTGIVVNVSKDNAN  463
            YLE DL   AE  P + V  E+  + C       WPWTG+VVN+    AN
Sbjct  92   YLENDLA--AEGGPSKRVGEEEPPIDCDHDEKLVWPWTGVVVNIPTRRAN  139



>ref|XP_010940184.1| PREDICTED: factor of DNA methylation 1-like [Elaeis guineensis]
Length=984

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 78/130 (60%), Gaps = 12/130 (9%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            I++Y+EK +  L++ K KVK      RCPFC GKKKQDY+Y++LLQHATGV  G++NR  
Sbjct  359  IDDYREKSFWRLKTQKLKVKYSENNYRCPFCVGKKKQDYQYEELLQHATGV--GASNRGG  416

Query  302  KQKANHVALAKYLEIDLGDQAEPLPQ----------RAVAPEDNNLYCWPWTGIVVNVSK  451
            K+KANH ALAK+L   +      +P+          +   P+   L+ WPW G++VN+  
Sbjct  417  KEKANHQALAKFLHELVNGAGSSVPKLNTRQQQQLQQPPQPDQPELFVWPWMGVLVNIQT  476

Query  452  DNANGTAVEE  481
            +  NG    E
Sbjct  477  EWRNGMHAGE  486



>gb|EYU18986.1| hypothetical protein MIMGU_mgv1a011844mg [Erythranthe guttata]
Length=269

 Score = 74.3 bits (181),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 66/114 (58%), Gaps = 7/114 (6%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            + EY ++ YE+L+    K+K  +   RCP+C GKKK  Y +KD+LQHA+ V KGS N+ +
Sbjct  16   MEEYVDRCYEQLKVETQKLKFSDTLYRCPYCPGKKKIVYPFKDILQHASDVAKGSQNKDI  75

Query  302  KQKANHVALAKYL--EIDLGDQAEPLPQRAVAPEDN-----NLYCWPWTGIVVN  442
            K K  H+ L KYL  E+D  D +  L    +  +       +L+ WPW GIV N
Sbjct  76   KHKGKHLGLVKYLKSEVDHEDLSSELTALTLVDQQEGNGVKDLFVWPWMGIVAN  129



>gb|KJB67635.1| hypothetical protein B456_010G201400 [Gossypium raimondii]
Length=640

 Score = 77.0 bits (188),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 60/130 (46%), Positives = 80/130 (62%), Gaps = 13/130 (10%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGK-GSANRS  298
            + EY++K YE+L++GKY V   +    CP+C    KQ Y+YKDLLQHA+GVG   SA R 
Sbjct  16   MEEYEDKSYEKLKNGKYTVMVSDETYTCPYCPKSNKQKYRYKDLLQHASGVGNSSSAKRK  75

Query  299  VKQKANHVALAKYLEIDLGD-QAEPLPQRAVAPEDNNLYC-------WPWTGIVVNV-SK  451
             + KANH+ALA+YLE DL    + P P   V  ED    C       WP TGIVVN+ ++
Sbjct  76   PRVKANHLALARYLETDLVPVVSSPKP---VVEEDPPSGCDHDEKIVWPCTGIVVNIPTR  132

Query  452  DNANGTAVEE  481
             +A+G +V E
Sbjct  133  RSADGRSVGE  142



>ref|XP_009387522.1| PREDICTED: uncharacterized protein LOC103974422 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009387523.1| PREDICTED: uncharacterized protein LOC103974422 [Musa acuminata 
subsp. malaccensis]
Length=641

 Score = 77.0 bits (188),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 51/148 (34%), Positives = 83/148 (56%), Gaps = 28/148 (19%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            + +Y+E+ Y+ L++G ++++ P+G  RCPFC GKKKQDY++KDLLQHATG+G  S++R  
Sbjct  19   VEDYEEECYQALKTGNHRIRNPDGTFRCPFCTGKKKQDYQFKDLLQHATGIG-ASSSRKG  77

Query  302  KQKANHVALAKYLEIDLGDQAEPLP---------------------------QRAVAPED  400
             QKA+H A A++L++DL       P                             +  P +
Sbjct  78   SQKAHHRAFARFLQLDLAPSLSLPPALKAAFAAAAAGDPSPIQSPPPSSSSYSASKPPRE  137

Query  401  NNLYCWPWTGIVVNVSKDNANGTAVEEE  484
            + L+ WPW  ++VN     A+G  ++E+
Sbjct  138  DELFVWPWMAVLVNAPPGAADGDDLKEK  165



>ref|XP_009357740.1| PREDICTED: myosin heavy chain, cardiac muscle isoform-like [Pyrus 
x bretschneideri]
Length=642

 Score = 76.3 bits (186),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 48/107 (45%), Positives = 68/107 (64%), Gaps = 5/107 (5%)
 Frame = +2

Query  158  RSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RSVKQKANHVALAK  334
            ++GKY V+  +G   CPFC  KKK+D+  K+LLQHA+GVGK +++ RS ++KA H+A+ K
Sbjct  32   KNGKYSVRSSDGRYTCPFCPSKKKRDFVLKELLQHASGVGKRTSDKRSTEEKAKHLAVVK  91

Query  335  YLEIDLGDQAEPLPQRAVAP----EDNNLYCWPWTGIVVNVSKDNAN  463
            YLE DL  +  P    A  P    + +    WPWTG+VVN+    AN
Sbjct  92   YLEKDLAAEGGPSKHVAEEPPIDCDQDEKLVWPWTGVVVNIPTRRAN  138



>emb|CDY05861.1| BnaC08g20380D [Brassica napus]
Length=661

 Score = 76.6 bits (187),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 60/131 (46%), Positives = 78/131 (60%), Gaps = 12/131 (9%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RS  298
            + EY +K Y  L+SGK KVK       CP C  KKK  ++YKDLLQHA+GVGK +++ R+
Sbjct  114  MEEYGDKIYLSLKSGKLKVKLSPHSFTCPCCPNKKKPSFQYKDLLQHASGVGKSNSDKRT  173

Query  299  VKQKANHVALAKYLEIDLGD--QAEPLPQRAVA-------PEDNNLYCWPWTGIVVNV-S  448
             K+KA+H ALAKYL+ DL D  QAEP  +R           +D  L C PW G+VVN+ +
Sbjct  174  AKEKASHRALAKYLQQDLADDSQAEPSSKRRKTGDPIQDCDQDEKLVC-PWKGVVVNIPT  232

Query  449  KDNANGTAVEE  481
                NG    E
Sbjct  233  TKTENGRTAGE  243



>gb|KEH34701.1| XH/XS domain protein [Medicago truncatula]
Length=640

 Score = 76.3 bits (186),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 56/129 (43%), Positives = 76/129 (59%), Gaps = 11/129 (9%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RS  298
            I EY+EK YEEL+SG   VK  +    CP+C  K+K+DY Y +LLQHA+GVG+ S+  R 
Sbjct  16   IGEYEEKCYEELKSGSQNVKTSDEKFTCPYCPKKRKRDYLYNELLQHASGVGQSSSQKRK  75

Query  299  VKQKANHVALAKYLEIDLGDQAEP-LPQRAVAP--------EDNNLYCWPWTGIVVNVSK  451
             ++KA H+AL KYLE DL +   P  P    A         + +  + WPW GI+VN+  
Sbjct  76   PREKATHLALVKYLEKDLMNIDTPSKPTENCADNGDTDTSIDSDEQFVWPWIGIIVNIPT  135

Query  452  DNA-NGTAV  475
              A +G AV
Sbjct  136  SRAQDGRAV  144



>gb|EYU43462.1| hypothetical protein MIMGU_mgv1a002657mg [Erythranthe guttata]
Length=649

 Score = 76.3 bits (186),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 51/126 (40%), Positives = 76/126 (60%), Gaps = 16/126 (13%)
 Frame = +2

Query  146  YEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN---RSVKQKAN  316
            YEEL++GKY+VK  N    CP+C  K+ +D++Y+DLLQHAT +G  S+    R+ + KAN
Sbjct  2    YEELKNGKYQVKISNKSYACPYCPEKRTRDFRYEDLLQHATAIGSCSSQNVKRTERDKAN  61

Query  317  HVALAKYLEIDL-----GDQAEPLPQRAVAPE--------DNNLYCWPWTGIVVNVSKDN  457
            HVAL KYL+ D+     G  ++P   ++ A           + ++ WPWTG++VN+  D 
Sbjct  62   HVALTKYLQTDIAVLPAGGGSKPPSAKSHAAAVLEQGLQGRDEVFVWPWTGVMVNIPTDL  121

Query  458  ANGTAV  475
             NG  V
Sbjct  122  KNGHYV  127


 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 69/124 (56%), Gaps = 15/124 (12%)
 Frame = +2

Query  152  ELRSGKYKVKGPNGCLR--CPFCAGkkkqdykykdllqHATGVGK-GSANRSVKQKANHV  322
            +L++G Y  KG        CP+C  ++  +++YKDLLQHA+ +    S  R+ K KANH+
Sbjct  120  DLKNGHYVGKGEEARKTNICPYCPWRRTINFQYKDLLQHASAIATCSSKKRTAKDKANHL  179

Query  323  ALAKYLEIDL-----GDQAEPLPQRAVAPED------NNLYCWPWTGIVVNVSKDNANGT  469
            +LAKYL+ID      G   +P P  +V  E       + +  WPW+G+VVN+  +  +G 
Sbjct  180  SLAKYLQIDFAVACAGSSTKP-PSSSVVVEAVTDYDPSEMLVWPWSGVVVNIPVELIDGR  238

Query  470  AVEE  481
             V E
Sbjct  239  YVGE  242



>gb|KHG06632.1| KilA-N domain-containing protein [Gossypium arboreum]
Length=640

 Score = 76.3 bits (186),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 58/129 (45%), Positives = 78/129 (60%), Gaps = 11/129 (9%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGK-GSANRS  298
            + EY++K YE+L++GKY V   +    CP+C    KQ Y+YKDLLQHA+GVG   SA R 
Sbjct  16   MEEYEDKSYEKLKNGKYTVMVSDETYTCPYCPKSNKQKYRYKDLLQHASGVGNSSSAKRK  75

Query  299  VKQKANHVALAKYLEIDLGDQAEPLPQRAVAPEDNNLYC-------WPWTGIVVNV-SKD  454
             + KANH+ALA+YLE D+         + V  ED    C       WP TGIVVN+ +K 
Sbjct  76   PRVKANHLALARYLETDVVPVVS--SSKPVVEEDPPSGCDHDEKIVWPCTGIVVNIPTKR  133

Query  455  NANGTAVEE  481
            +A+G +V E
Sbjct  134  SADGRSVGE  142



>gb|KJB67636.1| hypothetical protein B456_010G201400 [Gossypium raimondii]
Length=514

 Score = 75.5 bits (184),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 59/130 (45%), Positives = 80/130 (62%), Gaps = 13/130 (10%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVG-KGSANRS  298
            + EY++K YE+L++GKY V   +    CP+C    KQ Y+YKDLLQHA+GVG   SA R 
Sbjct  16   MEEYEDKSYEKLKNGKYTVMVSDETYTCPYCPKSNKQKYRYKDLLQHASGVGNSSSAKRK  75

Query  299  VKQKANHVALAKYLEIDLGD-QAEPLPQRAVAPED-------NNLYCWPWTGIVVNV-SK  451
             + KANH+ALA+YLE DL    + P P   V  ED       +    WP TGIVVN+ ++
Sbjct  76   PRVKANHLALARYLETDLVPVVSSPKP---VVEEDPPSGCDHDEKIVWPCTGIVVNIPTR  132

Query  452  DNANGTAVEE  481
             +A+G +V E
Sbjct  133  RSADGRSVGE  142



>gb|EMS45500.1| hypothetical protein TRIUR3_12203 [Triticum urartu]
Length=638

 Score = 75.9 bits (185),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 56/129 (43%), Positives = 78/129 (60%), Gaps = 8/129 (6%)
 Frame = +2

Query  131  YKEKPYEELR--SGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVK  304
            YK+K Y +LR  S K KV+      RCPFC GK+KQDY  KDLLQHA+G+G  +  R  +
Sbjct  19   YKDKIYAQLRLRSQKLKVQYGEKIFRCPFCLGKRKQDYNVKDLLQHASGIG-AAQKRKPR  77

Query  305  QKANHVALAKYLEIDLGDQAEPLPQRAVA----PE-DNNLYCWPWTGIVVNVSKDNANGT  469
             +A H+ALA+Y++ DLG   EP  Q A+     P+ +   + WPW GI+VN+  D  +  
Sbjct  78   VRAAHLALAEYVKNDLGSSLEPSLQLAIVEYKPPKIEQEKFVWPWMGILVNLPADLMDTN  137

Query  470  AVEEEDYWL  496
             V E ++ L
Sbjct  138  FVRESEHML  146



>ref|XP_008371804.1| PREDICTED: WEB family protein At4g27595, chloroplastic [Malus 
domestica]
Length=642

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 50/109 (46%), Positives = 70/109 (64%), Gaps = 9/109 (8%)
 Frame = +2

Query  158  RSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RSVKQKANHVALAK  334
            ++GK+ V+  +G   CPFC  KKK+D+  K+LLQHA+GVGK +++ RS ++KA H+A+ K
Sbjct  32   KNGKHSVRSSDGRYTCPFCPSKKKRDFVLKELLQHASGVGKSTSDKRSTEEKAKHLAVVK  91

Query  335  YLEIDLGDQAEPLPQRAVAPE------DNNLYCWPWTGIVVNVSKDNAN  463
            YLE DL   AE  P + VA E       +    WPWTG+VVN+    AN
Sbjct  92   YLEKDLA--AEGGPSKTVAEEPPIDCDQDEKLVWPWTGVVVNIPTRRAN  138



>ref|NP_001043655.1| Os01g0633200 [Oryza sativa Japonica Group]
 gb|AAF21887.1|AF101045_2 putative transcription factor X1 [Oryza sativa Japonica Group]
 dbj|BAB90725.1| putative X1 [Oryza sativa Japonica Group]
 dbj|BAF05569.1| Os01g0633200 [Oryza sativa Japonica Group]
 dbj|BAG91243.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE55041.1| hypothetical protein OsJ_02725 [Oryza sativa Japonica Group]
Length=629

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 51/123 (41%), Positives = 72/123 (59%), Gaps = 7/123 (6%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            I+EY +K Y  L +G++KVK       CPFC+GKKK+D+   +L+QHA+GVG  S NR  
Sbjct  16   IDEYADKFYARLVAGEFKVKDGQS-YSCPFCSGKKKKDFNINNLIQHASGVGAAS-NRQA  73

Query  302  KQKANHVALAKYLEIDLGDQAEPLPQRAVA-----PEDNNLYCWPWTGIVVNVSKDNANG  466
            K KA H ALAK+L+  L   +    Q AV      P  +  + WPW G++VNV  +  +G
Sbjct  74   KDKATHRALAKHLKNGLTKSSGQQSQTAVVEPQPLPNRDEKFVWPWMGVLVNVPTEWKDG  133

Query  467  TAV  475
              +
Sbjct  134  RQI  136



>gb|EEC71144.1| hypothetical protein OsI_02969 [Oryza sativa Indica Group]
Length=629

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 51/123 (41%), Positives = 72/123 (59%), Gaps = 7/123 (6%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            I+EY +K Y  L +G++KVK       CPFC+GKKK+D+   +L+QHA+GVG  S NR  
Sbjct  16   IDEYADKFYARLVAGEFKVKDGQS-YSCPFCSGKKKKDFNINNLIQHASGVGAAS-NRQA  73

Query  302  KQKANHVALAKYLEIDLGDQAEPLPQRAVA-----PEDNNLYCWPWTGIVVNVSKDNANG  466
            K KA H ALAK+L+  L   +    Q AV      P  +  + WPW G++VNV  +  +G
Sbjct  74   KDKATHRALAKHLKNGLTKSSGQQSQTAVVEPQPLPNRDEKFVWPWMGVLVNVPTEWKDG  133

Query  467  TAV  475
              +
Sbjct  134  RQI  136



>ref|XP_002316281.2| XH/XS domain-containing family protein [Populus trichocarpa]
 gb|EEF02452.2| XH/XS domain-containing family protein [Populus trichocarpa]
Length=749

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 48/116 (41%), Positives = 69/116 (59%), Gaps = 7/116 (6%)
 Frame = +2

Query  134  KEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdll-qHATGVGKG-SANRSVKQ  307
            ++K YEEL++G ++VK  +    CP+C  KK++       L QHATGVGK  S  R+ K+
Sbjct  131  EDKSYEELKNGNHQVKISDETFTCPYCPTKKRKRDYAYQDLLQHATGVGKSLSEKRTAKE  190

Query  308  KANHVALAKYLEIDL---GDQAEPL--PQRAVAPEDNNLYCWPWTGIVVNVSKDNA  460
            KA+H+AL KYLE DL   G  ++P    +   +   N+ + WPWTGI VN+    A
Sbjct  191  KADHLALVKYLEKDLAAAGSSSKPAGKTENLSSCSQNDKFVWPWTGIAVNLPTRRA  246


 Score = 69.3 bits (168),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 46/78 (59%), Positives = 57/78 (73%), Gaps = 1/78 (1%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKG-SANRS  298
            ++EY+ + YEEL+ GK +VK  +    CPFC  KK+Q Y YKDLLQHA+GVGK  S  RS
Sbjct  18   MDEYENEAYEELKDGKLRVKISDETFACPFCPQKKRQAYLYKDLLQHASGVGKSRSQKRS  77

Query  299  VKQKANHVALAKYLEIDL  352
             K+KANH+AL KYLE DL
Sbjct  78   TKEKANHLALVKYLEKDL  95



>ref|XP_010426360.1| PREDICTED: protein INVOLVED IN DE NOVO 2 [Camelina sativa]
 ref|XP_010426361.1| PREDICTED: protein INVOLVED IN DE NOVO 2 [Camelina sativa]
Length=648

 Score = 74.3 bits (181),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 71/120 (59%), Gaps = 13/120 (11%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKG-SANRS  298
            ++EY +K Y  L+ GK KVK       CP+C  KKK  ++YKDLLQHA+GVG   S  RS
Sbjct  21   MDEYGDKMYLNLKGGKLKVKLSPQAFLCPYCPNKKKPSFQYKDLLQHASGVGNSNSEKRS  80

Query  299  VKQKANHVALAKYLEIDLGDQ----AEPLPQRAV-------APEDNNLYCWPWTGIVVNV  445
             K+KA+H+AL KYL+ DL D     AEP  +R           +D  L C PW GIVVN+
Sbjct  81   AKEKASHLALVKYLQQDLADSASDAAEPSAKRQKNGNAIQDCDQDEKLVC-PWKGIVVNI  139



>ref|XP_006292435.1| hypothetical protein CARUB_v10018651mg [Capsella rubella]
 gb|EOA25333.1| hypothetical protein CARUB_v10018651mg [Capsella rubella]
Length=647

 Score = 74.3 bits (181),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 54/118 (46%), Positives = 70/118 (59%), Gaps = 10/118 (8%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKG-SANRS  298
            ++EY +K Y  L+ GK KVK       CP+C  KKK  ++YKDLLQHA+GVG   S  RS
Sbjct  21   MDEYGDKMYLNLKGGKVKVKLSPQAFVCPYCPNKKKPSFQYKDLLQHASGVGNSNSEKRS  80

Query  299  VKQKANHVALAKYLEIDLGD---QAEPLPQRAVAP------EDNNLYCWPWTGIVVNV  445
             K+KA+H+AL KYL+ DL D    AEP  +R          + +    WPW GIVVN+
Sbjct  81   AKEKASHLALVKYLQQDLADSASDAEPSSKRQKNGNPIQDCDHDEKLVWPWKGIVVNI  138



>ref|XP_010651011.1| PREDICTED: protein INVOLVED IN DE NOVO 2 [Vitis vinifera]
 ref|XP_010651012.1| PREDICTED: protein INVOLVED IN DE NOVO 2 [Vitis vinifera]
 ref|XP_010651013.1| PREDICTED: protein INVOLVED IN DE NOVO 2 [Vitis vinifera]
 emb|CBI16121.3| unnamed protein product [Vitis vinifera]
Length=626

 Score = 73.9 bits (180),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 44/124 (35%), Positives = 73/124 (59%), Gaps = 4/124 (3%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            +++Y+ + Y EL++G  +VK  +   RCP+C  K  +DY+ ++LLQHA+ VG+ S +  V
Sbjct  16   LDDYRYRYYRELQNGSVRVKISDTTFRCPYCPSKDDRDYRCRELLQHASRVGRDSGSGDV  75

Query  302  KQKANHVALAKYLEIDLGDQAEPLPQR----AVAPEDNNLYCWPWTGIVVNVSKDNANGT  469
            K+KA H+AL KYL+  L  +  P   +    + A + +  + WPW GI+ N+     +G 
Sbjct  76   KEKARHLALMKYLDKYLDTKQSPASTKDTESSTANDADGHFVWPWVGIIANIPVQRIDGR  135

Query  470  AVEE  481
             V E
Sbjct  136  YVGE  139



>ref|XP_006404228.1| hypothetical protein EUTSA_v10010188mg [Eutrema salsugineum]
 ref|XP_006404229.1| hypothetical protein EUTSA_v10010188mg [Eutrema salsugineum]
 ref|XP_006404230.1| hypothetical protein EUTSA_v10010188mg [Eutrema salsugineum]
 gb|ESQ45681.1| hypothetical protein EUTSA_v10010188mg [Eutrema salsugineum]
 gb|ESQ45682.1| hypothetical protein EUTSA_v10010188mg [Eutrema salsugineum]
 gb|ESQ45683.1| hypothetical protein EUTSA_v10010188mg [Eutrema salsugineum]
Length=646

 Score = 73.6 bits (179),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 71/118 (60%), Gaps = 10/118 (8%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKG-SANRS  298
            + EY++K Y  L+ GK KVK       CP+C  KKK  ++YKDLLQHA+GVG   S  RS
Sbjct  21   MEEYEDKIYLNLKGGKLKVKLSPQAFVCPYCPNKKKPSFQYKDLLQHASGVGNSNSEKRS  80

Query  299  VKQKANHVALAKYLEIDLGD---QAEPLPQRAVAP------EDNNLYCWPWTGIVVNV  445
             K+KA+H+AL KYL+ DL D   +AEP  +R          + +    +PW G+VVN+
Sbjct  81   AKEKASHLALVKYLQQDLADSAAEAEPSSKRKKTENAIQDCDQDEKLVYPWKGVVVNI  138



>emb|CDX77918.1| BnaC03g53010D [Brassica napus]
Length=584

 Score = 72.8 bits (177),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 54/117 (46%), Positives = 72/117 (62%), Gaps = 10/117 (9%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKG-SANRS  298
            + E+ +K Y  L+SGK KVK       CP+C  KKK  ++YKDLLQHA+GVG   S  R+
Sbjct  21   MEEHADKIYLTLKSGKLKVKLSPQAFTCPYCPNKKKPSFQYKDLLQHASGVGNSNSEKRT  80

Query  299  VKQKANHVALAKYLEIDLGD-QAEPLPQRAVA-------PEDNNLYCWPWTGIVVNV  445
             K+KA+H+AL KYL+ DL D +AEP  +R           +D  L C PW G+VVN+
Sbjct  81   SKEKASHLALVKYLQEDLADSEAEPSSKRQKTGDPIQDCDQDEKLVC-PWKGVVVNI  136



>ref|XP_010520104.1| PREDICTED: protein INVOLVED IN DE NOVO 2-like [Tarenaya hassleriana]
Length=620

 Score = 72.8 bits (177),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 49/105 (47%), Positives = 63/105 (60%), Gaps = 2/105 (2%)
 Frame = +2

Query  134  KEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RSVKQK  310
            ++K Y  L+ G+ +VK  +    CPFC   K++   YKDLLQHA+GVG  S+  RS KQK
Sbjct  9    EKKLYNNLKRGRLEVKVSSKTFICPFCPMNKRRVCLYKDLLQHASGVGNSSSKKRSAKQK  68

Query  311  ANHVALAKYLEIDLGDQAEPLPQRAVAPEDNNLYCWPWTGIVVNV  445
            A+H AL KYL+ DL D A  L       ED   + WPW GIV N+
Sbjct  69   ASHRALFKYLQNDLADSAT-LSNPHEFSEDGERFVWPWKGIVANI  112



>ref|XP_006644407.1| PREDICTED: intracellular protein transport protein USO1-like 
[Oryza brachyantha]
Length=629

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 50/124 (40%), Positives = 74/124 (60%), Gaps = 9/124 (7%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            I++Y+ K Y  L +G++KVK       CPFC+GKKK+ Y   +L+QHA+GVG  + NR  
Sbjct  16   IDDYEGKFYARLVAGEFKVKDGES-YSCPFCSGKKKKAYNLNNLIQHASGVG-AAPNRQA  73

Query  302  KQKANHVALAKYLEIDLGDQAEPLPQRAVA------PEDNNLYCWPWTGIVVNVSKDNAN  463
            K KA+H ALAK+L+  L   +E LP + V       P  +  + WPW G++VNV  +  +
Sbjct  74   KDKASHRALAKHLKNGLTKSSE-LPAQTVVVEPQPLPSRDEKFVWPWMGVLVNVPTEWKD  132

Query  464  GTAV  475
            G  +
Sbjct  133  GRQI  136



>ref|XP_002875916.1| XH/XS domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52175.1| XH/XS domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=647

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 74/119 (62%), Gaps = 12/119 (10%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RS  298
            ++EY +K Y  L+ GK KV+       CP+C  KKK  ++YKDLLQHA+GVG  +++ RS
Sbjct  21   MDEYGDKMYLNLKGGKLKVRLSPQAFVCPYCPNKKKPSFQYKDLLQHASGVGNSNSDKRS  80

Query  299  VKQKANHVALAKYLEIDLGD---QAEPLPQRAV-------APEDNNLYCWPWTGIVVNV  445
             K+KA+H+AL KYL+ DL D   +AEP  +R           +D  L  +PW GIVVN+
Sbjct  81   AKEKASHLALVKYLQQDLADSAVEAEPSSKRQKNGNPIQDCDQDEKL-VYPWKGIVVNI  138



>ref|XP_009799105.1| PREDICTED: golgin candidate 4 [Nicotiana sylvestris]
 ref|XP_009799106.1| PREDICTED: golgin candidate 4 [Nicotiana sylvestris]
Length=639

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 54/126 (43%), Positives = 80/126 (63%), Gaps = 14/126 (11%)
 Frame = +2

Query  146  YEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RSVKQKANHV  322
            YE+L+ G + +K  +    CP+C  K+K+D+ YK+L+QHA+GVG G++N R+ + KANH+
Sbjct  24   YEDLKRGNHSLKISDVAYTCPYCPKKRKRDFGYKELVQHASGVGSGNSNKRTARDKANHL  83

Query  323  ALAKYLEIDL---GD--------QAEPLPQRA-VAPEDNN-LYCWPWTGIVVNVSKDNAN  463
            ALAKYLE D+   GD         A+P PQ   +A  D + ++ WPW GIVVN+  +  +
Sbjct  84   ALAKYLENDVVVAGDSSNDSSKPDAKPDPQADPLADHDRDEMFVWPWIGIVVNILTEYKD  143

Query  464  GTAVEE  481
            G  V E
Sbjct  144  GRYVGE  149



>ref|XP_009150181.1| PREDICTED: uncharacterized protein LOC103873521 [Brassica rapa]
Length=643

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 53/115 (46%), Positives = 69/115 (60%), Gaps = 11/115 (10%)
 Frame = +2

Query  131  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKG-SANRSVKQ  307
            + +K Y  L+SGK KVK      +CP+C  KKK  ++YKDLLQHA+GVG   S  R+ K 
Sbjct  24   HADKIYPTLKSGKLKVKLSPQAFKCPYCPNKKKPSFQYKDLLQHASGVGNSNSEKRTSKD  83

Query  308  KANHVALAKYLEIDLGDQ--AEPLPQRAVA-------PEDNNLYCWPWTGIVVNV  445
            KA+H+AL KYL+ DL D   AEP  +R           +D  L C PW G+VVN+
Sbjct  84   KASHLALVKYLQQDLSDSAAAEPSSKRQKTGDPIQDCDQDEKLVC-PWKGVVVNI  137



>emb|CAB62356.1| putative protein [Arabidopsis thaliana]
Length=644

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 54/124 (44%), Positives = 74/124 (60%), Gaps = 12/124 (10%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RS  298
            ++EY +K Y  L+ GK KV+       CP+C  KKK  ++YKDLLQHA+GVG  +++ RS
Sbjct  21   MDEYGDKMYLNLKGGKLKVRLSPQAFICPYCPNKKKTSFQYKDLLQHASGVGNSNSDKRS  80

Query  299  VKQKANHVALAKYLEIDLGD---QAEPLPQRAV-------APEDNNLYCWPWTGIVVNVS  448
             K+KA+H+AL KYL+ DL D   +AEP  +R            D  L  +PW GIVVN+ 
Sbjct  81   AKEKASHLALVKYLQQDLADSASEAEPSSKRQKNGNPIQDCDHDEKL-VYPWKGIVVNIP  139

Query  449  KDNA  460
               A
Sbjct  140  TTKA  143



>ref|NP_190436.2| XH/XS domain-containing protein [Arabidopsis thaliana]
 ref|NP_974403.1| XH/XS domain-containing protein [Arabidopsis thaliana]
 sp|Q8VZ79.1|IDN2_ARATH RecName: Full=Protein INVOLVED IN DE NOVO 2; AltName: Full=Protein 
RNA-DIRECTED DNA METHYLATION 12 [Arabidopsis thaliana]
 gb|AAL38360.1| putative protein [Arabidopsis thaliana]
 gb|AAN15455.1| putative protein [Arabidopsis thaliana]
 gb|AEE78442.1| XH/XS domain-containing protein [Arabidopsis thaliana]
 gb|AEE78443.1| XH/XS domain-containing protein [Arabidopsis thaliana]
Length=647

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 54/124 (44%), Positives = 74/124 (60%), Gaps = 12/124 (10%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RS  298
            ++EY +K Y  L+ GK KV+       CP+C  KKK  ++YKDLLQHA+GVG  +++ RS
Sbjct  21   MDEYGDKMYLNLKGGKLKVRLSPQAFICPYCPNKKKTSFQYKDLLQHASGVGNSNSDKRS  80

Query  299  VKQKANHVALAKYLEIDLGD---QAEPLPQRAV-------APEDNNLYCWPWTGIVVNVS  448
             K+KA+H+AL KYL+ DL D   +AEP  +R            D  L  +PW GIVVN+ 
Sbjct  81   AKEKASHLALVKYLQQDLADSASEAEPSSKRQKNGNPIQDCDHDEKL-VYPWKGIVVNIP  139

Query  449  KDNA  460
               A
Sbjct  140  TTKA  143



>ref|XP_010503501.1| PREDICTED: protein INVOLVED IN DE NOVO 2-like [Camelina sativa]
 ref|XP_010503502.1| PREDICTED: protein INVOLVED IN DE NOVO 2-like [Camelina sativa]
Length=648

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 55/120 (46%), Positives = 70/120 (58%), Gaps = 13/120 (11%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKG-SANRS  298
            ++EY +K Y  L+ GK KVK       CP+C  KKK  ++YKDLLQHA+GVG   S  +S
Sbjct  21   MDEYGDKMYLNLKGGKLKVKLSPQAFLCPYCPTKKKPSFQYKDLLQHASGVGNSNSEKKS  80

Query  299  VKQKANHVALAKYLEIDLGDQ----AEPLPQRAV-------APEDNNLYCWPWTGIVVNV  445
             K+KA+H+AL KYL+ DL D     AEP  +R            D  L C PW GIVVN+
Sbjct  81   AKEKASHLALVKYLQQDLADSASDAAEPSAKRQKNGNAIQDCDHDEKLVC-PWKGIVVNI  139



>ref|XP_003569414.1| PREDICTED: factor of DNA methylation 1-like [Brachypodium distachyon]
Length=628

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 69/120 (58%), Gaps = 7/120 (6%)
 Frame = +2

Query  134  KEKPYEELRSGKYKVKGPNGC-LRCPFCAGkkkqdykykdllqHATGVGKGSANRSVKQK  310
            ++K Y  L SG  K+   NG    CPFC GKKK+DY   +LLQHA+GVG  + NR  K+K
Sbjct  20   EDKIYARLISGDLKIN--NGASYSCPFCTGKKKKDYNIHNLLQHASGVG-AAPNRPAKEK  76

Query  311  ANHVALAKYLEIDLGDQAEPLPQRAV---APEDNNLYCWPWTGIVVNVSKDNANGTAVEE  481
            A H ALAK+L+  L    EP PQ  V    P  N  + WPW G++ NV  +  +G  V E
Sbjct  77   ATHRALAKHLKNGLAKPPEPQPQLIVDQPLPNRNEKFVWPWMGVLANVPTEWKDGRQVGE  136



>emb|CDY37917.1| BnaA06g19000D [Brassica napus]
Length=579

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 53/115 (46%), Positives = 69/115 (60%), Gaps = 11/115 (10%)
 Frame = +2

Query  131  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKG-SANRSVKQ  307
            + +K Y  L+SGK KVK      +CP+C  KKK  ++YKDLLQHA+GVG   S  R+ K 
Sbjct  24   HADKIYPTLKSGKLKVKLSPQAFKCPYCPNKKKPSFQYKDLLQHASGVGNSNSEKRTSKD  83

Query  308  KANHVALAKYLEIDLGDQAEPLP----QRAVAP-----EDNNLYCWPWTGIVVNV  445
            KA+H+AL KYL+ DL D A   P    Q+   P     +D  L C PW G+VVN+
Sbjct  84   KASHLALVKYLQQDLSDSAAAEPSSKRQKTGDPIQDCDQDEKLVC-PWKGVVVNI  137



>ref|XP_008233634.1| PREDICTED: LOW QUALITY PROTEIN: CAP-Gly domain-containing linker 
protein 1 [Prunus mume]
Length=633

 Score = 70.9 bits (172),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 47/111 (42%), Positives = 60/111 (54%), Gaps = 18/111 (16%)
 Frame = +2

Query  155  LRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKG-SANRSVKQKANHVALA  331
            L++GK+ V+  +G   CPFC          K  LQHA+GV K  S  RS ++KA H ALA
Sbjct  31   LKNGKHNVRSSDGTYICPFCP--------KKSXLQHASGVEKSNSEKRSAEEKAKHSALA  82

Query  332  KYLEIDLGDQAEPLPQRAVAPEDNNLYC-------WPWTGIVVNVSKDNAN  463
            KYLE DL    E  P + V  ED  + C       WPWTG+VVN+    A+
Sbjct  83   KYLEKDLA--TEGGPSKPVGEEDPPVDCDHDEKLVWPWTGVVVNIPTRRAD  131



>ref|XP_010108755.1| hypothetical protein L484_011413 [Morus notabilis]
 gb|EXC20169.1| hypothetical protein L484_011413 [Morus notabilis]
Length=681

 Score = 70.9 bits (172),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 54/133 (41%), Positives = 76/133 (57%), Gaps = 25/133 (19%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKG-SANRS  298
            ++E  E+ Y+EL+SGK+ VK  +G   CP+C  KKKQ+Y Y+DLLQHA+GVG   S  RS
Sbjct  41   MDESVEEAYKELKSGKHHVKLWDGTFTCPYCQKKKKQNYLYRDLLQHASGVGNSPSDKRS  100

Query  299  VKQKANHVALAKYLEIDLG---DQAEPLPQR---------------------AVAPEDNN  406
             KQK  H+ALAK+LE DL      +EP  +                       V+ ++++
Sbjct  101  AKQKITHLALAKFLEKDLAGGVGPSEPAGEEKAPAPAPASAPAAAPAPAAAPVVSCDNDD  160

Query  407  LYCWPWTGIVVNV  445
             + WPW GI VN+
Sbjct  161  KFVWPWIGIAVNL  173



>gb|AGT17258.1| X1 protein [Saccharum hybrid cultivar R570]
 gb|AGT17260.1| X1 protein [Saccharum hybrid cultivar R570]
Length=629

 Score = 70.1 bits (170),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 51/125 (41%), Positives = 68/125 (54%), Gaps = 6/125 (5%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            I++Y+ K Y  L SG  KVK       C FC+ KKK +Y    L+QHA+GV   + NR  
Sbjct  16   IDDYEGKIYARLMSGDLKVKNNGENYSCLFCSSKKKNNYSKSSLVQHASGVS-AAPNRKA  74

Query  302  KQKANHVALAKYLEIDLGDQAEPLPQRA-VAPE----DNNLYCWPWTGIVVNVSKDNANG  466
            K+KA H AL KYL+ DL    EP P    V P+     +  + WPW GI+VNV  +  +G
Sbjct  75   KEKAAHRALFKYLKNDLTKSPEPRPHVIPVEPQPLQNRDEKFVWPWMGILVNVPTEWKDG  134

Query  467  TAVEE  481
              + E
Sbjct  135  RQIGE  139



>ref|XP_002456013.1| hypothetical protein SORBIDRAFT_03g028860 [Sorghum bicolor]
 gb|EES01133.1| hypothetical protein SORBIDRAFT_03g028860 [Sorghum bicolor]
Length=629

 Score = 70.1 bits (170),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 51/125 (41%), Positives = 69/125 (55%), Gaps = 6/125 (5%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            I++Y+ K Y  L SG  KVK       C FC+ KKK +Y    L+QHA+GV   + NR  
Sbjct  16   IDDYEGKVYASLMSGGLKVKNNGENYSCLFCSSKKKNNYSKSSLVQHASGVS-AAPNRKA  74

Query  302  KQKANHVALAKYLEIDLGDQAEPLPQRA-VAPE----DNNLYCWPWTGIVVNVSKDNANG  466
            K+KA H AL KYL+ DL   +EP P    V P+     +  + WPW GI+VNV  +  +G
Sbjct  75   KEKAAHRALFKYLKNDLAKSSEPQPLVIPVEPQPLQNRDEKFVWPWMGILVNVPTEWKDG  134

Query  467  TAVEE  481
              + E
Sbjct  135  RQIGE  139



>ref|XP_009589398.1| PREDICTED: golgin candidate 4 [Nicotiana tomentosiformis]
 ref|XP_009589399.1| PREDICTED: golgin candidate 4 [Nicotiana tomentosiformis]
Length=638

 Score = 69.7 bits (169),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 53/122 (43%), Positives = 79/122 (65%), Gaps = 10/122 (8%)
 Frame = +2

Query  146  YEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RSVKQKANHV  322
            YE+L+ G + +K  +    CP+C  K+K+D+ YK+L+QHA+GVG  ++N R+ + KANH+
Sbjct  24   YEDLKRGNHSLKISDVAYTCPYCPKKRKRDFGYKELVQHASGVGSCNSNKRTARDKANHL  83

Query  323  ALAKYLEIDL---GD----QAEPLPQ-RAVAPEDNN-LYCWPWTGIVVNVSKDNANGTAV  475
            ALAKYLE D+   GD     A+P PQ   +A  D + ++ WPW GIVVN+  +  +G  V
Sbjct  84   ALAKYLENDVAVAGDSSKPDAKPDPQADPLADHDRDEMFVWPWIGIVVNILTEYKDGRYV  143

Query  476  EE  481
             E
Sbjct  144  GE  145



>gb|EYU37790.1| hypothetical protein MIMGU_mgv1a002821mg [Erythranthe guttata]
Length=634

 Score = 69.7 bits (169),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 43/122 (35%), Positives = 67/122 (55%), Gaps = 9/122 (7%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            + ++ +  YE+L+     VK      RCP+C   KK+ + + DLLQHA+GV +GS  R +
Sbjct  17   LEDHADSCYEKLKQAGETVKISETEYRCPYCPRTKKRIFGFNDLLQHASGVSRGSQKRGI  76

Query  302  KQKANHVALAKYLEIDLGDQAEPLPQRAVAPED-------NNLYCWPWTGIVVNVSKDNA  460
            K +  H+ L KY++ +L  + E +P+  V   +       N LY WPW GIV N+  +  
Sbjct  77   KDRGRHLGLVKYIQKEL--KGESIPENTVDNNEIHKSCDLNELYVWPWMGIVANIPVEWK  134

Query  461  NG  466
            NG
Sbjct  135  NG  136



>gb|AGT16789.1| hypothetical protein SHCRBa_009_B01_R_10 [Saccharum hybrid cultivar 
R570]
Length=629

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 50/125 (40%), Positives = 68/125 (54%), Gaps = 6/125 (5%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            I++Y+ K Y  L SG  KVK       C FC+ KKK +Y    L+QHA+GV   + NR  
Sbjct  16   IDDYEGKIYARLMSGDLKVKKNGENYSCLFCSSKKKNNYSKSSLVQHASGVS-AAPNRKA  74

Query  302  KQKANHVALAKYLEIDLGDQAEPLPQRA-VAPE----DNNLYCWPWTGIVVNVSKDNANG  466
            K+KA H AL KYL+ DL    EP P    V P+     +  + WPW G++VNV  +  +G
Sbjct  75   KEKAAHRALFKYLKNDLAKSPEPRPHVIPVEPQPLQNRDEKFVWPWMGVLVNVPTEWKDG  134

Query  467  TAVEE  481
              + E
Sbjct  135  RQIGE  139



>gb|AGT16810.1| transcription factor [Saccharum hybrid cultivar R570]
Length=629

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 49/125 (39%), Positives = 68/125 (54%), Gaps = 6/125 (5%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            I++Y+ K Y  L SG  KVK       C FC+ KKK +Y    L+QHA+GV   + NR  
Sbjct  16   IDDYEGKIYARLMSGDLKVKKNGENYSCLFCSSKKKNNYSKSSLVQHASGVS-AAPNRKA  74

Query  302  KQKANHVALAKYLEIDLGDQAEPLPQRA-VAPE----DNNLYCWPWTGIVVNVSKDNANG  466
            K+KA H +L KYL+ DL    EP P    V P+     +  + WPW G++VNV  +  +G
Sbjct  75   KEKAAHRSLFKYLKNDLAKSPEPRPHVIPVEPQPLQNRDEKFVWPWMGVLVNVPTEWKDG  134

Query  467  TAVEE  481
              + E
Sbjct  135  RQIGE  139



>ref|XP_003569416.1| PREDICTED: factor of DNA methylation 1-like [Brachypodium distachyon]
Length=630

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 54/126 (43%), Positives = 70/126 (56%), Gaps = 9/126 (7%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNG-CLRCPFCAGkkkqdykykdllqHATGVGKGSANRS  298
            I+EY+ K Y  L SG  KV   NG    CPFC+GKKK++Y   +LLQHA+GVG  + NR 
Sbjct  16   IDEYEGKIYASLMSGDLKVN--NGESYSCPFCSGKKKKNYTLHNLLQHASGVG-AAPNRP  72

Query  299  VKQKANHVALAKYLEIDLGDQAEPLPQRAVA-----PEDNNLYCWPWTGIVVNVSKDNAN  463
             K+KA H ALAK+L+  L    EP  Q         P     + WPW G+V NV  +  +
Sbjct  73   EKEKATHRALAKHLKNGLAKSPEPQSQLVDVEPQPLPGRYEKFVWPWMGVVANVPTEWKD  132

Query  464  GTAVEE  481
            G  + E
Sbjct  133  GCQIGE  138



>ref|XP_006595902.1| PREDICTED: uncharacterized protein LOC100790814 isoform X3 [Glycine 
max]
Length=1073

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 66/111 (59%), Gaps = 7/111 (6%)
 Frame = +2

Query  131  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdyky-kdllqHATGVGKGSAN-RSVK  304
            Y  K YE L+ G + VK       CP+C  KK++     +++L+HA+GVG+ S+  RS  
Sbjct  455  YVHKSYEALKKGSHNVKTSEMTFSCPYCPNKKRKRDYVYREILEHASGVGQSSSEKRSAI  514

Query  305  QKANHVALAKYLEIDLGDQAEPLPQRAV--APEDN--NLYCWPWTGIVVNV  445
            +KANH+AL KYLE DL     P P+ A   +P  N    + WPWTGIVVN+
Sbjct  515  EKANHLALMKYLEKDLMIVDGP-PKTADEGSPPFNFEKQFVWPWTGIVVNI  564


 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 56/89 (63%), Gaps = 2/89 (2%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdy-kykdllqHATGVGKG-SANR  295
            I  Y EK YEEL+ G + VK  +   RCP+C+ KK      Y+++L+HA+GVG+  S  R
Sbjct  332  IGRYAEKFYEELKRGIHNVKTSDETFRCPYCSNKKINRDYVYREILEHASGVGQSKSQKR  391

Query  296  SVKQKANHVALAKYLEIDLGDQAEPLPQR  382
            S  +KANH+AL KYL+ DL +   P P +
Sbjct  392  SFIEKANHLALVKYLKKDLMNVGAPCPSK  420


 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 55/75 (73%), Gaps = 1/75 (1%)
 Frame = +2

Query  131  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSA-NRSVKQ  307
            Y EK Y+EL+ G + V+  +  L CP+C  K+KQDY Y++LL+HA+GVG+ S+  R V++
Sbjct  171  YVEKFYKELKKGNHMVQTSDLTLCCPYCPKKRKQDYVYRELLEHASGVGQSSSEKRHVRE  230

Query  308  KANHVALAKYLEIDL  352
            KA H+AL KYL+ DL
Sbjct  231  KATHLALMKYLKNDL  245


 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 52/75 (69%), Gaps = 2/75 (3%)
 Frame = +2

Query  131  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RSVKQ  307
            Y +  YEEL+ G + VK  +    CP+C  ++KQDY Y++LL+HA  VG+ S+  RS ++
Sbjct  55   YVDTSYEELKKGSHSVKTSDVTFICPYCP-RRKQDYLYRELLEHAYMVGRSSSEKRSARE  113

Query  308  KANHVALAKYLEIDL  352
            +ANH+AL KYLE DL
Sbjct  114  RANHLALVKYLENDL  128



>ref|XP_003545257.1| PREDICTED: uncharacterized protein LOC100790814 isoform X1 [Glycine 
max]
 ref|XP_006595901.1| PREDICTED: uncharacterized protein LOC100790814 isoform X2 [Glycine 
max]
Length=1154

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 66/111 (59%), Gaps = 7/111 (6%)
 Frame = +2

Query  131  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdyky-kdllqHATGVGKGSA-NRSVK  304
            Y  K YE L+ G + VK       CP+C  KK++     +++L+HA+GVG+ S+  RS  
Sbjct  536  YVHKSYEALKKGSHNVKTSEMTFSCPYCPNKKRKRDYVYREILEHASGVGQSSSEKRSAI  595

Query  305  QKANHVALAKYLEIDLGDQAEPLPQRAV--APEDN--NLYCWPWTGIVVNV  445
            +KANH+AL KYLE DL     P P+ A   +P  N    + WPWTGIVVN+
Sbjct  596  EKANHLALMKYLEKDLMIVDGP-PKTADEGSPPFNFEKQFVWPWTGIVVNI  645


 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 57/91 (63%), Gaps = 2/91 (2%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdy-kykdllqHATGVGKG-SANR  295
            I  Y EK YEEL+ G + VK  +   RCP+C+ KK      Y+++L+HA+GVG+  S  R
Sbjct  413  IGRYAEKFYEELKRGIHNVKTSDETFRCPYCSNKKINRDYVYREILEHASGVGQSKSQKR  472

Query  296  SVKQKANHVALAKYLEIDLGDQAEPLPQRAV  388
            S  +KANH+AL KYL+ DL +   P P + +
Sbjct  473  SFIEKANHLALVKYLKKDLMNVGAPCPSKPM  503


 Score = 58.2 bits (139),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 54/76 (71%), Gaps = 2/76 (3%)
 Frame = +2

Query  131  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSA-NRSVKQ  307
            Y +  Y+EL+ G YKV   +    CP+C  ++KQDYKY++LL HA+GVG+ S+  RS K+
Sbjct  20   YVDISYQELKKGSYKVMRSDETFICPYCP-ERKQDYKYRELLNHASGVGRSSSEKRSAKE  78

Query  308  KANHVALAKYLEIDLG  355
            KANH+AL KYLE DL 
Sbjct  79   KANHLALVKYLEKDLA  94


 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 55/75 (73%), Gaps = 1/75 (1%)
 Frame = +2

Query  131  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSA-NRSVKQ  307
            Y EK Y+EL+ G + V+  +  L CP+C  K+KQDY Y++LL+HA+GVG+ S+  R V++
Sbjct  252  YVEKFYKELKKGNHMVQTSDLTLCCPYCPKKRKQDYVYRELLEHASGVGQSSSEKRHVRE  311

Query  308  KANHVALAKYLEIDL  352
            KA H+AL KYL+ DL
Sbjct  312  KATHLALMKYLKNDL  326


 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 52/75 (69%), Gaps = 2/75 (3%)
 Frame = +2

Query  131  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSA-NRSVKQ  307
            Y +  YEEL+ G + VK  +    CP+C  ++KQDY Y++LL+HA  VG+ S+  RS ++
Sbjct  136  YVDTSYEELKKGSHSVKTSDVTFICPYCP-RRKQDYLYRELLEHAYMVGRSSSEKRSARE  194

Query  308  KANHVALAKYLEIDL  352
            +ANH+AL KYLE DL
Sbjct  195  RANHLALVKYLENDL  209



>gb|KHN20923.1| hypothetical protein glysoja_009231 [Glycine soja]
Length=1080

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 66/111 (59%), Gaps = 7/111 (6%)
 Frame = +2

Query  131  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdyky-kdllqHATGVGKGSA-NRSVK  304
            Y  K YE L+ G + VK       CP+C  KK++     +++L+HA+GVG+ S+  RS  
Sbjct  536  YVHKSYEALKKGSHNVKTSEMTFSCPYCPNKKRKRDYVYREILEHASGVGQSSSEKRSAI  595

Query  305  QKANHVALAKYLEIDLGDQAEPLPQRAV--APEDN--NLYCWPWTGIVVNV  445
            +KANH+AL KYLE DL     P P+ A   +P  N    + WPWTGIVVN+
Sbjct  596  EKANHLALMKYLEKDLMIVDGP-PKTADEGSPPFNFEKQFVWPWTGIVVNI  645


 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 57/91 (63%), Gaps = 2/91 (2%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdy-kykdllqHATGVGKG-SANR  295
            I  Y EK YEEL+ G + VK  +   RCP+C+ KK      Y+++L+HA+GVG+  S  R
Sbjct  413  IGRYAEKFYEELKRGIHNVKTSDETFRCPYCSNKKINRDYVYREILEHASGVGQSKSQKR  472

Query  296  SVKQKANHVALAKYLEIDLGDQAEPLPQRAV  388
            S  +KANH+AL KYL+ DL +   P P + +
Sbjct  473  SFIEKANHLALVKYLKKDLMNVGAPCPSKPM  503


 Score = 58.2 bits (139),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 54/76 (71%), Gaps = 2/76 (3%)
 Frame = +2

Query  131  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSA-NRSVKQ  307
            Y +  Y+EL+ G YKV   +    CP+C  ++KQDYKY++LL HA+GVG+ S+  RS K+
Sbjct  20   YVDISYQELKKGSYKVMRSDETFICPYCP-ERKQDYKYRELLNHASGVGRSSSEKRSAKE  78

Query  308  KANHVALAKYLEIDLG  355
            KANH+AL KYLE DL 
Sbjct  79   KANHLALVKYLEKDLA  94


 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 55/75 (73%), Gaps = 1/75 (1%)
 Frame = +2

Query  131  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSA-NRSVKQ  307
            Y EK Y+EL+ G + V+  +  L CP+C  K+KQDY Y++LL+HA+GVG+ S+  R V++
Sbjct  252  YVEKFYKELKKGNHMVQTSDLTLCCPYCPKKRKQDYVYRELLEHASGVGQSSSEKRHVRE  311

Query  308  KANHVALAKYLEIDL  352
            KA H+AL KYL+ DL
Sbjct  312  KATHLALMKYLKNDL  326


 Score = 52.0 bits (123),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 52/75 (69%), Gaps = 2/75 (3%)
 Frame = +2

Query  131  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSA-NRSVKQ  307
            Y +  YEEL+ G + VK  +    CP+C  ++KQDY Y++LL+HA  VG+ S+  RS ++
Sbjct  136  YVDTSYEELKKGSHSVKTSDVTFICPYCP-RRKQDYLYRELLEHAYMVGRSSSEKRSARE  194

Query  308  KANHVALAKYLEIDL  352
            +ANH+AL KYLE DL
Sbjct  195  RANHLALVKYLENDL  209



>gb|KHN41100.1| hypothetical protein glysoja_013442 [Glycine soja]
Length=1115

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 66/111 (59%), Gaps = 7/111 (6%)
 Frame = +2

Query  131  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdyky-kdllqHATGVGKGSAN-RSVK  304
            Y  K YE L+ G + VK       CP+C  KK++     +++L+HA+GVG+ S+  RS  
Sbjct  498  YVHKSYEALKKGSHNVKTSEMTFSCPYCPNKKRKRDYLYREILEHASGVGQSSSEKRSAI  557

Query  305  QKANHVALAKYLEIDLGDQAEPLPQRAV--APEDN--NLYCWPWTGIVVNV  445
            +KANH+AL KYLE DL     P P+ A   +P  N    + WPWTG+VVN+
Sbjct  558  EKANHLALMKYLEKDLMIVDGP-PKTADEGSPPFNFEKQFVWPWTGVVVNI  607


 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 53/88 (60%), Gaps = 2/88 (2%)
 Frame = +2

Query  131  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdyky-kdllqHATGVGKG-SANRSVK  304
            Y E  YEEL+ G + VK  +   RCP+C  KK       +++L+HA+GVG+  S  RS  
Sbjct  378  YAENFYEELKRGIHNVKTSDETFRCPYCPNKKINRDYAYREILEHASGVGQSKSQKRSFI  437

Query  305  QKANHVALAKYLEIDLGDQAEPLPQRAV  388
            +KANH+AL KYL+ DL +   P P + +
Sbjct  438  EKANHLALVKYLKRDLMNVGAPCPSKPM  465


 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 54/75 (72%), Gaps = 2/75 (3%)
 Frame = +2

Query  131  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RSVKQ  307
            Y +  Y+EL+ G YKV   +    CP+C  ++KQDYKY++LL HA+GVG+ S+  R+ K+
Sbjct  20   YVDISYQELKKGSYKVMRSDETFICPYCP-ERKQDYKYRELLNHASGVGRSSSEKRTAKE  78

Query  308  KANHVALAKYLEIDL  352
            KANH+AL KYLE DL
Sbjct  79   KANHLALVKYLEKDL  93


 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 56/81 (69%), Gaps = 1/81 (1%)
 Frame = +2

Query  131  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RSVKQ  307
            Y +K Y+EL+ G + V+  +  L CP+C  K+K+DY Y++LL+HA+GVG+ S+  R V++
Sbjct  251  YVDKFYKELKKGNHIVQTSDQTLSCPYCPRKRKRDYVYRELLEHASGVGQSSSQKRHVRE  310

Query  308  KANHVALAKYLEIDLGDQAEP  370
            K  H+AL KYL+ DL    +P
Sbjct  311  KTTHLALMKYLKNDLKYMNDP  331


 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 52/75 (69%), Gaps = 2/75 (3%)
 Frame = +2

Query  131  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RSVKQ  307
            Y +  YEEL++  + VK  +    CP+C  ++KQDY Y++LL+HA  VG+ S+  RS ++
Sbjct  136  YVDTSYEELKNRSHNVKTSDVTFICPYCP-RRKQDYLYRELLEHAYMVGRSSSEKRSARE  194

Query  308  KANHVALAKYLEIDL  352
            +ANH+AL KYLE DL
Sbjct  195  RANHLALVKYLENDL  209



>ref|XP_006575506.1| PREDICTED: uncharacterized protein LOC100806426 isoform X4 [Glycine 
max]
Length=1037

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 66/111 (59%), Gaps = 7/111 (6%)
 Frame = +2

Query  131  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdyky-kdllqHATGVGKGSA-NRSVK  304
            Y  K YE L+ G + VK       CP+C  KK++     +++L+HA+GVG+ S+  RS  
Sbjct  419  YVHKSYEALKKGSHNVKTSEMTFSCPYCPNKKRKRDYLYREILEHASGVGQSSSEKRSAI  478

Query  305  QKANHVALAKYLEIDLGDQAEPLPQRAV--APEDN--NLYCWPWTGIVVNV  445
            +KANH+AL KYLE DL     P P+ A   +P  N    + WPWTG+VVN+
Sbjct  479  EKANHLALIKYLEKDLMIVDGP-PKTADEGSPPFNFEKQFVWPWTGVVVNI  528


 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 53/88 (60%), Gaps = 2/88 (2%)
 Frame = +2

Query  131  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdyky-kdllqHATGVGKG-SANRSVK  304
            Y E  YEEL+ G + VK  +   RCP+C  KK       +++L+HA+GVG+  S  RS  
Sbjct  299  YAENFYEELKRGIHNVKTSDETFRCPYCPNKKINRDYAYREILEHASGVGQSKSQKRSFI  358

Query  305  QKANHVALAKYLEIDLGDQAEPLPQRAV  388
            +KANH+AL KYL+ DL +   P P + +
Sbjct  359  EKANHLALVKYLKRDLMNVGAPCPSKPM  386


 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 56/81 (69%), Gaps = 1/81 (1%)
 Frame = +2

Query  131  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RSVKQ  307
            Y +K Y+EL+ G + V+  +  L CP+C  K+K+DY Y++LL+HA+GVG+ S+  R V++
Sbjct  135  YVDKFYKELKKGNHIVQTSDQTLSCPYCPRKRKRDYVYRELLEHASGVGQSSSQKRHVRE  194

Query  308  KANHVALAKYLEIDLGDQAEP  370
            K  H+AL KYL+ DL    +P
Sbjct  195  KTTHLALMKYLKNDLKYMNDP  215


 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 52/75 (69%), Gaps = 2/75 (3%)
 Frame = +2

Query  131  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSA-NRSVKQ  307
            Y +  YEEL++  + VK  +    CP+C  ++KQDY Y++LL+HA  VG+ S+  RS ++
Sbjct  20   YVDTSYEELKNRSHNVKTSDVTFICPYCP-RRKQDYLYRELLEHAYMVGRSSSEKRSARE  78

Query  308  KANHVALAKYLEIDL  352
            +ANH+AL KYLE DL
Sbjct  79   RANHLALVKYLENDL  93



>ref|XP_006575505.1| PREDICTED: uncharacterized protein LOC100806426 isoform X3 [Glycine 
max]
Length=1076

 Score = 67.4 bits (163),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 66/111 (59%), Gaps = 7/111 (6%)
 Frame = +2

Query  131  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdyky-kdllqHATGVGKGSA-NRSVK  304
            Y  K YE L+ G + VK       CP+C  KK++     +++L+HA+GVG+ S+  RS  
Sbjct  535  YVHKSYEALKKGSHNVKTSEMTFSCPYCPNKKRKRDYLYREILEHASGVGQSSSEKRSAI  594

Query  305  QKANHVALAKYLEIDLGDQAEPLPQRAV--APEDN--NLYCWPWTGIVVNV  445
            +KANH+AL KYLE DL     P P+ A   +P  N    + WPWTG+VVN+
Sbjct  595  EKANHLALIKYLEKDLMIVDGP-PKTADEGSPPFNFEKQFVWPWTGVVVNI  644


 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 53/88 (60%), Gaps = 2/88 (2%)
 Frame = +2

Query  131  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdyky-kdllqHATGVGKG-SANRSVK  304
            Y E  YEEL+ G + VK  +   RCP+C  KK       +++L+HA+GVG+  S  RS  
Sbjct  415  YAENFYEELKRGIHNVKTSDETFRCPYCPNKKINRDYAYREILEHASGVGQSKSQKRSFI  474

Query  305  QKANHVALAKYLEIDLGDQAEPLPQRAV  388
            +KANH+AL KYL+ DL +   P P + +
Sbjct  475  EKANHLALVKYLKRDLMNVGAPCPSKPM  502


 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 54/75 (72%), Gaps = 2/75 (3%)
 Frame = +2

Query  131  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSA-NRSVKQ  307
            Y +  Y+EL+ G YKV   +    CP+C  ++KQDYKY++LL HA+GVG+ S+  R+ K+
Sbjct  20   YVDISYQELKKGSYKVMRSDETFICPYCP-ERKQDYKYRELLNHASGVGRSSSEKRTAKE  78

Query  308  KANHVALAKYLEIDL  352
            KANH+AL KYLE DL
Sbjct  79   KANHLALVKYLEKDL  93


 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 56/81 (69%), Gaps = 1/81 (1%)
 Frame = +2

Query  131  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RSVKQ  307
            Y +K Y+EL+ G + V+  +  L CP+C  K+K+DY Y++LL+HA+GVG+ S+  R V++
Sbjct  251  YVDKFYKELKKGNHIVQTSDQTLSCPYCPRKRKRDYVYRELLEHASGVGQSSSQKRHVRE  310

Query  308  KANHVALAKYLEIDLGDQAEP  370
            K  H+AL KYL+ DL    +P
Sbjct  311  KTTHLALMKYLKNDLKYMNDP  331


 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 52/75 (69%), Gaps = 2/75 (3%)
 Frame = +2

Query  131  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSA-NRSVKQ  307
            Y +  YEEL++  + VK  +    CP+C  ++KQDY Y++LL+HA  VG+ S+  RS ++
Sbjct  136  YVDTSYEELKNRSHNVKTSDVTFICPYCP-RRKQDYLYRELLEHAYMVGRSSSEKRSARE  194

Query  308  KANHVALAKYLEIDL  352
            +ANH+AL KYLE DL
Sbjct  195  RANHLALVKYLENDL  209



>ref|XP_006575503.1| PREDICTED: uncharacterized protein LOC100806426 isoform X1 [Glycine 
max]
 ref|XP_006575504.1| PREDICTED: uncharacterized protein LOC100806426 isoform X2 [Glycine 
max]
Length=1153

 Score = 67.4 bits (163),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 66/111 (59%), Gaps = 7/111 (6%)
 Frame = +2

Query  131  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdyky-kdllqHATGVGKGSA-NRSVK  304
            Y  K YE L+ G + VK       CP+C  KK++     +++L+HA+GVG+ S+  RS  
Sbjct  535  YVHKSYEALKKGSHNVKTSEMTFSCPYCPNKKRKRDYLYREILEHASGVGQSSSEKRSAI  594

Query  305  QKANHVALAKYLEIDLGDQAEPLPQRAV--APEDN--NLYCWPWTGIVVNV  445
            +KANH+AL KYLE DL     P P+ A   +P  N    + WPWTG+VVN+
Sbjct  595  EKANHLALIKYLEKDLMIVDGP-PKTADEGSPPFNFEKQFVWPWTGVVVNI  644


 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 53/88 (60%), Gaps = 2/88 (2%)
 Frame = +2

Query  131  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdyky-kdllqHATGVGKG-SANRSVK  304
            Y E  YEEL+ G + VK  +   RCP+C  KK       +++L+HA+GVG+  S  RS  
Sbjct  415  YAENFYEELKRGIHNVKTSDETFRCPYCPNKKINRDYAYREILEHASGVGQSKSQKRSFI  474

Query  305  QKANHVALAKYLEIDLGDQAEPLPQRAV  388
            +KANH+AL KYL+ DL +   P P + +
Sbjct  475  EKANHLALVKYLKRDLMNVGAPCPSKPM  502


 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 54/75 (72%), Gaps = 2/75 (3%)
 Frame = +2

Query  131  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSA-NRSVKQ  307
            Y +  Y+EL+ G YKV   +    CP+C  ++KQDYKY++LL HA+GVG+ S+  R+ K+
Sbjct  20   YVDISYQELKKGSYKVMRSDETFICPYCP-ERKQDYKYRELLNHASGVGRSSSEKRTAKE  78

Query  308  KANHVALAKYLEIDL  352
            KANH+AL KYLE DL
Sbjct  79   KANHLALVKYLEKDL  93


 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 56/81 (69%), Gaps = 1/81 (1%)
 Frame = +2

Query  131  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RSVKQ  307
            Y +K Y+EL+ G + V+  +  L CP+C  K+K+DY Y++LL+HA+GVG+ S+  R V++
Sbjct  251  YVDKFYKELKKGNHIVQTSDQTLSCPYCPRKRKRDYVYRELLEHASGVGQSSSQKRHVRE  310

Query  308  KANHVALAKYLEIDLGDQAEP  370
            K  H+AL KYL+ DL    +P
Sbjct  311  KTTHLALMKYLKNDLKYMNDP  331


 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 52/75 (69%), Gaps = 2/75 (3%)
 Frame = +2

Query  131  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSA-NRSVKQ  307
            Y +  YEEL++  + VK  +    CP+C  ++KQDY Y++LL+HA  VG+ S+  RS ++
Sbjct  136  YVDTSYEELKNRSHNVKTSDVTFICPYCP-RRKQDYLYRELLEHAYMVGRSSSEKRSARE  194

Query  308  KANHVALAKYLEIDL  352
            +ANH+AL KYLE DL
Sbjct  195  RANHLALVKYLENDL  209



>ref|XP_003616411.1| Transcription factor X1-like protein [Medicago truncatula]
 gb|AES99369.1| XH/XS domain protein [Medicago truncatula]
Length=1122

 Score = 67.4 bits (163),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 52/126 (41%), Positives = 65/126 (52%), Gaps = 25/126 (20%)
 Frame = +2

Query  140  KPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANR-SVKQKAN  316
            K Y EL+ G +KVK       CP+C  K+K DY+Y +LL HA GVG+  A R SV +KAN
Sbjct  490  KSYAELKKGVHKVKTSEDTFSCPYCP-KRKCDYRYSELLNHALGVGQSDAQRRSVLEKAN  548

Query  317  HVALAKYLEIDLGDQAEPLP----------------QRAVAPEDNNL-------YCWPWT  427
            H+AL KYLE DL       P                Q    P + N+       + WPWT
Sbjct  549  HLALVKYLEKDLMTMNVERPLKPANKYLENNLMNVEQNRTKPVNENILVNSERQFVWPWT  608

Query  428  GIVVNV  445
            GIVVN+
Sbjct  609  GIVVNI  614


 Score = 58.5 bits (140),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 55/82 (67%), Gaps = 5/82 (6%)
 Frame = +2

Query  146  YEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSA-NRSVKQKANHV  322
            YEEL++GK KVK       CP+C  ++KQDYK  +LL HATG+G+ S+  RS K+K +H+
Sbjct  25   YEELKTGKQKVKTSAETFSCPYCP-ERKQDYKLNELLNHATGIGRSSSEKRSAKEKGSHL  83

Query  323  ALAKYLEIDLGDQ---AEPLPQ  379
            AL KYLE DL  +   + P+ Q
Sbjct  84   ALVKYLEQDLNSKDGASRPIDQ  105


 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 41/111 (37%), Positives = 67/111 (60%), Gaps = 10/111 (9%)
 Frame = +2

Query  131  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RSVKQ  307
            Y +K Y+EL++   KV+  +    CP+C   KK DY Y+++L+HA+GVG+ S+  RSV++
Sbjct  247  YVDKLYQELKNRSLKVRISDDAFTCPYCPKMKKPDYVYREILEHASGVGQSSSQKRSVRE  306

Query  308  KANHVALAKYLEIDLGDQAEPLPQRAVAPEDNNLYCWPWTGIVVNVSKDNA  460
            KA H+AL KYL+ D+     P P + V   D+       +G ++   ++NA
Sbjct  307  KATHLALMKYLKQDII--YVPAPSKPVTEGDS-------SGAMIQSREENA  348


 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 47/81 (58%), Gaps = 2/81 (2%)
 Frame = +2

Query  131  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSA-NRSVKQ  307
            Y +  YEEL++G   VK  +G   CP+C  +K+     + L  HA  VG+ S+  RS ++
Sbjct  131  YVDTAYEELKNGTRNVKTSDGTFICPYCPNRKQDYLYRELLE-HAFMVGRSSSEKRSARE  189

Query  308  KANHVALAKYLEIDLGDQAEP  370
            +ANH+AL KYLE D+     P
Sbjct  190  RANHLALLKYLEKDITSMPGP  210



>ref|XP_004490889.1| PREDICTED: uncharacterized protein LOC101499007 isoform X1 [Cicer 
arietinum]
 ref|XP_004490890.1| PREDICTED: uncharacterized protein LOC101499007 isoform X2 [Cicer 
arietinum]
 ref|XP_004490891.1| PREDICTED: uncharacterized protein LOC101499007 isoform X3 [Cicer 
arietinum]
Length=1122

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 51/124 (41%), Positives = 65/124 (52%), Gaps = 23/124 (19%)
 Frame = +2

Query  140  KPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANR-SVKQKAN  316
            K YEEL+ G  KVK       CP+C  K+K DYKY +LL HA GVG+  A R SV +KAN
Sbjct  490  KSYEELKKGSLKVKTSEETFACPYCP-KRKWDYKYNELLNHALGVGQSDAQRRSVLEKAN  548

Query  317  HVALAKYLEIDLGDQ---------------------AEPLPQRAVAPEDNNLYCWPWTGI  433
            H+AL KYL+ DL +                       +P  +  +     N + WPWTGI
Sbjct  549  HLALVKYLKKDLMNMEYRIKPVNKYLEKDLMNVEHPTKPTNKGRLLVSSENQFVWPWTGI  608

Query  434  VVNV  445
            VVN+
Sbjct  609  VVNI  612


 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 53/76 (70%), Gaps = 2/76 (3%)
 Frame = +2

Query  146  YEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RSVKQKANHV  322
            YEEL+ G++KVK       CP+C  ++K DYKY +LL HATGVG+ S++ RS K+K +H+
Sbjct  25   YEELKQGRHKVKTSAETFTCPYCP-ERKHDYKYNELLNHATGVGRSSSDKRSAKEKGSHL  83

Query  323  ALAKYLEIDLGDQAEP  370
            AL KYLE DL  +  P
Sbjct  84   ALVKYLEEDLPSKDSP  99


 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 54/88 (61%), Gaps = 5/88 (6%)
 Frame = +2

Query  140  KPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdyky-kdllqHATGVG-KGSANRSVKQKA  313
            K YE+L+ G   VK  +    CP+C  KK++     +++L+HA+GVG   S NRS  +KA
Sbjct  372  KSYEQLKKGIQNVKSSDDTFICPYCPNKKRKRDYAYREILEHASGVGWSSSQNRSAIEKA  431

Query  314  NHVALAKYLEIDL---GDQAEPLPQRAV  388
            NH+AL KYL+ DL   G  +EP+ +  +
Sbjct  432  NHLALVKYLKKDLINVGGSSEPMDEGTI  459


 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 51/75 (68%), Gaps = 1/75 (1%)
 Frame = +2

Query  131  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKG-SANRSVKQ  307
            Y +K Y+EL+ G   V+  +    CP+C   +K  Y+Y++LL+HA+GVG+  S  RSV++
Sbjct  249  YVDKFYKELKKGSLNVRISDAAFTCPYCPKMRKPTYEYRELLEHASGVGQSCSQKRSVRE  308

Query  308  KANHVALAKYLEIDL  352
            KA H+AL KYL+ D+
Sbjct  309  KATHLALVKYLKNDI  323


 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 68/123 (55%), Gaps = 6/123 (5%)
 Frame = +2

Query  131  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RSVKQ  307
            Y +  YEEL++G    K  +G   CP+C  K+KQDY Y++LL+HA  VG+ S+  RS ++
Sbjct  131  YVDTAYEELKNGTQNAKTSDGNFICPYCP-KRKQDYAYRELLEHAFMVGRSSSEKRSARE  189

Query  308  KANHVALAKYLEIDLGDQAEPLPQRAVAPEDNNLYCWPWTGIVVNVSKDNANGTAVEEED  487
            +ANH+AL KYLE D+   + P P + V  +  NL     T + V     N +    E + 
Sbjct  190  RANHLALLKYLEKDVV--SMPGPSKPV-EKGTNLISQEQT-VTVTAHNSNKDTDTSESQI  245

Query  488  YWL  496
             W 
Sbjct  246  SWF  248



>emb|CDY35048.1| BnaA06g10580D [Brassica napus]
Length=598

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 40/87 (46%), Positives = 54/87 (62%), Gaps = 8/87 (9%)
 Frame = +2

Query  260  HATGVGKGSANRSVKQKANHVALAKYLEIDLGDQAEPLPQRAVAPEDNN--------LYC  415
            HA+GV KGSA+RS KQKANH+ALA+YL+ +L   AEPLP+    P   N        +Y 
Sbjct  3    HASGVSKGSASRSAKQKANHLALARYLQNELAGDAEPLPRPPPVPPQLNESEAKPGEVYV  62

Query  416  WPWTGIVVNVSKDNANGTAVEEEDYWL  496
            WPW GI+V+  K+  +  A+ +   WL
Sbjct  63   WPWMGIIVSPLKETDDKEALLDSACWL  89



>gb|EMT16668.1| hypothetical protein F775_11900 [Aegilops tauschii]
Length=674

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 62/116 (53%), Gaps = 12/116 (10%)
 Frame = +2

Query  125  NEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVK  304
            ++Y +K Y +L+SG+   +      RCPFC GK+   Y       HA GVG  ++N + +
Sbjct  21   HDYADKAYTDLKSGRLVARFGADRFRCPFCPGKEDYRYNELLQ--HAIGVG--ASNHAAE  76

Query  305  QKANHVALAKYLEIDLGDQAEPLPQRA----VAP----EDNNLYCWPWTGIVVNVS  448
             K NH+ALA +L+ D  + A  LP R     + P    +D  L+ WPW  I+ NV+
Sbjct  77   VKTNHLALANHLKTDYANAAGSLPPRQDEALMNPPRPVQDQELFVWPWMRILANVA  132



>gb|EPS61376.1| hypothetical protein M569_13419, partial [Genlisea aurea]
Length=626

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 49/116 (42%), Positives = 77/116 (66%), Gaps = 6/116 (5%)
 Frame = +2

Query  146  YEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVG-KGSANRSVKQKANHV  322
            YEE+++GK+ V+  +    CPFC+ K+K+D++YKDLLQHA+ +G +GS  RS  +KA+H+
Sbjct  18   YEEMKNGKHMVRVSDEAFSCPFCSKKRKRDFQYKDLLQHASAIGTQGSQKRSSLEKASHL  77

Query  323  ALAKYLEIDL-GDQAEPLPQ---RAVAPED-NNLYCWPWTGIVVNVSKDNANGTAV  475
            AL KYL+ ++  D   P P     A+A +D   ++ WPW GI+VN+  +  +G  V
Sbjct  78   ALLKYLQNEIAADNGAPKPSLETDALADQDREEMFVWPWIGIIVNIPTEFKDGRFV  133



>ref|XP_010520107.1| PREDICTED: protein INVOLVED IN DE NOVO 2-like [Tarenaya hassleriana]
 ref|XP_010520108.1| PREDICTED: protein INVOLVED IN DE NOVO 2-like [Tarenaya hassleriana]
 ref|XP_010520109.1| PREDICTED: protein INVOLVED IN DE NOVO 2-like [Tarenaya hassleriana]
Length=645

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 55/110 (50%), Positives = 64/110 (58%), Gaps = 10/110 (9%)
 Frame = +2

Query  140  KPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKG-SANRSVKQKAN  316
            K YE+L+ GK  VK       CP+C  KKK  Y+YKDLLQHA+GVG   S  RSVK+KA+
Sbjct  30   KIYEKLKGGKPVVKVSPQDFVCPYCPKKKKSSYQYKDLLQHASGVGNSNSEKRSVKEKAS  89

Query  317  HVALAKYLEIDLGDQAEPLPQRAVAPEDNNLYC-------WPWTGIVVNV  445
            H+ALAKYL  DL D     P  AV   D    C        PW GIVVN+
Sbjct  90   HLALAKYLGKDLADSTT--PSTAVKSSDPLQGCDHYEKLVSPWKGIVVNI  137



>ref|XP_010685748.1| PREDICTED: factor of DNA methylation 4 [Beta vulgaris subsp. 
vulgaris]
Length=622

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 43/122 (35%), Positives = 64/122 (52%), Gaps = 4/122 (3%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            +++Y    YE L+   YKV+      RCPFC  ++++DY + D++QHA  VGKGS    +
Sbjct  13   LDDYVVDVYERLKDRVYKVRVSTNRFRCPFCGERERKDYLFDDIVQHARRVGKGSRRDGL  72

Query  302  KQKANHVALAKYLEIDLGDQAEPLPQR----AVAPEDNNLYCWPWTGIVVNVSKDNANGT  469
            K K  H+AL K+L      +    P R     V   D+  + WPW GIV N+  +  +G 
Sbjct  73   KLKGKHIALEKFLLKYYSPRVSSGPSRQSISQVNRNDDEKFVWPWKGIVANIPVELKDGR  132

Query  470  AV  475
             V
Sbjct  133  YV  134



>ref|XP_006584160.1| PREDICTED: aquaporin NIP3-3-like [Glycine max]
Length=269

 Score = 63.2 bits (152),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 43/64 (67%), Gaps = 1/64 (2%)
 Frame = +2

Query  260  HATGVGKGSANRSVKQKANHVALAKYLEIDLGDQAEPLPQRAVAPEDNNLYCWPWTGIVV  439
            HA+GVGK SANRS +QKANH+AL KYLE DL  +AEP+ QR   P+    +     G+ +
Sbjct  60   HASGVGKSSANRSAQQKANHLALGKYLETDLACEAEPI-QRPALPQAFTYHLKINKGMDI  118

Query  440  NVSK  451
            N+ K
Sbjct  119  NLIK  122



>ref|NP_001054677.1| Os05g0153200 [Oryza sativa Japonica Group]
 gb|AAU44158.1| putative transcription factor [Oryza sativa Japonica Group]
 dbj|BAF16591.1| Os05g0153200 [Oryza sativa Japonica Group]
Length=617

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 56/105 (53%), Gaps = 3/105 (3%)
 Frame = +2

Query  131  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVKQK  310
            Y    Y  L +G  KV       +CPFC+ +K     +  L  HA  VG  + +R  K+K
Sbjct  14   YGSDTYALLEAGDIKVMNDKNMYQCPFCSDEKNDYNAHGLLQ-HALAVG-SADDRPAKEK  71

Query  311  ANHVALAKYLEIDLGDQAEPLPQRAVAPEDNNLYCWPWTGIVVNV  445
            ANH ALA +L+ D  + + PL Q     + N+L+ WPW GI+VN+
Sbjct  72   ANHRALALHLKDDTAESSRPLSQPPQHSK-NDLFVWPWMGIIVNM  115



>gb|EAY96594.1| hypothetical protein OsI_18500 [Oryza sativa Indica Group]
Length=617

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 56/105 (53%), Gaps = 3/105 (3%)
 Frame = +2

Query  131  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVKQK  310
            Y    Y  L +G  KV       +CPFC+ +K     +  L  HA  VG  + +R  K+K
Sbjct  14   YGSDTYALLEAGDIKVMNDKNMYQCPFCSDEKNDYNAHGLLQ-HALAVG-SADDRPAKEK  71

Query  311  ANHVALAKYLEIDLGDQAEPLPQRAVAPEDNNLYCWPWTGIVVNV  445
            ANH ALA +L+ D  + + PL Q     + N+L+ WPW GI+VN+
Sbjct  72   ANHRALALHLKDDTAESSRPLSQPPQHSK-NDLFVWPWMGIIVNM  115



>ref|XP_009610603.1| PREDICTED: uncharacterized protein LOC104104271 isoform X1 [Nicotiana 
tomentosiformis]
Length=1201

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 53/83 (64%), Gaps = 1/83 (1%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            I +YKEK YEELR G    K  +    CP+C  K  +   Y+DLLQHA+G+GK S  R+ 
Sbjct  16   IEDYKEKSYEELRCGNQSFKISDVAYTCPYCQEKSGRHLFYEDLLQHASGIGK-SKIRTA  74

Query  302  KQKANHVALAKYLEIDLGDQAEP  370
            + +ANH+ALAKYLE D+   A P
Sbjct  75   RDRANHLALAKYLENDVAGAAIP  97


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 65/123 (53%), Gaps = 10/123 (8%)
 Frame = +2

Query  143  PYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RSVKQKANH  319
            PYE+L+SG Y +  P       +C  K+K+++ YKDL+ H   VG  S+N R+   KANH
Sbjct  577  PYEKLKSGNYSLNIPAVAYTFAYCPKKRKREFMYKDLMFHVREVGSCSSNKRTAIDKANH  636

Query  320  VALAKYLEIDLGDQAEPL-PQRAVAPEDNNL--------YCWPWTGIVVNVSKDNANGTA  472
            + LAKY E D+   A P  P     P+ + L        + WPW  +VVN+  +  +G  
Sbjct  637  LTLAKYFENDVALAASPSKPDTLGDPQVDTLLDYDRAEMFVWPWIAVVVNLPTEFKDGRY  696

Query  473  VEE  481
            V E
Sbjct  697  VGE  699


 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 46/76 (61%), Gaps = 1/76 (1%)
 Frame = +2

Query  140  KPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKG-SANRSVKQKAN  316
            K YE+ RSG +  K  N    CP+C   +++ + YKDLLQHA G+G   S  R+ + K N
Sbjct  178  KYYEDSRSGNHSPKISNMAFACPYCPETRERVFSYKDLLQHANGIGSSNSLKRTARDKVN  237

Query  317  HVALAKYLEIDLGDQA  364
            H+ALAK LE D+   A
Sbjct  238  HLALAKRLEKDVAGSA  253



>ref|XP_009791219.1| PREDICTED: uncharacterized protein LOC104238532 isoform X5 [Nicotiana 
sylvestris]
Length=962

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 53/83 (64%), Gaps = 1/83 (1%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            I +YKEK YEELR G    K  +    CP+C  K  +   Y+DLLQHA+G+GK S  R+ 
Sbjct  16   IEDYKEKSYEELRCGNQSFKISDVAYTCPYCQEKSGRHLFYEDLLQHASGIGK-SKIRTA  74

Query  302  KQKANHVALAKYLEIDLGDQAEP  370
            + +ANH+ALAKYLE D+   A P
Sbjct  75   RDRANHLALAKYLENDVAGAAIP  97


 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 65/123 (53%), Gaps = 10/123 (8%)
 Frame = +2

Query  143  PYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RSVKQKANH  319
            PYE+L+SG Y +  P       +C  K+K+++ YKDL+ H   VG  S+N R+   KANH
Sbjct  577  PYEKLKSGNYSLNIPAVAYTFAYCPKKRKREFMYKDLMFHVREVGSCSSNKRTAIDKANH  636

Query  320  VALAKYLEIDLGDQAEPL-PQRAVAPEDNNL--------YCWPWTGIVVNVSKDNANGTA  472
            + LAKY E D+   A P  P     P+ + L        + WPW  +VVN+  +  +G  
Sbjct  637  LTLAKYFENDVVLAASPSKPDTLGDPQVDTLADYDRAEIFVWPWIAVVVNLPTEFKDGRY  696

Query  473  VEE  481
            V E
Sbjct  697  VGE  699


 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = +2

Query  140  KPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKG-SANRSVKQKAN  316
            K YE+ RSG + +K  N    CP+C   +++ + YKDLLQHA G+G   S  R+ + KAN
Sbjct  178  KYYEDSRSGNHSLKISNMAFACPYCPETRERVFSYKDLLQHANGIGSSNSLKRTTRDKAN  237

Query  317  HVALAKYLEIDLGDQA  364
            H+ALAK LE D+   A
Sbjct  238  HLALAKRLEKDVAGSA  253



>ref|XP_009610609.1| PREDICTED: uncharacterized protein LOC104104271 isoform X5 [Nicotiana 
tomentosiformis]
Length=962

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 53/83 (64%), Gaps = 1/83 (1%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            I +YKEK YEELR G    K  +    CP+C  K  +   Y+DLLQHA+G+GK S  R+ 
Sbjct  16   IEDYKEKSYEELRCGNQSFKISDVAYTCPYCQEKSGRHLFYEDLLQHASGIGK-SKIRTA  74

Query  302  KQKANHVALAKYLEIDLGDQAEP  370
            + +ANH+ALAKYLE D+   A P
Sbjct  75   RDRANHLALAKYLENDVAGAAIP  97


 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 65/123 (53%), Gaps = 10/123 (8%)
 Frame = +2

Query  143  PYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RSVKQKANH  319
            PYE+L+SG Y +  P       +C  K+K+++ YKDL+ H   VG  S+N R+   KANH
Sbjct  577  PYEKLKSGNYSLNIPAVAYTFAYCPKKRKREFMYKDLMFHVREVGSCSSNKRTAIDKANH  636

Query  320  VALAKYLEIDLGDQAEPL-PQRAVAPEDNNL--------YCWPWTGIVVNVSKDNANGTA  472
            + LAKY E D+   A P  P     P+ + L        + WPW  +VVN+  +  +G  
Sbjct  637  LTLAKYFENDVALAASPSKPDTLGDPQVDTLLDYDRAEMFVWPWIAVVVNLPTEFKDGRY  696

Query  473  VEE  481
            V E
Sbjct  697  VGE  699


 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 46/76 (61%), Gaps = 1/76 (1%)
 Frame = +2

Query  140  KPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKG-SANRSVKQKAN  316
            K YE+ RSG +  K  N    CP+C   +++ + YKDLLQHA G+G   S  R+ + K N
Sbjct  178  KYYEDSRSGNHSPKISNMAFACPYCPETRERVFSYKDLLQHANGIGSSNSLKRTARDKVN  237

Query  317  HVALAKYLEIDLGDQA  364
            H+ALAK LE D+   A
Sbjct  238  HLALAKRLEKDVAGSA  253



>ref|XP_009791212.1| PREDICTED: uncharacterized protein LOC104238532 isoform X2 [Nicotiana 
sylvestris]
Length=1179

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 53/83 (64%), Gaps = 1/83 (1%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            I +YKEK YEELR G    K  +    CP+C  K  +   Y+DLLQHA+G+GK S  R+ 
Sbjct  16   IEDYKEKSYEELRCGNQSFKISDVAYTCPYCQEKSGRHLFYEDLLQHASGIGK-SKIRTA  74

Query  302  KQKANHVALAKYLEIDLGDQAEP  370
            + +ANH+ALAKYLE D+   A P
Sbjct  75   RDRANHLALAKYLENDVAGAAIP  97


 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 65/123 (53%), Gaps = 10/123 (8%)
 Frame = +2

Query  143  PYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RSVKQKANH  319
            PYE+L+SG Y +  P       +C  K+K+++ YKDL+ H   VG  S+N R+   KANH
Sbjct  577  PYEKLKSGNYSLNIPAVAYTFAYCPKKRKREFMYKDLMFHVREVGSCSSNKRTAIDKANH  636

Query  320  VALAKYLEIDLGDQAEPL-PQRAVAPEDNNL--------YCWPWTGIVVNVSKDNANGTA  472
            + LAKY E D+   A P  P     P+ + L        + WPW  +VVN+  +  +G  
Sbjct  637  LTLAKYFENDVVLAASPSKPDTLGDPQVDTLADYDRAEIFVWPWIAVVVNLPTEFKDGRY  696

Query  473  VEE  481
            V E
Sbjct  697  VGE  699


 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = +2

Query  140  KPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKG-SANRSVKQKAN  316
            K YE+ RSG + +K  N    CP+C   +++ + YKDLLQHA G+G   S  R+ + KAN
Sbjct  178  KYYEDSRSGNHSLKISNMAFACPYCPETRERVFSYKDLLQHANGIGSSNSLKRTTRDKAN  237

Query  317  HVALAKYLEIDLGDQA  364
            H+ALAK LE D+   A
Sbjct  238  HLALAKRLEKDVAGSA  253



>ref|XP_009791210.1| PREDICTED: uncharacterized protein LOC104238532 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009791211.1| PREDICTED: uncharacterized protein LOC104238532 isoform X1 [Nicotiana 
sylvestris]
Length=1189

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 53/83 (64%), Gaps = 1/83 (1%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            I +YKEK YEELR G    K  +    CP+C  K  +   Y+DLLQHA+G+GK S  R+ 
Sbjct  16   IEDYKEKSYEELRCGNQSFKISDVAYTCPYCQEKSGRHLFYEDLLQHASGIGK-SKIRTA  74

Query  302  KQKANHVALAKYLEIDLGDQAEP  370
            + +ANH+ALAKYLE D+   A P
Sbjct  75   RDRANHLALAKYLENDVAGAAIP  97


 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 65/123 (53%), Gaps = 10/123 (8%)
 Frame = +2

Query  143  PYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RSVKQKANH  319
            PYE+L+SG Y +  P       +C  K+K+++ YKDL+ H   VG  S+N R+   KANH
Sbjct  577  PYEKLKSGNYSLNIPAVAYTFAYCPKKRKREFMYKDLMFHVREVGSCSSNKRTAIDKANH  636

Query  320  VALAKYLEIDLGDQAEPL-PQRAVAPEDNNL--------YCWPWTGIVVNVSKDNANGTA  472
            + LAKY E D+   A P  P     P+ + L        + WPW  +VVN+  +  +G  
Sbjct  637  LTLAKYFENDVVLAASPSKPDTLGDPQVDTLADYDRAEIFVWPWIAVVVNLPTEFKDGRY  696

Query  473  VEE  481
            V E
Sbjct  697  VGE  699


 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = +2

Query  140  KPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKG-SANRSVKQKAN  316
            K YE+ RSG + +K  N    CP+C   +++ + YKDLLQHA G+G   S  R+ + KAN
Sbjct  178  KYYEDSRSGNHSLKISNMAFACPYCPETRERVFSYKDLLQHANGIGSSNSLKRTTRDKAN  237

Query  317  HVALAKYLEIDLGDQA  364
            H+ALAK LE D+   A
Sbjct  238  HLALAKRLEKDVAGSA  253



>ref|XP_009610604.1| PREDICTED: uncharacterized protein LOC104104271 isoform X2 [Nicotiana 
tomentosiformis]
 ref|XP_009610605.1| PREDICTED: uncharacterized protein LOC104104271 isoform X2 [Nicotiana 
tomentosiformis]
Length=1189

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 53/83 (64%), Gaps = 1/83 (1%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            I +YKEK YEELR G    K  +    CP+C  K  +   Y+DLLQHA+G+GK S  R+ 
Sbjct  16   IEDYKEKSYEELRCGNQSFKISDVAYTCPYCQEKSGRHLFYEDLLQHASGIGK-SKIRTA  74

Query  302  KQKANHVALAKYLEIDLGDQAEP  370
            + +ANH+ALAKYLE D+   A P
Sbjct  75   RDRANHLALAKYLENDVAGAAIP  97


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 65/123 (53%), Gaps = 10/123 (8%)
 Frame = +2

Query  143  PYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RSVKQKANH  319
            PYE+L+SG Y +  P       +C  K+K+++ YKDL+ H   VG  S+N R+   KANH
Sbjct  577  PYEKLKSGNYSLNIPAVAYTFAYCPKKRKREFMYKDLMFHVREVGSCSSNKRTAIDKANH  636

Query  320  VALAKYLEIDLGDQAEPL-PQRAVAPEDNNL--------YCWPWTGIVVNVSKDNANGTA  472
            + LAKY E D+   A P  P     P+ + L        + WPW  +VVN+  +  +G  
Sbjct  637  LTLAKYFENDVALAASPSKPDTLGDPQVDTLLDYDRAEMFVWPWIAVVVNLPTEFKDGRY  696

Query  473  VEE  481
            V E
Sbjct  697  VGE  699


 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 46/76 (61%), Gaps = 1/76 (1%)
 Frame = +2

Query  140  KPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKG-SANRSVKQKAN  316
            K YE+ RSG +  K  N    CP+C   +++ + YKDLLQHA G+G   S  R+ + K N
Sbjct  178  KYYEDSRSGNHSPKISNMAFACPYCPETRERVFSYKDLLQHANGIGSSNSLKRTARDKVN  237

Query  317  HVALAKYLEIDLGDQA  364
            H+ALAK LE D+   A
Sbjct  238  HLALAKRLEKDVAGSA  253



>ref|XP_009791213.1| PREDICTED: uncharacterized protein LOC104238532 isoform X3 [Nicotiana 
sylvestris]
 ref|XP_009791214.1| PREDICTED: uncharacterized protein LOC104238532 isoform X3 [Nicotiana 
sylvestris]
 ref|XP_009791215.1| PREDICTED: uncharacterized protein LOC104238532 isoform X3 [Nicotiana 
sylvestris]
 ref|XP_009791216.1| PREDICTED: uncharacterized protein LOC104238532 isoform X3 [Nicotiana 
sylvestris]
 ref|XP_009791217.1| PREDICTED: uncharacterized protein LOC104238532 isoform X3 [Nicotiana 
sylvestris]
Length=1176

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 53/83 (64%), Gaps = 1/83 (1%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            I +YKEK YEELR G    K  +    CP+C  K  +   Y+DLLQHA+G+GK S  R+ 
Sbjct  16   IEDYKEKSYEELRCGNQSFKISDVAYTCPYCQEKSGRHLFYEDLLQHASGIGK-SKIRTA  74

Query  302  KQKANHVALAKYLEIDLGDQAEP  370
            + +ANH+ALAKYLE D+   A P
Sbjct  75   RDRANHLALAKYLENDVAGAAIP  97


 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 65/123 (53%), Gaps = 10/123 (8%)
 Frame = +2

Query  143  PYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RSVKQKANH  319
            PYE+L+SG Y +  P       +C  K+K+++ YKDL+ H   VG  S+N R+   KANH
Sbjct  577  PYEKLKSGNYSLNIPAVAYTFAYCPKKRKREFMYKDLMFHVREVGSCSSNKRTAIDKANH  636

Query  320  VALAKYLEIDLGDQAEPL-PQRAVAPEDNNL--------YCWPWTGIVVNVSKDNANGTA  472
            + LAKY E D+   A P  P     P+ + L        + WPW  +VVN+  +  +G  
Sbjct  637  LTLAKYFENDVVLAASPSKPDTLGDPQVDTLADYDRAEIFVWPWIAVVVNLPTEFKDGRY  696

Query  473  VEE  481
            V E
Sbjct  697  VGE  699


 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = +2

Query  140  KPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKG-SANRSVKQKAN  316
            K YE+ RSG + +K  N    CP+C   +++ + YKDLLQHA G+G   S  R+ + KAN
Sbjct  178  KYYEDSRSGNHSLKISNMAFACPYCPETRERVFSYKDLLQHANGIGSSNSLKRTTRDKAN  237

Query  317  HVALAKYLEIDLGDQA  364
            H+ALAK LE D+   A
Sbjct  238  HLALAKRLEKDVAGSA  253



>gb|KHN12113.1| hypothetical protein glysoja_048283 [Glycine soja]
Length=236

 Score = 62.0 bits (149),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 36/46 (78%), Gaps = 1/46 (2%)
 Frame = +2

Query  260  HATGVGKGSANRSVKQKANHVALAKYLEIDLGDQAEPLPQRAVAPE  397
            HA+GVGK SANRS +QKANH+AL KYLE DL  +AEP+ QR   P+
Sbjct  20   HASGVGKSSANRSAQQKANHLALGKYLETDLACEAEPI-QRPALPQ  64



>ref|XP_009610608.1| PREDICTED: uncharacterized protein LOC104104271 isoform X4 [Nicotiana 
tomentosiformis]
Length=1167

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 53/83 (64%), Gaps = 1/83 (1%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            I +YKEK YEELR G    K  +    CP+C  K  +   Y+DLLQHA+G+GK S  R+ 
Sbjct  16   IEDYKEKSYEELRCGNQSFKISDVAYTCPYCQEKSGRHLFYEDLLQHASGIGK-SKIRTA  74

Query  302  KQKANHVALAKYLEIDLGDQAEP  370
            + +ANH+ALAKYLE D+   A P
Sbjct  75   RDRANHLALAKYLENDVAGAAIP  97


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 65/123 (53%), Gaps = 10/123 (8%)
 Frame = +2

Query  143  PYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RSVKQKANH  319
            PYE+L+SG Y +  P       +C  K+K+++ YKDL+ H   VG  S+N R+   KANH
Sbjct  577  PYEKLKSGNYSLNIPAVAYTFAYCPKKRKREFMYKDLMFHVREVGSCSSNKRTAIDKANH  636

Query  320  VALAKYLEIDLGDQAEPL-PQRAVAPEDNNL--------YCWPWTGIVVNVSKDNANGTA  472
            + LAKY E D+   A P  P     P+ + L        + WPW  +VVN+  +  +G  
Sbjct  637  LTLAKYFENDVALAASPSKPDTLGDPQVDTLLDYDRAEMFVWPWIAVVVNLPTEFKDGRY  696

Query  473  VEE  481
            V E
Sbjct  697  VGE  699


 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 46/76 (61%), Gaps = 1/76 (1%)
 Frame = +2

Query  140  KPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKG-SANRSVKQKAN  316
            K YE+ RSG +  K  N    CP+C   +++ + YKDLLQHA G+G   S  R+ + K N
Sbjct  178  KYYEDSRSGNHSPKISNMAFACPYCPETRERVFSYKDLLQHANGIGSSNSLKRTARDKVN  237

Query  317  HVALAKYLEIDLGDQA  364
            H+ALAK LE D+   A
Sbjct  238  HLALAKRLEKDVAGSA  253



>ref|XP_006424841.1| hypothetical protein CICLE_v10029911mg [Citrus clementina]
 gb|ESR38081.1| hypothetical protein CICLE_v10029911mg [Citrus clementina]
Length=732

 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 46/116 (40%), Positives = 67/116 (58%), Gaps = 9/116 (8%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            + +Y+ K Y +L+ G  KV+      RCPFC GKK+ DY YK+LLQHA+ VG+ S +R  
Sbjct  117  LKDYEYKKYNQLKKGDLKVEVSETAYRCPFCRGKKETDYLYKELLQHASDVGR-SRSRGA  175

Query  302  KQKANHVAL----AKYLEIDLGDQAEPLPQ----RAVAPEDNNLYCWPWTGIVVNV  445
            ++KA H+AL    +KYL +    Q EP       +    + + L  +PW GIV N+
Sbjct  176  REKAQHLALEKYVSKYLVVKDRSQLEPGTSSECLKITDHQPDQLLVYPWVGIVANI  231



>ref|XP_009791218.1| PREDICTED: uncharacterized protein LOC104238532 isoform X4 [Nicotiana 
sylvestris]
Length=1167

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 53/83 (64%), Gaps = 1/83 (1%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            I +YKEK YEELR G    K  +    CP+C  K  +   Y+DLLQHA+G+GK S  R+ 
Sbjct  16   IEDYKEKSYEELRCGNQSFKISDVAYTCPYCQEKSGRHLFYEDLLQHASGIGK-SKIRTA  74

Query  302  KQKANHVALAKYLEIDLGDQAEP  370
            + +ANH+ALAKYLE D+   A P
Sbjct  75   RDRANHLALAKYLENDVAGAAIP  97


 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 65/123 (53%), Gaps = 10/123 (8%)
 Frame = +2

Query  143  PYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RSVKQKANH  319
            PYE+L+SG Y +  P       +C  K+K+++ YKDL+ H   VG  S+N R+   KANH
Sbjct  577  PYEKLKSGNYSLNIPAVAYTFAYCPKKRKREFMYKDLMFHVREVGSCSSNKRTAIDKANH  636

Query  320  VALAKYLEIDLGDQAEPL-PQRAVAPEDNNL--------YCWPWTGIVVNVSKDNANGTA  472
            + LAKY E D+   A P  P     P+ + L        + WPW  +VVN+  +  +G  
Sbjct  637  LTLAKYFENDVVLAASPSKPDTLGDPQVDTLADYDRAEIFVWPWIAVVVNLPTEFKDGRY  696

Query  473  VEE  481
            V E
Sbjct  697  VGE  699


 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = +2

Query  140  KPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKG-SANRSVKQKAN  316
            K YE+ RSG + +K  N    CP+C   +++ + YKDLLQHA G+G   S  R+ + KAN
Sbjct  178  KYYEDSRSGNHSLKISNMAFACPYCPETRERVFSYKDLLQHANGIGSSNSLKRTTRDKAN  237

Query  317  HVALAKYLEIDLGDQA  364
            H+ALAK LE D+   A
Sbjct  238  HLALAKRLEKDVAGSA  253



>ref|XP_008660210.1| PREDICTED: uncharacterized protein LOC103639218 isoform X1 [Zea 
mays]
Length=415

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 39/74 (53%), Positives = 54/74 (73%), Gaps = 1/74 (1%)
 Frame = +2

Query  131  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV-KQ  307
            Y+EK +  L+SGK++V+ P+G  RCPFC GKKKQ YK KDLLQHA G+G  S +R   ++
Sbjct  35   YEEKSFGLLKSGKHRVRNPDGTFRCPFCLGKKKQGYKIKDLLQHADGIGVSSKHRRHGRE  94

Query  308  KANHVALAKYLEID  349
            +ANH A A+++  D
Sbjct  95   RANHRAFARFVRTD  108



>ref|XP_009610606.1| PREDICTED: uncharacterized protein LOC104104271 isoform X3 [Nicotiana 
tomentosiformis]
 ref|XP_009610607.1| PREDICTED: uncharacterized protein LOC104104271 isoform X3 [Nicotiana 
tomentosiformis]
Length=1176

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 53/83 (64%), Gaps = 1/83 (1%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            I +YKEK YEELR G    K  +    CP+C  K  +   Y+DLLQHA+G+GK S  R+ 
Sbjct  16   IEDYKEKSYEELRCGNQSFKISDVAYTCPYCQEKSGRHLFYEDLLQHASGIGK-SKIRTA  74

Query  302  KQKANHVALAKYLEIDLGDQAEP  370
            + +ANH+ALAKYLE D+   A P
Sbjct  75   RDRANHLALAKYLENDVAGAAIP  97


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 65/123 (53%), Gaps = 10/123 (8%)
 Frame = +2

Query  143  PYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RSVKQKANH  319
            PYE+L+SG Y +  P       +C  K+K+++ YKDL+ H   VG  S+N R+   KANH
Sbjct  577  PYEKLKSGNYSLNIPAVAYTFAYCPKKRKREFMYKDLMFHVREVGSCSSNKRTAIDKANH  636

Query  320  VALAKYLEIDLGDQAEPL-PQRAVAPEDNNL--------YCWPWTGIVVNVSKDNANGTA  472
            + LAKY E D+   A P  P     P+ + L        + WPW  +VVN+  +  +G  
Sbjct  637  LTLAKYFENDVALAASPSKPDTLGDPQVDTLLDYDRAEMFVWPWIAVVVNLPTEFKDGRY  696

Query  473  VEE  481
            V E
Sbjct  697  VGE  699


 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 46/76 (61%), Gaps = 1/76 (1%)
 Frame = +2

Query  140  KPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKG-SANRSVKQKAN  316
            K YE+ RSG +  K  N    CP+C   +++ + YKDLLQHA G+G   S  R+ + K N
Sbjct  178  KYYEDSRSGNHSPKISNMAFACPYCPETRERVFSYKDLLQHANGIGSSNSLKRTARDKVN  237

Query  317  HVALAKYLEIDLGDQA  364
            H+ALAK LE D+   A
Sbjct  238  HLALAKRLEKDVAGSA  253



>gb|EEE62370.1| hypothetical protein OsJ_17159 [Oryza sativa Japonica Group]
Length=691

 Score = 64.3 bits (155),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 56/108 (52%), Gaps = 3/108 (3%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  301
            +  Y    Y  L +G  KV       +CPFC+ +K     +  L  HA  VG    +R  
Sbjct  85   LEAYGSDTYALLEAGDIKVMNDKNMYQCPFCSDEKNDYNAHGLLQ-HALAVGSAD-DRPA  142

Query  302  KQKANHVALAKYLEIDLGDQAEPLPQRAVAPEDNNLYCWPWTGIVVNV  445
            K+KANH ALA +L+ D  + + PL Q     + N+L+ WPW GI+VN+
Sbjct  143  KEKANHRALALHLKDDTAESSRPLSQPPQHSK-NDLFVWPWMGIIVNM  189



>ref|XP_008660211.1| PREDICTED: uncharacterized protein LOC103639218 isoform X2 [Zea 
mays]
Length=367

 Score = 63.2 bits (152),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 39/74 (53%), Positives = 54/74 (73%), Gaps = 1/74 (1%)
 Frame = +2

Query  131  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV-KQ  307
            Y+EK +  L+SGK++V+ P+G  RCPFC GKKKQ YK KDLLQHA G+G  S +R   ++
Sbjct  35   YEEKSFGLLKSGKHRVRNPDGTFRCPFCLGKKKQGYKIKDLLQHADGIGVSSKHRRHGRE  94

Query  308  KANHVALAKYLEID  349
            +ANH A A+++  D
Sbjct  95   RANHRAFARFVRTD  108



>ref|XP_007141865.1| hypothetical protein PHAVU_008G232300g [Phaseolus vulgaris]
 gb|ESW13859.1| hypothetical protein PHAVU_008G232300g [Phaseolus vulgaris]
Length=1146

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 60/107 (56%), Gaps = 3/107 (3%)
 Frame = +2

Query  131  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdyky-kdllqHATGVGKGSAN-RSVK  304
            Y  K YE L+   + VK       CP+C  KK++     +++L+HA+GVG+ S+  RS  
Sbjct  533  YVHKSYEALKKVSHIVKTSEMTFACPYCPNKKRKRDYVYREILEHASGVGQSSSQKRSAT  592

Query  305  QKANHVALAKYLEIDLGDQAEPLPQRAVAPEDNNLYCWPWTGIVVNV  445
            +KANH+AL KYL+ DL +   P P           + WPW GI+VN+
Sbjct  593  EKANHLALMKYLQKDLMNVDGP-PITVDEGNAEEQFVWPWAGILVNI  638


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 55/76 (72%), Gaps = 2/76 (3%)
 Frame = +2

Query  131  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSA-NRSVKQ  307
            Y +  Y+EL+ G YKVK  +    CP+C  ++KQDYKY++LL HA+GVG+ S+  R+ K+
Sbjct  20   YVDISYQELKKGSYKVKSSDETFICPYCP-ERKQDYKYRELLNHASGVGRSSSGKRTAKE  78

Query  308  KANHVALAKYLEIDLG  355
            KANH+AL KYLE DL 
Sbjct  79   KANHLALVKYLEKDLA  94


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 55/81 (68%), Gaps = 1/81 (1%)
 Frame = +2

Query  131  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RSVKQ  307
            Y +K Y+EL+ G + V+       CP+C  K+KQDY Y++LL HA+GVG+ S+  RSV++
Sbjct  250  YVDKFYKELKKGNHIVQTSEETFSCPYCPKKRKQDYVYRELLDHASGVGQSSSQKRSVRE  309

Query  308  KANHVALAKYLEIDLGDQAEP  370
            KA H+AL KYL+ DL    +P
Sbjct  310  KATHLALMKYLKNDLMHMNDP  330


 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 54/89 (61%), Gaps = 2/89 (2%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdy-kykdllqHATGVGKG-SANR  295
            I  Y +K YEEL+ G++ VK  +    CP+C  KK      Y+++L+HA+GVG+  S  R
Sbjct  410  IGRYVDKFYEELKKGRHCVKTSDETFTCPYCPNKKLNRDYVYREILEHASGVGQSRSQKR  469

Query  296  SVKQKANHVALAKYLEIDLGDQAEPLPQR  382
            S  ++ANH+AL KYL+ D+ +     P +
Sbjct  470  SFFERANHLALEKYLKKDVMNVGASFPSK  498


 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 52/75 (69%), Gaps = 2/75 (3%)
 Frame = +2

Query  131  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RSVKQ  307
            Y +  YEEL+ G Y VK  +    CP+C  ++KQDY Y++LL+HA  VG+ S+  RS ++
Sbjct  134  YVDTSYEELKKGSYNVKTSDVTFICPYCP-RRKQDYLYRELLEHAYMVGRSSSEKRSARE  192

Query  308  KANHVALAKYLEIDL  352
            +ANH+AL KYLE DL
Sbjct  193  RANHLALVKYLENDL  207



>ref|XP_003568908.1| PREDICTED: factor of DNA methylation 1-like [Brachypodium distachyon]
Length=623

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 44/111 (40%), Positives = 56/111 (50%), Gaps = 8/111 (7%)
 Frame = +2

Query  131  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVKQK  310
            Y    Y  L SG  KV       +CPFC+  K     +  L  HA GVG  + +R  K+K
Sbjct  14   YGADTYTLLLSGDIKVMIDESLYQCPFCSDGKDDYNIHDLLQ-HALGVG-AAHDRQAKEK  71

Query  311  ANHVALAKYLEIDLGDQAEPLPQRAVA----PEDNN--LYCWPWTGIVVNV  445
             +H ALAK+L+ + G    PL Q  V     P+ N   L+ WPW GIVVNV
Sbjct  72   VDHRALAKHLKDESGKSPSPLLQPYVKDPQPPQHNRDELFVWPWMGIVVNV  122



>ref|XP_003568833.1| PREDICTED: factor of DNA methylation 1-like [Brachypodium distachyon]
Length=700

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 54/155 (35%), Positives = 74/155 (48%), Gaps = 40/155 (26%)
 Frame = +2

Query  125  NEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV-  301
            ++Y++K Y  L+SG ++V+ P+G  RCPFC GKKKQ YK KDLLQHA G+G  S +R   
Sbjct  49   SDYEDKSYGLLKSGNHRVRNPDGTFRCPFCPGKKKQAYKLKDLLQHADGIGVSSKHRRHG  108

Query  302  KQKANHVALAKYLEIDL------------------------------GDQAEPLPQRAVA  391
            K++A H A A+++  D                               G   EP    A  
Sbjct  109  KERAFHRAFARFVRADPSFAQELASITGIPGATANADTIDNGKSDANGHATEPSLAAAEG  168

Query  392  P--EDNNLYCWPWTGIVVNVSKDNANGTAVEEEDY  490
            P  +    +CWPW GI+       A GT    ED+
Sbjct  169  PPQDGEEKFCWPWCGIL-------AAGTGFNPEDF  196



>ref|XP_006407322.1| hypothetical protein EUTSA_v10020282mg [Eutrema salsugineum]
 gb|ESQ48775.1| hypothetical protein EUTSA_v10020282mg [Eutrema salsugineum]
Length=637

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 46/124 (37%), Positives = 64/124 (52%), Gaps = 16/124 (13%)
 Frame = +2

Query  122  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKG-SANRS  298
            +  +++  Y++L+SGK +VK       CP+C   K +   Y D+LQHA+GVG   S  RS
Sbjct  7    VKNFEKSLYKQLKSGKLEVKVSYRTFLCPYCPKNKTKVGLYTDILQHASGVGNSNSKKRS  66

Query  299  VKQKANHVALAKYLEIDLGDQA---EPLPQRA------------VAPEDNNLYCWPWTGI  433
            V ++A+H ALAKYL  DL   A   + L  R             V  E      WPW GI
Sbjct  67   VTERASHRALAKYLRKDLAGYATVSKRLKARISSTPAETGDTPLVYDESFEKLVWPWKGI  126

Query  434  VVNV  445
            +VN+
Sbjct  127  LVNI  130



>ref|XP_002455202.1| hypothetical protein SORBIDRAFT_03g006150 [Sorghum bicolor]
 gb|EES00322.1| hypothetical protein SORBIDRAFT_03g006150 [Sorghum bicolor]
Length=693

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 43/82 (52%), Positives = 58/82 (71%), Gaps = 2/82 (2%)
 Frame = +2

Query  131  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV-KQ  307
            Y+EK +  L+SGK++V+ P+G  RCPFC GKKKQ YK KDLLQHA G+G  S +R   ++
Sbjct  41   YEEKSFGLLKSGKHRVRNPDGTFRCPFCPGKKKQGYKIKDLLQHADGIGVSSKHRRHGRE  100

Query  308  KANHVALAKYLEIDLGDQAEPL  373
            +ANH A A+++  D  D AE L
Sbjct  101  RANHRAFARFVRTD-PDFAEDL  121



>gb|AAB94013.1| gene X-like protein [Sorghum bicolor]
Length=895

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 61/112 (54%), Gaps = 6/112 (5%)
 Frame = +2

Query  161  SGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVKQKANHVALAKYL  340
            SG  KVK       C FC+ KKK +Y    L+QHA+GV   + NR  K+KA H AL KYL
Sbjct  2    SGGLKVKNNGENYSCLFCSSKKKNNYSKSSLVQHASGVS-AAPNRKAKEKAAHRALFKYL  60

Query  341  EIDLGDQAEPLPQRA-VAPE----DNNLYCWPWTGIVVNVSKDNANGTAVEE  481
            + DL   +EP P    V P+     +  + WPW GI+VNV  +  +G  + E
Sbjct  61   KNDLAKSSEPQPLVIPVEPQPLQNRDEKFVWPWMGILVNVPTEWKDGRQIGE  112



>ref|XP_010106492.1| hypothetical protein L484_025250 [Morus notabilis]
 gb|EXC10668.1| hypothetical protein L484_025250 [Morus notabilis]
Length=620

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 41/124 (33%), Positives = 64/124 (52%), Gaps = 8/124 (6%)
 Frame = +2

Query  128  EYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVKQ  307
            E + + Y  L+ G  K+K  +   RCPFC   +K+  + K+LL HA+   + S  R +K+
Sbjct  8    ELEMEYYRRLKDGSAKIKTSDSRYRCPFCVEDRKKYDRSKELLYHASDFSRASYKRELKE  67

Query  308  KANHVALAKYLE---IDLGDQAEPLPQRAV---APEDNNLYCWPWTGIVVNVSKDNANGT  469
            +A H AL +Y++    D  D+ E  P R V    P+    + WP  GI+ N+  +  NG 
Sbjct  68   RAKHSALERYIKKYYYDTKDRKE--PSRKVERETPDHEEKFVWPSMGILANIRTELRNGK  125

Query  470  AVEE  481
             V E
Sbjct  126  RVAE  129



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 552737873190