BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002C14

Length=546
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AAD12055.1|  DnaJ protein                                            219   5e-66   Hevea brasiliensis [jebe]
ref|XP_002466747.1|  hypothetical protein SORBIDRAFT_01g013390          218   1e-65   Sorghum bicolor [broomcorn]
ref|NP_001051497.1|  Os03g0787300                                       218   2e-65   
ref|NP_001130317.1|  chaperone DNA J2                                   218   2e-65   Zea mays [maize]
ref|XP_006650701.1|  PREDICTED: dnaJ protein homolog 2-like             216   7e-65   Oryza brachyantha
gb|EAY92107.1|  hypothetical protein OsI_13813                          216   8e-65   Oryza sativa Indica Group [Indian rice]
gb|ABG78615.1|  J-domain protein                                        213   1e-63   Triticum aestivum [Canadian hard winter wheat]
gb|AAX95135.1|  DnaJ protein, putative                                  213   1e-63   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001050779.1|  Os03g0648400                                       213   1e-63   
gb|AFW68140.1|  putative dnaJ chaperone family protein isoform 1        213   1e-63   
ref|NP_001146715.1|  uncharacterized protein LOC100280317               213   1e-63   
dbj|BAA35121.1|  DnaJ homolog                                           212   3e-63   Salix gilgiana
ref|XP_006650350.1|  PREDICTED: dnaJ protein homolog 2-like             209   3e-62   
gb|KJB60379.1|  hypothetical protein B456_009G302500                    208   1e-61   Gossypium raimondii
ref|XP_007052233.1|  DNAJ                                               208   1e-61   Theobroma cacao [chocolate]
gb|KJB84163.1|  hypothetical protein B456_N007500                       202   2e-61   Gossypium raimondii
gb|EMT10718.1|  DnaJ protein-like protein                               207   2e-61   
dbj|BAJ91943.1|  predicted protein                                      207   3e-61   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ABX57881.1|  DnaJ                                                    206   4e-61   Viola baoshanensis
gb|KDO85584.1|  hypothetical protein CISIN_1g014800mg                   201   7e-61   Citrus sinensis [apfelsine]
ref|XP_010907982.1|  PREDICTED: dnaJ protein homolog                    206   7e-61   Elaeis guineensis
ref|XP_007010484.1|  DNAJ                                               206   9e-61   Theobroma cacao [chocolate]
gb|KHG01500.1|  Chaperone dnaJ 3 -like protein                          202   1e-60   Gossypium arboreum [tree cotton]
ref|XP_010248011.1|  PREDICTED: dnaJ protein homolog 2-like             205   1e-60   Nelumbo nucifera [Indian lotus]
gb|AGY48884.1|  MIP1.2                                                  205   1e-60   Nicotiana benthamiana
gb|KJB84165.1|  hypothetical protein B456_N007500                       202   1e-60   Gossypium raimondii
ref|XP_009766164.1|  PREDICTED: dnaJ protein homolog 2-like             204   3e-60   Nicotiana sylvestris
gb|ABI83623.1|  DnaJ-like protein                                       204   3e-60   Setaria italica
ref|XP_008231805.1|  PREDICTED: dnaJ protein homolog                    204   3e-60   Prunus mume [ume]
ref|XP_009600920.1|  PREDICTED: dnaJ protein homolog                    204   3e-60   Nicotiana tomentosiformis
ref|XP_004982304.1|  PREDICTED: dnaJ protein homolog 2-like             204   3e-60   Setaria italica
emb|CDO99946.1|  unnamed protein product                                204   4e-60   Coffea canephora [robusta coffee]
ref|XP_007211787.1|  hypothetical protein PRUPE_ppa006330mg             204   4e-60   Prunus persica
gb|AFW67421.1|  putative dnaJ chaperone family protein                  204   4e-60   
ref|XP_008354864.1|  PREDICTED: dnaJ protein homolog                    201   6e-60   
ref|XP_010933633.1|  PREDICTED: dnaJ protein homolog 2-like isofo...    203   6e-60   Elaeis guineensis
gb|AGY48885.1|  MIP1.3                                                  203   8e-60   Nicotiana benthamiana
ref|XP_009623415.1|  PREDICTED: dnaJ protein homolog                    203   8e-60   Nicotiana tomentosiformis
ref|XP_008375557.1|  PREDICTED: dnaJ protein homolog                    203   1e-59   
gb|KJB84164.1|  hypothetical protein B456_N007500                       202   1e-59   Gossypium raimondii
gb|KJB84159.1|  hypothetical protein B456_N007500                       202   1e-59   Gossypium raimondii
ref|XP_009418972.1|  PREDICTED: dnaJ protein homolog isoform X2         202   1e-59   
ref|XP_003561819.1|  PREDICTED: dnaJ protein homolog                    202   1e-59   Brachypodium distachyon [annual false brome]
gb|ABI18985.1|  molecular chaperone DjA2                                202   2e-59   Allium ampeloprasum
gb|ACN39991.1|  unknown                                                 202   2e-59   Picea sitchensis
gb|KDP22008.1|  hypothetical protein JCGZ_03128                         199   2e-59   Jatropha curcas
ref|XP_006445792.1|  hypothetical protein CICLE_v10015385mg             202   2e-59   Citrus clementina [clementine]
ref|XP_010090486.1|  DnaJ-like protein                                  202   2e-59   Morus notabilis
ref|XP_009341572.1|  PREDICTED: dnaJ protein homolog                    202   3e-59   Pyrus x bretschneideri [bai li]
ref|XP_006365672.1|  PREDICTED: dnaJ protein homolog isoform X1         202   3e-59   
ref|XP_010933632.1|  PREDICTED: dnaJ protein homolog isoform X1         202   3e-59   Elaeis guineensis
ref|XP_004249937.1|  PREDICTED: dnaJ protein homolog                    202   3e-59   
ref|XP_002263156.1|  PREDICTED: dnaJ protein homolog                    202   3e-59   Vitis vinifera
ref|XP_006485485.1|  PREDICTED: dnaJ protein homolog                    201   3e-59   Citrus sinensis [apfelsine]
ref|XP_009793841.1|  PREDICTED: dnaJ protein homolog isoform X1         202   3e-59   Nicotiana sylvestris
ref|XP_004981504.1|  PREDICTED: dnaJ protein homolog                    202   3e-59   Setaria italica
ref|XP_010031320.1|  PREDICTED: dnaJ protein homolog                    201   3e-59   Eucalyptus grandis [rose gum]
ref|XP_008345828.1|  PREDICTED: dnaJ protein homolog                    201   3e-59   Malus domestica [apple tree]
ref|XP_009793842.1|  PREDICTED: dnaJ protein homolog isoform X2         201   4e-59   Nicotiana sylvestris
ref|NP_001168650.1|  putative dnaJ chaperone family protein             201   4e-59   Zea mays [maize]
gb|KDO85583.1|  hypothetical protein CISIN_1g014800mg                   199   4e-59   Citrus sinensis [apfelsine]
ref|XP_006365673.1|  PREDICTED: dnaJ protein homolog isoform X2         201   4e-59   
ref|XP_010258832.1|  PREDICTED: dnaJ protein homolog 2-like isofo...    201   5e-59   Nelumbo nucifera [Indian lotus]
ref|XP_009398344.1|  PREDICTED: dnaJ protein homolog 2-like             201   5e-59   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004239737.1|  PREDICTED: dnaJ protein homolog                    201   5e-59   Solanum lycopersicum
ref|XP_009397426.1|  PREDICTED: dnaJ protein homolog                    201   5e-59   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002514419.1|  Chaperone protein dnaJ, putative                   201   6e-59   
ref|XP_002270362.1|  PREDICTED: dnaJ protein homolog isoform X1         201   8e-59   Vitis vinifera
emb|CBI28261.3|  unnamed protein product                                200   8e-59   Vitis vinifera
ref|XP_009408520.1|  PREDICTED: dnaJ protein homolog isoform X1         200   1e-58   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAF64454.1|AF239932_1  DnaJ protein                                  200   1e-58   Euphorbia esula [wolf's milk]
ref|NP_001234241.1|  DnaJ-like protein                                  200   1e-58   
ref|XP_011017419.1|  PREDICTED: dnaJ protein homolog 2-like isofo...    200   1e-58   Populus euphratica
gb|AFW67420.1|  putative dnaJ chaperone family protein                  200   2e-58   
emb|CAA63965.1|  DnaJ protein                                           200   2e-58   Solanum tuberosum [potatoes]
ref|XP_004236804.1|  PREDICTED: dnaJ protein homolog isoform X1         199   2e-58   Solanum lycopersicum
ref|XP_006367020.1|  PREDICTED: dnaJ protein homolog 2-like isofo...    199   2e-58   Solanum tuberosum [potatoes]
ref|XP_010651845.1|  PREDICTED: dnaJ protein homolog isoform X2         199   3e-58   
ref|XP_006445376.1|  hypothetical protein CICLE_v10020330mg             198   5e-58   Citrus clementina [clementine]
ref|XP_010053981.1|  PREDICTED: dnaJ protein homolog                    198   7e-58   Eucalyptus grandis [rose gum]
gb|AGY48883.1|  MIP1.1b                                                 198   7e-58   Nicotiana benthamiana
ref|XP_009418971.1|  PREDICTED: dnaJ protein homolog isoform X1         198   8e-58   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABB16980.1|  DnaJ-like protein                                       198   9e-58   Solanum tuberosum [potatoes]
ref|XP_006345881.1|  PREDICTED: dnaJ protein homolog                    198   9e-58   Solanum tuberosum [potatoes]
ref|XP_009408521.1|  PREDICTED: dnaJ protein homolog isoform X2         198   9e-58   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009406563.1|  PREDICTED: dnaJ protein homolog                    197   1e-57   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAG24642.1|AF308737_1  J1P                                           197   1e-57   Daucus carota [carrots]
gb|ABA46776.1|  DnaJ-like protein                                       198   1e-57   Solanum tuberosum [potatoes]
ref|XP_009588725.1|  PREDICTED: dnaJ protein homolog                    197   2e-57   
ref|XP_004510114.1|  PREDICTED: dnaJ protein homolog 2-like             197   2e-57   Cicer arietinum [garbanzo]
gb|AFR66645.1|  MIP1.1a                                                 197   2e-57   Nicotiana benthamiana
ref|NP_001275059.1|  DnaJ-like protein                                  197   2e-57   Solanum tuberosum [potatoes]
emb|CDP09461.1|  unnamed protein product                                197   2e-57   Coffea canephora [robusta coffee]
ref|XP_010685460.1|  PREDICTED: dnaJ protein homolog ANJ1               197   2e-57   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011084248.1|  PREDICTED: dnaJ protein homolog                    197   3e-57   Sesamum indicum [beniseed]
ref|XP_011008852.1|  PREDICTED: dnaJ protein homolog isoform X1         196   3e-57   Populus euphratica
ref|XP_011008853.1|  PREDICTED: dnaJ protein homolog isoform X2         196   3e-57   Populus euphratica
ref|XP_007015642.1|  DNAJ isoform 3                                     194   3e-57   
ref|XP_002313505.1|  seed maturation protein PM37                       196   4e-57   Populus trichocarpa [western balsam poplar]
ref|XP_003558043.1|  PREDICTED: dnaJ protein homolog                    196   4e-57   Brachypodium distachyon [annual false brome]
ref|XP_002515865.1|  Chaperone protein dnaJ, putative                   196   4e-57   Ricinus communis
gb|EMS59985.1|  Chaperone protein dnaJ 2                                192   9e-57   Triticum urartu
ref|XP_010907714.1|  PREDICTED: dnaJ protein homolog                    195   9e-57   Elaeis guineensis
ref|XP_010089281.1|  DnaJ-like protein                                  195   1e-56   Morus notabilis
ref|XP_004169945.1|  PREDICTED: dnaJ protein homolog                    195   1e-56   
ref|XP_008446732.1|  PREDICTED: dnaJ protein homolog                    195   1e-56   Cucumis melo [Oriental melon]
ref|XP_008787761.1|  PREDICTED: dnaJ protein homolog                    195   1e-56   Phoenix dactylifera
ref|XP_011024143.1|  PREDICTED: dnaJ protein homolog                    195   2e-56   Populus euphratica
ref|XP_002316479.1|  DnaJ family protein                                194   2e-56   Populus trichocarpa [western balsam poplar]
ref|XP_007015641.1|  DNAJ isoform 2                                     194   2e-56   
ref|XP_009760224.1|  PREDICTED: dnaJ protein homolog                    194   3e-56   Nicotiana sylvestris
ref|XP_006378828.1|  hypothetical protein POPTR_0010s24930g             195   3e-56   
ref|XP_011032891.1|  PREDICTED: dnaJ protein homolog                    194   3e-56   Populus euphratica
ref|XP_004306421.1|  PREDICTED: dnaJ protein homolog                    194   3e-56   Fragaria vesca subsp. vesca
ref|XP_009622737.1|  PREDICTED: dnaJ protein homolog 2-like             194   4e-56   Nicotiana tomentosiformis
ref|XP_007015640.1|  DNAJ isoform 1                                     193   5e-56   
ref|XP_002310999.1|  DnaJ family protein                                193   6e-56   Populus trichocarpa [western balsam poplar]
ref|XP_010031575.1|  PREDICTED: dnaJ protein homolog                    193   7e-56   Eucalyptus grandis [rose gum]
ref|XP_004953339.1|  PREDICTED: dnaJ protein homolog 2-like             192   9e-56   Setaria italica
gb|EMT20603.1|  DnaJ protein-like protein                               192   9e-56   
gb|EMS60670.1|  DnaJ protein-like protein                               193   1e-55   Triticum urartu
ref|NP_001267695.1|  dnaJ protein homolog                               192   1e-55   Cucumis sativus [cucumbers]
gb|KJB35427.1|  hypothetical protein B456_006G117100                    187   2e-55   Gossypium raimondii
ref|XP_001768102.1|  predicted protein                                  191   3e-55   
gb|ACU24346.1|  unknown                                                 191   4e-55   Glycine max [soybeans]
ref|NP_001047626.1|  Os02g0656500                                       191   4e-55   
ref|XP_003521084.1|  PREDICTED: dnaJ protein homolog 2-like             191   4e-55   Glycine max [soybeans]
gb|AGY48887.1|  MIP1.4b                                                 191   4e-55   Nicotiana benthamiana
gb|EEC73725.1|  hypothetical protein OsI_08334                          191   4e-55   Oryza sativa Indica Group [Indian rice]
ref|XP_003529049.1|  PREDICTED: dnaJ protein homolog 2-like             190   6e-55   Glycine max [soybeans]
ref|XP_002446897.1|  hypothetical protein SORBIDRAFT_06g024520          190   7e-55   Sorghum bicolor [broomcorn]
gb|EEE57509.1|  hypothetical protein OsJ_07792                          191   1e-54   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001755408.1|  predicted protein                                  189   1e-54   
ref|XP_008803820.1|  PREDICTED: dnaJ protein homolog 2-like             189   1e-54   
ref|NP_001136581.1|  putative dnaJ chaperone family protein             189   1e-54   Zea mays [maize]
gb|KHG17902.1|  Chaperone dnaJ 3 -like protein                          189   2e-54   Gossypium arboreum [tree cotton]
ref|XP_006826444.1|  hypothetical protein AMTR_s00004p00172570          189   3e-54   Amborella trichopoda
gb|KJB35428.1|  hypothetical protein B456_006G117100                    186   3e-54   Gossypium raimondii
ref|XP_002454540.1|  hypothetical protein SORBIDRAFT_04g032970          189   3e-54   Sorghum bicolor [broomcorn]
ref|XP_002301248.1|  DnaJ family protein                                189   4e-54   
ref|XP_006386554.1|  hypothetical protein POPTR_0002s14200g             188   4e-54   
emb|CAC12824.1|  putative DNAJ protein                                  187   7e-54   Nicotiana tabacum [American tobacco]
ref|XP_006647626.1|  PREDICTED: dnaJ protein homolog 2-like isofo...    187   8e-54   Oryza brachyantha
ref|XP_006647627.1|  PREDICTED: dnaJ protein homolog 2-like isofo...    187   9e-54   Oryza brachyantha
ref|XP_001782829.1|  predicted protein                                  187   1e-53   
gb|KJB41003.1|  hypothetical protein B456_007G087000                    187   1e-53   Gossypium raimondii
ref|XP_009789005.1|  PREDICTED: dnaJ protein homolog                    187   1e-53   Nicotiana sylvestris
gb|KJB35426.1|  hypothetical protein B456_006G117100                    186   2e-53   Gossypium raimondii
ref|XP_010919645.1|  PREDICTED: dnaJ protein homolog                    186   2e-53   Elaeis guineensis
emb|CAH67501.1|  OSIGBa0134H18.3                                        186   2e-53   Oryza sativa [red rice]
gb|EPS59846.1|  hypothetical protein M569_14958                         181   3e-53   Genlisea aurea
emb|CAA04447.1|  DnaJ-like protein                                      186   5e-53   Medicago sativa [alfalfa]
gb|ACJ84518.1|  unknown                                                 186   5e-53   Medicago truncatula
ref|XP_003626730.1|  DnaJ protein-like protein                          186   5e-53   Medicago truncatula
gb|KJB35429.1|  hypothetical protein B456_006G117100                    186   6e-53   Gossypium raimondii
gb|KHF97331.1|  Chaperone dnaJ 3 -like protein                          185   8e-53   Gossypium arboreum [tree cotton]
ref|XP_009592511.1|  PREDICTED: dnaJ protein homolog                    184   1e-52   Nicotiana tomentosiformis
ref|XP_006424068.1|  hypothetical protein CICLE_v10028531mg             184   1e-52   Citrus clementina [clementine]
ref|NP_001053485.1|  Os04g0549600                                       184   1e-52   
gb|KJB09149.1|  hypothetical protein B456_001G126200                    184   1e-52   Gossypium raimondii
ref|XP_006347934.1|  PREDICTED: dnaJ protein homolog 2-like isofo...    184   2e-52   
ref|XP_001774283.1|  predicted protein                                  184   2e-52   
gb|ABY52936.1|  DnaJ family heat shock protein                          184   2e-52   Oryza sativa Japonica Group [Japonica rice]
dbj|BAD25681.1|  putative DnaJ-like protein MsJ1                        183   3e-52   Oryza sativa Japonica Group [Japonica rice]
gb|AFK48766.1|  unknown                                                 183   3e-52   Medicago truncatula
gb|EYU36024.1|  hypothetical protein MIMGU_mgv1a007013mg                183   5e-52   Erythranthe guttata [common monkey flower]
sp|P42824.1|DNJH2_ALLPO  RecName: Full=DnaJ protein homolog 2; Fl...    182   5e-52   Allium ampeloprasum
ref|XP_002511620.1|  Chaperone protein dnaJ, putative                   182   6e-52   
ref|XP_010692097.1|  PREDICTED: dnaJ protein homolog 2-like             182   7e-52   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009411580.1|  PREDICTED: dnaJ protein homolog                    182   1e-51   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007134513.1|  hypothetical protein PHAVU_010G053900g             182   1e-51   Phaseolus vulgaris [French bean]
ref|XP_010263053.1|  PREDICTED: dnaJ protein homolog                    182   1e-51   Nelumbo nucifera [Indian lotus]
ref|XP_002983333.1|  hypothetical protein SELMODRAFT_118063             181   2e-51   Selaginella moellendorffii
ref|XP_002969107.1|  hypothetical protein SELMODRAFT_267228             181   3e-51   Selaginella moellendorffii
ref|XP_009382439.1|  PREDICTED: dnaJ protein homolog                    181   4e-51   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003570021.1|  PREDICTED: dnaJ protein homolog 2-like             180   6e-51   Brachypodium distachyon [annual false brome]
gb|AES67168.2|  DnaJ-class molecular chaperone                          177   7e-51   Medicago truncatula
ref|XP_006345526.1|  PREDICTED: dnaJ protein homolog isoform X1         179   2e-50   Solanum tuberosum [potatoes]
ref|XP_004976432.1|  PREDICTED: dnaJ protein homolog 2-like             178   2e-50   Setaria italica
gb|KHG16063.1|  DnaJ protein                                            175   3e-50   Gossypium arboreum [tree cotton]
gb|AGY48888.1|  MIP1L1                                                  178   3e-50   Nicotiana benthamiana
ref|XP_006340318.1|  PREDICTED: dnaJ protein homolog ANJ1-like is...    178   3e-50   Solanum tuberosum [potatoes]
ref|XP_007150008.1|  hypothetical protein PHAVU_005G118100g             178   4e-50   Phaseolus vulgaris [French bean]
ref|XP_003596916.1|  DnaJ                                               177   4e-50   Medicago truncatula
ref|XP_004506241.1|  PREDICTED: dnaJ protein homolog ANJ1-like          177   4e-50   Cicer arietinum [garbanzo]
gb|KHG16062.1|  Chaperone protein dnaJ 3                                175   5e-50   Gossypium arboreum [tree cotton]
gb|EYU37228.1|  hypothetical protein MIMGU_mgv1a006942mg                177   7e-50   Erythranthe guttata [common monkey flower]
dbj|BAK03083.1|  predicted protein                                      169   7e-50   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004251216.1|  PREDICTED: dnaJ protein homolog                    177   7e-50   Solanum lycopersicum
ref|XP_009779099.1|  PREDICTED: dnaJ protein homolog                    177   8e-50   Nicotiana sylvestris
ref|NP_001240264.1|  uncharacterized protein LOC100818805               177   8e-50   Glycine max [soybeans]
ref|XP_004487721.1|  PREDICTED: dnaJ protein homolog                    175   9e-50   Cicer arietinum [garbanzo]
gb|KDP42967.1|  hypothetical protein JCGZ_23909                         177   1e-49   Jatropha curcas
sp|P43644.1|DNJH_ATRNU  RecName: Full=DnaJ protein homolog ANJ1; ...    177   1e-49   Atriplex nummularia
ref|XP_003540271.1|  PREDICTED: dnaJ protein homolog                    176   1e-49   Glycine max [soybeans]
gb|KHN17991.1|  DnaJ protein like                                       176   1e-49   Glycine soja [wild soybean]
ref|XP_006837307.1|  hypothetical protein AMTR_s00111p00054240          173   2e-49   
ref|XP_004229763.1|  PREDICTED: dnaJ protein homolog 2-like             176   2e-49   Solanum lycopersicum
gb|EYU37227.1|  hypothetical protein MIMGU_mgv1a006922mg                176   2e-49   Erythranthe guttata [common monkey flower]
ref|XP_009596179.1|  PREDICTED: dnaJ protein homolog                    176   3e-49   Nicotiana tomentosiformis
ref|XP_011090296.1|  PREDICTED: dnaJ protein homolog                    175   6e-49   Sesamum indicum [beniseed]
ref|XP_011088982.1|  PREDICTED: dnaJ protein homolog                    174   7e-49   Sesamum indicum [beniseed]
gb|AFK37703.1|  unknown                                                 174   7e-49   Medicago truncatula
ref|XP_010493266.1|  PREDICTED: chaperone protein dnaJ 2-like iso...    174   8e-49   Camelina sativa [gold-of-pleasure]
gb|AGR45906.1|  DnaJ protein 2-like protein                             174   1e-48   Triticum aestivum [Canadian hard winter wheat]
emb|CAI64493.1|  OSJNBa0065H10.16                                       174   1e-48   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004139085.1|  PREDICTED: dnaJ protein homolog                    173   2e-48   Cucumis sativus [cucumbers]
ref|XP_010694477.1|  PREDICTED: dnaJ protein homolog                    173   2e-48   Beta vulgaris subsp. vulgaris [field beet]
gb|ACJ85577.1|  unknown                                                 169   2e-48   Medicago truncatula
ref|XP_010089798.1|  DnaJ-like protein                                  173   3e-48   
ref|XP_010263054.1|  PREDICTED: dnaJ protein homolog                    172   4e-48   Nelumbo nucifera [Indian lotus]
ref|XP_008443634.1|  PREDICTED: dnaJ protein homolog                    172   5e-48   Cucumis melo [Oriental melon]
tpg|DAA41207.1|  TPA: putative dnaJ chaperone family protein            175   6e-48   
ref|XP_007205259.1|  hypothetical protein PRUPE_ppa006299mg             172   8e-48   Prunus persica
ref|XP_008230416.1|  PREDICTED: dnaJ protein homolog                    172   8e-48   Prunus mume [ume]
ref|XP_006590333.1|  PREDICTED: uncharacterized protein LOC100808...    172   8e-48   
emb|CAD41609.2|  OSJNBb0034G17.1                                        175   8e-48   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001238341.1|  seed maturation protein PM37                       171   9e-48   Glycine max [soybeans]
emb|CDX70980.1|  BnaC03g10640D                                          171   1e-47   
ref|XP_007132506.1|  hypothetical protein PHAVU_011G100000g             171   1e-47   Phaseolus vulgaris [French bean]
gb|EYU36023.1|  hypothetical protein MIMGU_mgv1a007093mg                171   2e-47   Erythranthe guttata [common monkey flower]
gb|AHA84223.1|  seed maturation protein PM37                            171   2e-47   Phaseolus vulgaris [French bean]
ref|NP_001242510.1|  uncharacterized protein LOC100808604               171   2e-47   
gb|AHA84264.1|  seed maturation protein PM37                            171   2e-47   Phaseolus vulgaris [French bean]
ref|XP_011093285.1|  PREDICTED: chaperone protein dnaJ 3-like           170   3e-47   Sesamum indicum [beniseed]
ref|XP_003605981.1|  DnaJ                                               169   7e-47   
ref|XP_010535721.1|  PREDICTED: chaperone protein dnaJ 3                169   7e-47   Tarenaya hassleriana [spider flower]
ref|XP_003605980.1|  DnaJ                                               169   8e-47   Medicago truncatula
ref|XP_009368443.1|  PREDICTED: dnaJ protein homolog                    169   8e-47   Pyrus x bretschneideri [bai li]
ref|XP_006404506.1|  hypothetical protein EUTSA_v10010407mg             169   1e-46   Eutrema salsugineum [saltwater cress]
ref|XP_002874044.1|  hypothetical protein ARALYDRAFT_489058             169   1e-46   
ref|XP_008385581.1|  PREDICTED: dnaJ protein homolog                    169   1e-46   
ref|XP_009388365.1|  PREDICTED: dnaJ protein homolog                    161   1e-46   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDP15561.1|  unnamed protein product                                168   2e-46   Coffea canephora [robusta coffee]
gb|ACJ85213.1|  unknown                                                 159   3e-46   Medicago truncatula
ref|XP_002877319.1|  hypothetical protein ARALYDRAFT_905503             167   4e-46   Arabidopsis lyrata subsp. lyrata
ref|XP_010544327.1|  PREDICTED: dnaJ protein homolog                    167   7e-46   Tarenaya hassleriana [spider flower]
dbj|BAA76883.1|  DnaJ homolog protein                                   167   7e-46   Salix gilgiana
ref|NP_850653.1|  chaperone protein dnaJ 3                              164   9e-46   Arabidopsis thaliana [mouse-ear cress]
gb|AAB86799.1|  putative                                                166   1e-45   Arabidopsis thaliana [mouse-ear cress]
ref|NP_568412.1|  chaperone protein dnaJ 2                              166   1e-45   Arabidopsis thaliana [mouse-ear cress]
gb|AAD09517.1|  NTFP2                                                   157   2e-45   Nicotiana tabacum [American tobacco]
ref|XP_008232370.1|  PREDICTED: dnaJ protein homolog 2-like             165   2e-45   Prunus mume [ume]
ref|NP_189997.1|  chaperone protein dnaJ 3                              165   3e-45   Arabidopsis thaliana [mouse-ear cress]
gb|AAK74013.1|  AT3g44110/F26G5_60                                      165   3e-45   Arabidopsis thaliana [mouse-ear cress]
gb|AAB49030.1|  DnaJ homolog                                            165   3e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008361658.1|  PREDICTED: dnaJ protein homolog                    164   6e-45   
ref|XP_006400711.1|  hypothetical protein EUTSA_v10013655mg             164   6e-45   Eutrema salsugineum [saltwater cress]
gb|KDO48715.1|  hypothetical protein CISIN_1g015695mg                   162   6e-45   Citrus sinensis [apfelsine]
ref|XP_009336413.1|  PREDICTED: dnaJ protein homolog                    164   7e-45   Pyrus x bretschneideri [bai li]
ref|XP_006287824.1|  hypothetical protein CARUB_v10001042mg             164   7e-45   Capsella rubella
emb|CAN64325.1|  hypothetical protein VITISV_005641                     163   8e-45   Vitis vinifera
ref|XP_010514755.1|  PREDICTED: chaperone protein dnaJ 3-like           164   9e-45   Camelina sativa [gold-of-pleasure]
ref|XP_002275918.1|  PREDICTED: dnaJ protein homolog 2                  164   9e-45   Vitis vinifera
ref|XP_010427107.1|  PREDICTED: chaperone protein dnaJ 3 isoform X1     164   1e-44   
ref|XP_006292339.1|  hypothetical protein CARUB_v10018551mg             163   1e-44   Capsella rubella
ref|XP_004291531.1|  PREDICTED: dnaJ protein homolog                    163   1e-44   Fragaria vesca subsp. vesca
ref|XP_010454471.1|  PREDICTED: chaperone protein dnaJ 2                163   1e-44   Camelina sativa [gold-of-pleasure]
ref|XP_010420996.1|  PREDICTED: chaperone protein dnaJ 2 isoform X1     163   1e-44   Camelina sativa [gold-of-pleasure]
ref|XP_001774301.1|  predicted protein                                  163   2e-44   
ref|XP_010521621.1|  PREDICTED: dnaJ protein homolog ANJ1-like          163   2e-44   Tarenaya hassleriana [spider flower]
gb|KFK26344.1|  hypothetical protein AALP_AA8G235700                    162   2e-44   Arabis alpina [alpine rockcress]
gb|KDO48711.1|  hypothetical protein CISIN_1g015695mg                   162   3e-44   Citrus sinensis [apfelsine]
ref|XP_008359180.1|  PREDICTED: dnaJ protein homolog                    162   4e-44   
ref|XP_008375745.1|  PREDICTED: dnaJ protein homolog 2-like             162   4e-44   Malus domestica [apple tree]
gb|KDO48710.1|  hypothetical protein CISIN_1g015695mg                   161   7e-44   Citrus sinensis [apfelsine]
emb|CBI16632.3|  unnamed protein product                                164   8e-44   Vitis vinifera
emb|CDY09117.1|  BnaA02g05430D                                          160   1e-43   Brassica napus [oilseed rape]
emb|CDY65546.1|  BnaCnng47600D                                          160   2e-43   Brassica napus [oilseed rape]
emb|CDX92385.1|  BnaA10g14240D                                          160   2e-43   
ref|XP_009120690.1|  PREDICTED: chaperone protein dnaJ 3-like           160   2e-43   Brassica rapa
emb|CDX92386.1|  BnaA10g14250D                                          160   2e-43   
sp|Q03363.1|DNJH1_ALLPO  RecName: Full=DnaJ protein homolog 1; Sh...    159   3e-43   Allium ampeloprasum
emb|CAL36997.1|  DnaJ-like protein                                      152   4e-43   Platanus x hispanica [London plane tree]
ref|XP_009120689.1|  PREDICTED: chaperone protein dnaJ 3-like           159   6e-43   Brassica rapa
ref|XP_010520679.1|  PREDICTED: chaperone protein dnaJ 3-like           160   7e-43   
gb|KDP36478.1|  hypothetical protein JCGZ_08608                         151   2e-42   Jatropha curcas
ref|XP_009126521.1|  PREDICTED: chaperone protein dnaJ 3                157   3e-42   Brassica rapa
ref|XP_002963792.1|  hypothetical protein SELMODRAFT_230221             156   5e-42   Selaginella moellendorffii
ref|XP_009131855.1|  PREDICTED: chaperone protein dnaJ 3-like           155   1e-41   
ref|XP_004291528.1|  PREDICTED: dnaJ protein homolog                    154   6e-41   
ref|XP_004307004.1|  PREDICTED: dnaJ protein homolog 2-like             153   7e-41   
ref|XP_002974881.1|  hypothetical protein SELMODRAFT_232411             152   2e-40   
ref|XP_005819280.1|  hypothetical protein GUITHDRAFT_121532             150   1e-39   
gb|KHN36510.1|  DnaJ protein like                                       147   1e-39   
gb|AGY48886.1|  MIP1.4a                                                 147   9e-39   
ref|XP_004170446.1|  PREDICTED: dnaJ protein homolog                    141   9e-39   
gb|KDO48709.1|  hypothetical protein CISIN_1g015695mg                   146   2e-38   
gb|KDP28841.1|  hypothetical protein JCGZ_14612                         146   2e-38   
ref|XP_007220469.1|  hypothetical protein PRUPE_ppa006364mg             146   3e-38   
gb|AAD09516.1|  NTFP1                                                   134   4e-37   
ref|XP_003058583.1|  predicted protein                                  142   1e-36   
ref|XP_002507968.1|  predicted protein                                  137   4e-35   
ref|XP_009525521.1|  hypothetical protein PHYSODRAFT_345922             135   2e-34   
ref|XP_009830474.1|  hypothetical protein H257_06805                    134   9e-34   
emb|CCA21495.1|  conserved hypothetical protein                         134   1e-33   
ref|XP_005707879.1|  molecular chaperone DnaJ                           134   1e-33   
ref|XP_002900006.1|  conserved hypothetical protein                     133   2e-33   
emb|CCI48830.1|  unnamed protein product                                136   3e-33   
emb|CCI48831.1|  unnamed protein product                                135   3e-33   
ref|XP_007515206.1|  predicted protein                                  132   4e-33   
ref|XP_008890293.1|  hypothetical protein PPTG_00631                    132   5e-33   
ref|XP_001419206.1|  predicted protein                                  131   8e-33   
ref|XP_008874469.1|  hypothetical protein H310_10010                    131   8e-33   
ref|XP_003080911.1|  DnaJ-like protein (ISS)                            130   2e-32   
emb|CCI48832.1|  unnamed protein product                                134   2e-32   
emb|CCI48829.1|  unnamed protein product                                133   2e-32   
ref|XP_011457522.1|  PREDICTED: dnaJ protein homolog                    130   2e-32   
ref|XP_005707432.1|  molecular chaperone DnaJ                           130   3e-32   
gb|EKC32228.1|  DnaJ-like protein subfamily A member 1                  128   4e-32   
ref|XP_011416044.1|  PREDICTED: dnaJ homolog subfamily A member 1...    129   6e-32   
ref|XP_002949642.1|  molecular chaperone                                128   1e-31   
ref|XP_005852710.1|  DnaJ subfamily A member 2-like protein             127   2e-31   
ref|XP_005645695.1|  DnaJ-like protein                                  127   4e-31   
gb|EWM24221.1|  HSP40/DnaJ heat shock protein                           125   1e-30   
emb|CBJ30599.1|  Heat shock protein 40                                  125   1e-30   
ref|XP_001691598.1|  DnaJ-like protein                                  125   2e-30   
ref|XP_002364366.1|  DnaJ domain-containing protein                     125   2e-30   
gb|KIZ04147.1|  putative DnaJ proteinJ1                                 125   2e-30   
ref|XP_008885880.1|  DnaJ family chaperone, putative                    124   3e-30   
ref|XP_007862829.1|  hypothetical protein GLOTRDRAFT_35434              122   1e-29   
ref|XP_009830477.1|  hypothetical protein H257_06808                    122   1e-29   
emb|CBK20067.2|  unnamed protein product                                122   2e-29   
ref|XP_001616597.1|  DnaJ domain containing protein                     122   2e-29   
ref|XP_009689477.1|  molecular chaperone protein                        121   2e-29   
ref|XP_002782044.1|  molecular chaperone, putative                      119   2e-29   
ref|XP_007764824.1|  hypothetical protein CONPUDRAFT_87768              121   3e-29   
gb|KIJ17275.1|  hypothetical protein PAXINDRAFT_162188                  121   3e-29   
ref|XP_002260632.1|  DNAJ protein                                       121   4e-29   
gb|EUT78884.1|  hypothetical protein PFAG_05460                         120   6e-29   
ref|XP_001348533.1|  HSP40, subfamily A, putative                       120   7e-29   
ref|XP_971446.1|  PREDICTED: dnaJ homolog subfamily A member 1          120   1e-28   
ref|XP_007308701.1|  DnaJ-domain-containing protein                     119   2e-28   
ref|XP_007399859.1|  hypothetical protein PHACADRAFT_262538             119   2e-28   
ref|XP_008874481.1|  hypothetical protein H310_10021                    119   2e-28   
ref|XP_008607517.1|  hypothetical protein SDRG_03658                    119   2e-28   
ref|XP_783657.1|  PREDICTED: dnaJ homolog subfamily A member 1-like     119   2e-28   
emb|CDR94440.1|  DnaJ chaperone, putative                               119   2e-28   
gb|AFJ54624.1|  DnaJ                                                    119   2e-28   
ref|XP_002768280.1|  chaperone protein DnaJ, putative                   119   2e-28   
gb|EWC85742.1|  hypothetical protein PFNF54_05408                       118   3e-28   
gb|KDQ33681.1|  hypothetical protein PLEOSDRAFT_1099644                 118   4e-28   
gb|ETW28492.1|  hypothetical protein PFFCH_04123                        118   4e-28   
gb|KDD76066.1|  hypothetical protein H632_c371p1                        118   4e-28   
gb|AAC27389.1|  DnaJ homolog                                            118   4e-28   
ref|XP_001610911.1|  DnaJ chaperone                                     118   4e-28   
dbj|BAN66103.1|  DnaJ chaperone, putative                               118   4e-28   
ref|XP_766227.1|  chaperone protein DnaJ                                118   5e-28   
ref|XP_009034902.1|  hypothetical protein AURANDRAFT_59942              118   5e-28   
ref|XP_002734268.1|  PREDICTED: dnaJ homolog subfamily A member 1...    118   5e-28   
ref|XP_006458405.1|  hypothetical protein AGABI2DRAFT_190689            118   6e-28   
ref|XP_010583355.1|  PREDICTED: dnaJ homolog subfamily A member 2...    117   6e-28   
ref|XP_007396150.1|  hypothetical protein PHACADRAFT_209359             117   7e-28   
ref|XP_003969457.1|  PREDICTED: dnaJ homolog subfamily A member 2...    117   7e-28   
ref|XP_007887604.1|  PREDICTED: dnaJ homolog subfamily A member 2       117   9e-28   
gb|KDQ59400.1|  hypothetical protein JAAARDRAFT_32961                   117   1e-27   
ref|XP_954074.1|  molecular chaperone                                   117   1e-27   
gb|KIO13237.1|  hypothetical protein M404DRAFT_992794                   117   1e-27   
ref|XP_006375231.1|  hypothetical protein POPTR_0014s05490g             114   1e-27   
ref|XP_007478072.1|  PREDICTED: dnaJ homolog subfamily A member 4...    116   1e-27   
ref|XP_003699212.1|  PREDICTED: dnaJ homolog subfamily A member 1...    117   1e-27   
ref|NP_001005841.1|  dnaJ homolog subfamily A member 2                  117   1e-27   
ref|XP_008607516.1|  hypothetical protein SDRG_03657                    117   1e-27   
ref|XP_004387526.1|  PREDICTED: dnaJ homolog subfamily A member 4       117   1e-27   
emb|CAG03075.1|  unnamed protein product                                120   1e-27   
ref|XP_007321427.1|  hypothetical protein SERLADRAFT_474282             116   1e-27   
ref|XP_004617681.1|  PREDICTED: dnaJ homolog subfamily A member 4       116   2e-27   
emb|CDS21532.1|  dnaJ subfamily A                                       116   2e-27   
emb|CDI97251.1|  dnaJ subfamily A                                       116   2e-27   
dbj|GAA36748.2|  DnaJ homolog subfamily A member 1                      116   2e-27   
gb|EUB57005.1|  DnaJ subfamily A member                                 116   2e-27   
emb|CDO70578.1|  hypothetical protein BN946_scf184636.g10               119   2e-27   
ref|XP_003494215.1|  PREDICTED: dnaJ homolog subfamily A member 1...    116   2e-27   
ref|NP_001274228.1|  DnaJ (Hsp40) homolog, subfamily A, member 1        116   2e-27   
gb|AIS25018.1|  heat shock protein 40                                   116   2e-27   
ref|XP_009166302.1|  hypothetical protein T265_03526                    116   2e-27   
gb|KIK31351.1|  hypothetical protein PISMIDRAFT_26243                   116   2e-27   
gb|KIK08123.1|  hypothetical protein K443DRAFT_128494                   116   2e-27   
emb|CCD75013.1|  putative hsp40, subfamily A, members 1,2,4             115   2e-27   
ref|XP_003395031.1|  PREDICTED: dnaJ homolog subfamily A member 1...    116   2e-27   
gb|KDO27150.1|  hypothetical protein SPRG_07857                         116   3e-27   
ref|NP_001187713.1|  DnaJ-like protein subfamily a member 4             116   3e-27   
ref|XP_005283531.1|  PREDICTED: dnaJ homolog subfamily A member 1       116   3e-27   
gb|ERL94599.1|  hypothetical protein D910_11876                         116   3e-27   
ref|XP_008612573.1|  DnaJ like subfamily A member 2                     116   3e-27   
ref|XP_005490145.1|  PREDICTED: dnaJ homolog subfamily A member 2       115   3e-27   
gb|ERE91501.1|  putative dnaJ subfamily A member 4-like protein         112   3e-27   
emb|CCF74395.1|  unnamed protein product                                115   3e-27   
ref|XP_001362945.2|  PREDICTED: dnaJ homolog subfamily A member 4...    115   3e-27   
ref|NP_001004807.1|  DnaJ subfamily A member 2                          115   3e-27   
ref|XP_004833174.1|  DnaJ domain containing protein                     115   4e-27   
gb|KIK77119.1|  hypothetical protein PAXRUDRAFT_835106                  115   4e-27   
emb|CCA68652.1|  probable YDJ1-mitochondrial and ER import protein      115   4e-27   
gb|KIL69507.1|  hypothetical protein M378DRAFT_20903                    115   4e-27   
ref|XP_005715007.1|  unnamed protein product                            115   4e-27   
emb|CDS28557.1|  dnaJ subfamily A                                       115   4e-27   
ref|XP_001875492.1|  predicted protein                                  115   5e-27   
ref|XP_003784609.1|  PREDICTED: dnaJ homolog subfamily A member 4       115   5e-27   
ref|XP_005822285.1|  hypothetical protein GUITHDRAFT_97880              115   6e-27   
ref|NP_001072848.1|  DnaJ (Hsp40) homolog, subfamily A, member 4,...    115   6e-27   
gb|EGW13880.1|  DnaJ-like subfamily A member 1                          111   7e-27   
ref|XP_011150153.1|  PREDICTED: dnaJ homolog subfamily A member 1       115   7e-27   
ref|XP_005828145.1|  hypothetical protein GUITHDRAFT_158251             114   7e-27   
ref|XP_001511550.1|  PREDICTED: dnaJ homolog subfamily A member 4       114   7e-27   
ref|XP_006114888.1|  PREDICTED: dnaJ homolog subfamily A member 1       114   8e-27   
gb|KDO27145.1|  hypothetical protein SPRG_07853                         114   8e-27   
ref|XP_005526438.1|  PREDICTED: dnaJ homolog subfamily A member 2       114   8e-27   
ref|XP_007057982.1|  PREDICTED: dnaJ homolog subfamily A member 1       114   8e-27   
emb|CCM06079.1|  predicted protein                                      117   9e-27   
gb|KDQ12271.1|  hypothetical protein BOTBODRAFT_419527                  114   9e-27   
ref|XP_008552261.1|  PREDICTED: dnaJ homolog subfamily A member 1       114   1e-26   
ref|XP_006261401.1|  PREDICTED: dnaJ homolog subfamily A member 4       114   1e-26   
emb|CEF67628.1|  DnaJ-like-2                                            114   1e-26   
ref|XP_002765185.1|  DNAJ domain protein, putative                      114   1e-26   
ref|XP_008816960.1|  DnaJ like subfamily A member 2                     114   1e-26   
ref|XP_007520454.1|  PREDICTED: dnaJ homolog subfamily A member 4       114   1e-26   
ref|XP_006027277.1|  PREDICTED: dnaJ homolog subfamily A member 4       114   1e-26   
emb|CCD75012.1|  putative hsp40, subfamily A, members 1,2,4             114   1e-26   
gb|KIJ69543.1|  hypothetical protein HYDPIDRAFT_172911                  114   1e-26   
ref|XP_007625571.1|  PREDICTED: LOW QUALITY PROTEIN: dnaJ homolog...    114   1e-26   
ref|XP_011334056.1|  PREDICTED: dnaJ homolog subfamily A member 4       114   1e-26   
ref|XP_003754938.1|  PREDICTED: dnaJ homolog subfamily A member 4       114   1e-26   
ref|NP_001119620.1|  DnaJ-like                                          114   2e-26   
gb|AAX46634.1|  DnaJ subfamily A member 2                               110   2e-26   
ref|XP_011302182.1|  PREDICTED: dnaJ homolog subfamily A member 1       114   2e-26   
gb|KIM65128.1|  hypothetical protein SCLCIDRAFT_1212624                 114   2e-26   
gb|EJU05619.1|  hypothetical protein DACRYDRAFT_20055                   114   2e-26   
gb|KIK45919.1|  hypothetical protein CY34DRAFT_801078                   114   2e-26   
ref|XP_011252179.1|  PREDICTED: dnaJ homolog subfamily A member 1       113   2e-26   
emb|CBK23334.2|  unnamed protein product                                113   2e-26   
ref|XP_007364587.1|  hypothetical protein DICSQDRAFT_135488             113   2e-26   
gb|KDR81343.1|  hypothetical protein GALMADRAFT_239173                  113   2e-26   
gb|AES12470.1|  heat shock protein 40                                   113   2e-26   
ref|XP_010618179.1|  PREDICTED: LOW QUALITY PROTEIN: dnaJ homolog...    113   2e-26   
gb|KJA27264.1|  hypothetical protein HYPSUDRAFT_198055                  113   2e-26   
ref|XP_003387983.1|  PREDICTED: dnaJ homolog subfamily A member 1...    113   3e-26   
gb|KIJ29865.1|  hypothetical protein M422DRAFT_214779                   113   3e-26   
ref|XP_001833569.1|  chaperone dnaJ 3                                   113   3e-26   
ref|XP_009028927.1|  hypothetical protein HELRODRAFT_95902              113   3e-26   
ref|XP_003694595.1|  PREDICTED: dnaJ homolog subfamily A member 1...    113   3e-26   
ref|XP_009248965.1|  PREDICTED: dnaJ homolog subfamily A member 2       111   3e-26   
ref|XP_003224682.1|  PREDICTED: dnaJ homolog subfamily A member 1       113   3e-26   
gb|EFA74718.1|  heat shock protein                                      113   3e-26   
gb|KDN47527.1|  putative YDJ1-mitochondrial and ER import protein       112   4e-26   
ref|XP_010778685.1|  PREDICTED: dnaJ homolog subfamily A member 4       112   4e-26   
ref|XP_006888325.1|  PREDICTED: dnaJ homolog subfamily A member 4...    112   4e-26   
gb|AAC72887.1|  heat shock protein Ddj1                                 112   4e-26   
gb|EMD34506.1|  hypothetical protein CERSUDRAFT_86596                   112   5e-26   
gb|KIP12385.1|  hypothetical protein PHLGIDRAFT_98388                   112   5e-26   
ref|XP_006641433.1|  PREDICTED: dnaJ homolog subfamily A member 2...    112   5e-26   
gb|ETE65876.1|  DnaJ-like subfamily A member 4                          111   6e-26   
ref|NP_001080625.1|  DnaJ subfamily A member 2                          112   6e-26   
emb|CDJ57769.1|  DnaJ domain-containing protein, putative               112   6e-26   
emb|CDW76720.1|  dnaj protein homolog                                   112   6e-26   
ref|XP_007263805.1|  hypothetical protein FOMMEDRAFT_139033             112   6e-26   
ref|XP_004553185.1|  PREDICTED: dnaJ homolog subfamily A member 1...    112   6e-26   
emb|CDI76051.1|  DnaJ domain-containing protein, putative               112   7e-26   
gb|KIY62309.1|  hypothetical protein CYLTODRAFT_438937                  112   8e-26   
ref|XP_007441498.1|  PREDICTED: dnaJ homolog subfamily A member 4       112   8e-26   
ref|XP_641304.1|  heat shock protein                                    111   9e-26   
ref|XP_005851097.1|  hypothetical protein CHLNCDRAFT_29444              112   9e-26   
emb|CDJ42592.1|  DnaJ domain-containing protein, putative               111   1e-25   
ref|XP_003127042.1|  PREDICTED: dnaJ homolog subfamily A member 2       111   1e-25   
gb|KDO48708.1|  hypothetical protein CISIN_1g015695mg                   111   1e-25   
emb|CDJ62663.1|  DnaJ domain-containing protein, putative               111   1e-25   
emb|CAF98323.1|  unnamed protein product                                111   1e-25   
ref|XP_002426657.1|  protein tumorous imaginal discs, putative          110   1e-25   
gb|KIM30531.1|  hypothetical protein M408DRAFT_15510                    111   1e-25   
ref|XP_009542430.1|  hypothetical protein HETIRDRAFT_407567             111   1e-25   
gb|EMP27743.1|  DnaJ like protein subfamily A member 4                  110   1e-25   
ref|XP_007068411.1|  PREDICTED: dnaJ homolog subfamily A member 4       111   2e-25   
gb|ACM09839.1|  DnaJ homolog subfamily A member 2                       108   2e-25   
ref|XP_006729764.1|  PREDICTED: dnaJ homolog subfamily A member 2       110   2e-25   
gb|AAB69313.1|  Dnj3/Cpr3                                               110   2e-25   
gb|AFS63891.1|  HSP40A4                                                 110   2e-25   
ref|XP_007246543.1|  PREDICTED: dnaJ homolog subfamily A member 4       110   2e-25   
ref|XP_004825473.1|  PREDICTED: dnaJ homolog subfamily A member 2       110   2e-25   
ref|XP_003937295.1|  PREDICTED: dnaJ homolog subfamily A member 2       111   2e-25   
ref|XP_006872627.1|  PREDICTED: dnaJ homolog subfamily A member 2       110   2e-25   
ref|XP_004704755.1|  PREDICTED: dnaJ homolog subfamily A member 2       110   2e-25   
ref|XP_004629252.1|  PREDICTED: dnaJ homolog subfamily A member 2       110   2e-25   
ref|XP_010759695.1|  chaperone DnaJ                                     110   2e-25   
ref|XP_010980930.1|  PREDICTED: dnaJ homolog subfamily A member 2       110   2e-25   
ref|XP_010948491.1|  PREDICTED: dnaJ homolog subfamily A member 2       110   2e-25   
ref|XP_005079250.1|  PREDICTED: dnaJ homolog subfamily A member 2       110   2e-25   
ref|XP_007945027.1|  PREDICTED: dnaJ homolog subfamily A member 2       110   2e-25   
ref|XP_007537773.1|  PREDICTED: dnaJ homolog subfamily A member 2       110   2e-25   
gb|KGB79686.1|  chaperone regulator                                     110   2e-25   
ref|XP_005401468.1|  PREDICTED: dnaJ homolog subfamily A member 2       110   2e-25   
ref|XP_002721610.1|  PREDICTED: dnaJ homolog subfamily A member 2       110   2e-25   
ref|XP_004664889.1|  PREDICTED: dnaJ homolog subfamily A member 2       110   3e-25   
ref|XP_004403732.1|  PREDICTED: dnaJ homolog subfamily A member 2       110   3e-25   
dbj|BAE40948.1|  unnamed protein product                                110   3e-25   
gb|AFR93444.1|  chaperone regulator                                     110   3e-25   
ref|XP_008583923.1|  PREDICTED: dnaJ homolog subfamily A member 2       110   3e-25   
ref|XP_003191198.1|  chaperone regulator                                110   3e-25   
ref|NP_005871.1|  dnaJ homolog subfamily A member 2                     110   3e-25   
ref|XP_001082094.1|  PREDICTED: dnaJ homolog subfamily A member 2       110   3e-25   
ref|XP_002760963.1|  PREDICTED: dnaJ homolog subfamily A member 2       110   3e-25   
ref|NP_062768.1|  dnaJ homolog subfamily A member 2                     110   3e-25   



>gb|AAD12055.1| DnaJ protein [Hevea brasiliensis]
Length=415

 Score =   219 bits (558),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 121/143 (85%), Positives = 127/143 (89%), Gaps = 1/143 (1%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+TKYYEILGV K+ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKREIYDQYGE+ALKEGMGSGGG HDPFDI    F G    GGG S   R++ GED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGSGGGAHDPFDI-FQSFFGGNPFGGGGSSRGRRKEGED  119

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            V+HPLKVSLEDLYNGTSKKLSLS
Sbjct  120  VIHPLKVSLEDLYNGTSKKLSLS  142



>ref|XP_002466747.1| hypothetical protein SORBIDRAFT_01g013390 [Sorghum bicolor]
 gb|EER93745.1| hypothetical protein SORBIDRAFT_01g013390 [Sorghum bicolor]
Length=419

 Score =   218 bits (556),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 132/143 (92%), Positives = 134/143 (94%), Gaps = 0/143 (0%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+TKYYEILGVPK ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKSASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKREIYDQYGE+ALKEGMG GG   DPFDIF SFFG S  GGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGAHVDPFDIFSSFFGPSFGGGGGSSRGRRQRRGED  120

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            VVHPLKVSLEDLYNGTSKKLSLS
Sbjct  121  VVHPLKVSLEDLYNGTSKKLSLS  143



>ref|NP_001051497.1| Os03g0787300 [Oryza sativa Japonica Group]
 gb|AAT75262.1| putative DnaJ like protein [Oryza sativa Japonica Group]
 gb|ABF99246.1| DnaJ protein, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF13411.1| Os03g0787300 [Oryza sativa Japonica Group]
 gb|EAZ28837.1| hypothetical protein OsJ_12871 [Oryza sativa Japonica Group]
 dbj|BAG87697.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96593.1| unnamed protein product [Oryza sativa Japonica Group]
Length=417

 Score =   218 bits (555),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 125/143 (87%), Positives = 130/143 (91%), Gaps = 2/143 (1%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+T+YYE+LGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEVLGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKREIYDQYGE+ALKEGMG GGG HDPFDI           GGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGPGGGMHDPFDI--FSSFFGGGFGGGSSRGRRQRRGED  118

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            VVHPLKVSLE+LYNGTSKKLSLS
Sbjct  119  VVHPLKVSLEELYNGTSKKLSLS  141



>ref|NP_001130317.1| chaperone DNA J2 [Zea mays]
 gb|AAC08009.1| DnaJ-related protein ZMDJ1 [Zea mays]
 gb|ACF78499.1| unknown [Zea mays]
 gb|ACG32917.1| dnaJ protein [Zea mays]
 gb|ACL53813.1| unknown [Zea mays]
 gb|ACN34490.1| unknown [Zea mays]
 gb|ACR38444.1| unknown [Zea mays]
 tpg|DAA50285.1| TPA: chaperone DNA J2 [Zea mays]
Length=419

 Score =   218 bits (555),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 132/143 (92%), Positives = 134/143 (94%), Gaps = 0/143 (0%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+TKYYEILGVPK ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKSASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKREIYDQYGE+ALKEGMG GG   DPFDIF SFFG S  GGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGSHVDPFDIFSSFFGPSFGGGGGSSRGRRQRRGED  120

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            VVHPLKVSLEDLYNGTSKKLSLS
Sbjct  121  VVHPLKVSLEDLYNGTSKKLSLS  143



>ref|XP_006650701.1| PREDICTED: dnaJ protein homolog 2-like [Oryza brachyantha]
Length=418

 Score =   216 bits (550),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 127/143 (89%), Positives = 133/143 (93%), Gaps = 1/143 (1%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+T+YYE+LGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEVLGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKREIYDQYGE+ALKEGMG GGG HDPFDI  S F G    GGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGPGGGMHDPFDI-FSSFFGGGGFGGGSSRGRRQRRGED  119

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            VVHPLKVSL++LYNGTSKKLSLS
Sbjct  120  VVHPLKVSLDELYNGTSKKLSLS  142



>gb|EAY92107.1| hypothetical protein OsI_13813 [Oryza sativa Indica Group]
Length=417

 Score =   216 bits (550),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 124/143 (87%), Positives = 129/143 (90%), Gaps = 2/143 (1%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+T+YYE+LGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEVLGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKREIYDQYGE+ALKEGMG GGG HDP DI           GGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGPGGGMHDPLDI--CSSFFGGGFGGGSSRGRRQRRGED  118

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            VVHPLKVSLE+LYNGTSKKLSLS
Sbjct  119  VVHPLKVSLEELYNGTSKKLSLS  141



>gb|ABG78615.1| J-domain protein [Triticum aestivum]
Length=420

 Score =   213 bits (543),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 133/145 (92%), Positives = 138/145 (95%), Gaps = 3/145 (2%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSDST+YYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDSTRYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfq--sffggspfggggssrgrrqrrg  469
            LSDPEKREIYDQYGE+ALKEGMG GGG HDPFDIFQ     GG+PFGGGGSSRGRRQRRG
Sbjct  61   LSDPEKREIYDQYGEDALKEGMG-GGGMHDPFDIFQSFFGGGGNPFGGGGSSRGRRQRRG  119

Query  470  EDVVHPLKVSLEDLYNGTSKKLSLS  544
            EDVVHPLKVSLE+LYNGTSKKLSL+
Sbjct  120  EDVVHPLKVSLEELYNGTSKKLSLA  144



>gb|AAX95135.1| DnaJ protein, putative [Oryza sativa Japonica Group]
 gb|ABF97900.1| DnaJ protein, putative, expressed [Oryza sativa Japonica Group]
Length=416

 Score =   213 bits (542),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 125/143 (87%), Positives = 128/143 (90%), Gaps = 2/143 (1%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+TKYYEILGVPK ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKTASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKREIYDQYGE+ALKEGMG GG   DPFDI        P  GGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGSHVDPFDI--FSSFFGPSFGGGSSRGRRQRRGED  118

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            V+HPLKVSLEDLYNGTSKKLSLS
Sbjct  119  VIHPLKVSLEDLYNGTSKKLSLS  141



>ref|NP_001050779.1| Os03g0648400 [Oryza sativa Japonica Group]
 gb|AAO72551.1| DNAJ-like protein [Oryza sativa Japonica Group]
 gb|AAU89194.1| DnaJ protein, putative [Oryza sativa Japonica Group]
 gb|ABF97899.1| DnaJ protein, putative, expressed [Oryza sativa Japonica Group]
 gb|ABF97901.1| DnaJ protein, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF12693.1| Os03g0648400 [Oryza sativa Japonica Group]
 gb|EAY94672.1| hypothetical protein OsI_16451 [Oryza sativa Indica Group]
 gb|EAZ27951.1| hypothetical protein OsJ_11911 [Oryza sativa Japonica Group]
 gb|ACA50510.1| DnaJ protein [Oryza sativa Japonica Group]
 dbj|BAG97073.1| unnamed protein product [Oryza sativa Japonica Group]
Length=417

 Score =   213 bits (542),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 129/143 (90%), Positives = 132/143 (92%), Gaps = 1/143 (1%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+TKYYEILGVPK ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKTASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKREIYDQYGE+ALKEGMG GG   DPFDI  S F G  FGGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGSHVDPFDI-FSSFFGPSFGGGGSSRGRRQRRGED  119

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            V+HPLKVSLEDLYNGTSKKLSLS
Sbjct  120  VIHPLKVSLEDLYNGTSKKLSLS  142



>gb|AFW68140.1| putative dnaJ chaperone family protein isoform 1 [Zea mays]
 gb|AFW68141.1| putative dnaJ chaperone family protein isoform 2 [Zea mays]
Length=419

 Score =   213 bits (542),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 130/143 (91%), Positives = 132/143 (92%), Gaps = 0/143 (0%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+TKYYEILGVPK ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKSASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKREIYDQYGE+ALKEGMG GG   DPFDIF SFFG S  GGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGSHADPFDIFSSFFGPSFGGGGGSSRGRRQRRGED  120

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            VVH LKVSLEDLYNG SKKLSLS
Sbjct  121  VVHSLKVSLEDLYNGISKKLSLS  143



>ref|NP_001146715.1| uncharacterized protein LOC100280317 [Zea mays]
 gb|ACL54611.1| unknown [Zea mays]
Length=419

 Score =   213 bits (542),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 130/143 (91%), Positives = 132/143 (92%), Gaps = 0/143 (0%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+TKYYEILGVPK ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKSASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKREIYDQYGE+ALKEGMG GG   DPFDIF SFFG S  GGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGSHADPFDIFSSFFGPSFGGGGGSSRGRRQRRGED  120

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            VVH LKVSLEDLYNG SKKLSLS
Sbjct  121  VVHSLKVSLEDLYNGISKKLSLS  143



>dbj|BAA35121.1| DnaJ homolog [Salix gilgiana]
Length=420

 Score =   212 bits (540),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 130/145 (90%), Positives = 135/145 (93%), Gaps = 2/145 (1%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+TKYYE+LGV K ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEVLGVSKSASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGG-GXHDPFDI-fqsffggspfggggssrgrrqrrg  469
            LSDPEKREIYDQYGE+ALKEGMGSGG G HDPFDI    F GG+PFGGGGSSRGRRQRRG
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGSGGSGAHDPFDIFQSFFGGGNPFGGGGSSRGRRQRRG  120

Query  470  EDVVHPLKVSLEDLYNGTSKKLSLS  544
            EDV+HPLKVS EDLYNGTSKKLSLS
Sbjct  121  EDVIHPLKVSFEDLYNGTSKKLSLS  145



>ref|XP_006650350.1| PREDICTED: dnaJ protein homolog 2-like [Oryza brachyantha]
Length=417

 Score =   209 bits (533),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 128/143 (90%), Positives = 131/143 (92%), Gaps = 1/143 (1%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+TKYYEILGVPK ASQDDLKKAYRKAAIKN PDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKSASQDDLKKAYRKAAIKNPPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKREIYDQYGE+ALKEGMG GG   DPFDI  S F G  FGGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGSHADPFDI-FSSFFGPSFGGGGSSRGRRQRRGED  119

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            V+HPLKVSLEDLYNGTSKKLSLS
Sbjct  120  VIHPLKVSLEDLYNGTSKKLSLS  142



>gb|KJB60379.1| hypothetical protein B456_009G302500 [Gossypium raimondii]
 gb|KJB60380.1| hypothetical protein B456_009G302500 [Gossypium raimondii]
 gb|KJB60381.1| hypothetical protein B456_009G302500 [Gossypium raimondii]
 gb|KJB60382.1| hypothetical protein B456_009G302500 [Gossypium raimondii]
 gb|KJB60383.1| hypothetical protein B456_009G302500 [Gossypium raimondii]
Length=418

 Score =   208 bits (529),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 136/143 (95%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+TKYYEILGVPK ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKTASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKREIYDQYGE+ALKEGMG GGG HDPFDIFQSFFGG+PFGGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGAHDPFDIFQSFFGGNPFGGGGSSRGRRQRRGED  120

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            V+HPLKVSLEDLYNGTSKKLSLS
Sbjct  121  VIHPLKVSLEDLYNGTSKKLSLS  143



>ref|XP_007052233.1| DNAJ [Theobroma cacao]
 gb|EOX96390.1| DNAJ [Theobroma cacao]
Length=421

 Score =   208 bits (529),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 125/143 (87%), Positives = 133/143 (93%), Gaps = 0/143 (0%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGR PKKSD+TKYYE+LGV K ASQD+LKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRVPKKSDNTKYYEVLGVSKTASQDELKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKREIYDQYGE+ALKEGMG G   H+PFDIF+SFFGG  FGGGGSSRGRRQ+RGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGASSHNPFDIFESFFGGGAFGGGGSSRGRRQKRGED  120

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            VVH LKVSLEDLYNGT+KKLSLS
Sbjct  121  VVHSLKVSLEDLYNGTTKKLSLS  143



>gb|KJB84163.1| hypothetical protein B456_N007500 [Gossypium raimondii]
Length=248

 Score =   202 bits (514),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 134/143 (94%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD++KYYEILGV K+ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNSKYYEILGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKREIYDQYGE+ALKEGMGSGGG HDPFDIFQSFFGG+PFG GGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGSGGGGHDPFDIFQSFFGGNPFGAGGSSRGRRQRRGED  120

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            V+HPLKVSLEDLYNGTSKKLSLS
Sbjct  121  VIHPLKVSLEDLYNGTSKKLSLS  143



>gb|EMT10718.1| DnaJ protein-like protein [Aegilops tauschii]
Length=421

 Score =   207 bits (527),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 132/146 (90%), Positives = 137/146 (94%), Gaps = 4/146 (3%)
 Frame = +2

Query  116  MFGRAP-KKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYE  292
            MFGR P KKSDST+YYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYE
Sbjct  1    MFGRGPPKKSDSTRYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYE  60

Query  293  VLSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfq--sffggspfggggssrgrrqrr  466
            VLSDPEKREIYDQYGE+ALKEGMG GGG HDPFDIFQ     GG+PFGGGGSSRGRRQRR
Sbjct  61   VLSDPEKREIYDQYGEDALKEGMG-GGGMHDPFDIFQSFFGGGGNPFGGGGSSRGRRQRR  119

Query  467  gEDVVHPLKVSLEDLYNGTSKKLSLS  544
            GEDVVHPLKVSLE+LYNGTSKKLSL+
Sbjct  120  GEDVVHPLKVSLEELYNGTSKKLSLA  145



>dbj|BAJ91943.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=421

 Score =   207 bits (527),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 132/146 (90%), Positives = 137/146 (94%), Gaps = 4/146 (3%)
 Frame = +2

Query  116  MFGRAP-KKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYE  292
            MFGR P KKSDST+YYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYE
Sbjct  1    MFGRGPPKKSDSTRYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYE  60

Query  293  VLSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfq--sffggspfggggssrgrrqrr  466
            VLSDPEKREIYDQYGE+ALKEGMG GGG HDPFDIFQ     GG+PFGGGGSSRGRRQRR
Sbjct  61   VLSDPEKREIYDQYGEDALKEGMG-GGGMHDPFDIFQSFFGGGGNPFGGGGSSRGRRQRR  119

Query  467  gEDVVHPLKVSLEDLYNGTSKKLSLS  544
            GEDVVHPLKVSLE+LYNGTSKKLSL+
Sbjct  120  GEDVVHPLKVSLEELYNGTSKKLSLA  145



>gb|ABX57881.1| DnaJ [Viola baoshanensis]
Length=417

 Score =   206 bits (525),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 135/143 (94%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+TKYYEILGV K+ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKREIYDQYGE+ALKEGMG GGG HDPFDIFQSFFGG+PFGGGGSSRGRRQR+GED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFQSFFGGNPFGGGGSSRGRRQRKGED  120

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            VVHPLKVSLEDLYNGTSKKLSLS
Sbjct  121  VVHPLKVSLEDLYNGTSKKLSLS  143



>gb|KDO85584.1| hypothetical protein CISIN_1g014800mg [Citrus sinensis]
Length=247

 Score =   201 bits (511),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 115/143 (80%), Positives = 131/143 (92%), Gaps = 0/143 (0%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGR P++S++TKYYEILGV K A++D+LKKAYRKAA+KNHPDKGGDPEKFKEL QAYEV
Sbjct  1    MFGRTPRRSNNTKYYEILGVSKSATEDELKKAYRKAAMKNHPDKGGDPEKFKELGQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKR+IYDQYGE+ALKEGMG  G  H+PFDIF+SFFGG  FG GGSSRGRR+++GED
Sbjct  61   LSDPEKRDIYDQYGEDALKEGMGGAGAAHNPFDIFESFFGGGTFGAGGSSRGRRRKQGED  120

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            VVH LKVSLEDLYNGT+KKLSLS
Sbjct  121  VVHTLKVSLEDLYNGTTKKLSLS  143



>ref|XP_010907982.1| PREDICTED: dnaJ protein homolog [Elaeis guineensis]
Length=417

 Score =   206 bits (524),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 134/143 (94%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGR PKKSD+T+YYEILGVPK+ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRPPKKSDNTRYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKREIYDQYGE+ALKEGMG GGG HDPFDIFQSFFGG+PFGGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFQSFFGGNPFGGGGSSRGRRQRRGED  120

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            V+HPLKVSLEDLYNGTSKKLSLS
Sbjct  121  VIHPLKVSLEDLYNGTSKKLSLS  143



>ref|XP_007010484.1| DNAJ [Theobroma cacao]
 gb|EOY19294.1| DNAJ [Theobroma cacao]
Length=417

 Score =   206 bits (523),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 135/143 (94%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+TKYYEILGV K+ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKREIYDQYGE+ALKEGMG GGG HDPFDIFQSFFGG+PFGGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFQSFFGGNPFGGGGSSRGRRQRRGED  120

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            V+HPLKVSLEDLYNGTSKKLSLS
Sbjct  121  VIHPLKVSLEDLYNGTSKKLSLS  143



>gb|KHG01500.1| Chaperone dnaJ 3 -like protein [Gossypium arboreum]
 gb|KHG06497.1| Chaperone dnaJ 3 -like protein [Gossypium arboreum]
Length=318

 Score =   202 bits (515),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 134/143 (94%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+TKYYEILGV K+ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKREIYDQYGE+ALKEGMGSGGG HDPFDIFQSFFGG+PFG  GSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGSGGGGHDPFDIFQSFFGGNPFGASGSSRGRRQRRGED  120

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            V+HPLKVSLEDLYNGTSKKLSLS
Sbjct  121  VIHPLKVSLEDLYNGTSKKLSLS  143



>ref|XP_010248011.1| PREDICTED: dnaJ protein homolog 2-like [Nelumbo nucifera]
 ref|XP_010248012.1| PREDICTED: dnaJ protein homolog 2-like [Nelumbo nucifera]
Length=417

 Score =   205 bits (522),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 122/143 (85%), Positives = 130/143 (91%), Gaps = 1/143 (1%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAP+KSD+TKYYEILGV K+ASQD+LKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPRKSDNTKYYEILGVSKNASQDELKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSD EKREIYDQYGE+ALKEGMG GG  H+PFDI    F G  FGGGGSSRGRRQ++GED
Sbjct  61   LSDTEKREIYDQYGEDALKEGMGGGGASHNPFDI-FESFFGGGFGGGGSSRGRRQKQGED  119

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            VVH LKVSLEDLYNGTSKKLSLS
Sbjct  120  VVHTLKVSLEDLYNGTSKKLSLS  142



>gb|AGY48884.1| MIP1.2 [Nicotiana benthamiana]
Length=419

 Score =   205 bits (522),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 133/143 (93%), Positives = 138/143 (97%), Gaps = 0/143 (0%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD++KYYEILGVPK ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNSKYYEILGVPKSASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKREIYDQYGE+ALKEGMG GGG HDPFDIFQSFFGG  FGGGGSSRGRRQR+GED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGAHDPFDIFQSFFGGGGFGGGGSSRGRRQRKGED  120

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            VVHPLKVSLEDLY+GTSKKLSLS
Sbjct  121  VVHPLKVSLEDLYSGTSKKLSLS  143



>gb|KJB84165.1| hypothetical protein B456_N007500 [Gossypium raimondii]
Length=333

 Score =   202 bits (515),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 134/143 (94%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD++KYYEILGV K+ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNSKYYEILGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKREIYDQYGE+ALKEGMGSGGG HDPFDIFQSFFGG+PFG GGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGSGGGGHDPFDIFQSFFGGNPFGAGGSSRGRRQRRGED  120

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            V+HPLKVSLEDLYNGTSKKLSLS
Sbjct  121  VIHPLKVSLEDLYNGTSKKLSLS  143



>ref|XP_009766164.1| PREDICTED: dnaJ protein homolog 2-like [Nicotiana sylvestris]
 ref|XP_009766166.1| PREDICTED: dnaJ protein homolog 2-like [Nicotiana sylvestris]
Length=419

 Score =   204 bits (519),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 133/143 (93%), Positives = 137/143 (96%), Gaps = 0/143 (0%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD++KYYEILGVPK ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNSKYYEILGVPKSASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKREIYDQYGE+ALKEGMG GGG HDPFDIFQSFFGG  FGGGGSSRGRRQR+GED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGAHDPFDIFQSFFGGGGFGGGGSSRGRRQRKGED  120

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            VVH LKVSLEDLYNGTSKKLSLS
Sbjct  121  VVHSLKVSLEDLYNGTSKKLSLS  143



>gb|ABI83623.1| DnaJ-like protein [Setaria italica]
Length=419

 Score =   204 bits (519),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 133/143 (93%), Positives = 135/143 (94%), Gaps = 0/143 (0%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+TKYYEILGVPK ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKSASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKREIYDQYGE+ALKEGMG GGG  DPFDIF SFFG S  GGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGHVDPFDIFSSFFGPSFGGGGGSSRGRRQRRGED  120

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            VVHPLKVSLEDLYNGTSKKLSLS
Sbjct  121  VVHPLKVSLEDLYNGTSKKLSLS  143



>ref|XP_008231805.1| PREDICTED: dnaJ protein homolog [Prunus mume]
Length=417

 Score =   204 bits (519),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 136/143 (95%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+TKYYEILGV K ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVSKTASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKREIYDQYGE+ALKEGMG GGG HDPFDIFQSFFGGSPFGGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFQSFFGGSPFGGGGSSRGRRQRRGED  120

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            V+HPLKVSLEDLYNGTSKKLSLS
Sbjct  121  VIHPLKVSLEDLYNGTSKKLSLS  143



>ref|XP_009600920.1| PREDICTED: dnaJ protein homolog [Nicotiana tomentosiformis]
 ref|XP_009600921.1| PREDICTED: dnaJ protein homolog [Nicotiana tomentosiformis]
Length=417

 Score =   204 bits (519),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 134/143 (94%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGR PKKSD+TKYYEILGVPK ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRTPKKSDNTKYYEILGVPKSASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKR+IYDQYGE+ALKEGMG GGG HDPFDIFQSFFGGSPFGGGGSSRGRRQR+GED
Sbjct  61   LSDPEKRDIYDQYGEDALKEGMGGGGGGHDPFDIFQSFFGGSPFGGGGSSRGRRQRKGED  120

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            VVHPLKVSLED+YNGTSKKLSLS
Sbjct  121  VVHPLKVSLEDVYNGTSKKLSLS  143



>ref|XP_004982304.1| PREDICTED: dnaJ protein homolog 2-like [Setaria italica]
Length=419

 Score =   204 bits (519),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 133/143 (93%), Positives = 135/143 (94%), Gaps = 0/143 (0%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+TKYYEILGVPK ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKSASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKREIYDQYGE+ALKEGMG GGG  DPFDIF SFFG S  GGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGHVDPFDIFSSFFGPSFGGGGGSSRGRRQRRGED  120

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            VVHPLKVSLEDLYNGTSKKLSLS
Sbjct  121  VVHPLKVSLEDLYNGTSKKLSLS  143



>emb|CDO99946.1| unnamed protein product [Coffea canephora]
Length=416

 Score =   204 bits (519),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 134/143 (94%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPK+SD+TKYYE+LGV K+ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKRSDNTKYYEVLGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKREIYDQYGE+ALKEGMG GGG HDPFDIFQSFFGGSPFGGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGVHDPFDIFQSFFGGSPFGGGGSSRGRRQRRGED  120

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            V+HPLKVSLEDLYNGTSKKLSLS
Sbjct  121  VIHPLKVSLEDLYNGTSKKLSLS  143



>ref|XP_007211787.1| hypothetical protein PRUPE_ppa006330mg [Prunus persica]
 gb|EMJ12986.1| hypothetical protein PRUPE_ppa006330mg [Prunus persica]
Length=417

 Score =   204 bits (519),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 136/143 (95%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+TKYYEILGV K ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVSKTASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKREIYDQYGE+ALKEGMG GGG HDPFDIFQSFFGGSPFGGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFQSFFGGSPFGGGGSSRGRRQRRGED  120

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            V+HPLKVSLEDLYNGTSKKLSLS
Sbjct  121  VIHPLKVSLEDLYNGTSKKLSLS  143



>gb|AFW67421.1| putative dnaJ chaperone family protein [Zea mays]
Length=417

 Score =   204 bits (519),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 132/143 (92%), Positives = 136/143 (95%), Gaps = 0/143 (0%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+T+YYEILGV KDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKREIYDQYGE+ALKEGMG GGG HDPFDIFQSFFGG    GGGSSRGRRQRRG+D
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGMHDPFDIFQSFFGGGSPFGGGSSRGRRQRRGDD  120

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            VVHPLKVSLEDLYNGTSKKLSLS
Sbjct  121  VVHPLKVSLEDLYNGTSKKLSLS  143



>ref|XP_008354864.1| PREDICTED: dnaJ protein homolog [Malus domestica]
Length=322

 Score =   201 bits (511),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 133/143 (93%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD++KYYEILGV K ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNSKYYEILGVSKTASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKREIYDQYGE+ALKEGMG GGG HDPFDIFQSFFGG+PFGGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFQSFFGGNPFGGGGSSRGRRQRRGED  120

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            V+HPLKVSLEDLYNGTSKKLSL+
Sbjct  121  VIHPLKVSLEDLYNGTSKKLSLA  143



>ref|XP_010933633.1| PREDICTED: dnaJ protein homolog 2-like isoform X2 [Elaeis guineensis]
Length=416

 Score =   203 bits (517),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 119/143 (83%), Positives = 128/143 (90%), Gaps = 1/143 (1%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGR P++SD+TKYYEILGV K+ASQD+LKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRGPRRSDNTKYYEILGVSKNASQDELKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKREIYD+YGE+ALKEGMG GG  H+PFDI    F G    GGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDEYGEDALKEGMGGGGTSHNPFDI-FEQFFGGSAFGGGSSRGRRQRRGED  119

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            VVH LKVSLEDLYNGT+KKLSLS
Sbjct  120  VVHSLKVSLEDLYNGTTKKLSLS  142



>gb|AGY48885.1| MIP1.3 [Nicotiana benthamiana]
Length=418

 Score =   203 bits (517),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 126/144 (88%), Positives = 131/144 (91%), Gaps = 1/144 (1%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+TKYYEILGVPK ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKSASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrg-E  472
            LSDPEKREIYDQYGE+ALKEGMG GGG HDPFDIFQSFFGG    GGG S   R++R  E
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGAHDPFDIFQSFFGGGSPFGGGGSSRGRRQRKGE  120

Query  473  DVVHPLKVSLEDLYNGTSKKLSLS  544
            DVVHPLKVSLED+YNGTSKKLSLS
Sbjct  121  DVVHPLKVSLEDVYNGTSKKLSLS  144



>ref|XP_009623415.1| PREDICTED: dnaJ protein homolog [Nicotiana tomentosiformis]
 ref|XP_009623416.1| PREDICTED: dnaJ protein homolog [Nicotiana tomentosiformis]
Length=420

 Score =   203 bits (517),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 131/143 (92%), Positives = 137/143 (96%), Gaps = 0/143 (0%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGR PKKSD++KYYEILGVPK ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYE+
Sbjct  1    MFGRTPKKSDNSKYYEILGVPKSASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEI  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKREIYDQYGE+ALKEGMG GGG HDPFDIFQSFFGG  FGGGGSSRGRRQR+GED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGAHDPFDIFQSFFGGGGFGGGGSSRGRRQRKGED  120

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            VVHPLKVSLEDLY+GTSKKLSLS
Sbjct  121  VVHPLKVSLEDLYSGTSKKLSLS  143



>ref|XP_008375557.1| PREDICTED: dnaJ protein homolog [Malus domestica]
Length=417

 Score =   203 bits (516),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 134/143 (94%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD++KYYEILGV K ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNSKYYEILGVSKTASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKREIYDQYGE+ALKEGMG GGG HDPFDIFQSFFGG+PFGGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFQSFFGGNPFGGGGSSRGRRQRRGED  120

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            V+HPLKVSLEDLYNGTSKKLSLS
Sbjct  121  VIHPLKVSLEDLYNGTSKKLSLS  143



>gb|KJB84164.1| hypothetical protein B456_N007500 [Gossypium raimondii]
Length=418

 Score =   202 bits (515),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 134/143 (94%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD++KYYEILGV K+ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNSKYYEILGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKREIYDQYGE+ALKEGMGSGGG HDPFDIFQSFFGG+PFG GGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGSGGGGHDPFDIFQSFFGGNPFGAGGSSRGRRQRRGED  120

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            V+HPLKVSLEDLYNGTSKKLSLS
Sbjct  121  VIHPLKVSLEDLYNGTSKKLSLS  143



>gb|KJB84159.1| hypothetical protein B456_N007500 [Gossypium raimondii]
 gb|KJB84160.1| hypothetical protein B456_N007500 [Gossypium raimondii]
 gb|KJB84161.1| hypothetical protein B456_N007500 [Gossypium raimondii]
 gb|KJB84162.1| hypothetical protein B456_N007500 [Gossypium raimondii]
 gb|KJB84166.1| hypothetical protein B456_N007500 [Gossypium raimondii]
Length=418

 Score =   202 bits (515),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 134/143 (94%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD++KYYEILGV K+ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNSKYYEILGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKREIYDQYGE+ALKEGMGSGGG HDPFDIFQSFFGG+PFG GGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGSGGGGHDPFDIFQSFFGGNPFGAGGSSRGRRQRRGED  120

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            V+HPLKVSLEDLYNGTSKKLSLS
Sbjct  121  VIHPLKVSLEDLYNGTSKKLSLS  143



>ref|XP_009418972.1| PREDICTED: dnaJ protein homolog isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=416

 Score =   202 bits (515),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 130/143 (91%), Positives = 135/143 (94%), Gaps = 1/143 (1%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+T+YYEILGVPK ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVPKSASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKRE+YDQYGE+ALKE    GGG HDPFDIF SFFGG PFGGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREVYDQYGEDALKE-GMGGGGGHDPFDIFSSFFGGGPFGGGGSSRGRRQRRGED  119

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            V+HPLKVSLEDLYNGTSKKLSLS
Sbjct  120  VIHPLKVSLEDLYNGTSKKLSLS  142



>ref|XP_003561819.1| PREDICTED: dnaJ protein homolog [Brachypodium distachyon]
Length=420

 Score =   202 bits (515),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 131/143 (92%), Positives = 135/143 (94%), Gaps = 0/143 (0%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+TKYYEILGVPK+ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKREIYDQYGE+ALKEGMG GGG  DPFDIF SFFG S  GGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGVDPFDIFSSFFGPSFGGGGGSSRGRRQRRGED  120

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            V+HPLK SLEDLYNGTSKKLSLS
Sbjct  121  VIHPLKASLEDLYNGTSKKLSLS  143



>gb|ABI18985.1| molecular chaperone DjA2 [Allium ampeloprasum]
Length=418

 Score =   202 bits (514),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 133/143 (93%), Positives = 138/143 (97%), Gaps = 0/143 (0%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+TKYYEILGVPK+AS DDLKKAYRKAAIKNHPDKGGDPEKFKELAQAY+V
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKNASPDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYDV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKREIYDQYGE+ALKEGMG GGG HDPFDIFQSFFGG  FGGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGDHDPFDIFQSFFGGGGFGGGGSSRGRRQRRGED  120

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            VVHPLKVSLE+LYNGTSKKLSLS
Sbjct  121  VVHPLKVSLEELYNGTSKKLSLS  143



>gb|ACN39991.1| unknown [Picea sitchensis]
Length=421

 Score =   202 bits (514),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 128/146 (88%), Gaps = 3/146 (2%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+TKYY+ILGV K A+ D+LKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYDILGVSKSATPDELKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDI---fqsffggspfggggssrgrrqrr  466
            LSDPEKREIYDQYGE+ALKEGMG GG  H+PFDI   F     G    GGGSSRGRRQ++
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGASHNPFDIFESFFGGSFGGSSFGGGSSRGRRQKQ  120

Query  467  gEDVVHPLKVSLEDLYNGTSKKLSLS  544
            GEDVVHPLKVSL+DLYNGTS+KLSLS
Sbjct  121  GEDVVHPLKVSLDDLYNGTSRKLSLS  146



>gb|KDP22008.1| hypothetical protein JCGZ_03128 [Jatropha curcas]
Length=326

 Score =   199 bits (507),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 134/143 (94%), Positives = 138/143 (97%), Gaps = 0/143 (0%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGR PKKSD+TKYYEILGV K+ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRGPKKSDNTKYYEILGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LS PEKREIYDQYGE+ALKEGMG GGG HDPFDIFQSFFGGSPFGGGGSSRGRRQRRGED
Sbjct  61   LSAPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFQSFFGGSPFGGGGSSRGRRQRRGED  120

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            V+HPLKVSLEDLYNGTSKKLSLS
Sbjct  121  VIHPLKVSLEDLYNGTSKKLSLS  143



>ref|XP_006445792.1| hypothetical protein CICLE_v10015385mg [Citrus clementina]
 gb|ESR59032.1| hypothetical protein CICLE_v10015385mg [Citrus clementina]
Length=416

 Score =   202 bits (513),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 127/143 (89%), Positives = 131/143 (92%), Gaps = 1/143 (1%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+TKYYEILGV K+ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKREIYDQYGE+ALKEGMG GGG HDPFDI    F G    GGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGAHDPFDI-FQSFFGGSPFGGGSSRGRRQRRGED  119

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            V+HPLKVSLEDLYNGTSKKLSLS
Sbjct  120  VIHPLKVSLEDLYNGTSKKLSLS  142



>ref|XP_010090486.1| DnaJ-like protein [Morus notabilis]
 gb|EXB39585.1| DnaJ-like protein [Morus notabilis]
Length=417

 Score =   202 bits (513),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 133/143 (93%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGR PKKSD+TKYYE+LGV K+ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRGPKKSDNTKYYEVLGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKREIYDQYGE+ALKEGMG GGG HDPFDIFQSFFGGSPFGGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFQSFFGGSPFGGGGSSRGRRQRRGED  120

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            V+HPLKVSLEDLYNGT+KKLSLS
Sbjct  121  VIHPLKVSLEDLYNGTAKKLSLS  143



>ref|XP_009341572.1| PREDICTED: dnaJ protein homolog [Pyrus x bretschneideri]
Length=417

 Score =   202 bits (513),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 133/143 (93%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD++KYYEILGV K ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNSKYYEILGVSKTASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKREIYDQYGE+ALKEGMG GGG HDPFDIFQSFFGG+PFGGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFQSFFGGNPFGGGGSSRGRRQRRGED  120

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            V+HPLKVSLEDLYNGTSKKLSL+
Sbjct  121  VIHPLKVSLEDLYNGTSKKLSLA  143



>ref|XP_006365672.1| PREDICTED: dnaJ protein homolog isoform X1 [Solanum tuberosum]
Length=419

 Score =   202 bits (513),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 123/145 (85%), Positives = 129/145 (89%), Gaps = 2/145 (1%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+TKYYEILGVPK ASQ+DLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKAASQEDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrg--  469
            LSDPEKREIYDQYGE+ALKEGMG GGG HDPFDIFQSFFGG     GG    R +R+   
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFQSFFGGGGSPFGGGGSSRARRQRRG  120

Query  470  EDVVHPLKVSLEDLYNGTSKKLSLS  544
            EDV+HPLKVSLEDLYNGTSKKLSLS
Sbjct  121  EDVIHPLKVSLEDLYNGTSKKLSLS  145



>ref|XP_010933632.1| PREDICTED: dnaJ protein homolog isoform X1 [Elaeis guineensis]
Length=421

 Score =   202 bits (513),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 119/147 (81%), Positives = 129/147 (88%), Gaps = 4/147 (3%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGR P++SD+TKYYEILGV K+ASQD+LKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRGPRRSDNTKYYEILGVSKNASQDELKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqs----ffggspfggggssrgrrqr  463
            LSDPEKREIYD+YGE+ALKEGMG GG  H+PFDIF+        G    GGGSSRGRRQR
Sbjct  61   LSDPEKREIYDEYGEDALKEGMGGGGTSHNPFDIFEQFFGGSAFGGGAFGGGSSRGRRQR  120

Query  464  rgEDVVHPLKVSLEDLYNGTSKKLSLS  544
            RGEDVVH LKVSLEDLYNGT+KKLSLS
Sbjct  121  RGEDVVHSLKVSLEDLYNGTTKKLSLS  147



>ref|XP_004249937.1| PREDICTED: dnaJ protein homolog [Solanum lycopersicum]
Length=419

 Score =   202 bits (513),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 123/145 (85%), Positives = 129/145 (89%), Gaps = 2/145 (1%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+TKYYEILGVPK ASQ+DLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKAASQEDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrg--  469
            LSDPEKREIYDQYGE+ALKEGMG GGG HDPFDIFQSFFGG     GG    R +R+   
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFQSFFGGGGNPFGGGGSSRARRQRRG  120

Query  470  EDVVHPLKVSLEDLYNGTSKKLSLS  544
            EDV+HPLKVSLEDLYNGTSKKLSLS
Sbjct  121  EDVIHPLKVSLEDLYNGTSKKLSLS  145



>ref|XP_002263156.1| PREDICTED: dnaJ protein homolog [Vitis vinifera]
 ref|XP_010658892.1| PREDICTED: dnaJ protein homolog [Vitis vinifera]
 emb|CBI24994.3| unnamed protein product [Vitis vinifera]
Length=416

 Score =   202 bits (513),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 132/143 (92%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+TKYY++LGV K+ASQ+DLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYDVLGVSKNASQEDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKREIYDQYGE+ALKEGMG GGG HDPFDIFQSFFGG+PFGGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFQSFFGGNPFGGGGSSRGRRQRRGED  120

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            V+HPLKVSLEDLYNGTSKKLSLS
Sbjct  121  VIHPLKVSLEDLYNGTSKKLSLS  143



>ref|XP_006485485.1| PREDICTED: dnaJ protein homolog [Citrus sinensis]
Length=416

 Score =   201 bits (512),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 127/143 (89%), Positives = 131/143 (92%), Gaps = 1/143 (1%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+TKYYEILGV K+ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKREIYDQYGE+ALKEGMG GGG HDPFDI    F G    GGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGAHDPFDI-FQSFFGGSPFGGGSSRGRRQRRGED  119

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            V+HPLKVSLEDLYNGTSKKLSLS
Sbjct  120  VIHPLKVSLEDLYNGTSKKLSLS  142



>ref|XP_009793841.1| PREDICTED: dnaJ protein homolog isoform X1 [Nicotiana sylvestris]
Length=418

 Score =   202 bits (513),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 125/144 (87%), Positives = 130/144 (90%), Gaps = 1/144 (1%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGR PKKSD+TKYYEILGVPK ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRTPKKSDNTKYYEILGVPKSASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrg-E  472
            LSDPEKREIYDQYGE+ALKEGMG GGG HDPFDIFQSFFGG    GGG S   R++R  E
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFQSFFGGGSPFGGGGSSRGRRQRKGE  120

Query  473  DVVHPLKVSLEDLYNGTSKKLSLS  544
            DVVHPLKVSLED+YNGTSKKLSLS
Sbjct  121  DVVHPLKVSLEDVYNGTSKKLSLS  144



>ref|XP_004981504.1| PREDICTED: dnaJ protein homolog [Setaria italica]
Length=418

 Score =   202 bits (513),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 125/144 (87%), Positives = 132/144 (92%), Gaps = 1/144 (1%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+T+YYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrg-E  472
            LSDPEKREIYDQYGE+ALKEGMG GGG HDPFDIFQSFFGG    GGG S   R++R  E
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGMHDPFDIFQSFFGGGSPFGGGGSSRGRRQRKGE  120

Query  473  DVVHPLKVSLEDLYNGTSKKLSLS  544
            DVVHPLKVSL++LYNGTSKKLSLS
Sbjct  121  DVVHPLKVSLDELYNGTSKKLSLS  144



>ref|XP_010031320.1| PREDICTED: dnaJ protein homolog [Eucalyptus grandis]
 ref|XP_010031321.1| PREDICTED: dnaJ protein homolog [Eucalyptus grandis]
 gb|KCW50579.1| hypothetical protein EUGRSUZ_J00292 [Eucalyptus grandis]
Length=417

 Score =   201 bits (512),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 133/143 (93%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+TKYY++LGV K+ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYDVLGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKREIYDQYGE+ALKEGMG GGG HDPFDIFQSFFGGSPFGGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFQSFFGGSPFGGGGSSRGRRQRRGED  120

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            V+HPLKVSLEDLYNGTSKKL+LS
Sbjct  121  VIHPLKVSLEDLYNGTSKKLALS  143



>ref|XP_008345828.1| PREDICTED: dnaJ protein homolog [Malus domestica]
Length=417

 Score =   201 bits (512),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 133/143 (93%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD++KYYEILGV K ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNSKYYEILGVSKTASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKREIYDQYGE+ALKEGMG GGG HDPFDIFQSFFGG+PFGGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFQSFFGGNPFGGGGSSRGRRQRRGED  120

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            V+HPLKVSLEDLYNGTSKKLSL+
Sbjct  121  VIHPLKVSLEDLYNGTSKKLSLA  143



>ref|XP_009793842.1| PREDICTED: dnaJ protein homolog isoform X2 [Nicotiana sylvestris]
Length=412

 Score =   201 bits (512),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 127/143 (89%), Positives = 131/143 (92%), Gaps = 5/143 (3%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGR PKKSD+TKYYEILGVPK ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRTPKKSDNTKYYEILGVPKSASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKREIYDQYGE+ALKEGMG GGG HDPFDI       S FGGGGSSRGRRQR+GED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDI-----FQSFFGGGGSSRGRRQRKGED  115

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            VVHPLKVSLED+YNGTSKKLSLS
Sbjct  116  VVHPLKVSLEDVYNGTSKKLSLS  138



>ref|NP_001168650.1| putative dnaJ chaperone family protein [Zea mays]
 gb|ACN29044.1| unknown [Zea mays]
 tpg|DAA51803.1| TPA: putative dnaJ chaperone family protein [Zea mays]
Length=418

 Score =   201 bits (512),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 133/144 (92%), Positives = 136/144 (94%), Gaps = 1/144 (1%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+T+YYEILGV KDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDI-fqsffggspfggggssrgrrqrrgE  472
            LSDPEKREIYDQYGE+ALKEGMG GGG HDPFDI    F GGSPFGGGGSSRGRRQRRGE
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGMHDPFDIFQSFFGGGSPFGGGGSSRGRRQRRGE  120

Query  473  DVVHPLKVSLEDLYNGTSKKLSLS  544
            DVVHPLKVSLEDLYNGTSKKLSLS
Sbjct  121  DVVHPLKVSLEDLYNGTSKKLSLS  144



>gb|KDO85583.1| hypothetical protein CISIN_1g014800mg [Citrus sinensis]
Length=334

 Score =   199 bits (506),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 115/143 (80%), Positives = 131/143 (92%), Gaps = 0/143 (0%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGR P++S++TKYYEILGV K A++D+LKKAYRKAA+KNHPDKGGDPEKFKEL QAYEV
Sbjct  1    MFGRTPRRSNNTKYYEILGVSKSATEDELKKAYRKAAMKNHPDKGGDPEKFKELGQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKR+IYDQYGE+ALKEGMG  G  H+PFDIF+SFFGG  FG GGSSRGRR+++GED
Sbjct  61   LSDPEKRDIYDQYGEDALKEGMGGAGAAHNPFDIFESFFGGGTFGAGGSSRGRRRKQGED  120

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            VVH LKVSLEDLYNGT+KKLSLS
Sbjct  121  VVHTLKVSLEDLYNGTTKKLSLS  143



>ref|XP_006365673.1| PREDICTED: dnaJ protein homolog isoform X2 [Solanum tuberosum]
Length=412

 Score =   201 bits (511),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 127/143 (89%), Positives = 131/143 (92%), Gaps = 5/143 (3%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+TKYYEILGVPK ASQ+DLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKAASQEDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKREIYDQYGE+ALKEGMG GGG HDPFDI       S FGGGGSSR RRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDI-----FQSFFGGGGSSRARRQRRGED  115

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            V+HPLKVSLEDLYNGTSKKLSLS
Sbjct  116  VIHPLKVSLEDLYNGTSKKLSLS  138



>ref|XP_010258832.1| PREDICTED: dnaJ protein homolog 2-like isoform X1 [Nelumbo nucifera]
Length=413

 Score =   201 bits (511),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 118/143 (83%), Positives = 128/143 (90%), Gaps = 5/143 (3%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MF  AP+KSD+TKYYEILGV K+ASQD+LKKAYRKAAIKNHPDKGGDPEKFK+LAQAYEV
Sbjct  1    MFSCAPRKSDNTKYYEILGVSKNASQDELKKAYRKAAIKNHPDKGGDPEKFKDLAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKR+IYDQYGE+ALKEGMG GG  H+PFDI       S FGGGGSSRGRRQ++GED
Sbjct  61   LSDPEKRDIYDQYGEDALKEGMGVGGASHNPFDI-----FESFFGGGGSSRGRRQKQGED  115

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            VVH LKVSLEDLYNGTSKKLSLS
Sbjct  116  VVHTLKVSLEDLYNGTSKKLSLS  138



>ref|XP_009398344.1| PREDICTED: dnaJ protein homolog 2-like [Musa acuminata subsp. 
malaccensis]
Length=418

 Score =   201 bits (511),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 132/143 (92%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+T+YYEILGV K+ASQ+DLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKNASQEDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKREIYDQYGE+ALKEGMGSGGG H+PFDIF+SFFGGS FGGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGSGGGGHNPFDIFESFFGGSTFGGGGSSRGRRQRRGED  120

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            V+HPLKVSLEDLYNGTSKKLSLS
Sbjct  121  VIHPLKVSLEDLYNGTSKKLSLS  143



>ref|XP_004239737.1| PREDICTED: dnaJ protein homolog [Solanum lycopersicum]
Length=419

 Score =   201 bits (511),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 128/144 (89%), Positives = 132/144 (92%), Gaps = 1/144 (1%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+TKYYEILGVPK A+Q+DLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKTAAQEDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDI-fqsffggspfggggssrgrrqrrgE  472
            LSDPEKREIYDQYGE+ALKEGMG GGG HDPFDI    F G    GGGGSSRGRRQRRGE
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFSSFFGGSPFGGGGGSSRGRRQRRGE  120

Query  473  DVVHPLKVSLEDLYNGTSKKLSLS  544
            DVVHPLKVSLEDLYNGTSKKLSLS
Sbjct  121  DVVHPLKVSLEDLYNGTSKKLSLS  144



>ref|XP_009397426.1| PREDICTED: dnaJ protein homolog [Musa acuminata subsp. malaccensis]
Length=416

 Score =   201 bits (511),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 130/143 (91%), Positives = 138/143 (97%), Gaps = 1/143 (1%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+TKYYEILGVPK+ASQ+DLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKNASQEDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKREIYDQYGE+ALKE    GGG H+PFDIF+SFFGG+PFGGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKE-GMGGGGGHNPFDIFESFFGGNPFGGGGSSRGRRQRRGED  119

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            V+HPLKVSLEDLYNGTSKKLSLS
Sbjct  120  VIHPLKVSLEDLYNGTSKKLSLS  142



>ref|XP_002514419.1| Chaperone protein dnaJ, putative [Ricinus communis]
 gb|ABH06547.1| molecular chaperone [Ricinus communis]
 gb|EEF47915.1| Chaperone protein dnaJ, putative [Ricinus communis]
Length=418

 Score =   201 bits (511),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 134/144 (93%), Positives = 138/144 (96%), Gaps = 1/144 (1%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+TKYYEILGV K+ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKE-GMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgE  472
            LSDPEKREIYDQYGE+ALKE   G GGG HDPFDIFQSFFGGSPFGGGGSSRGRRQRRGE
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGGHDPFDIFQSFFGGSPFGGGGSSRGRRQRRGE  120

Query  473  DVVHPLKVSLEDLYNGTSKKLSLS  544
            DV+HPLKVSLEDLYNGTSKKLSLS
Sbjct  121  DVIHPLKVSLEDLYNGTSKKLSLS  144



>ref|XP_002270362.1| PREDICTED: dnaJ protein homolog isoform X1 [Vitis vinifera]
 emb|CAN64692.1| hypothetical protein VITISV_030671 [Vitis vinifera]
Length=417

 Score =   201 bits (510),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 133/143 (93%), Positives = 137/143 (96%), Gaps = 0/143 (0%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+T+YYE LGV K+ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYETLGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKREIYDQYGE+ALKEGMG  GG HDPFDIFQSFFGGSPFGGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGSGGGHDPFDIFQSFFGGSPFGGGGSSRGRRQRRGED  120

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            VVHPLKVSLEDLY GTSKKLSLS
Sbjct  121  VVHPLKVSLEDLYIGTSKKLSLS  143



>emb|CBI28261.3| unnamed protein product [Vitis vinifera]
Length=394

 Score =   200 bits (508),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 133/143 (93%), Positives = 137/143 (96%), Gaps = 0/143 (0%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+T+YYE LGV K+ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYETLGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKREIYDQYGE+ALKEGMG  GG HDPFDIFQSFFGGSPFGGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGSGGGHDPFDIFQSFFGGSPFGGGGSSRGRRQRRGED  120

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            VVHPLKVSLEDLY GTSKKLSLS
Sbjct  121  VVHPLKVSLEDLYIGTSKKLSLS  143



>ref|XP_009408520.1| PREDICTED: dnaJ protein homolog isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=417

 Score =   200 bits (509),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 128/143 (90%), Positives = 135/143 (94%), Gaps = 0/143 (0%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPK SDST+YYEILGV K+ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKTSDSTRYYEILGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKREIYDQYGE+ALKEGM  GGG H+PFDIF+SFFGGSPFG GGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMRGGGGGHNPFDIFESFFGGSPFGVGGSSRGRRQRRGED  120

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
             +HPLKVSLEDLY+G SKKLSLS
Sbjct  121  AIHPLKVSLEDLYSGISKKLSLS  143



>gb|AAF64454.1|AF239932_1 DnaJ protein [Euphorbia esula]
Length=418

 Score =   200 bits (508),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 134/143 (94%), Positives = 138/143 (97%), Gaps = 0/143 (0%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD++KYYEILGV K ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNSKYYEILGVSKSASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKR+IYDQYGE+ALKEGMG GGG HDPFDIFQSFFGGSPFGGGGSSRGRRQRRGED
Sbjct  61   LSDPEKRDIYDQYGEDALKEGMGGGGGGHDPFDIFQSFFGGSPFGGGGSSRGRRQRRGED  120

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            V HPLKVSLEDLYNGTSKKLSLS
Sbjct  121  VTHPLKVSLEDLYNGTSKKLSLS  143



>ref|NP_001234241.1| DnaJ-like protein [Solanum lycopersicum]
 gb|AAF28382.1|AF124139_1 DnaJ-like protein [Solanum lycopersicum]
Length=419

 Score =   200 bits (508),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 129/145 (89%), Gaps = 2/145 (1%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+TKYYEILGVPK ASQ+DLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKAASQEDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrg--  469
            LSDPEKREIYDQYGE+ALKEGMG GGG H+PFDIFQSFFGG     GG    R +R+   
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHEPFDIFQSFFGGGGNPFGGGGSSRVRRQRRG  120

Query  470  EDVVHPLKVSLEDLYNGTSKKLSLS  544
            EDV+HPLKVSLEDLYNGTSKKLSLS
Sbjct  121  EDVIHPLKVSLEDLYNGTSKKLSLS  145



>ref|XP_011017419.1| PREDICTED: dnaJ protein homolog 2-like isoform X1 [Populus euphratica]
Length=423

 Score =   200 bits (508),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 135/144 (94%), Gaps = 1/144 (1%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAP++SD+ KYYE+LGV K ASQD+LKKAYRKAAIKNHPDKGGDPEKFKEL+QAYEV
Sbjct  1    MFGRAPRRSDNNKYYEVLGVSKGASQDELKKAYRKAAIKNHPDKGGDPEKFKELSQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGG-XHDPFDIfqsffggspfggggssrgrrqrrgE  472
            LSDP+KR+IYDQYGE+ALKEGMG GG   H+P+DIF+SFFGG  FGGGGSSRGRRQ++GE
Sbjct  61   LSDPDKRDIYDQYGEDALKEGMGPGGSDGHNPYDIFESFFGGGGFGGGGSSRGRRQKQGE  120

Query  473  DVVHPLKVSLEDLYNGTSKKLSLS  544
            DVVHPLKVSLEDLYNGTSKKLSLS
Sbjct  121  DVVHPLKVSLEDLYNGTSKKLSLS  144



>gb|AFW67420.1| putative dnaJ chaperone family protein [Zea mays]
Length=415

 Score =   200 bits (508),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 121/143 (85%), Positives = 125/143 (87%), Gaps = 2/143 (1%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+T+YYEILGV KDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKREIYDQYGE+ALKEGMG GGG HDPFDI             G  RGRRQRRG+D
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGMHDPFDI--FQSFFGGGSPFGGIRGRRQRRGDD  118

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            VVHPLKVSLEDLYNGTSKKLSLS
Sbjct  119  VVHPLKVSLEDLYNGTSKKLSLS  141



>emb|CAA63965.1| DnaJ protein [Solanum tuberosum]
Length=419

 Score =   200 bits (508),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 127/144 (88%), Positives = 132/144 (92%), Gaps = 1/144 (1%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAP+KSD+TKYYEILGVPK A+Q+DLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPEKSDNTKYYEILGVPKTAAQEDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDI-fqsffggspfggggssrgrrqrrgE  472
            LSDPEKREIYDQYGE+ALKEGMG GGG HDPFDI    F G    GGGGSSRGRRQRRGE
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFSSFFGGSPFGGGGGSSRGRRQRRGE  120

Query  473  DVVHPLKVSLEDLYNGTSKKLSLS  544
            DVVHPLKVSLEDLYNGTSKKLSLS
Sbjct  121  DVVHPLKVSLEDLYNGTSKKLSLS  144



>ref|XP_004236804.1| PREDICTED: dnaJ protein homolog isoform X1 [Solanum lycopersicum]
Length=418

 Score =   199 bits (507),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 131/143 (92%), Positives = 135/143 (94%), Gaps = 0/143 (0%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+TKYYEILGVP  AS DDLKKAYRKAAIKNHPDKGGDPEKFKE+AQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPNTASPDDLKKAYRKAAIKNHPDKGGDPEKFKEIAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            L+DPEKREIYDQYGE+ALKEGMG GGG HDPFDIFQSFFGG  FGGGGSSRGRRQRRGED
Sbjct  61   LNDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFQSFFGGGGFGGGGSSRGRRQRRGED  120

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            VVHPLKVSLEDLYNG SKKLSLS
Sbjct  121  VVHPLKVSLEDLYNGISKKLSLS  143



>ref|XP_006367020.1| PREDICTED: dnaJ protein homolog 2-like isoform X1 [Solanum tuberosum]
Length=419

 Score =   199 bits (506),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 131/143 (92%), Positives = 135/143 (94%), Gaps = 0/143 (0%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+TKYYEILGVP  AS DDLKKAYRKAAIKNHPDKGGDPEKFKE+AQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPNTASPDDLKKAYRKAAIKNHPDKGGDPEKFKEIAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            L+DPEKREIYDQYGE+ALKEGMG GGG HDPFDIFQSFFGG  FGGGGSSRGRRQRRGED
Sbjct  61   LNDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFQSFFGGGGFGGGGSSRGRRQRRGED  120

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            VVHPLKVSLEDLYNG SKKLSLS
Sbjct  121  VVHPLKVSLEDLYNGISKKLSLS  143



>ref|XP_010651845.1| PREDICTED: dnaJ protein homolog isoform X2 [Vitis vinifera]
Length=417

 Score =   199 bits (506),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 132/143 (92%), Positives = 136/143 (95%), Gaps = 0/143 (0%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+T+YYE LGV K+ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYETLGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKREIYDQYGE+ALKEGMG  GG HDPFDIFQSFFGGSPF GGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGSGGGHDPFDIFQSFFGGSPFAGGGSSRGRRQRRGED  120

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            VVHPLKVSLEDLY GTSKKLSLS
Sbjct  121  VVHPLKVSLEDLYIGTSKKLSLS  143



>ref|XP_006445376.1| hypothetical protein CICLE_v10020330mg [Citrus clementina]
 ref|XP_006464459.1| PREDICTED: dnaJ protein homolog 2-like [Citrus sinensis]
 gb|ESR58616.1| hypothetical protein CICLE_v10020330mg [Citrus clementina]
 gb|KDO85581.1| hypothetical protein CISIN_1g014800mg [Citrus sinensis]
 gb|KDO85582.1| hypothetical protein CISIN_1g014800mg [Citrus sinensis]
Length=418

 Score =   198 bits (504),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 115/143 (80%), Positives = 131/143 (92%), Gaps = 0/143 (0%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGR P++S++TKYYEILGV K A++D+LKKAYRKAA+KNHPDKGGDPEKFKEL QAYEV
Sbjct  1    MFGRTPRRSNNTKYYEILGVSKSATEDELKKAYRKAAMKNHPDKGGDPEKFKELGQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKR+IYDQYGE+ALKEGMG  G  H+PFDIF+SFFGG  FG GGSSRGRR+++GED
Sbjct  61   LSDPEKRDIYDQYGEDALKEGMGGAGAAHNPFDIFESFFGGGTFGAGGSSRGRRRKQGED  120

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            VVH LKVSLEDLYNGT+KKLSLS
Sbjct  121  VVHTLKVSLEDLYNGTTKKLSLS  143



>ref|XP_010053981.1| PREDICTED: dnaJ protein homolog [Eucalyptus grandis]
 gb|KCW78355.1| hypothetical protein EUGRSUZ_D02530 [Eucalyptus grandis]
Length=433

 Score =   198 bits (504),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 117/152 (77%), Positives = 129/152 (85%), Gaps = 9/152 (6%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGR P+KSD+TKYYE+LGVPK+ASQD+LKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRVPRKSDNTKYYEVLGVPKNASQDELKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfgg---------ggssr  448
            LSDPEKR++YDQYGE+ALKEGMG G   HDPFDIF+SFFGG  F G           SSR
Sbjct  61   LSDPEKRDMYDQYGEDALKEGMGGGSAGHDPFDIFESFFGGDSFFGGGFGGRFGGASSSR  120

Query  449  grrqrrgEDVVHPLKVSLEDLYNGTSKKLSLS  544
             RRQ++GEDVV  LKVSLEDLYNGT KKLSLS
Sbjct  121  RRRQKQGEDVVQVLKVSLEDLYNGTMKKLSLS  152



>gb|AGY48883.1| MIP1.1b [Nicotiana benthamiana]
Length=418

 Score =   198 bits (503),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 126/144 (88%), Positives = 133/144 (92%), Gaps = 1/144 (1%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+TKYYEILGVPK AS +DLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKSASPEDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrg-E  472
            LSDPEKREIYDQYGE+ALKEGMG GGG HDPFDIF SFFGGSPFGGGG S   R+++  E
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFSSFFGGSPFGGGGGSSRGRRQKRGE  120

Query  473  DVVHPLKVSLEDLYNGTSKKLSLS  544
            DVVHPLKVSL+DLYNGTSKKLSLS
Sbjct  121  DVVHPLKVSLDDLYNGTSKKLSLS  144



>ref|XP_009418971.1| PREDICTED: dnaJ protein homolog isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=417

 Score =   198 bits (503),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 125/144 (87%), Positives = 130/144 (90%), Gaps = 2/144 (1%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+T+YYEILGVPK ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVPKSASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDI-fqsffggspfggggssrgrrqrrgE  472
            LSDPEKRE+YDQYGE+ALKE    GGG HDPFDI    F GG   GGGGSSRGRRQRRGE
Sbjct  61   LSDPEKREVYDQYGEDALKE-GMGGGGGHDPFDIFSSFFGGGPFGGGGGSSRGRRQRRGE  119

Query  473  DVVHPLKVSLEDLYNGTSKKLSLS  544
            DV+HPLKVSLEDLYNGTSKKLSLS
Sbjct  120  DVIHPLKVSLEDLYNGTSKKLSLS  143



>gb|ABB16980.1| DnaJ-like protein [Solanum tuberosum]
Length=419

 Score =   198 bits (503),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 127/144 (88%), Positives = 131/144 (91%), Gaps = 1/144 (1%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+TKYYEILGVPK A+ +DLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKTAAPEDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDI-fqsffggspfggggssrgrrqrrgE  472
            LSDPEKREIYDQYGE+ALKEGMG GGG HDPFDI    F G    GGGGSSRGRRQRRGE
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFSSFFGGSPFGGGGGSSRGRRQRRGE  120

Query  473  DVVHPLKVSLEDLYNGTSKKLSLS  544
            DVVHPLKVSLEDLYNGTSKKLSLS
Sbjct  121  DVVHPLKVSLEDLYNGTSKKLSLS  144



>ref|XP_006345881.1| PREDICTED: dnaJ protein homolog [Solanum tuberosum]
 gb|ABB16989.1| DnaJ-like protein [Solanum tuberosum]
Length=419

 Score =   198 bits (503),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 127/144 (88%), Positives = 131/144 (91%), Gaps = 1/144 (1%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+TKYYEILGVPK A+ +DLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKTAAPEDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDI-fqsffggspfggggssrgrrqrrgE  472
            LSDPEKREIYDQYGE+ALKEGMG GGG HDPFDI    F G    GGGGSSRGRRQRRGE
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFSSFFGGSPFGGGGGSSRGRRQRRGE  120

Query  473  DVVHPLKVSLEDLYNGTSKKLSLS  544
            DVVHPLKVSLEDLYNGTSKKLSLS
Sbjct  121  DVVHPLKVSLEDLYNGTSKKLSLS  144



>ref|XP_009408521.1| PREDICTED: dnaJ protein homolog isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=416

 Score =   198 bits (503),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 121/143 (85%), Positives = 127/143 (89%), Gaps = 1/143 (1%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPK SDST+YYEILGV K+ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKTSDSTRYYEILGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKREIYDQYGE+ALKEGM  GGG H+PFDI    F G    GGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMRGGGGGHNPFDI-FESFFGGSPFGGGSSRGRRQRRGED  119

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
             +HPLKVSLEDLY+G SKKLSLS
Sbjct  120  AIHPLKVSLEDLYSGISKKLSLS  142



>ref|XP_009406563.1| PREDICTED: dnaJ protein homolog [Musa acuminata subsp. malaccensis]
Length=414

 Score =   197 bits (501),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 124/143 (87%), Positives = 129/143 (90%), Gaps = 2/143 (1%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKS++TKYYE+LGVPK ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSNNTKYYEVLGVPKSASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKREIYDQYGE+ALKE    GGG HDPFDI  S F G    GGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKE-GMGGGGGHDPFDI-FSSFFGGSPFGGGSSRGRRQRRGED  118

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            V+HPLKVSLEDLYNGTSKKLSLS
Sbjct  119  VIHPLKVSLEDLYNGTSKKLSLS  141



>gb|AAG24642.1|AF308737_1 J1P [Daucus carota]
 gb|AAG24643.1|AF308738_1 J2P [Daucus carota]
Length=418

 Score =   197 bits (501),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 133/144 (92%), Positives = 136/144 (94%), Gaps = 1/144 (1%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+TKYYEILGVPK AS DDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKTASPDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKE-GMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgE  472
            LSDPEKREIYDQYGE+ALKE   G GGG HDPFDIFQSFFGGSPFGGGGSSRGRRQRRGE
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGGHDPFDIFQSFFGGSPFGGGGSSRGRRQRRGE  120

Query  473  DVVHPLKVSLEDLYNGTSKKLSLS  544
            DV+HPLKVSLEDL NGTSKKLSLS
Sbjct  121  DVIHPLKVSLEDLCNGTSKKLSLS  144



>gb|ABA46776.1| DnaJ-like protein [Solanum tuberosum]
Length=443

 Score =   198 bits (503),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 127/144 (88%), Positives = 131/144 (91%), Gaps = 1/144 (1%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+TKYYEILGVPK A+ +DLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKTAAPEDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDI-fqsffggspfggggssrgrrqrrgE  472
            LSDPEKREIYDQYGE+ALKEGMG GGG HDPFDI    F G    GGGGSSRGRRQRRGE
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFSSFFGGSPFGGGGGSSRGRRQRRGE  120

Query  473  DVVHPLKVSLEDLYNGTSKKLSLS  544
            DVVHPLKVSLEDLYNGTSKKLSLS
Sbjct  121  DVVHPLKVSLEDLYNGTSKKLSLS  144



>ref|XP_009588725.1| PREDICTED: dnaJ protein homolog [Nicotiana tomentosiformis]
 ref|XP_009588726.1| PREDICTED: dnaJ protein homolog [Nicotiana tomentosiformis]
Length=420

 Score =   197 bits (501),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 126/146 (86%), Positives = 130/146 (89%), Gaps = 3/146 (2%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+TKYYEILGVPK AS +DLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKTASPEDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrg--  469
            LSDPEKREIYDQYGE+ALKEGMG GGG HDPFDIF SFFGGSPFGGG      R RR   
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFSSFFGGSPFGGGMGGGSSRGRRQKR  120

Query  470  -EDVVHPLKVSLEDLYNGTSKKLSLS  544
             EDVVHPLKVSL+DLYNGTSKKLSLS
Sbjct  121  GEDVVHPLKVSLDDLYNGTSKKLSLS  146



>ref|XP_004510114.1| PREDICTED: dnaJ protein homolog 2-like [Cicer arietinum]
Length=421

 Score =   197 bits (501),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 115/143 (80%), Positives = 133/143 (93%), Gaps = 0/143 (0%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGR P+KSD+TKYY+ILGV K+AS+D++KKAYRKAA+KNHPDKGGDPEKFKEL QAYEV
Sbjct  1    MFGRGPRKSDNTKYYDILGVAKNASEDEIKKAYRKAAMKNHPDKGGDPEKFKELGQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEK+E+YDQYGE+ALKEGMG G   H+PFDIF+SFFGG+ FGGGG SRGRRQ++GED
Sbjct  61   LSDPEKKEMYDQYGEDALKEGMGGGSSFHNPFDIFESFFGGAGFGGGGPSRGRRQKQGED  120

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            VVH LKVSLED+YNGT+KKLSLS
Sbjct  121  VVHSLKVSLEDVYNGTTKKLSLS  143



>gb|AFR66645.1| MIP1.1a [Nicotiana benthamiana]
Length=420

 Score =   197 bits (501),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 126/146 (86%), Positives = 130/146 (89%), Gaps = 3/146 (2%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+TKYYEILGVPK AS +DLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKTASPEDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrg--  469
            LSDPEKREIYDQYGE+ALKEGMG GGG HDPFDIF SFFGGSPFGGG      R RR   
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFSSFFGGSPFGGGMGGGSSRGRRQKR  120

Query  470  -EDVVHPLKVSLEDLYNGTSKKLSLS  544
             EDVVHPLKVSL+DLYNGTSKKLSLS
Sbjct  121  GEDVVHPLKVSLDDLYNGTSKKLSLS  146



>ref|NP_001275059.1| DnaJ-like protein [Solanum tuberosum]
 gb|ABB55383.1| DnaJ-like protein-like [Solanum tuberosum]
Length=445

 Score =   197 bits (502),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 127/144 (88%), Positives = 131/144 (91%), Gaps = 1/144 (1%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+TKYYEILGVPK A+ +DLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKTAAPEDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDI-fqsffggspfggggssrgrrqrrgE  472
            LSDPEKREIYDQYGE+ALKEGMG GGG HDPFDI    F G    GGGGSSRGRRQRRGE
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFSSFFGGSPFGGGGGSSRGRRQRRGE  120

Query  473  DVVHPLKVSLEDLYNGTSKKLSLS  544
            DVVHPLKVSLEDLYNGTSKKLSLS
Sbjct  121  DVVHPLKVSLEDLYNGTSKKLSLS  144



>emb|CDP09461.1| unnamed protein product [Coffea canephora]
Length=416

 Score =   197 bits (500),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 106/143 (74%), Positives = 119/143 (83%), Gaps = 4/143 (3%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAP++S+++KYYE+LGV K ASQD+LKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPRRSNNSKYYEVLGVSKSASQDELKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKRE+YDQYGE+ALKEGMG GGG HDPFDI   F               R+++GED
Sbjct  61   LSDPEKRELYDQYGEDALKEGMG-GGGVHDPFDI---FESFFSPLHRRDGFRGRKKQGED  116

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            VVH LKVSL+DLY GTSKKLSLS
Sbjct  117  VVHTLKVSLDDLYKGTSKKLSLS  139



>ref|XP_010685460.1| PREDICTED: dnaJ protein homolog ANJ1 [Beta vulgaris subsp. vulgaris]
Length=417

 Score =   197 bits (500),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 130/143 (91%), Positives = 137/143 (96%), Gaps = 0/143 (0%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSDST+YYEILGVPKDAS +DLK+AY+KAAIKNHPDKGGDPEKFKELA AYEV
Sbjct  1    MFGRAPKKSDSTRYYEILGVPKDASPEDLKRAYKKAAIKNHPDKGGDPEKFKELAHAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKREIYDQYGE+ALKEGMG GGG HDPFDIF SFFGGSPFGGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGMHDPFDIFSSFFGGSPFGGGGSSRGRRQRRGED  120

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            V+HPLKVSLEDL+ GTSKKLSLS
Sbjct  121  VIHPLKVSLEDLFMGTSKKLSLS  143



>ref|XP_011084248.1| PREDICTED: dnaJ protein homolog [Sesamum indicum]
 ref|XP_011084249.1| PREDICTED: dnaJ protein homolog [Sesamum indicum]
Length=418

 Score =   197 bits (500),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 127/144 (88%), Positives = 136/144 (94%), Gaps = 1/144 (1%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+TKYYEILGV K+ASQDDLKKAYRK+AIKNHPDKGGDPEKFKE+AQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVSKNASQDDLKKAYRKSAIKNHPDKGGDPEKFKEIAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKE-GMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgE  472
            LSDPEKREIYDQYGE+ALKE     GG  H+PFDIF+SFFGG+PFGGGGSSRGRRQRRGE
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGSGGGAGHNPFDIFESFFGGNPFGGGGSSRGRRQRRGE  120

Query  473  DVVHPLKVSLEDLYNGTSKKLSLS  544
            DV+HPLKVSLEDLYNGTSKKLSLS
Sbjct  121  DVIHPLKVSLEDLYNGTSKKLSLS  144



>ref|XP_011008852.1| PREDICTED: dnaJ protein homolog isoform X1 [Populus euphratica]
Length=415

 Score =   196 bits (499),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 124/143 (87%), Positives = 129/143 (90%), Gaps = 1/143 (1%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+T+YYEILGV K+ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKREIYDQYGEEALKEGMG GGG H+PFDI    F G    GGG SRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEEALKEGMGGGGGGHNPFDI-FESFFGGNPFGGGGSRGRRQRRGED  119

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            VVHPLKVSLEDLY GTSKKLSL+
Sbjct  120  VVHPLKVSLEDLYLGTSKKLSLT  142



>ref|XP_011008853.1| PREDICTED: dnaJ protein homolog isoform X2 [Populus euphratica]
Length=409

 Score =   196 bits (498),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 122/143 (85%), Positives = 127/143 (89%), Gaps = 7/143 (5%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+T+YYEILGV K+ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKREIYDQYGEEALKEGMG GGG H+PFDI            GGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEEALKEGMGGGGGGHNPFDI-------FESFFGGSSRGRRQRRGED  113

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            VVHPLKVSLEDLY GTSKKLSL+
Sbjct  114  VVHPLKVSLEDLYLGTSKKLSLT  136



>ref|XP_007015642.1| DNAJ isoform 3 [Theobroma cacao]
 gb|EOY33261.1| DNAJ isoform 3 [Theobroma cacao]
Length=320

 Score =   194 bits (492),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 118/143 (83%), Positives = 127/143 (89%), Gaps = 2/143 (1%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+T+YYEILGV K+ASQDDLKKAY+K A KNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKNASQDDLKKAYKKTAFKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKREIYDQYGE+ALK+GMG+ G  HDPFDI  S F G    GGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKDGMGATGA-HDPFDI-FSSFFGGSPFGGGSSRGRRQRRGED  118

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            V+H +KVSLEDLY GTSKKLSLS
Sbjct  119  VIHNMKVSLEDLYLGTSKKLSLS  141



>ref|XP_002313505.1| seed maturation protein PM37 [Populus trichocarpa]
 gb|EEE87460.1| seed maturation protein PM37 [Populus trichocarpa]
Length=415

 Score =   196 bits (498),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 123/143 (86%), Positives = 128/143 (90%), Gaps = 1/143 (1%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+T+YYEILGV K+ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKREIYDQYGEEALKEGMG GG  H+PFDI    F G    GGG SRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEEALKEGMGGGGAGHNPFDI-FESFFGGNPFGGGGSRGRRQRRGED  119

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            VVHPLKVSLEDLY GTSKKLSL+
Sbjct  120  VVHPLKVSLEDLYLGTSKKLSLT  142



>ref|XP_003558043.1| PREDICTED: dnaJ protein homolog [Brachypodium distachyon]
Length=420

 Score =   196 bits (498),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 133/144 (92%), Positives = 140/144 (97%), Gaps = 1/144 (1%)
 Frame = +2

Query  116  MFGRAP-KKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYE  292
            MFGR P KKSD+T+YYEILGVPK+ASQDDLKKAYRK+AIKNHPDKGGDPEKFKE+AQAYE
Sbjct  1    MFGRGPPKKSDNTRYYEILGVPKEASQDDLKKAYRKSAIKNHPDKGGDPEKFKEIAQAYE  60

Query  293  VLSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgE  472
            VLSDPEKREIYDQYGE+ALKEGMG GGG HDPFDIFQSFFGGSPFGGGGSSRGRRQRRGE
Sbjct  61   VLSDPEKREIYDQYGEDALKEGMGGGGGMHDPFDIFQSFFGGSPFGGGGSSRGRRQRRGE  120

Query  473  DVVHPLKVSLEDLYNGTSKKLSLS  544
            DVVHPLKVSLE+LYNGTSKKLSLS
Sbjct  121  DVVHPLKVSLEELYNGTSKKLSLS  144



>ref|XP_002515865.1| Chaperone protein dnaJ, putative [Ricinus communis]
 gb|EEF46534.1| Chaperone protein dnaJ, putative [Ricinus communis]
Length=418

 Score =   196 bits (498),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 126/143 (88%), Positives = 134/143 (94%), Gaps = 0/143 (0%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+TKYYEILGV K+A+QDDLKKAY++AAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVSKNATQDDLKKAYKRAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKREIYDQYGE+ALKEGMG GG  H+PFDIF+SFFGGSPFGGG S  GRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGAGHNPFDIFESFFGGSPFGGGSSRGGRRQRRGED  120

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            VVHPLKVSLEDLY GT KKLSLS
Sbjct  121  VVHPLKVSLEDLYLGTIKKLSLS  143



>gb|EMS59985.1| Chaperone protein dnaJ 2 [Triticum urartu]
Length=317

 Score =   192 bits (489),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 125/145 (86%), Positives = 130/145 (90%), Gaps = 2/145 (1%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+TKYYE+LGVPK+A+QDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEVLGVPKNAAQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXH-DPFDI-fqsffggspfggggssrgrrqrrg  469
            LSDPEKREIYDQYGE+ALKEGMG GGG   DPFDI    F      GGGGSSRGRRQRRG
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGGVDPFDIFSSFFGPSFGGGGGGSSRGRRQRRG  120

Query  470  EDVVHPLKVSLEDLYNGTSKKLSLS  544
            EDVVHPLK SLEDLYNGTSKKLSLS
Sbjct  121  EDVVHPLKASLEDLYNGTSKKLSLS  145



>ref|XP_010907714.1| PREDICTED: dnaJ protein homolog [Elaeis guineensis]
Length=415

 Score =   195 bits (496),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 122/143 (85%), Positives = 128/143 (90%), Gaps = 2/143 (1%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+T+YYEILGV K+ASQ+DLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKNASQEDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKREIYDQYGE+ALKE    GGG HDPFDI    F G    GGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKE-GMGGGGGHDPFDI-FQSFFGGNPFGGGSSRGRRQRRGED  118

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            V+HPLKVSLEDLYNGTSKKLSLS
Sbjct  119  VIHPLKVSLEDLYNGTSKKLSLS  141



>ref|XP_010089281.1| DnaJ-like protein [Morus notabilis]
 gb|EXB37606.1| DnaJ-like protein [Morus notabilis]
Length=419

 Score =   195 bits (496),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 127/144 (88%), Gaps = 2/144 (1%)
 Frame = +2

Query  116  MFGRAPKKS-DSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYE  292
            MFGR P++S D+TKYYE+LGV K ASQ++LKKAYRKAAIKNHPDKGGDPEKFKELAQAYE
Sbjct  1    MFGRMPRRSSDNTKYYEVLGVSKSASQEELKKAYRKAAIKNHPDKGGDPEKFKELAQAYE  60

Query  293  VLSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgE  472
            VL+DPEKREIYDQYGE+ALKEGMG GG  H PFDI    F G  FGGG SSRGRR+++GE
Sbjct  61   VLNDPEKREIYDQYGEDALKEGMGGGGPSHSPFDI-FESFFGGGFGGGPSSRGRRKKQGE  119

Query  473  DVVHPLKVSLEDLYNGTSKKLSLS  544
            DVVH LKVSLEDLYNGT+KKLSLS
Sbjct  120  DVVHTLKVSLEDLYNGTTKKLSLS  143



>ref|XP_004169945.1| PREDICTED: dnaJ protein homolog [Cucumis sativus]
 sp|Q04960.1|DNJH_CUCSA RecName: Full=DnaJ protein homolog; AltName: Full=DNAJ-1; Flags: 
Precursor [Cucumis sativus]
 emb|CAA47925.1| cs DnaJ-1 [Cucumis sativus]
 gb|KGN52169.1| hypothetical protein Csa_5G613470 [Cucumis sativus]
Length=413

 Score =   195 bits (495),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 132/143 (92%), Positives = 136/143 (95%), Gaps = 2/143 (1%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGR PKKSD+TKYYEILGV K+ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGR-PKKSDNTKYYEILGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  59

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKREIYDQYGE+ALKE    GGG HDPFDIFQSFFGGSPFGGGGSSRGRRQRRGED
Sbjct  60   LSDPEKREIYDQYGEDALKE-GMGGGGGHDPFDIFQSFFGGSPFGGGGSSRGRRQRRGED  118

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            V+HPLKVSLEDLYNGTSKKLSLS
Sbjct  119  VIHPLKVSLEDLYNGTSKKLSLS  141



>ref|XP_008446732.1| PREDICTED: dnaJ protein homolog [Cucumis melo]
Length=413

 Score =   195 bits (495),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 132/143 (92%), Positives = 136/143 (95%), Gaps = 2/143 (1%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGR PKKSD+TKYYEILGV K+ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGR-PKKSDNTKYYEILGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  59

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKREIYDQYGE+ALKE    GGG HDPFDIFQSFFGGSPFGGGGSSRGRRQRRGED
Sbjct  60   LSDPEKREIYDQYGEDALKE-GMGGGGGHDPFDIFQSFFGGSPFGGGGSSRGRRQRRGED  118

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            V+HPLKVSLEDLYNGTSKKLSLS
Sbjct  119  VIHPLKVSLEDLYNGTSKKLSLS  141



>ref|XP_008787761.1| PREDICTED: dnaJ protein homolog [Phoenix dactylifera]
Length=415

 Score =   195 bits (495),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 122/143 (85%), Positives = 127/143 (89%), Gaps = 2/143 (1%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+T+YYEILGV K ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKSASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKREIYDQYGE+ALKE    GGG HDPFDI    F G    GGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKE-GMGGGGGHDPFDI-FQSFFGGNPFGGGSSRGRRQRRGED  118

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            V+HPLKVSLEDLYNGT+KKLSLS
Sbjct  119  VIHPLKVSLEDLYNGTAKKLSLS  141



>ref|XP_011024143.1| PREDICTED: dnaJ protein homolog [Populus euphratica]
 ref|XP_011024144.1| PREDICTED: dnaJ protein homolog [Populus euphratica]
Length=422

 Score =   195 bits (495),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 128/146 (88%), Positives = 133/146 (91%), Gaps = 3/146 (2%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+TKYYEILGV K ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVSKSASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKE--GMGSGGGXHDPFDI-fqsffggspfggggssrgrrqrr  466
            LSDPEKREIYDQYGE+ALKE  G   GGG HDPFDI    F GG+PFGGGGSSRGRRQRR
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGSGGGGAHDPFDIFQSFFGGGNPFGGGGSSRGRRQRR  120

Query  467  gEDVVHPLKVSLEDLYNGTSKKLSLS  544
            GEDV+HPLKVSLED+YNGTSKKLSLS
Sbjct  121  GEDVIHPLKVSLEDIYNGTSKKLSLS  146



>ref|XP_002316479.1| DnaJ family protein [Populus trichocarpa]
 gb|ABK95315.1| unknown [Populus trichocarpa]
 gb|EEF02650.1| DnaJ family protein [Populus trichocarpa]
Length=422

 Score =   194 bits (494),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 129/146 (88%), Positives = 134/146 (92%), Gaps = 3/146 (2%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+TKYYEILGV K ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVSKSASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKE--GMGSGGGXHDPFDI-fqsffggspfggggssrgrrqrr  466
            LSDPEKREIYDQYGE+ALKE  G G GGG HDPFDI    F GG+PFGGGGSSRGRRQRR
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGGAHDPFDIFQSFFGGGNPFGGGGSSRGRRQRR  120

Query  467  gEDVVHPLKVSLEDLYNGTSKKLSLS  544
            GEDV+HPLKVSLED+YNGTSKKLSLS
Sbjct  121  GEDVIHPLKVSLEDIYNGTSKKLSLS  146



>ref|XP_007015641.1| DNAJ isoform 2 [Theobroma cacao]
 gb|EOY33260.1| DNAJ isoform 2 [Theobroma cacao]
Length=414

 Score =   194 bits (493),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 118/143 (83%), Positives = 127/143 (89%), Gaps = 2/143 (1%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+T+YYEILGV K+ASQDDLKKAY+K A KNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKNASQDDLKKAYKKTAFKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKREIYDQYGE+ALK+GMG+ G  HDPFDI  S F G    GGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKDGMGATGA-HDPFDI-FSSFFGGSPFGGGSSRGRRQRRGED  118

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            V+H +KVSLEDLY GTSKKLSLS
Sbjct  119  VIHNMKVSLEDLYLGTSKKLSLS  141



>ref|XP_009760224.1| PREDICTED: dnaJ protein homolog [Nicotiana sylvestris]
 ref|XP_009760225.1| PREDICTED: dnaJ protein homolog [Nicotiana sylvestris]
Length=420

 Score =   194 bits (493),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 129/146 (88%), Gaps = 3/146 (2%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRA KKSD+TKYYEILGVPK AS +DLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRATKKSDNTKYYEILGVPKTASPEDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrg--  469
            LSDPEKREIYDQYGE+ALKEGMG GGG HDPFDIF SFFGGSPFGGG      R RR   
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFSSFFGGSPFGGGMGGGSSRGRRQKR  120

Query  470  -EDVVHPLKVSLEDLYNGTSKKLSLS  544
             EDVVHPLKVSL+DLYNGTSKKLSLS
Sbjct  121  GEDVVHPLKVSLDDLYNGTSKKLSLS  146



>ref|XP_006378828.1| hypothetical protein POPTR_0010s24930g [Populus trichocarpa]
 gb|ERP56625.1| hypothetical protein POPTR_0010s24930g [Populus trichocarpa]
Length=459

 Score =   195 bits (495),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 129/146 (88%), Positives = 134/146 (92%), Gaps = 3/146 (2%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+TKYYEILGV K ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVSKSASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKE--GMGSGGGXHDPFDI-fqsffggspfggggssrgrrqrr  466
            LSDPEKREIYDQYGE+ALKE  G G GGG HDPFDI    F GG+PFGGGGSSRGRRQRR
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGGAHDPFDIFQSFFGGGNPFGGGGSSRGRRQRR  120

Query  467  gEDVVHPLKVSLEDLYNGTSKKLSLS  544
            GEDV+HPLKVSLED+YNGTSKKLSLS
Sbjct  121  GEDVIHPLKVSLEDIYNGTSKKLSLS  146



>ref|XP_011032891.1| PREDICTED: dnaJ protein homolog [Populus euphratica]
 ref|XP_011032892.1| PREDICTED: dnaJ protein homolog [Populus euphratica]
Length=420

 Score =   194 bits (492),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 127/145 (88%), Positives = 132/145 (91%), Gaps = 2/145 (1%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+TKYYE+LGV K ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEVLGVSKSASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKE-GMGSGGGXHDPFDI-fqsffggspfggggssrgrrqrrg  469
            LSDPEKREIYDQYGE+ALKE   G GGG HDPFDI    F GG+PFGGGGSSRGRRQRRG
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGGHDPFDIFQSFFGGGNPFGGGGSSRGRRQRRG  120

Query  470  EDVVHPLKVSLEDLYNGTSKKLSLS  544
            EDV+HPLKVS EDLYNGTSKKLSLS
Sbjct  121  EDVIHPLKVSFEDLYNGTSKKLSLS  145



>ref|XP_004306421.1| PREDICTED: dnaJ protein homolog [Fragaria vesca subsp. vesca]
Length=410

 Score =   194 bits (492),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 117/144 (81%), Positives = 122/144 (85%), Gaps = 10/144 (7%)
 Frame = +2

Query  116  MFGR-APKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYE  292
            MFGR  PKKSD++KYYEILGVPK ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYE
Sbjct  1    MFGRGVPKKSDNSKYYEILGVPKTASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYE  60

Query  293  VLSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgE  472
            VLSDPEKREIYDQYGE+ALKEGMG GGG HDPFDI         F        RRQRRGE
Sbjct  61   VLSDPEKREIYDQYGEDALKEGMGGGGGAHDPFDI---------FQSFFGGGSRRQRRGE  111

Query  473  DVVHPLKVSLEDLYNGTSKKLSLS  544
            DV+HPLKVSLEDLY+GTSKKLSLS
Sbjct  112  DVIHPLKVSLEDLYSGTSKKLSLS  135



>ref|XP_009622737.1| PREDICTED: dnaJ protein homolog 2-like [Nicotiana tomentosiformis]
 ref|XP_009622738.1| PREDICTED: dnaJ protein homolog 2-like [Nicotiana tomentosiformis]
Length=421

 Score =   194 bits (492),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 110/145 (76%), Positives = 124/145 (86%), Gaps = 2/145 (1%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAP++SD++KYYE+LGV K ASQD+LKKAYRKAAI+NHPDKGGDPEKFK LAQAY+V
Sbjct  1    MFGRAPRRSDNSKYYEVLGVSKSASQDELKKAYRKAAIRNHPDKGGDPEKFKGLAQAYDV  60

Query  296  LSDPEKREIYDQYGEEALKEGMG-SGGGXHDPFDI-fqsffggspfggggssrgrrqrrg  469
            LSDPEKR+IYDQYGE+ALKEGMG SGGG H  FDI    F GGS  GG    R  RQ++G
Sbjct  61   LSDPEKRDIYDQYGEDALKEGMGSSGGGVHSHFDIFESFFGGGSFGGGSSRFRASRQKQG  120

Query  470  EDVVHPLKVSLEDLYNGTSKKLSLS  544
            EDVVH L+VSLEDLYNGT+KKLSLS
Sbjct  121  EDVVHTLRVSLEDLYNGTTKKLSLS  145



>ref|XP_007015640.1| DNAJ isoform 1 [Theobroma cacao]
 gb|EOY33259.1| DNAJ isoform 1 [Theobroma cacao]
Length=431

 Score =   193 bits (491),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 118/143 (83%), Positives = 127/143 (89%), Gaps = 2/143 (1%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+T+YYEILGV K+ASQDDLKKAY+K A KNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKNASQDDLKKAYKKTAFKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKREIYDQYGE+ALK+GMG+ G  HDPFDI  S F G    GGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKDGMGATGA-HDPFDI-FSSFFGGSPFGGGSSRGRRQRRGED  118

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            V+H +KVSLEDLY GTSKKLSLS
Sbjct  119  VIHNMKVSLEDLYLGTSKKLSLS  141



>ref|XP_002310999.1| DnaJ family protein [Populus trichocarpa]
 gb|EEE88366.1| DnaJ family protein [Populus trichocarpa]
Length=420

 Score =   193 bits (490),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 125/145 (86%), Positives = 131/145 (90%), Gaps = 2/145 (1%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+TKYYE+LGV K ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEVLGVSKSASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKE-GMGSGGGXHDPFDI-fqsffggspfggggssrgrrqrrg  469
            LSDPEKREIYDQYGE+ALKE   G G G HDPFDI    F GG+PFGGGGSSRGRRQRRG
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGSGAHDPFDIFQSFFGGGNPFGGGGSSRGRRQRRG  120

Query  470  EDVVHPLKVSLEDLYNGTSKKLSLS  544
            EDV+HPLKVS ED+YNGTSKKLSLS
Sbjct  121  EDVIHPLKVSFEDIYNGTSKKLSLS  145



>ref|XP_010031575.1| PREDICTED: dnaJ protein homolog [Eucalyptus grandis]
 gb|KCW50935.1| hypothetical protein EUGRSUZ_J00583 [Eucalyptus grandis]
Length=416

 Score =   193 bits (490),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 123/143 (86%), Positives = 130/143 (91%), Gaps = 1/143 (1%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+T+YYE+LGV K+ASQ+DLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEVLGVSKNASQEDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKREIYDQYGE+ALKEGMG GGG HDPFDI  S F G    GGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDI-FSSFFGGSGFGGGSSRGRRQRRGED  119

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            VVHPLK SLEDLY GT+KKLSLS
Sbjct  120  VVHPLKASLEDLYLGTTKKLSLS  142



>ref|XP_004953339.1| PREDICTED: dnaJ protein homolog 2-like [Setaria italica]
Length=421

 Score =   192 bits (489),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 117/146 (80%), Positives = 128/146 (88%), Gaps = 3/146 (2%)
 Frame = +2

Query  116  MFGRAPKK-SDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYE  292
            MFGR P+K S++TKYYE+LGV K ASQD+LKKAYRKAAIKNHPDKGGDPEKFKEL+QAYE
Sbjct  1    MFGRMPRKTSNNTKYYEVLGVSKSASQDELKKAYRKAAIKNHPDKGGDPEKFKELSQAYE  60

Query  293  VLSDPEKREIYDQYGEEALKEGMGSGGGX--HDPFDIfqsffggspfggggssrgrrqrr  466
            VLSDPEKREIYDQYGE+ALKEGMG G     H PFDIF+  F GS   GGGSSRGRRQ+R
Sbjct  61   VLSDPEKREIYDQYGEDALKEGMGGGSSSDFHSPFDIFEQLFPGSGTFGGGSSRGRRQKR  120

Query  467  gEDVVHPLKVSLEDLYNGTSKKLSLS  544
            GEDVVH +KVSLEDLYNGT+KKLSLS
Sbjct  121  GEDVVHTMKVSLEDLYNGTTKKLSLS  146



>gb|EMT20603.1| DnaJ protein-like protein [Aegilops tauschii]
Length=421

 Score =   192 bits (489),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 125/145 (86%), Positives = 130/145 (90%), Gaps = 2/145 (1%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+TKYYE+LGVPK+A+QDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEVLGVPKNAAQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXH-DPFDI-fqsffggspfggggssrgrrqrrg  469
            LSDPEKREIYDQYGE+ALKEGMG GGG   DPFDI    F      GGGGSSRGRRQRRG
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGGVDPFDIFSSFFGPSFGGGGGGSSRGRRQRRG  120

Query  470  EDVVHPLKVSLEDLYNGTSKKLSLS  544
            EDVVHPLK SLEDLYNGTSKKLSLS
Sbjct  121  EDVVHPLKASLEDLYNGTSKKLSLS  145



>gb|EMS60670.1| DnaJ protein-like protein [Triticum urartu]
Length=446

 Score =   193 bits (490),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 132/171 (77%), Positives = 137/171 (80%), Gaps = 29/171 (17%)
 Frame = +2

Query  116  MFGRAP-KKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEK---------  265
            MFGR P KKSDST+YYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEK         
Sbjct  1    MFGRGPPKKSDSTRYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKVSARRISHP  60

Query  266  ----------------FKELAQAYEVLSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDI  397
                            FKELAQAYEVLSDPEKREIYDQYGE+ALKEGMG GGG HDPFDI
Sbjct  61   STTDLFPIGITRLVDLFKELAQAYEVLSDPEKREIYDQYGEDALKEGMG-GGGMHDPFDI  119

Query  398  fq--sffggspfggggssrgrrqrrgEDVVHPLKVSLEDLYNGTSKKLSLS  544
            FQ     GG+PFGGGGSSRGRRQRRGEDVVHPLKVSLE+LYNGTSKKLSL+
Sbjct  120  FQSFFGGGGNPFGGGGSSRGRRQRRGEDVVHPLKVSLEELYNGTSKKLSLA  170



>ref|NP_001267695.1| dnaJ protein homolog [Cucumis sativus]
 gb|ADF30255.1| heat shock protein [Cucumis sativus]
Length=413

 Score =   192 bits (488),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 130/143 (91%), Positives = 134/143 (94%), Gaps = 2/143 (1%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGR PKKSD+TKYYEILGV K+ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAY V
Sbjct  1    MFGR-PKKSDNTKYYEILGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYGV  59

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKREIYDQYGE+ALKE    GGG HDPFDIFQSFFGGSPFGGGGSSRGRRQR GED
Sbjct  60   LSDPEKREIYDQYGEDALKE-GMGGGGGHDPFDIFQSFFGGSPFGGGGSSRGRRQRGGED  118

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            V+HPLKVSLEDLYNGTSKKLSLS
Sbjct  119  VIHPLKVSLEDLYNGTSKKLSLS  141



>gb|KJB35427.1| hypothetical protein B456_006G117100 [Gossypium raimondii]
Length=248

 Score =   187 bits (474),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 123/143 (86%), Positives = 128/143 (90%), Gaps = 1/143 (1%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKS +T+YYEILGV  +ASQDDLKKAY+KAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSTNTRYYEILGVSNNASQDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKREIYDQYGE+ALKEGMG G G HDPFDI  S F G    GGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGAGAHDPFDI-FSSFFGGSPFGGGSSRGRRQRRGED  119

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            VVHPLKVSLEDLY GTSKKLSLS
Sbjct  120  VVHPLKVSLEDLYLGTSKKLSLS  142



>ref|XP_001768102.1| predicted protein [Physcomitrella patens]
 gb|EDQ66975.1| predicted protein [Physcomitrella patens]
Length=419

 Score =   191 bits (485),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 128/145 (88%), Gaps = 2/145 (1%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGR PKKSD+TKYYE LGV K ASQD+LKKAYRKAAIKNHPDKGGDPEKFKEL+QAYEV
Sbjct  1    MFGRMPKKSDNTKYYETLGVSKSASQDELKKAYRKAAIKNHPDKGGDPEKFKELSQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDI--fqsffggspfggggssrgrrqrrg  469
            LSDPEKRE+YDQYGE+ALKEGMG GGG H+PFDI       GGSPFGG G   GRRQRRG
Sbjct  61   LSDPEKRELYDQYGEDALKEGMGGGGGGHNPFDIFESFFGGGGSPFGGNGRGGGRRQRRG  120

Query  470  EDVVHPLKVSLEDLYNGTSKKLSLS  544
            EDVVHPLKVSLEDLYNGTSKKLSLS
Sbjct  121  EDVVHPLKVSLEDLYNGTSKKLSLS  145



>gb|ACU24346.1| unknown [Glycine max]
Length=420

 Score =   191 bits (485),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 114/144 (79%), Positives = 134/144 (93%), Gaps = 1/144 (1%)
 Frame = +2

Query  116  MFGRA-PKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYE  292
            MFGR  P++SD++KYY+ILG+ K+AS+D++KKAYRKAA+KNHPDKGGDPEKFKEL QAYE
Sbjct  1    MFGRGGPRRSDNSKYYDILGISKNASEDEIKKAYRKAAMKNHPDKGGDPEKFKELGQAYE  60

Query  293  VLSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgE  472
            VLSDPEK+E+YDQYGE+ALKEGMG GG  H+PFDIF+SFFGG+ FGGGGSSRGRRQ+ GE
Sbjct  61   VLSDPEKKELYDQYGEDALKEGMGGGGSFHNPFDIFESFFGGASFGGGGSSRGRRQKHGE  120

Query  473  DVVHPLKVSLEDLYNGTSKKLSLS  544
            DVVH LKVSLED+YNGT+KKLSLS
Sbjct  121  DVVHSLKVSLEDVYNGTTKKLSLS  144



>ref|NP_001047626.1| Os02g0656500 [Oryza sativa Japonica Group]
 emb|CAC39071.1| DnaJ-like protein [Oryza sativa]
 dbj|BAF09540.1| Os02g0656500 [Oryza sativa Japonica Group]
Length=420

 Score =   191 bits (485),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 120/145 (83%), Gaps = 5/145 (3%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            M+GR PKKS++TKYYE+LGV K A+QD+LKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MYGRMPKKSNNTKYYEVLGVSKTATQDELKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGX--HDPFDIfqsffggspfggggssrgrrqrrg  469
            L+DPEKREIYDQYGE+ALKEGMG G     H PFD+   F       GG   RG RQ+RG
Sbjct  61   LNDPEKREIYDQYGEDALKEGMGGGSSSDFHSPFDL---FEQIFQNRGGFGGRGHRQKRG  117

Query  470  EDVVHPLKVSLEDLYNGTSKKLSLS  544
            EDVVH +KVSLEDLYNGT+KKLSLS
Sbjct  118  EDVVHTMKVSLEDLYNGTTKKLSLS  142



>ref|XP_003521084.1| PREDICTED: dnaJ protein homolog 2-like [Glycine max]
 gb|KHN43746.1| Chaperone protein dnaJ 2 [Glycine soja]
Length=420

 Score =   191 bits (485),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 114/144 (79%), Positives = 134/144 (93%), Gaps = 1/144 (1%)
 Frame = +2

Query  116  MFGRA-PKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYE  292
            MFGR  P++SD++KYY+ILG+ K+AS+D++KKAYRKAA+KNHPDKGGDPEKFKEL QAYE
Sbjct  1    MFGRGGPRRSDNSKYYDILGISKNASEDEIKKAYRKAAMKNHPDKGGDPEKFKELGQAYE  60

Query  293  VLSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgE  472
            VLSDPEK+E+YDQYGE+ALKEGMG GG  H+PFDIF+SFFGG+ FGGGGSSRGRRQ+ GE
Sbjct  61   VLSDPEKKELYDQYGEDALKEGMGGGGSFHNPFDIFESFFGGASFGGGGSSRGRRQKHGE  120

Query  473  DVVHPLKVSLEDLYNGTSKKLSLS  544
            DVVH LKVSLED+YNGT+KKLSLS
Sbjct  121  DVVHSLKVSLEDVYNGTTKKLSLS  144



>gb|AGY48887.1| MIP1.4b [Nicotiana benthamiana]
Length=418

 Score =   191 bits (485),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 125/143 (87%), Positives = 138/143 (97%), Gaps = 0/143 (0%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGR PKKSD+T+YYEILGVPK+AS+D++KKAYRKAA+KNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRGPKKSDNTRYYEILGVPKNASEDEIKKAYRKAAMKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSD +KREIYDQYGE+ALKEGMG GGG HDPFDIF+SFFGG+PFGGGGSSRGRRQRRGED
Sbjct  61   LSDSQKREIYDQYGEDALKEGMGGGGGMHDPFDIFESFFGGNPFGGGGSSRGRRQRRGED  120

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            VVHPLKVSLEDLY+G +KKLSLS
Sbjct  121  VVHPLKVSLEDLYSGITKKLSLS  143



>gb|EEC73725.1| hypothetical protein OsI_08334 [Oryza sativa Indica Group]
Length=420

 Score =   191 bits (485),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 120/145 (83%), Gaps = 5/145 (3%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            M+GR PKKS++TKYYE+LGV K A+QD+LKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MYGRMPKKSNNTKYYEVLGVSKTATQDELKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGX--HDPFDIfqsffggspfggggssrgrrqrrg  469
            L+DPEKREIYDQYGE+ALKEGMG G     H PFD+   F       GG   RG RQ+RG
Sbjct  61   LNDPEKREIYDQYGEDALKEGMGGGSSSDFHSPFDL---FEQIFQNRGGFGGRGHRQKRG  117

Query  470  EDVVHPLKVSLEDLYNGTSKKLSLS  544
            EDVVH +KVSLEDLYNGT+KKLSLS
Sbjct  118  EDVVHTMKVSLEDLYNGTTKKLSLS  142



>ref|XP_003529049.1| PREDICTED: dnaJ protein homolog 2-like [Glycine max]
 gb|KHN34491.1| Chaperone protein dnaJ 2 [Glycine soja]
Length=420

 Score =   190 bits (483),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 114/144 (79%), Positives = 134/144 (93%), Gaps = 1/144 (1%)
 Frame = +2

Query  116  MFGRA-PKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYE  292
            MFGR  P++SD++KYY+ILGV K+AS+D++KKAYRKAA+KNHPDKGGDPEKFKEL QAYE
Sbjct  1    MFGRGGPRRSDNSKYYDILGVSKNASEDEIKKAYRKAAMKNHPDKGGDPEKFKELGQAYE  60

Query  293  VLSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgE  472
            VLSDPEK+++YDQYGE+ALKEGMG GG  H+PFDIF+SFFGG+ FGGGGSSRGRRQ+ GE
Sbjct  61   VLSDPEKKDLYDQYGEDALKEGMGGGGSFHNPFDIFESFFGGASFGGGGSSRGRRQKHGE  120

Query  473  DVVHPLKVSLEDLYNGTSKKLSLS  544
            DVVH LKVSLED+YNGT+KKLSLS
Sbjct  121  DVVHSLKVSLEDVYNGTTKKLSLS  144



>ref|XP_002446897.1| hypothetical protein SORBIDRAFT_06g024520 [Sorghum bicolor]
 gb|EES11225.1| hypothetical protein SORBIDRAFT_06g024520 [Sorghum bicolor]
Length=418

 Score =   190 bits (483),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 107/143 (75%), Positives = 122/143 (85%), Gaps = 1/143 (1%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAP++S++TKYYE+LGV   ASQD+LKKAYRKAAIK+HPDKGGDPEKFKEL+QAYEV
Sbjct  1    MFGRAPRRSNNTKYYEVLGVSNTASQDELKKAYRKAAIKSHPDKGGDPEKFKELSQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKREIYDQYGE+ LKEGMG G   H+PFDI    F G    GG SSR RRQ+RG+D
Sbjct  61   LSDPEKREIYDQYGEDGLKEGMGGGSDYHNPFDI-FEQFFGGGAFGGSSSRVRRQKRGDD  119

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            VVH LKVSLED+YNG +K+LSLS
Sbjct  120  VVHSLKVSLEDVYNGATKRLSLS  142



>gb|EEE57509.1| hypothetical protein OsJ_07792 [Oryza sativa Japonica Group]
Length=452

 Score =   191 bits (484),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 120/145 (83%), Gaps = 5/145 (3%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            M+GR PKKS++TKYYE+LGV K A+QD+LKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  33   MYGRMPKKSNNTKYYEVLGVSKTATQDELKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  92

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGX--HDPFDIfqsffggspfggggssrgrrqrrg  469
            L+DPEKREIYDQYGE+ALKEGMG G     H PFD+   F       GG   RG RQ+RG
Sbjct  93   LNDPEKREIYDQYGEDALKEGMGGGSSSDFHSPFDL---FEQIFQNRGGFGGRGHRQKRG  149

Query  470  EDVVHPLKVSLEDLYNGTSKKLSLS  544
            EDVVH +KVSLEDLYNGT+KKLSLS
Sbjct  150  EDVVHTMKVSLEDLYNGTTKKLSLS  174



>ref|XP_001755408.1| predicted protein [Physcomitrella patens]
 gb|EDQ79888.1| predicted protein [Physcomitrella patens]
Length=419

 Score =   189 bits (481),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 123/146 (84%), Positives = 133/146 (91%), Gaps = 3/146 (2%)
 Frame = +2

Query  116  MFGRAP-KKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYE  292
            MFGRAP KKSD++KYY++LGVPK ASQD+LKKAYRKAAIKNHPDKGGDPEKFKELAQAYE
Sbjct  1    MFGRAPSKKSDNSKYYDVLGVPKSASQDELKKAYRKAAIKNHPDKGGDPEKFKELAQAYE  60

Query  293  VLSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsff--ggspfggggssrgrrqrr  466
            VLSDPEKREIYDQYGE+ALKEGMG GGG H+PFDIF+SFF    +PFGG     GRRQRR
Sbjct  61   VLSDPEKREIYDQYGEDALKEGMGGGGGGHNPFDIFESFFGGASNPFGGSSGRGGRRQRR  120

Query  467  gEDVVHPLKVSLEDLYNGTSKKLSLS  544
            GEDVVHPLKVSL+DLYNGTSKKLSLS
Sbjct  121  GEDVVHPLKVSLDDLYNGTSKKLSLS  146



>ref|XP_008803820.1| PREDICTED: dnaJ protein homolog 2-like [Phoenix dactylifera]
Length=417

 Score =   189 bits (481),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 118/144 (82%), Positives = 125/144 (87%), Gaps = 2/144 (1%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAP+KS++TKYYEILGV K+ASQD+LKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPRKSNNTKYYEILGVSKNASQDELKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKE-GMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgE  472
            LSDPEKREIYDQYGE+ALKE   G GG  H+PFDI    F G    GG SSRG RQRRGE
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGASHNPFDI-FEQFFGGGAFGGSSSRGHRQRRGE  119

Query  473  DVVHPLKVSLEDLYNGTSKKLSLS  544
            DVVH LKVSLEDLYNGTSKKLSLS
Sbjct  120  DVVHTLKVSLEDLYNGTSKKLSLS  143



>ref|NP_001136581.1| putative dnaJ chaperone family protein [Zea mays]
 gb|ACF82216.1| unknown [Zea mays]
 gb|AFW72634.1| putative dnaJ chaperone family protein [Zea mays]
Length=422

 Score =   189 bits (481),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 115/146 (79%), Positives = 128/146 (88%), Gaps = 3/146 (2%)
 Frame = +2

Query  116  MFGRAPKKS-DSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYE  292
            MFGR P+KS ++TKYYE+LGV K ASQD+LKKAYRKAAIKNHPDKGGDPEKFKEL+QAY+
Sbjct  1    MFGRMPRKSSNNTKYYEVLGVSKTASQDELKKAYRKAAIKNHPDKGGDPEKFKELSQAYD  60

Query  293  VLSDPEKREIYDQYGEEALKEGMGSGGGX--HDPFDIfqsffggspfggggssrgrrqrr  466
            VLSDPEKREIYDQYGE+ALKEGMG G     H PFDIF+  F GS   GGGSSRGRRQ+R
Sbjct  61   VLSDPEKREIYDQYGEDALKEGMGGGSSSDFHSPFDIFEQLFPGSSTFGGGSSRGRRQKR  120

Query  467  gEDVVHPLKVSLEDLYNGTSKKLSLS  544
            GEDVVH +KVSL+DLYNGT+KKLSLS
Sbjct  121  GEDVVHTMKVSLDDLYNGTTKKLSLS  146



>gb|KHG17902.1| Chaperone dnaJ 3 -like protein [Gossypium arboreum]
Length=417

 Score =   189 bits (480),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 124/143 (87%), Positives = 130/143 (91%), Gaps = 1/143 (1%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKS++T+YYEILGV K+ASQDDLKKAY+KAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSNNTRYYEILGVSKNASQDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKREIYDQYGE+ALKEGMG G G HDPFDI  S F G    GGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGAGAHDPFDI-FSSFFGGSPFGGGSSRGRRQRRGED  119

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            VVHPLKVSLEDLY GTSKKLSLS
Sbjct  120  VVHPLKVSLEDLYLGTSKKLSLS  142



>ref|XP_006826444.1| hypothetical protein AMTR_s00004p00172570 [Amborella trichopoda]
 gb|ERM93681.1| hypothetical protein AMTR_s00004p00172570 [Amborella trichopoda]
Length=419

 Score =   189 bits (479),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 122/144 (85%), Positives = 129/144 (90%), Gaps = 2/144 (1%)
 Frame = +2

Query  116  MFGRA-PKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYE  292
            MFGRA PKKSD+T+YYEILGV K+ASQ+DLK+AYRKAAIKNHPDKGGDPEKFKELAQAYE
Sbjct  1    MFGRAAPKKSDNTRYYEILGVSKNASQEDLKRAYRKAAIKNHPDKGGDPEKFKELAQAYE  60

Query  293  VLSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgE  472
            VLSD EKREIYDQYGE+ALKEGMG G G HDPFDI    F G    GGGSSRGRRQRRGE
Sbjct  61   VLSDREKREIYDQYGEDALKEGMGGGAGGHDPFDI-FQSFFGGNPFGGGSSRGRRQRRGE  119

Query  473  DVVHPLKVSLEDLYNGTSKKLSLS  544
            DVVHPLKVSLE+LYNGTSKKLSLS
Sbjct  120  DVVHPLKVSLEELYNGTSKKLSLS  143



>gb|KJB35428.1| hypothetical protein B456_006G117100 [Gossypium raimondii]
Length=318

 Score =   186 bits (472),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 123/143 (86%), Positives = 128/143 (90%), Gaps = 1/143 (1%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKS +T+YYEILGV  +ASQDDLKKAY+KAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSTNTRYYEILGVSNNASQDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKREIYDQYGE+ALKEGMG G G HDPFDI  S F G    GGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGAGAHDPFDI-FSSFFGGSPFGGGSSRGRRQRRGED  119

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            VVHPLKVSLEDLY GTSKKLSLS
Sbjct  120  VVHPLKVSLEDLYLGTSKKLSLS  142



>ref|XP_002454540.1| hypothetical protein SORBIDRAFT_04g032970 [Sorghum bicolor]
 gb|EES07516.1| hypothetical protein SORBIDRAFT_04g032970 [Sorghum bicolor]
Length=420

 Score =   189 bits (479),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 123/146 (84%), Gaps = 4/146 (3%)
 Frame = +2

Query  116  MFGRAPKKS-DSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYE  292
            MFGR P+KS ++TKYYE+LGV K ASQD+LKKAYRKAAIKNHPDKGGDPEKFKEL+QAY+
Sbjct  1    MFGRMPRKSSNNTKYYEVLGVSKTASQDELKKAYRKAAIKNHPDKGGDPEKFKELSQAYD  60

Query  293  VLSDPEKREIYDQYGEEALKEGMGSGGGX--HDPFDIfqsffggspfggggssrgrrqrr  466
            VLSDPEKREIYDQYGE+ALKEGMG GG    H PFDI          G GG SRGRRQ+R
Sbjct  61   VLSDPEKREIYDQYGEDALKEGMGGGGSSDFHSPFDI-FEQLFPGSSGFGGGSRGRRQKR  119

Query  467  gEDVVHPLKVSLEDLYNGTSKKLSLS  544
            GEDVVH +KVSLEDLYNGT+KKLSLS
Sbjct  120  GEDVVHTMKVSLEDLYNGTTKKLSLS  145



>ref|XP_002301248.1| DnaJ family protein [Populus trichocarpa]
 gb|EEE80521.1| DnaJ family protein [Populus trichocarpa]
Length=425

 Score =   189 bits (479),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 136/145 (94%), Gaps = 2/145 (1%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAP++SD+TKYYE+LGV K ASQD+LKKAYRKAAIKNHPDKGGDPEKFKEL+QAYEV
Sbjct  1    MFGRAPRRSDNTKYYEVLGVSKGASQDELKKAYRKAAIKNHPDKGGDPEKFKELSQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKE--GMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrg  469
            LSDP+KR+IYDQYGE+ALKE  G G GGG H+P+DIF+SFFGG  FGGGGSSRGRRQ++G
Sbjct  61   LSDPDKRDIYDQYGEDALKEGMGPGGGGGGHNPYDIFESFFGGGGFGGGGSSRGRRQKQG  120

Query  470  EDVVHPLKVSLEDLYNGTSKKLSLS  544
            EDVVHPLKVSLEDLYNGTSKKLSLS
Sbjct  121  EDVVHPLKVSLEDLYNGTSKKLSLS  145



>ref|XP_006386554.1| hypothetical protein POPTR_0002s14200g [Populus trichocarpa]
 gb|ERP64351.1| hypothetical protein POPTR_0002s14200g [Populus trichocarpa]
Length=424

 Score =   188 bits (478),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 136/145 (94%), Gaps = 2/145 (1%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAP++SD+TKYYE+LGV K ASQD+LKKAYRKAAIKNHPDKGGDPEKFKEL+QAYEV
Sbjct  1    MFGRAPRRSDNTKYYEVLGVSKGASQDELKKAYRKAAIKNHPDKGGDPEKFKELSQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKE--GMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrg  469
            LSDP+KR+IYDQYGE+ALKE  G G GGG H+P+DIF+SFFGG  FGGGGSSRGRRQ++G
Sbjct  61   LSDPDKRDIYDQYGEDALKEGMGPGGGGGGHNPYDIFESFFGGGGFGGGGSSRGRRQKQG  120

Query  470  EDVVHPLKVSLEDLYNGTSKKLSLS  544
            EDVVHPLKVSLEDLYNGTSKKLSLS
Sbjct  121  EDVVHPLKVSLEDLYNGTSKKLSLS  145



>emb|CAC12824.1| putative DNAJ protein [Nicotiana tabacum]
Length=418

 Score =   187 bits (476),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 124/143 (87%), Positives = 136/143 (95%), Gaps = 0/143 (0%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGR PKKSD+T+YYEILGV K+AS D++KKAYRKAA+KNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRGPKKSDNTRYYEILGVSKNASDDEIKKAYRKAAMKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSD +KREIYDQYGE+ALKEGMG GGG HDPFDIF+SFFGG+PFGGGGSSRGRRQRRGED
Sbjct  61   LSDSQKREIYDQYGEDALKEGMGGGGGMHDPFDIFESFFGGNPFGGGGSSRGRRQRRGED  120

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            VVHPLKVSLEDLY+G +KKLSLS
Sbjct  121  VVHPLKVSLEDLYSGITKKLSLS  143



>ref|XP_006647626.1| PREDICTED: dnaJ protein homolog 2-like isoform X1 [Oryza brachyantha]
Length=423

 Score =   187 bits (476),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 105/145 (72%), Positives = 119/145 (82%), Gaps = 4/145 (3%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGR PKKS++TKYYE+LGV K A+QD+LKKAYRKAAIKNHPDKGGDPEKFKE++QAYEV
Sbjct  1    MFGRMPKKSNNTKYYEVLGVSKTATQDELKKAYRKAAIKNHPDKGGDPEKFKEISQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGX--HDPFDIfqsffggspfggggssrgrrqrrg  469
            L+DPEKR+IYDQYGE+ALKEGMG G     H PFD+           G G  RG RQ+RG
Sbjct  61   LNDPEKRDIYDQYGEDALKEGMGGGSSSDFHSPFDL--FEQLFQGRSGFGVGRGHRQKRG  118

Query  470  EDVVHPLKVSLEDLYNGTSKKLSLS  544
            EDVVH +KVSLEDLYNGT+KKLSLS
Sbjct  119  EDVVHTMKVSLEDLYNGTTKKLSLS  143



>ref|XP_006647627.1| PREDICTED: dnaJ protein homolog 2-like isoform X2 [Oryza brachyantha]
Length=422

 Score =   187 bits (476),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 105/145 (72%), Positives = 119/145 (82%), Gaps = 5/145 (3%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGR PKKS++TKYYE+LGV K A+QD+LKKAYRKAAIKNHPDKGGDPEKFKE++QAYEV
Sbjct  1    MFGRMPKKSNNTKYYEVLGVSKTATQDELKKAYRKAAIKNHPDKGGDPEKFKEISQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGX--HDPFDIfqsffggspfggggssrgrrqrrg  469
            L+DPEKR+IYDQYGE+ALKEGMG G     H PFD+   F        G   RG RQ+RG
Sbjct  61   LNDPEKRDIYDQYGEDALKEGMGGGSSSDFHSPFDL---FEQLFQGRSGFGGRGHRQKRG  117

Query  470  EDVVHPLKVSLEDLYNGTSKKLSLS  544
            EDVVH +KVSLEDLYNGT+KKLSLS
Sbjct  118  EDVVHTMKVSLEDLYNGTTKKLSLS  142



>ref|XP_001782829.1| predicted protein [Physcomitrella patens]
 gb|EDQ52343.1| predicted protein [Physcomitrella patens]
Length=415

 Score =   187 bits (475),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 122/143 (85%), Gaps = 2/143 (1%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGR PKKSD+TKYY++LGV K ASQD+LK+AYRKAAIKNHPDKGGDPEKFKEL+QAYEV
Sbjct  1    MFGRMPKKSDNTKYYDVLGVSKSASQDELKRAYRKAAIKNHPDKGGDPEKFKELSQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKR++YDQYGE+ALKEGMG GGG H+PFDI          G G     RRQRRGED
Sbjct  61   LSDPEKRDLYDQYGEDALKEGMGGGGGGHNPFDI--FESFFGGGGSGSGRGSRRQRRGED  118

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            VVHPLKVSLE+LYNGTSKKLSLS
Sbjct  119  VVHPLKVSLEELYNGTSKKLSLS  141



>gb|KJB41003.1| hypothetical protein B456_007G087000 [Gossypium raimondii]
 gb|KJB41005.1| hypothetical protein B456_007G087000 [Gossypium raimondii]
Length=423

 Score =   187 bits (475),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 123/143 (86%), Positives = 134/143 (94%), Gaps = 0/143 (0%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGR PKKSD+TK+YE+LGVPK ASQD+LKKAY+KAAIKNHPDKGGDPEKFKELA AYEV
Sbjct  1    MFGRVPKKSDNTKFYEVLGVPKSASQDELKKAYKKAAIKNHPDKGGDPEKFKELAHAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKREIYDQYGE+ALKEGMG GG  H+PFDIF+SFFGG  FGGGGSSRGRRQ+RGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGSSHNPFDIFESFFGGGAFGGGGSSRGRRQKRGED  120

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            VVH LKVSLE+LYNGT+KKLSLS
Sbjct  121  VVHALKVSLEELYNGTTKKLSLS  143



>ref|XP_009789005.1| PREDICTED: dnaJ protein homolog [Nicotiana sylvestris]
Length=418

 Score =   187 bits (474),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 124/143 (87%), Positives = 136/143 (95%), Gaps = 0/143 (0%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGR PKKSD+T+YYEILGV K+AS D++KKAYRKAA+KNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRGPKKSDNTRYYEILGVSKNASDDEIKKAYRKAAMKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSD +KREIYDQYGE+ALKEGMG GGG HDPFDIF+SFFGG+PFGGGGSSRGRRQRRGED
Sbjct  61   LSDSQKREIYDQYGEDALKEGMGGGGGMHDPFDIFESFFGGNPFGGGGSSRGRRQRRGED  120

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            VVHPLKVSLEDLY+G +KKLSLS
Sbjct  121  VVHPLKVSLEDLYSGITKKLSLS  143



>gb|KJB35426.1| hypothetical protein B456_006G117100 [Gossypium raimondii]
Length=417

 Score =   186 bits (473),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 123/143 (86%), Positives = 128/143 (90%), Gaps = 1/143 (1%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKS +T+YYEILGV  +ASQDDLKKAY+KAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSTNTRYYEILGVSNNASQDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKREIYDQYGE+ALKEGMG G G HDPFDI  S F G    GGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGAGAHDPFDI-FSSFFGGSPFGGGSSRGRRQRRGED  119

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            VVHPLKVSLEDLY GTSKKLSLS
Sbjct  120  VVHPLKVSLEDLYLGTSKKLSLS  142



>ref|XP_010919645.1| PREDICTED: dnaJ protein homolog [Elaeis guineensis]
 ref|XP_010919646.1| PREDICTED: dnaJ protein homolog [Elaeis guineensis]
Length=417

 Score =   186 bits (473),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 116/144 (81%), Positives = 124/144 (86%), Gaps = 2/144 (1%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRA ++S++TKYYEILGV K+ASQD+LKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAQRRSNNTKYYEILGVSKNASQDELKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKE-GMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgE  472
            LSDPEKREIYDQYGE+ALKE   G GG  H+PFDI    F G    GG SSRG RQRRGE
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGASHNPFDI-FEQFFGGGAFGGSSSRGHRQRRGE  119

Query  473  DVVHPLKVSLEDLYNGTSKKLSLS  544
            DVVH LKVSLEDLYNGTSKKLSLS
Sbjct  120  DVVHTLKVSLEDLYNGTSKKLSLS  143



>emb|CAH67501.1| OSIGBa0134H18.3 [Oryza sativa Indica Group]
 gb|EAY95074.1| hypothetical protein OsI_16890 [Oryza sativa Indica Group]
Length=416

 Score =   186 bits (472),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 123/143 (86%), Gaps = 2/143 (1%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGR P+ S++TKYYE+LGVPK AS+D+LKKAYRKAAIKNHPDKGGDPEKFKEL+QAYEV
Sbjct  1    MFGRVPR-SNNTKYYEVLGVPKTASKDELKKAYRKAAIKNHPDKGGDPEKFKELSQAYEV  59

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            L+DPEKR+IYDQYGE+ALK+GMG G   H+PFDI    F G    GG SSR RRQRRGED
Sbjct  60   LTDPEKRDIYDQYGEDALKDGMGGGSDFHNPFDI-FEQFFGGGAFGGSSSRVRRQRRGED  118

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            VVH LKVSLED+YNG+ KKLSLS
Sbjct  119  VVHTLKVSLEDVYNGSMKKLSLS  141



>gb|EPS59846.1| hypothetical protein M569_14958, partial [Genlisea aurea]
Length=247

 Score =   181 bits (460),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 120/145 (83%), Positives = 132/145 (91%), Gaps = 2/145 (1%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+++YY+ILGVPK AS DDLK+AYRKAAIKNHPDKGGDPEKFKEL+ AY+V
Sbjct  2    MFGRAPKKSDNSRYYDILGVPKSASPDDLKRAYRKAAIKNHPDKGGDPEKFKELSHAYDV  61

Query  296  LSDPEKREIYDQYGEEALKE--GMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrg  469
            LSDPEKREIY+QYGE+ALKE  G G GGG HDPFDIF SFFGGS FG GGSSRGRRQR+G
Sbjct  62   LSDPEKREIYNQYGEDALKEGMGGGGGGGMHDPFDIFSSFFGGSHFGAGGSSRGRRQRKG  121

Query  470  EDVVHPLKVSLEDLYNGTSKKLSLS  544
            +D+V PLKVSLEDLY GTSKKLSLS
Sbjct  122  DDLVQPLKVSLEDLYTGTSKKLSLS  146



>emb|CAA04447.1| DnaJ-like protein [Medicago sativa]
 gb|AAC19391.1| DnaJ-like protein MsJ1 [Medicago sativa]
Length=423

 Score =   186 bits (471),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 110/146 (75%), Positives = 127/146 (87%), Gaps = 4/146 (3%)
 Frame = +2

Query  116  MFGRAP-KKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYE  292
            MFGR P +KSD+TKYY+ILGV K AS+D++KKAYRKAA+KNHPDKGGDPEKFKEL QAYE
Sbjct  1    MFGRGPTRKSDNTKYYDILGVSKSASEDEIKKAYRKAAMKNHPDKGGDPEKFKELGQAYE  60

Query  293  VLSDPEKREIYDQYGEEALKEGMGSGGGX--HDPFDIfqsffggspfggggssrgrrqrr  466
            VLSDPEK+E+YDQYGE+ALKEGMG G G   H+PFDI    F G+ FGGGG SR RRQ++
Sbjct  61   VLSDPEKKELYDQYGEDALKEGMGGGAGSSFHNPFDI-FESFFGAGFGGGGPSRARRQKQ  119

Query  467  gEDVVHPLKVSLEDLYNGTSKKLSLS  544
            GEDVVH +KVSLED+YNGT+KKLSLS
Sbjct  120  GEDVVHSIKVSLEDVYNGTTKKLSLS  145



>gb|ACJ84518.1| unknown [Medicago truncatula]
Length=423

 Score =   186 bits (471),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 110/146 (75%), Positives = 127/146 (87%), Gaps = 4/146 (3%)
 Frame = +2

Query  116  MFGRAP-KKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYE  292
            MFGR P +KSD+TKYY+ILGV K AS+D++KKAYRKAA+KNHPDKGGDPEKFKEL QAYE
Sbjct  1    MFGRGPTRKSDNTKYYDILGVSKSASEDEIKKAYRKAAMKNHPDKGGDPEKFKELGQAYE  60

Query  293  VLSDPEKREIYDQYGEEALKEGMGSGGGX--HDPFDIfqsffggspfggggssrgrrqrr  466
            VLSDPEK+E+YDQYGE+ALKEGMG G G   H+PFDI    F G+ FGGGG SR RRQ++
Sbjct  61   VLSDPEKKELYDQYGEDALKEGMGGGAGSSFHNPFDI-FESFFGAGFGGGGPSRARRQKQ  119

Query  467  gEDVVHPLKVSLEDLYNGTSKKLSLS  544
            GEDVVH +KVSLED+YNGT+KKLSLS
Sbjct  120  GEDVVHSIKVSLEDVYNGTTKKLSLS  145



>ref|XP_003626730.1| DnaJ protein-like protein [Medicago truncatula]
 gb|AET01206.1| DnaJ-class molecular chaperone [Medicago truncatula]
Length=423

 Score =   186 bits (471),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 110/146 (75%), Positives = 127/146 (87%), Gaps = 4/146 (3%)
 Frame = +2

Query  116  MFGRAP-KKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYE  292
            MFGR P +KSD+TKYY+ILGV K AS+D++KKAYRKAA+KNHPDKGGDPEKFKEL QAYE
Sbjct  1    MFGRGPTRKSDNTKYYDILGVSKSASEDEIKKAYRKAAMKNHPDKGGDPEKFKELGQAYE  60

Query  293  VLSDPEKREIYDQYGEEALKEGMGSGGGX--HDPFDIfqsffggspfggggssrgrrqrr  466
            VLSDPEK+E+YDQYGE+ALKEGMG G G   H+PFDI    F G+ FGGGG SR RRQ++
Sbjct  61   VLSDPEKKELYDQYGEDALKEGMGGGAGSSFHNPFDI-FESFFGAGFGGGGPSRARRQKQ  119

Query  467  gEDVVHPLKVSLEDLYNGTSKKLSLS  544
            GEDVVH +KVSLED+YNGT+KKLSLS
Sbjct  120  GEDVVHSIKVSLEDVYNGTTKKLSLS  145



>gb|KJB35429.1| hypothetical protein B456_006G117100 [Gossypium raimondii]
Length=444

 Score =   186 bits (472),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 123/143 (86%), Positives = 128/143 (90%), Gaps = 1/143 (1%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKS +T+YYEILGV  +ASQDDLKKAY+KAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSTNTRYYEILGVSNNASQDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKREIYDQYGE+ALKEGMG G G HDPFDI  S F G    GGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGAGAHDPFDI-FSSFFGGSPFGGGSSRGRRQRRGED  119

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            VVHPLKVSLEDLY GTSKKLSLS
Sbjct  120  VVHPLKVSLEDLYLGTSKKLSLS  142



>gb|KHF97331.1| Chaperone dnaJ 3 -like protein [Gossypium arboreum]
Length=422

 Score =   185 bits (469),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 122/143 (85%), Positives = 134/143 (94%), Gaps = 0/143 (0%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGR PKKSD+TK+YE+LGVPK ASQD+LKKAY+KAAIKNHPDKGGDPEKFKELA AYEV
Sbjct  1    MFGRVPKKSDNTKFYEVLGVPKSASQDELKKAYKKAAIKNHPDKGGDPEKFKELAHAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKR+IYDQYGE+ALKEGMG GG  H+PFDIF+SFFGG  FGGGGSSRGRRQ+RGED
Sbjct  61   LSDPEKRDIYDQYGEDALKEGMGGGGSSHNPFDIFESFFGGGAFGGGGSSRGRRQKRGED  120

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            VVH LKVSLE+LYNGT+KKLSLS
Sbjct  121  VVHALKVSLEELYNGTAKKLSLS  143



>ref|XP_009592511.1| PREDICTED: dnaJ protein homolog [Nicotiana tomentosiformis]
Length=418

 Score =   184 bits (468),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 123/143 (86%), Positives = 135/143 (94%), Gaps = 0/143 (0%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGR PKKSD+T+YYEILGV K+AS D++KKAYRKAA+KNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRGPKKSDNTRYYEILGVSKNASDDEIKKAYRKAAMKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSD +KREIYDQYGE+ALKEGMG GGG HDPFDIF+SFFGG+PFGGGGSSRGRRQRRGED
Sbjct  61   LSDSQKREIYDQYGEDALKEGMGGGGGMHDPFDIFESFFGGNPFGGGGSSRGRRQRRGED  120

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            VVH LKVSLEDLY+G +KKLSLS
Sbjct  121  VVHTLKVSLEDLYSGITKKLSLS  143



>ref|XP_006424068.1| hypothetical protein CICLE_v10028531mg [Citrus clementina]
 ref|XP_006487844.1| PREDICTED: dnaJ protein homolog ANJ1-like [Citrus sinensis]
 gb|ESR37308.1| hypothetical protein CICLE_v10028531mg [Citrus clementina]
 gb|KDO48965.1| hypothetical protein CISIN_1g014903mg [Citrus sinensis]
Length=416

 Score =   184 bits (468),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 122/143 (85%), Positives = 129/143 (90%), Gaps = 1/143 (1%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKS++T+YYEILGV K+AS +DLKKAY+KAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSNNTRYYEILGVSKNASAEDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKREIYDQYGE+ALKEGMG G G HDPFDI  S F G    GGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGAGAHDPFDI-FSSFFGGSPFGGGSSRGRRQRRGED  119

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            VVHPLKVSLEDLY GTSKKLSLS
Sbjct  120  VVHPLKVSLEDLYLGTSKKLSLS  142



>ref|NP_001053485.1| Os04g0549600 [Oryza sativa Japonica Group]
 dbj|BAF15399.1| Os04g0549600 [Oryza sativa Japonica Group]
 dbj|BAG95310.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE61449.1| hypothetical protein OsJ_15688 [Oryza sativa Japonica Group]
Length=416

 Score =   184 bits (468),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 122/143 (85%), Gaps = 2/143 (1%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGR P+ S++TKYYE+LGVPK AS+D+LKKAYRKAAIKNHPDKGGDPEKFKEL+QAYEV
Sbjct  1    MFGRVPR-SNNTKYYEVLGVPKTASKDELKKAYRKAAIKNHPDKGGDPEKFKELSQAYEV  59

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            L+DPEKR+IYDQYGE+ALK+GMG G   H+PFDI    F G    GG SSR RRQRRGED
Sbjct  60   LTDPEKRDIYDQYGEDALKDGMGGGSDFHNPFDI-FEQFFGGGAFGGSSSRVRRQRRGED  118

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            V H LKVSLED+YNG+ KKLSLS
Sbjct  119  VAHTLKVSLEDVYNGSMKKLSLS  141



>gb|KJB09149.1| hypothetical protein B456_001G126200 [Gossypium raimondii]
Length=416

 Score =   184 bits (467),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 122/143 (85%), Positives = 127/143 (89%), Gaps = 1/143 (1%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+T+YYEILGV K+AS DDLKKAY+KAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKNASHDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKREIYDQYGE+ALKEGMG G   HDPFDI  S F G    GG SSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGAAAHDPFDI-FSSFFGGSPFGGASSRGRRQRRGED  119

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            VVHPLKVSLEDLY GTSKKLSLS
Sbjct  120  VVHPLKVSLEDLYLGTSKKLSLS  142



>ref|XP_006347934.1| PREDICTED: dnaJ protein homolog 2-like isoform X1 [Solanum tuberosum]
 ref|XP_006347935.1| PREDICTED: dnaJ protein homolog 2-like isoform X2 [Solanum tuberosum]
Length=420

 Score =   184 bits (467),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 126/144 (88%), Gaps = 1/144 (1%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAP++SD++KYYE+LGV K ASQD+LKKAYRKAAI+NHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPRRSDNSKYYEVLGVSKSASQDELKKAYRKAAIRNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKE-GMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgE  472
            LSDPEKR+IYDQYGE+ALKE     GGG H+ FDIF+SFF GS  GGG   R  RQ+RGE
Sbjct  61   LSDPEKRDIYDQYGEDALKEGMGSGGGGVHNHFDIFESFFSGSFGGGGSRFRASRQKRGE  120

Query  473  DVVHPLKVSLEDLYNGTSKKLSLS  544
            DVVH L+VSLEDLYNGT+KKLSLS
Sbjct  121  DVVHTLRVSLEDLYNGTTKKLSLS  144



>ref|XP_001774283.1| predicted protein [Physcomitrella patens]
 gb|EDQ60919.1| predicted protein [Physcomitrella patens]
Length=417

 Score =   184 bits (467),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 118/144 (82%), Positives = 127/144 (88%), Gaps = 2/144 (1%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGR PKKSD+TKYYE LGV K ASQD+LK+AYRKAAIKNHPDKGGDPEKFKE++QAYEV
Sbjct  1    MFGRMPKKSDNTKYYEALGVSKSASQDELKRAYRKAAIKNHPDKGGDPEKFKEISQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspf-ggggssrgrrqrrgE  472
            LSDPEKRE+YDQYGE+ALKE    GGG H+PFDIF+SFFGG  F GG G    RRQRRGE
Sbjct  61   LSDPEKRELYDQYGEDALKE-GMGGGGGHNPFDIFESFFGGDSFPGGSGRGGSRRQRRGE  119

Query  473  DVVHPLKVSLEDLYNGTSKKLSLS  544
            DVVHPLKVSLEDLYNGTSKKLSLS
Sbjct  120  DVVHPLKVSLEDLYNGTSKKLSLS  143



>gb|ABY52936.1| DnaJ family heat shock protein [Oryza sativa Japonica Group]
Length=416

 Score =   184 bits (467),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 122/143 (85%), Gaps = 2/143 (1%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGR P+ S++TKYYE+LGVPK AS+D+LKKAYRKAAIKNHPDKGGDPEKFKEL+QAYEV
Sbjct  1    MFGRVPR-SNNTKYYEVLGVPKTASKDELKKAYRKAAIKNHPDKGGDPEKFKELSQAYEV  59

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            L+DPEKR+IYDQYGE+ALK+GMG G   H+PFDI    F G    GG SSR RRQRRGED
Sbjct  60   LTDPEKRDIYDQYGEDALKDGMGGGSDFHNPFDI-FEQFFGGGAFGGSSSRVRRQRRGED  118

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            V H LKVSLED+YNG+ KKLSLS
Sbjct  119  VAHTLKVSLEDVYNGSMKKLSLS  141



>dbj|BAD25681.1| putative DnaJ-like protein MsJ1 [Oryza sativa Japonica Group]
Length=416

 Score =   183 bits (465),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 105/140 (75%), Positives = 116/140 (83%), Gaps = 5/140 (4%)
 Frame = +2

Query  131  PKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEVLSDPE  310
            PKKS++TKYYE+LGV K A+QD+LKKAYRKAAIKNHPDKGGDPEKFKELAQAYEVL+DPE
Sbjct  2    PKKSNNTKYYEVLGVSKTATQDELKKAYRKAAIKNHPDKGGDPEKFKELAQAYEVLNDPE  61

Query  311  KREIYDQYGEEALKEGMGSGGGX--HDPFDIfqsffggspfggggssrgrrqrrgEDVVH  484
            KREIYDQYGE+ALKEGMG G     H PFD+   F       GG   RG RQ+RGEDVVH
Sbjct  62   KREIYDQYGEDALKEGMGGGSSSDFHSPFDL---FEQIFQNRGGFGGRGHRQKRGEDVVH  118

Query  485  PLKVSLEDLYNGTSKKLSLS  544
             +KVSLEDLYNGT+KKLSLS
Sbjct  119  TMKVSLEDLYNGTTKKLSLS  138



>gb|AFK48766.1| unknown [Medicago truncatula]
Length=423

 Score =   183 bits (465),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 109/146 (75%), Positives = 126/146 (86%), Gaps = 4/146 (3%)
 Frame = +2

Query  116  MFGRAP-KKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYE  292
            MFGR P +KSD+ KYY+ILGV K AS+D++KKAYRKAA+KNHPDKGGDPEKFKEL QAYE
Sbjct  1    MFGRGPTRKSDNAKYYDILGVSKSASEDEIKKAYRKAAMKNHPDKGGDPEKFKELGQAYE  60

Query  293  VLSDPEKREIYDQYGEEALKEGMGSGGGX--HDPFDIfqsffggspfggggssrgrrqrr  466
            VLSDPEK+E+YDQYGE+ALKEGMG G G   H+PFDI    F G+ FGGGG SR RRQ++
Sbjct  61   VLSDPEKKELYDQYGEDALKEGMGGGAGSSFHNPFDI-FESFFGAGFGGGGPSRARRQKQ  119

Query  467  gEDVVHPLKVSLEDLYNGTSKKLSLS  544
            GEDVVH +KVSLED+YNGT+KKLSLS
Sbjct  120  GEDVVHSIKVSLEDVYNGTTKKLSLS  145



>gb|EYU36024.1| hypothetical protein MIMGU_mgv1a007013mg [Erythranthe guttata]
Length=422

 Score =   183 bits (464),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 130/146 (89%), Positives = 133/146 (91%), Gaps = 3/146 (2%)
 Frame = +2

Query  116  MFGRAP-KKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYE  292
            MFGRAP  KSD+TKYYE+LGVPK AS DDLKKAYRKAAIKNHPDKGGDPEKFKELA AYE
Sbjct  1    MFGRAPPSKSDNTKYYEVLGVPKTASPDDLKKAYRKAAIKNHPDKGGDPEKFKELAHAYE  60

Query  293  VLSDPEKREIYDQYGEEALKE--GMGSGGGXHDPFDIfqsffggspfggggssrgrrqrr  466
            VLSDPEKREIYDQYGE+ALKE  G G GGG HDPFDIF SFFGGSPFGGGGSSRGRRQRR
Sbjct  61   VLSDPEKREIYDQYGEDALKEGMGGGGGGGMHDPFDIFSSFFGGSPFGGGGSSRGRRQRR  120

Query  467  gEDVVHPLKVSLEDLYNGTSKKLSLS  544
            GEDVVH LKVSLEDLY GTSKKLSLS
Sbjct  121  GEDVVHALKVSLEDLYLGTSKKLSLS  146



>sp|P42824.1|DNJH2_ALLPO RecName: Full=DnaJ protein homolog 2; Flags: Precursor [Allium 
ampeloprasum]
 emb|CAA54720.1| LDJ2 [Allium ampeloprasum]
Length=418

 Score =   182 bits (463),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 128/143 (90%), Positives = 135/143 (94%), Gaps = 0/143 (0%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+TKYYE+LGV K+A+ +DLKKAYRKAAIKNHPDKGGDPEKFKE+ QAYEV
Sbjct  1    MFGRAPKKSDNTKYYEVLGVSKNATPEDLKKAYRKAAIKNHPDKGGDPEKFKEIGQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            L+DPEKREIYDQYGEE LKEGMG GGG HDPFDIFQSFFGG  FGGGGSSRGRRQRRGED
Sbjct  61   LNDPEKREIYDQYGEEGLKEGMGGGGGVHDPFDIFQSFFGGGGFGGGGSSRGRRQRRGED  120

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            VVHPLKVSLEDLYNGTSKKLSLS
Sbjct  121  VVHPLKVSLEDLYNGTSKKLSLS  143



>ref|XP_002511620.1| Chaperone protein dnaJ, putative [Ricinus communis]
 gb|EEF50289.1| Chaperone protein dnaJ, putative [Ricinus communis]
Length=391

 Score =   182 bits (461),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 114/143 (80%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFG  P++SD+TKYYE+LGVPK+ASQD++KKAYRKAAIKNHPDKGGD EKFKEL+ AYEV
Sbjct  1    MFGYGPRRSDNTKYYEVLGVPKNASQDEMKKAYRKAAIKNHPDKGGDSEKFKELSHAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDP+KREIYDQYGE ALKEGMG GG  H+PFDIF S FG   FGGGGSSRGRRQ+RGED
Sbjct  61   LSDPQKREIYDQYGEAALKEGMGGGGSGHNPFDIFDSLFGRGAFGGGGSSRGRRQKRGED  120

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            V+H  KVSLEDLYNGT++KLSLS
Sbjct  121  VLHATKVSLEDLYNGTTRKLSLS  143



>ref|XP_010692097.1| PREDICTED: dnaJ protein homolog 2-like [Beta vulgaris subsp. 
vulgaris]
Length=420

 Score =   182 bits (463),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 112/145 (77%), Positives = 126/145 (87%), Gaps = 3/145 (2%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+TKYYE+LGV K ASQD+LKKAYRK+AIKNHPDKGGDPEKFKEL QAYEV
Sbjct  1    MFGRAPKKSDNTKYYEVLGVSKSASQDELKKAYRKSAIKNHPDKGGDPEKFKELGQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGX--HDPFDIfqsffggspfggggssrgrrqrrg  469
            LSDPEKREIYDQYGE+ALKEGMG GGG   H+PFDI    F  +   GGGSS  RRQ++G
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGPFHNPFDI-FEQFFSTSGFGGGSSSRRRQQQG  119

Query  470  EDVVHPLKVSLEDLYNGTSKKLSLS  544
            EDV+H +KVSLEDLYNGT+KK+S+S
Sbjct  120  EDVIHTMKVSLEDLYNGTTKKVSIS  144



>ref|XP_009411580.1| PREDICTED: dnaJ protein homolog [Musa acuminata subsp. malaccensis]
Length=425

 Score =   182 bits (462),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 128/151 (85%), Gaps = 8/151 (5%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+TKYYE+LGVP  A+QD+LKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEVLGVPNSANQDELKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGX----HDPFDIfqs----ffggspfggggssrg  451
            LSDPEKREIYD+YGE+ALKEGMG G G     H PFDIF+        G    GGGSSRG
Sbjct  61   LSDPEKREIYDKYGEDALKEGMGGGSGGGGGFHSPFDIFEQFFGGSTFGGGSFGGGSSRG  120

Query  452  rrqrrgEDVVHPLKVSLEDLYNGTSKKLSLS  544
            RRQ++GEDVVH LKVSLED+YNGTSKKLSLS
Sbjct  121  RRQKQGEDVVHSLKVSLEDVYNGTSKKLSLS  151



>ref|XP_007134513.1| hypothetical protein PHAVU_010G053900g [Phaseolus vulgaris]
 gb|ESW06507.1| hypothetical protein PHAVU_010G053900g [Phaseolus vulgaris]
Length=423

 Score =   182 bits (462),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 113/145 (78%), Positives = 133/145 (92%), Gaps = 2/145 (1%)
 Frame = +2

Query  116  MFGRA-PKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYE  292
            MFGR  P+KSD++KYY+ILGV K+A++D++KKAYRKAA+KNHPDKGGDPEKFKEL QAYE
Sbjct  1    MFGRGGPRKSDNSKYYDILGVSKNATEDEIKKAYRKAAMKNHPDKGGDPEKFKELGQAYE  60

Query  293  VLSDPEKREIYDQYGEEALKEGMGSGGGX-HDPFDIfqsffggspfggggssrgrrqrrg  469
            VL DPEK+E+YDQYGE+ALK+GMG GG   H+PFDIF+SFFGGS FGGGGSSRGRRQ++G
Sbjct  61   VLGDPEKKEMYDQYGEDALKDGMGGGGSSFHNPFDIFESFFGGSSFGGGGSSRGRRQKQG  120

Query  470  EDVVHPLKVSLEDLYNGTSKKLSLS  544
            EDVVH LKVSLED+YNG +KKLSLS
Sbjct  121  EDVVHSLKVSLEDVYNGANKKLSLS  145



>ref|XP_010263053.1| PREDICTED: dnaJ protein homolog [Nelumbo nucifera]
Length=417

 Score =   182 bits (461),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 129/143 (90%), Positives = 138/143 (97%), Gaps = 0/143 (0%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+T+YYEILGV K+ASQ+DLKKAY+KAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKNASQEDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDP+KR+IYDQYGE+ALKEGM  GGG HDPFDIFQSFFGGSPFGGGGSSRGRRQRRGED
Sbjct  61   LSDPDKRDIYDQYGEDALKEGMSGGGGGHDPFDIFQSFFGGSPFGGGGSSRGRRQRRGED  120

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            V+HPLKVSLEDLY GTSKKLSLS
Sbjct  121  VIHPLKVSLEDLYMGTSKKLSLS  143



>ref|XP_002983333.1| hypothetical protein SELMODRAFT_118063 [Selaginella moellendorffii]
 ref|XP_002987616.1| hypothetical protein SELMODRAFT_426414 [Selaginella moellendorffii]
 gb|EFJ11191.1| hypothetical protein SELMODRAFT_426414 [Selaginella moellendorffii]
 gb|EFJ15675.1| hypothetical protein SELMODRAFT_118063 [Selaginella moellendorffii]
Length=419

 Score =   181 bits (460),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 118/143 (83%), Positives = 128/143 (90%), Gaps = 1/143 (1%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGR PKKSD++KYY+ILGV K AS D+LKKAYRKAAIKNHPDKGGDPEKFKE++QAYEV
Sbjct  1    MFGRPPKKSDNSKYYDILGVSKSASADELKKAYRKAAIKNHPDKGGDPEKFKEISQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEK+EIYDQYGE+ALKE    GGG H+PFDIF SFFGG PFGGG S  GRRQRRGED
Sbjct  61   LSDPEKKEIYDQYGEDALKE-GMGGGGGHNPFDIFDSFFGGKPFGGGSSRGGRRQRRGED  119

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            VVHPLKVSLEDLYNG+ KKLSLS
Sbjct  120  VVHPLKVSLEDLYNGSVKKLSLS  142



>ref|XP_002969107.1| hypothetical protein SELMODRAFT_267228 [Selaginella moellendorffii]
 ref|XP_002973957.1| hypothetical protein SELMODRAFT_149573 [Selaginella moellendorffii]
 gb|EFJ24912.1| hypothetical protein SELMODRAFT_149573 [Selaginella moellendorffii]
 gb|EFJ30223.1| hypothetical protein SELMODRAFT_267228 [Selaginella moellendorffii]
Length=414

 Score =   181 bits (458),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 107/143 (75%), Positives = 118/143 (83%), Gaps = 5/143 (3%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGR P++S+ TKYY+ILGV KD S +DLKKAYRKAAIKNHPDKGGDPE+FKE++QAYEV
Sbjct  1    MFGRGPRRSNETKYYDILGVSKDVSPEDLKKAYRKAAIKNHPDKGGDPEQFKEISQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEK+EIYDQYGEE LKEGMG G     PFDI    F     GGGGS  G R+RRGED
Sbjct  61   LSDPEKKEIYDQYGEEGLKEGMG-GPSAGSPFDI----FESLFSGGGGSRGGSRKRRGED  115

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            VVH LKVSLEDLYNGTSKKL+LS
Sbjct  116  VVHTLKVSLEDLYNGTSKKLTLS  138



>ref|XP_009382439.1| PREDICTED: dnaJ protein homolog [Musa acuminata subsp. malaccensis]
Length=423

 Score =   181 bits (458),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 117/149 (79%), Positives = 127/149 (85%), Gaps = 6/149 (4%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MF RA +KSD+TKYYEILGVPK ASQD+LKKAYRKAAI+NHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFARAQRKSDNTKYYEILGVPKSASQDELKKAYRKAAIRNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKE--GMGSGGGXHDPFDIfqs----ffggspfggggssrgrr  457
            LSDPEKREIYD+YGE+ALKE  G G GG  H+PF+IF+        G    GGGSSRGRR
Sbjct  61   LSDPEKREIYDKYGEDALKEGIGGGGGGSFHNPFEIFEQFFGGSSFGGGSFGGGSSRGRR  120

Query  458  qrrgEDVVHPLKVSLEDLYNGTSKKLSLS  544
            Q+RGEDVVH LKVSLEDLYNGTSKKLSLS
Sbjct  121  QKRGEDVVHSLKVSLEDLYNGTSKKLSLS  149



>ref|XP_003570021.1| PREDICTED: dnaJ protein homolog 2-like [Brachypodium distachyon]
Length=423

 Score =   180 bits (456),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 124/146 (85%), Gaps = 3/146 (2%)
 Frame = +2

Query  116  MFGRAPKK-SDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYE  292
            MFGR PKK S++TKYYE+LGV K A+ D+LKKAYRKAAIKNHPDKGGDPEKFKELA AY+
Sbjct  1    MFGRMPKKTSNNTKYYEVLGVSKTATPDELKKAYRKAAIKNHPDKGGDPEKFKELAHAYD  60

Query  293  VLSDPEKREIYDQYGEEALKEGMGSGGG-XHDPFDI-fqsffggspfggggssrgrrqrr  466
            VL+DPEKREIYDQYGE+ALKEGMG G    H PFDI  Q F GG    GGGSSRGRRQ+R
Sbjct  61   VLNDPEKREIYDQYGEDALKEGMGGGSSDMHSPFDIFEQLFGGGGGGFGGGSSRGRRQKR  120

Query  467  gEDVVHPLKVSLEDLYNGTSKKLSLS  544
            GEDVVH +KVSLEDLYNG +KKLSLS
Sbjct  121  GEDVVHTMKVSLEDLYNGATKKLSLS  146



>gb|AES67168.2| DnaJ-class molecular chaperone [Medicago truncatula]
Length=327

 Score =   177 bits (450),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 129/143 (90%), Positives = 134/143 (94%), Gaps = 0/143 (0%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+TKYYEILGV K+AS DDLKKAY+KAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVSKNASPDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKRE+YDQYGE+ALKEGMG GGG HDPFDIF SFFGG  F GGGSSRGRRQRRGED
Sbjct  61   LSDPEKREVYDQYGEDALKEGMGGGGGGHDPFDIFSSFFGGGGFPGGGSSRGRRQRRGED  120

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            VVHPLKVSLEDLY GTSKKLSLS
Sbjct  121  VVHPLKVSLEDLYLGTSKKLSLS  143



>ref|XP_006345526.1| PREDICTED: dnaJ protein homolog isoform X1 [Solanum tuberosum]
 ref|XP_006345527.1| PREDICTED: dnaJ protein homolog isoform X2 [Solanum tuberosum]
 ref|XP_006345528.1| PREDICTED: dnaJ protein homolog isoform X3 [Solanum tuberosum]
 ref|XP_006345529.1| PREDICTED: dnaJ protein homolog isoform X4 [Solanum tuberosum]
Length=419

 Score =   179 bits (453),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 125/143 (87%), Gaps = 2/143 (1%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGR  ++SD++KYYE+LGV K++SQD+LKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRGARRSDNSKYYEVLGVSKNSSQDELKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKRE+YDQYGE+ALKE    GGG H+PFDI    F G  FGGGGS RG R+++GED
Sbjct  61   LSDPEKRELYDQYGEDALKE-GMGGGGGHNPFDI-FESFFGGAFGGGGSFRGSRKKKGED  118

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            VVH L+VSLEDLYNGT+KKLSLS
Sbjct  119  VVHTLRVSLEDLYNGTTKKLSLS  141



>ref|XP_004976432.1| PREDICTED: dnaJ protein homolog 2-like [Setaria italica]
Length=419

 Score =   178 bits (452),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 121/143 (85%), Gaps = 1/143 (1%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGR P++S++TKYYE+LGV   ASQD+LKKAYRKAAIK+HPDKGGDPEKFKEL+QAYEV
Sbjct  1    MFGRVPRRSNNTKYYEVLGVSSTASQDELKKAYRKAAIKSHPDKGGDPEKFKELSQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKREIYDQYGE+ LKEGMG GG  H+PFDI    F G    GG  SR RRQ+RGED
Sbjct  61   LSDPEKREIYDQYGEDGLKEGMGGGGDFHNPFDI-FEQFFGGGSFGGSRSRVRRQKRGED  119

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            VVH LKVSLED+YNG +KKLSLS
Sbjct  120  VVHSLKVSLEDVYNGATKKLSLS  142



>gb|KHG16063.1| DnaJ protein [Gossypium arboreum]
Length=299

 Score =   175 bits (444),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 119/126 (94%), Positives = 123/126 (98%), Gaps = 0/126 (0%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+TKYYEILGVPK ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKTASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKREIYDQYGE+ALKEGMG GGG HDPFDIFQSFFGG+PFGGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGAHDPFDIFQSFFGGNPFGGGGSSRGRRQRRGED  120

Query  476  VVHPLK  493
            V+HPLK
Sbjct  121  VIHPLK  126



>gb|AGY48888.1| MIP1L1 [Nicotiana benthamiana]
Length=423

 Score =   178 bits (452),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 122/146 (84%), Gaps = 3/146 (2%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGR  ++SD++KYYE+LGVPK++SQD+LKKAYRKAAIKNHPDKGGDPEKFKELA AYEV
Sbjct  1    MFGRGARRSDNSKYYEVLGVPKNSSQDELKKAYRKAAIKNHPDKGGDPEKFKELAHAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrg--  469
            +SDPEKREIYDQYGE+AL EGMG GGG H+PFDIF+SFFGG   G  G     R  R   
Sbjct  61   ISDPEKREIYDQYGEDALNEGMGGGGGGHNPFDIFESFFGGGFDGAFGGGGSFRGSRKKQ  120

Query  470  -EDVVHPLKVSLEDLYNGTSKKLSLS  544
             E+ VH L+VSLEDLYNGT+KKLSLS
Sbjct  121  GENAVHTLRVSLEDLYNGTTKKLSLS  146



>ref|XP_006340318.1| PREDICTED: dnaJ protein homolog ANJ1-like isoform X1 [Solanum 
tuberosum]
Length=419

 Score =   178 bits (451),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 117/144 (81%), Positives = 131/144 (91%), Gaps = 1/144 (1%)
 Frame = +2

Query  116  MFGRA-PKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYE  292
            MFGR   KKSD+T++YEILGV K+AS+D++KKAYRKAA+KNHPDKGGDPEKFKELAQAYE
Sbjct  1    MFGRGGKKKSDNTRFYEILGVSKNASEDEIKKAYRKAAMKNHPDKGGDPEKFKELAQAYE  60

Query  293  VLSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgE  472
            VLSD +KREIYDQYGEEALKEGMG GGG HDPFD+F SFF GSPFGGGG  RG+R+RRG+
Sbjct  61   VLSDSQKREIYDQYGEEALKEGMGGGGGTHDPFDLFNSFFSGSPFGGGGGRRGQRERRGD  120

Query  473  DVVHPLKVSLEDLYNGTSKKLSLS  544
            DVVHPLKVSLEDLY G +KKLSLS
Sbjct  121  DVVHPLKVSLEDLYTGITKKLSLS  144



>ref|XP_007150008.1| hypothetical protein PHAVU_005G118100g [Phaseolus vulgaris]
 gb|ESW22002.1| hypothetical protein PHAVU_005G118100g [Phaseolus vulgaris]
Length=418

 Score =   178 bits (451),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 128/143 (90%), Positives = 134/143 (94%), Gaps = 0/143 (0%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSDST+YYEILGV K+AS +DLKKAY+KAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDSTRYYEILGVAKNASPEDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSD EKREIYD YGE+ALKEGM  GGG HDPFDIF SFFGG+PFGGGGSSRGRRQRRGED
Sbjct  61   LSDAEKREIYDTYGEDALKEGMSGGGGGHDPFDIFSSFFGGNPFGGGGSSRGRRQRRGED  120

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            VVHPLKVSLEDLY GTSKKLSLS
Sbjct  121  VVHPLKVSLEDLYLGTSKKLSLS  143



>ref|XP_003596916.1| DnaJ [Medicago truncatula]
 gb|AES67167.1| DnaJ-class molecular chaperone [Medicago truncatula]
Length=417

 Score =   177 bits (450),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 129/143 (90%), Positives = 134/143 (94%), Gaps = 0/143 (0%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+TKYYEILGV K+AS DDLKKAY+KAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVSKNASPDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKRE+YDQYGE+ALKEGMG GGG HDPFDIF SFFGG  F GGGSSRGRRQRRGED
Sbjct  61   LSDPEKREVYDQYGEDALKEGMGGGGGGHDPFDIFSSFFGGGGFPGGGSSRGRRQRRGED  120

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            VVHPLKVSLEDLY GTSKKLSLS
Sbjct  121  VVHPLKVSLEDLYLGTSKKLSLS  143



>ref|XP_004506241.1| PREDICTED: dnaJ protein homolog ANJ1-like [Cicer arietinum]
Length=418

 Score =   177 bits (450),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 129/143 (90%), Positives = 134/143 (94%), Gaps = 0/143 (0%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGR PKKSDST+YYEILGV K+ASQDDLKKAY+KAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRQPKKSDSTRYYEILGVSKNASQDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKREIYD YGE+ALKEGMG GGG HDPFDIF SFFGG+ FGGGG SRGRRQRRGED
Sbjct  61   LSDPEKREIYDTYGEDALKEGMGGGGGGHDPFDIFSSFFGGNHFGGGGGSRGRRQRRGED  120

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            VVHPLKVSLEDLY GTSKKLSLS
Sbjct  121  VVHPLKVSLEDLYLGTSKKLSLS  143



>gb|KHG16062.1| Chaperone protein dnaJ 3 [Gossypium arboreum]
Length=321

 Score =   175 bits (444),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 119/126 (94%), Positives = 123/126 (98%), Gaps = 0/126 (0%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+TKYYEILGVPK ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKTASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKREIYDQYGE+ALKEGMG GGG HDPFDIFQSFFGG+PFGGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGAHDPFDIFQSFFGGNPFGGGGSSRGRRQRRGED  120

Query  476  VVHPLK  493
            V+HPLK
Sbjct  121  VIHPLK  126



>gb|EYU37228.1| hypothetical protein MIMGU_mgv1a006942mg [Erythranthe guttata]
Length=425

 Score =   177 bits (450),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 125/148 (84%), Gaps = 5/148 (3%)
 Frame = +2

Query  116  MFGRAP-KKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYE  292
            MFGR P KKS++TKYYEILGV K+AS DDLKKAYRK AIKNHPDKGGDPEKFKE+AQAYE
Sbjct  1    MFGRGPPKKSNNTKYYEILGVEKNASPDDLKKAYRKLAIKNHPDKGGDPEKFKEIAQAYE  60

Query  293  VLSDPEKREIYDQYGEEALKE-GMGSGGGXHDPFDIfqs---ffggspfggggssrgrrq  460
            VL+DPEKREIYDQYGE+ALKE   G GGG H+PFDIF+S     G    GGGGS   RR 
Sbjct  61   VLNDPEKREIYDQYGEDALKEGMGGGGGGGHNPFDIFESFFGASGNPFGGGGGSRGQRRV  120

Query  461  rrgEDVVHPLKVSLEDLYNGTSKKLSLS  544
            RRGEDVVHPLKVSL+DLYNGTSKKLSLS
Sbjct  121  RRGEDVVHPLKVSLDDLYNGTSKKLSLS  148



>dbj|BAK03083.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=153

 Score =   169 bits (429),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 119/147 (81%), Gaps = 4/147 (3%)
 Frame = +2

Query  116  MFGRAPKK-SDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYE  292
            MFGR P+K S++TKYYE+LGV K A+ D+LKKAYRKAAIKNHPDKGGDPEKFKELAQAY+
Sbjct  1    MFGRMPRKTSNNTKYYEVLGVSKTATPDELKKAYRKAAIKNHPDKGGDPEKFKELAQAYD  60

Query  293  VLSDPEKREIYDQYGEEALKE--GMGSGGGXHDPFDIfqsffggspfggggssrgrrqrr  466
            VL+DPEKREIYDQYGE+ALKE  G G     H PFDIF+  FGG   G GG S   R+++
Sbjct  61   VLNDPEKREIYDQYGEDALKEGMGGGGSSDMHSPFDIFEQLFGGGGGGFGGGSSRGRRQK  120

Query  467  g-EDVVHPLKVSLEDLYNGTSKKLSLS  544
              EDVVH +KVSLEDLYNG +KKLSLS
Sbjct  121  RGEDVVHTMKVSLEDLYNGATKKLSLS  147



>ref|XP_004251216.1| PREDICTED: dnaJ protein homolog [Solanum lycopersicum]
Length=418

 Score =   177 bits (449),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 111/144 (77%), Positives = 125/144 (87%), Gaps = 2/144 (1%)
 Frame = +2

Query  116  MFGRA-PKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYE  292
            MFGR   KKSD+TK+YEILGV K+AS+D++KKAYRKAA+KNHPDKGGDPEKFKELAQAYE
Sbjct  1    MFGRGGKKKSDNTKFYEILGVSKNASEDEIKKAYRKAAMKNHPDKGGDPEKFKELAQAYE  60

Query  293  VLSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgE  472
            VLSD +KREIYDQYGEEALKEGMG GGG HDPFD+  + F      GGG  RG+R+RRG+
Sbjct  61   VLSDSQKREIYDQYGEEALKEGMGGGGGTHDPFDL-FNSFFSGSPFGGGGRRGQRERRGD  119

Query  473  DVVHPLKVSLEDLYNGTSKKLSLS  544
            DVVHPLKVSLEDLYNG +KKLSLS
Sbjct  120  DVVHPLKVSLEDLYNGMTKKLSLS  143



>ref|XP_009779099.1| PREDICTED: dnaJ protein homolog [Nicotiana sylvestris]
 ref|XP_009779100.1| PREDICTED: dnaJ protein homolog [Nicotiana sylvestris]
Length=423

 Score =   177 bits (449),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 109/146 (75%), Positives = 125/146 (86%), Gaps = 3/146 (2%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGR  ++S+++KYYE+LGVPK++SQD+LKKAYRKAAIKNHPDKGGDPEKFKELA AYEV
Sbjct  1    MFGRGARRSENSKYYEVLGVPKNSSQDELKKAYRKAAIKNHPDKGGDPEKFKELAHAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDI---fqsffggspfggggssrgrrqrr  466
            LSDPEKREIYDQYGE+AL EGMG GGG H PFDI   F     G  FGGGGS RG R+++
Sbjct  61   LSDPEKREIYDQYGEDALNEGMGGGGGGHSPFDIFESFFGGGFGGAFGGGGSFRGSRKKQ  120

Query  467  gEDVVHPLKVSLEDLYNGTSKKLSLS  544
            GE+ VH L+VSLEDLYNGT+KKLSLS
Sbjct  121  GENAVHALRVSLEDLYNGTTKKLSLS  146



>ref|NP_001240264.1| uncharacterized protein LOC100818805 [Glycine max]
 gb|ACU23708.1| unknown [Glycine max]
Length=417

 Score =   177 bits (448),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 131/143 (92%), Positives = 135/143 (94%), Gaps = 0/143 (0%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSDST+YYEILGV K+AS DDLKKAY+KAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDSTRYYEILGVSKNASPDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKREIYD YGE+ALKEGMG GGG HDPFDIF SFFGGSPFG GGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDTYGEDALKEGMGGGGGGHDPFDIFSSFFGGSPFGSGGSSRGRRQRRGED  120

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            VVHPLKVSLEDLY GTSKKLSLS
Sbjct  121  VVHPLKVSLEDLYLGTSKKLSLS  143



>ref|XP_004487721.1| PREDICTED: dnaJ protein homolog [Cicer arietinum]
Length=343

 Score =   175 bits (443),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 122/143 (85%), Positives = 125/143 (87%), Gaps = 1/143 (1%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAP KSD+TKYYEILGV K ASQDDLKKAY+KAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPTKSDNTKYYEILGVSKSASQDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKREIYDQYGE+ALKEGMG GGG HDPFDI  S F G     GG  R RRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDI-FSSFFGGGGFSGGGGRVRRQRRGED  119

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            VVHPLKVSLEDLY GTSKKLSLS
Sbjct  120  VVHPLKVSLEDLYLGTSKKLSLS  142



>gb|KDP42967.1| hypothetical protein JCGZ_23909 [Jatropha curcas]
Length=418

 Score =   177 bits (448),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 131/143 (92%), Positives = 138/143 (97%), Gaps = 0/143 (0%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+T+YYEILGV K+ASQDDLKKAY+KAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKNASQDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKREIYDQYGE+ALKEGMG GGG H PFDIF+SFFGGSPFGGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHSPFDIFESFFGGSPFGGGGSSRGRRQRRGED  120

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            VVHPLKVSLEDLY GT+KKLSLS
Sbjct  121  VVHPLKVSLEDLYLGTTKKLSLS  143



>sp|P43644.1|DNJH_ATRNU RecName: Full=DnaJ protein homolog ANJ1; Flags: Precursor [Atriplex 
nummularia]
Length=417

 Score =   177 bits (448),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 131/143 (92%), Positives = 137/143 (96%), Gaps = 0/143 (0%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSDST+YYEILGVPKDAS +DLKKAY+KAAIKNHPDKGGDPEKFKELA AYEV
Sbjct  1    MFGRAPKKSDSTRYYEILGVPKDASPEDLKKAYKKAAIKNHPDKGGDPEKFKELAHAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKREIYDQYGE+ALKEGMG GGG HDPFDIFQSFFGGSPFGG GSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGMHDPFDIFQSFFGGSPFGGVGSSRGRRQRRGED  120

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            VVHPLKVSLEDL+ GT+KKLSLS
Sbjct  121  VVHPLKVSLEDLFTGTTKKLSLS  143



>ref|XP_003540271.1| PREDICTED: dnaJ protein homolog [Glycine max]
Length=417

 Score =   176 bits (447),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 131/143 (92%), Positives = 135/143 (94%), Gaps = 0/143 (0%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSDST+YYEILGV K+AS DDLKKAY+KAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDSTRYYEILGVSKNASPDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKREIYD YGE+ALKEGMG GGG HDPFDIF SFFGGSPFG GGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDTYGEDALKEGMGGGGGGHDPFDIFSSFFGGSPFGSGGSSRGRRQRRGED  120

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            VVHPLKVSLEDLY GTSKKLSLS
Sbjct  121  VVHPLKVSLEDLYLGTSKKLSLS  143



>gb|KHN17991.1| DnaJ protein like [Glycine soja]
Length=417

 Score =   176 bits (447),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 131/143 (92%), Positives = 135/143 (94%), Gaps = 0/143 (0%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSDST+YYEILGV K+AS DDLKKAY+KAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDSTRYYEILGVSKNASPDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKREIYD YGE+ALKEGMG GGG HDPFDIF SFFGGSPFG GGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDTYGEDALKEGMGGGGGGHDPFDIFSSFFGGSPFGSGGSSRGRRQRRGED  120

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            VVHPLKVSLEDLY GTSKKLSLS
Sbjct  121  VVHPLKVSLEDLYLGTSKKLSLS  143



>ref|XP_006837307.1| hypothetical protein AMTR_s00111p00054240 [Amborella trichopoda]
 gb|ERN00161.1| hypothetical protein AMTR_s00111p00054240 [Amborella trichopoda]
Length=304

 Score =   173 bits (439),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 127/143 (89%), Gaps = 1/143 (1%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAP++ D+++YY+ILGV K+ASQD+LKKAY+KAAIKNHPDKGGDPEKFKELAQAY+V
Sbjct  1    MFGRAPRRGDNSRYYDILGVSKNASQDELKKAYKKAAIKNHPDKGGDPEKFKELAQAYDV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKRE+YDQYGE+ALKEGMG  G  H+PFDI    F G    GGGSSRGRRQ++G+D
Sbjct  61   LSDPEKREVYDQYGEDALKEGMGGAGPSHNPFDI-FESFFGGGGFGGGSSRGRRQKQGDD  119

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            VVH LKVSLEDLYNGTSKKLSLS
Sbjct  120  VVHSLKVSLEDLYNGTSKKLSLS  142



>ref|XP_004229763.1| PREDICTED: dnaJ protein homolog 2-like [Solanum lycopersicum]
Length=424

 Score =   176 bits (446),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 112/148 (76%), Positives = 127/148 (86%), Gaps = 5/148 (3%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFG+AP++SD++KYYE+LGV K ASQD+LKKAYRKAAI+NHPDKGGDPEKFKEL QAYEV
Sbjct  1    MFGQAPRRSDNSKYYEVLGVSKSASQDELKKAYRKAAIRNHPDKGGDPEKFKELGQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKE-----GMGSGGGXHDPFDIfqsffggspfggggssrgrrq  460
            L DPEKR+IYDQYGE+ALKE     G G GGG H+ FDIF+SFFGGS  GGG   R  RQ
Sbjct  61   LIDPEKRDIYDQYGEDALKEGMGSGGGGGGGGVHNHFDIFESFFGGSFGGGGSHFRASRQ  120

Query  461  rrgEDVVHPLKVSLEDLYNGTSKKLSLS  544
            +RGEDVVH L+VSLEDLYNGT+KKLSLS
Sbjct  121  KRGEDVVHTLRVSLEDLYNGTTKKLSLS  148



>gb|EYU37227.1| hypothetical protein MIMGU_mgv1a006922mg [Erythranthe guttata]
Length=426

 Score =   176 bits (446),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 125/148 (84%), Gaps = 5/148 (3%)
 Frame = +2

Query  116  MFGRAP-KKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYE  292
            MFGRAP KKSD+ KYYEILGV K AS DDLKKAYRK AIKNHPDKGGDPEKFKE+AQAYE
Sbjct  1    MFGRAPPKKSDNNKYYEILGVEKTASPDDLKKAYRKLAIKNHPDKGGDPEKFKEIAQAYE  60

Query  293  VLSDPEKREIYDQYGEEALKE-GMGSGGGXHDPFDIfqs---ffggspfggggssrgrrq  460
            VL+DPEKREIYDQYGE+ALKE   G GGG H+PFDIF+S     G    GGGGS   RRQ
Sbjct  61   VLNDPEKREIYDQYGEDALKEGMGGGGGGGHNPFDIFESFFGGSGHPFGGGGGSRGQRRQ  120

Query  461  rrgEDVVHPLKVSLEDLYNGTSKKLSLS  544
            RRGEDVVHPLKVSL++LYNGTSKKLSLS
Sbjct  121  RRGEDVVHPLKVSLDNLYNGTSKKLSLS  148



>ref|XP_009596179.1| PREDICTED: dnaJ protein homolog [Nicotiana tomentosiformis]
 ref|XP_009596180.1| PREDICTED: dnaJ protein homolog [Nicotiana tomentosiformis]
 ref|XP_009596181.1| PREDICTED: dnaJ protein homolog [Nicotiana tomentosiformis]
 ref|XP_009596182.1| PREDICTED: dnaJ protein homolog [Nicotiana tomentosiformis]
 ref|XP_009596183.1| PREDICTED: dnaJ protein homolog [Nicotiana tomentosiformis]
Length=421

 Score =   176 bits (445),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 109/146 (75%), Positives = 126/146 (86%), Gaps = 3/146 (2%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGR  ++SD++KYYE+LGV K++SQD+LKKAYRKAAIKNHPDKGGDPEKFKELA AYEV
Sbjct  1    MFGRGARRSDNSKYYEVLGVSKNSSQDELKKAYRKAAIKNHPDKGGDPEKFKELAHAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDI---fqsffggspfggggssrgrrqrr  466
            LSDPEKREIYDQYGE+ALKEGMG GGG H+PFDI   F     G  FGGGGS RG R+++
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHNPFDIFESFFGGGFGGAFGGGGSFRGSRKKQ  120

Query  467  gEDVVHPLKVSLEDLYNGTSKKLSLS  544
            GE+ VH L+VSLEDLY+GT+KKLSLS
Sbjct  121  GENAVHTLRVSLEDLYSGTTKKLSLS  146



>ref|XP_011090296.1| PREDICTED: dnaJ protein homolog [Sesamum indicum]
Length=417

 Score =   175 bits (443),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 130/143 (91%), Positives = 136/143 (95%), Gaps = 0/143 (0%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+T+YY+ILGVPK AS DDLKKAY+KAAIKNHPDKGGDPEKFKELA AYEV
Sbjct  1    MFGRAPKKSDNTRYYDILGVPKTASPDDLKKAYKKAAIKNHPDKGGDPEKFKELAHAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKREIYDQYGE+ALKEGMG GGG HDPFDIF SFFGGSPFGGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGMHDPFDIFSSFFGGSPFGGGGSSRGRRQRRGED  120

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            VVHPLKVSLEDLY GT+KKLSLS
Sbjct  121  VVHPLKVSLEDLYLGTTKKLSLS  143



>ref|XP_011088982.1| PREDICTED: dnaJ protein homolog [Sesamum indicum]
Length=413

 Score =   174 bits (442),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 130/143 (91%), Positives = 136/143 (95%), Gaps = 0/143 (0%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+++YYEILGVPK AS DDLKKAY+KAAIKNHPDKGGDPEKFKELA AYEV
Sbjct  1    MFGRAPKKSDNSRYYEILGVPKTASPDDLKKAYKKAAIKNHPDKGGDPEKFKELAHAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKREIYDQYGE+ALKEGMG GGG HDPFDIF SFFGGSPFGGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGMHDPFDIFSSFFGGSPFGGGGSSRGRRQRRGED  120

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            VVHPLKVSLEDLY GT+KKLSLS
Sbjct  121  VVHPLKVSLEDLYLGTTKKLSLS  143



>gb|AFK37703.1| unknown [Medicago truncatula]
Length=417

 Score =   174 bits (442),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 128/143 (90%), Positives = 133/143 (93%), Gaps = 0/143 (0%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+TKYYEI GV K+AS DDLKKAY+KAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEIPGVSKNASPDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKRE+YDQYGE+ALKEGMG GGG HDPFDIF SFFGG  F GGGSSRGRRQRRGED
Sbjct  61   LSDPEKREVYDQYGEDALKEGMGGGGGGHDPFDIFSSFFGGGGFPGGGSSRGRRQRRGED  120

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            VVHPLKVSLEDLY GTSKKLSLS
Sbjct  121  VVHPLKVSLEDLYLGTSKKLSLS  143



>ref|XP_010493266.1| PREDICTED: chaperone protein dnaJ 2-like isoform X1 [Camelina 
sativa]
 ref|XP_010493267.1| PREDICTED: chaperone protein dnaJ 2-like isoform X2 [Camelina 
sativa]
Length=420

 Score =   174 bits (442),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 127/145 (88%), Gaps = 2/145 (1%)
 Frame = +2

Query  116  MFGRAP-KKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYE  292
            MFGR P +KSD+TK+YEILGVPK AS +DLKKAY+KAAIKNHPDKGGDPEKFKELAQAYE
Sbjct  1    MFGRGPSRKSDNTKFYEILGVPKTASPEDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYE  60

Query  293  VLSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDI-fqsffggspfggggssrgrrqrrg  469
            VLSDPEKREIYDQYGE+ALKEGMG   G HDPFDI    F GG    GGGSSRGRRQRRG
Sbjct  61   VLSDPEKREIYDQYGEDALKEGMGPASGGHDPFDIFSSFFGGGGHPFGGGSSRGRRQRRG  120

Query  470  EDVVHPLKVSLEDLYNGTSKKLSLS  544
            EDVVHPLKVSLED+Y GT+KKLSLS
Sbjct  121  EDVVHPLKVSLEDVYLGTTKKLSLS  145



>gb|AGR45906.1| DnaJ protein 2-like protein [Triticum aestivum]
Length=421

 Score =   174 bits (441),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 108/140 (77%), Positives = 120/140 (86%), Gaps = 3/140 (2%)
 Frame = +2

Query  134  KKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEVLSDPEK  313
            K S++TKYYE+LGV K A+ D+LKKAYRKAAIKNHPDKGGDPEKFKELAQAY+VL+DPEK
Sbjct  4    KTSNNTKYYEVLGVSKTATPDELKKAYRKAAIKNHPDKGGDPEKFKELAQAYDVLNDPEK  63

Query  314  REIYDQYGEEALKEGMGSGGGX--HDPFDI-fqsffggspfggggssrgrrqrrgEDVVH  484
            REIYDQYGE+A+KEGMG  GG   H PFDI  Q F GG    GGGSSRGRRQ+RGEDVVH
Sbjct  64   REIYDQYGEDAIKEGMGGSGGADMHSPFDIFEQLFGGGGGGFGGGSSRGRRQKRGEDVVH  123

Query  485  PLKVSLEDLYNGTSKKLSLS  544
             +KVSLEDLYNG +KKLSLS
Sbjct  124  TMKVSLEDLYNGATKKLSLS  143



>emb|CAI64493.1| OSJNBa0065H10.16 [Oryza sativa Japonica Group]
Length=439

 Score =   174 bits (442),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 103/135 (76%), Positives = 116/135 (86%), Gaps = 1/135 (1%)
 Frame = +2

Query  140  SDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEVLSDPEKRE  319
            S++TKYYE+LGVPK AS+D+LKKAYRKAAIKNHPDKGGDPEKFKEL+QAYEVL+DPEKR+
Sbjct  296  SNNTKYYEVLGVPKTASKDELKKAYRKAAIKNHPDKGGDPEKFKELSQAYEVLTDPEKRD  355

Query  320  IYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgEDVVHPLKVS  499
            IYDQYGE+ALK+GMG G   H+PFDI    F G    GG SSR RRQRRGEDV H LKVS
Sbjct  356  IYDQYGEDALKDGMGGGSDFHNPFDI-FEQFFGGGAFGGSSSRVRRQRRGEDVAHTLKVS  414

Query  500  LEDLYNGTSKKLSLS  544
            LED+YNG+ KKLSLS
Sbjct  415  LEDVYNGSMKKLSLS  429



>ref|XP_004139085.1| PREDICTED: dnaJ protein homolog [Cucumis sativus]
 gb|KGN66611.1| DnaJ [Cucumis sativus]
Length=413

 Score =   173 bits (439),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 123/143 (86%), Positives = 127/143 (89%), Gaps = 2/143 (1%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSDST+YYEILGV K+ASQDDLKKAY+KAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDSTRYYEILGVSKNASQDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKREIYDQYGE+ALKE    GGG HDPFDI    F G    GGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKE-GMGGGGGHDPFDI-FQSFFGGSPFGGGSSRGRRQRRGED  118

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            VVHPLKVSLEDLY GTSKKLSLS
Sbjct  119  VVHPLKVSLEDLYLGTSKKLSLS  141



>ref|XP_010694477.1| PREDICTED: dnaJ protein homolog [Beta vulgaris subsp. vulgaris]
Length=419

 Score =   173 bits (439),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 123/144 (85%), Positives = 130/144 (90%), Gaps = 1/144 (1%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGR PKKSDST+YYEILGVPK+AS +DLKKAY+KAAIKNHPDKGGDPEKFKELA AYEV
Sbjct  1    MFGRPPKKSDSTRYYEILGVPKNASPEDLKKAYKKAAIKNHPDKGGDPEKFKELAHAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDI-fqsffggspfggggssrgrrqrrgE  472
            LSDPEKREIYDQYGE+ALKEGMG GGG HDPFDI    F G    GGGGSSRGRRQRRGE
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGAHDPFDIFSSFFGGSPFGGGGGSSRGRRQRRGE  120

Query  473  DVVHPLKVSLEDLYNGTSKKLSLS  544
            DV+HPLKVSLED+YNGTSKKLSLS
Sbjct  121  DVIHPLKVSLEDIYNGTSKKLSLS  144



>gb|ACJ85577.1| unknown [Medicago truncatula]
Length=263

 Score =   169 bits (428),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 123/144 (85%), Positives = 126/144 (88%), Gaps = 4/144 (3%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSDST+YYEILGV K ASQDDLKKAY+KAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDSTRYYEILGVSKTASQDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKE-GMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgE  472
            LSDPEKREIYD YGE+ALKE   G GGG HDPFDI   F      GGGGSSRGRRQRRGE
Sbjct  61   LSDPEKREIYDTYGEDALKEGMGGGGGGGHDPFDI---FSSFFGGGGGGSSRGRRQRRGE  117

Query  473  DVVHPLKVSLEDLYNGTSKKLSLS  544
            DVVHPLKVSLEDLY GTSKKLSLS
Sbjct  118  DVVHPLKVSLEDLYLGTSKKLSLS  141



>ref|XP_010089798.1| DnaJ-like protein [Morus notabilis]
 gb|EXB38414.1| DnaJ-like protein [Morus notabilis]
Length=440

 Score =   173 bits (439),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 121/139 (87%), Gaps = 1/139 (1%)
 Frame = +2

Query  128  APKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEVLSDP  307
            APKKSD+T+YY+ILGV K+ASQDDLKKAY+KAAIKNHPDKGGDPEKFKELAQAYEVLSDP
Sbjct  28   APKKSDNTRYYDILGVSKNASQDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEVLSDP  87

Query  308  EKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgEDVVHP  487
            EKREIYDQYGE+ALKEGMG G   HDPFDI    F G    GG S  GRRQRRGED+VHP
Sbjct  88   EKREIYDQYGEDALKEGMGGGADGHDPFDI-FQSFFGGNPFGGSSKGGRRQRRGEDIVHP  146

Query  488  LKVSLEDLYNGTSKKLSLS  544
            LKVSLEDLY GT+KKLSLS
Sbjct  147  LKVSLEDLYLGTTKKLSLS  165



>ref|XP_010263054.1| PREDICTED: dnaJ protein homolog [Nelumbo nucifera]
Length=416

 Score =   172 bits (437),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 127/143 (89%), Positives = 135/143 (94%), Gaps = 1/143 (1%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGR PKKSD+T+YYEILGVPK+AS +DLKKAY+KAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRQPKKSDNTRYYEILGVPKNASPEDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKREIYDQYGE+ALKE    GGG HDPFDIFQSFFGG+PFGGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKE-GMGGGGGHDPFDIFQSFFGGNPFGGGGSSRGRRQRRGED  119

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            V+HPLKVSLEDLY GTSKKLSLS
Sbjct  120  VIHPLKVSLEDLYVGTSKKLSLS  142



>ref|XP_008443634.1| PREDICTED: dnaJ protein homolog [Cucumis melo]
Length=413

 Score =   172 bits (436),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 122/143 (85%), Positives = 127/143 (89%), Gaps = 2/143 (1%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+T+YYEILGV K+ASQDDLKKAY+KAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKNASQDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKREIYDQYGE+ALKE    GGG HDPFDI    F G    GGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKE-GMGGGGGHDPFDI-FQSFFGGSPFGGGSSRGRRQRRGED  118

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            VVHPLKVSLEDLY GTSKKLSLS
Sbjct  119  VVHPLKVSLEDLYLGTSKKLSLS  141



>tpg|DAA41207.1| TPA: putative dnaJ chaperone family protein [Zea mays]
Length=581

 Score =   175 bits (443),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 115/132 (87%), Positives = 122/132 (92%), Gaps = 0/132 (0%)
 Frame = +2

Query  149  TKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEVLSDPEKREIYD  328
            ++YYEILGV KDASQDDLKKAYRKAAIK+HP+KGGDPEKFKELAQAYEV SDPEKREIYD
Sbjct  335  SRYYEILGVSKDASQDDLKKAYRKAAIKDHPNKGGDPEKFKELAQAYEVPSDPEKREIYD  394

Query  329  QYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgEDVVHPLKVSLED  508
            QYGE+ALKEGMG GGG HDPFD+FQSFFGG    GGGSSRGR QR G+DVVHPLKVSLED
Sbjct  395  QYGEDALKEGMGGGGGMHDPFDLFQSFFGGGSPFGGGSSRGRTQRWGDDVVHPLKVSLED  454

Query  509  LYNGTSKKLSLS  544
            LYNGTSKKLSLS
Sbjct  455  LYNGTSKKLSLS  466



>ref|XP_007205259.1| hypothetical protein PRUPE_ppa006299mg [Prunus persica]
 gb|EMJ06458.1| hypothetical protein PRUPE_ppa006299mg [Prunus persica]
Length=418

 Score =   172 bits (435),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 128/143 (90%), Positives = 136/143 (95%), Gaps = 0/143 (0%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+T+YYEILGV ++AS DDLKKAY+KAAIKNHPDKGGDPEKFKELAQAY+V
Sbjct  1    MFGRAPKKSDNTRYYEILGVSQNASHDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYDV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKREIYDQYGE+ALKEGMG GGG HDPFDIF SFFGGSPFGGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFSSFFGGSPFGGGGSSRGRRQRRGED  120

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            VVH LKVSLED+Y GTSKKLSLS
Sbjct  121  VVHSLKVSLEDIYLGTSKKLSLS  143



>ref|XP_008230416.1| PREDICTED: dnaJ protein homolog [Prunus mume]
Length=418

 Score =   172 bits (435),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 128/143 (90%), Positives = 136/143 (95%), Gaps = 0/143 (0%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+T+YYEILGV ++AS DDLKKAY+KAAIKNHPDKGGDPEKFKELAQAY+V
Sbjct  1    MFGRAPKKSDNTRYYEILGVSQNASHDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYDV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKREIYDQYGE+ALKEGMG GGG HDPFDIF SFFGGSPFGGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFSSFFGGSPFGGGGSSRGRRQRRGED  120

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            VVH LKVSLED+Y GTSKKLSLS
Sbjct  121  VVHSLKVSLEDIYLGTSKKLSLS  143



>ref|XP_006590333.1| PREDICTED: uncharacterized protein LOC100808604 isoform X1 [Glycine 
max]
 gb|KHN13055.1| DnaJ protein like [Glycine soja]
Length=417

 Score =   172 bits (435),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 126/144 (88%), Positives = 131/144 (91%), Gaps = 2/144 (1%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+T+YYEILGV K+ASQDDLKKAY+KAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKNASQDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDI-fqsffggspfggggssrgrrqrrgE  472
            LSDPEKREIYDQYGE+ALKE    GGG HDPFDI    F GGSPFG GGSSRGRRQRRGE
Sbjct  61   LSDPEKREIYDQYGEDALKE-GMGGGGGHDPFDIFSSFFGGGSPFGSGGSSRGRRQRRGE  119

Query  473  DVVHPLKVSLEDLYNGTSKKLSLS  544
            DVVHPLKVSLEDLY GTSKKLSLS
Sbjct  120  DVVHPLKVSLEDLYLGTSKKLSLS  143



>emb|CAD41609.2| OSJNBb0034G17.1 [Oryza sativa Japonica Group]
Length=704

 Score =   175 bits (444),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 103/135 (76%), Positives = 116/135 (86%), Gaps = 1/135 (1%)
 Frame = +2

Query  140  SDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEVLSDPEKRE  319
            S++TKYYE+LGVPK AS+D+LKKAYRKAAIKNHPDKGGDPEKFKEL+QAYEVL+DPEKR+
Sbjct  296  SNNTKYYEVLGVPKTASKDELKKAYRKAAIKNHPDKGGDPEKFKELSQAYEVLTDPEKRD  355

Query  320  IYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgEDVVHPLKVS  499
            IYDQYGE+ALK+GMG G   H+PFDI    F G    GG SSR RRQRRGEDV H LKVS
Sbjct  356  IYDQYGEDALKDGMGGGSDFHNPFDI-FEQFFGGGAFGGSSSRVRRQRRGEDVAHTLKVS  414

Query  500  LEDLYNGTSKKLSLS  544
            LED+YNG+ KKLSLS
Sbjct  415  LEDVYNGSMKKLSLS  429



>ref|NP_001238341.1| seed maturation protein PM37 [Glycine max]
 gb|AAD51625.1|AF169022_1 seed maturation protein PM37 [Glycine max]
 gb|KHN21201.1| DnaJ protein like [Glycine soja]
Length=417

 Score =   171 bits (434),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 126/144 (88%), Positives = 131/144 (91%), Gaps = 2/144 (1%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+T+YYEILGV K+ASQDDLKKAY+KAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKNASQDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDI-fqsffggspfggggssrgrrqrrgE  472
            LSDPEKREIYDQYGE+ALKE    GGG HDPFDI    F GGSPFG GGSSRGRRQRRGE
Sbjct  61   LSDPEKREIYDQYGEDALKE-GMGGGGGHDPFDIFSSFFGGGSPFGSGGSSRGRRQRRGE  119

Query  473  DVVHPLKVSLEDLYNGTSKKLSLS  544
            DVVHPLKVSLEDLY GTSKKLSLS
Sbjct  120  DVVHPLKVSLEDLYLGTSKKLSLS  143



>emb|CDX70980.1| BnaC03g10640D [Brassica napus]
Length=407

 Score =   171 bits (433),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 100/144 (69%), Positives = 111/144 (77%), Gaps = 14/144 (10%)
 Frame = +2

Query  116  MFGRAPK-KSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYE  292
            MF R P  KSD+TK+YEILGVPK AS +DLKKAY++AAIKNHPDKGGDPEKFKEL +AY 
Sbjct  1    MFRRGPSSKSDNTKFYEILGVPKSASPEDLKKAYKRAAIKNHPDKGGDPEKFKELGEAYG  60

Query  293  VLSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgE  472
            VLSDPEKREIYDQYGEE +K+G+      HDPFDI         F        RRQRRGE
Sbjct  61   VLSDPEKREIYDQYGEEGIKDGIDR----HDPFDI---------FSSFFGRNERRQRRGE  107

Query  473  DVVHPLKVSLEDLYNGTSKKLSLS  544
            DVVHPL+VSLEDLY GT+KKLSLS
Sbjct  108  DVVHPLRVSLEDLYLGTTKKLSLS  131



>ref|XP_007132506.1| hypothetical protein PHAVU_011G100000g [Phaseolus vulgaris]
 gb|ESW04500.1| hypothetical protein PHAVU_011G100000g [Phaseolus vulgaris]
Length=418

 Score =   171 bits (433),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 125/144 (87%), Positives = 131/144 (91%), Gaps = 2/144 (1%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+T+YYEILGV K+ASQDDLKKAY+KAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKNASQDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDI-fqsffggspfggggssrgrrqrrgE  472
            LSDPEKRE+YDQYGE+ALKE    GGG HDPFDI    F GGSPFG GGSSRGRRQRRGE
Sbjct  61   LSDPEKREVYDQYGEDALKE-GMGGGGGHDPFDIFSSFFGGGSPFGSGGSSRGRRQRRGE  119

Query  473  DVVHPLKVSLEDLYNGTSKKLSLS  544
            DVVHPLKVSLEDLY GTSKKLSLS
Sbjct  120  DVVHPLKVSLEDLYLGTSKKLSLS  143



>gb|EYU36023.1| hypothetical protein MIMGU_mgv1a007093mg [Erythranthe guttata]
Length=420

 Score =   171 bits (433),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 130/144 (90%), Positives = 134/144 (93%), Gaps = 1/144 (1%)
 Frame = +2

Query  116  MFGRAP-KKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYE  292
            MFGRAP  KSD+TKYYEILGVPK AS DDLKKAY+KAAIKNHPDKGGDPEKFKELA AYE
Sbjct  1    MFGRAPPSKSDNTKYYEILGVPKTASPDDLKKAYKKAAIKNHPDKGGDPEKFKELAHAYE  60

Query  293  VLSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgE  472
            VLSDPEKREIYDQYGE+ALKEGMG GGG HDPFDIF SFFGGSPFGGGGS RG+RQRRGE
Sbjct  61   VLSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFSSFFGGSPFGGGGSGRGQRQRRGE  120

Query  473  DVVHPLKVSLEDLYNGTSKKLSLS  544
            DVVHPLKVSLEDLY GTSKKLSLS
Sbjct  121  DVVHPLKVSLEDLYLGTSKKLSLS  144



>gb|AHA84223.1| seed maturation protein PM37 [Phaseolus vulgaris]
Length=418

 Score =   171 bits (432),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 125/144 (87%), Positives = 131/144 (91%), Gaps = 2/144 (1%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+T+YYEILGV K+ASQDDLKKAY+KAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKNASQDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDI-fqsffggspfggggssrgrrqrrgE  472
            LSDPEKRE+YDQYGE+ALKE    GGG HDPFDI    F GGSPFG GGSSRGRRQRRGE
Sbjct  61   LSDPEKREVYDQYGEDALKE-GMGGGGGHDPFDIFSSFFGGGSPFGSGGSSRGRRQRRGE  119

Query  473  DVVHPLKVSLEDLYNGTSKKLSLS  544
            DVVHPLKVSLEDLY GTSKKLSLS
Sbjct  120  DVVHPLKVSLEDLYLGTSKKLSLS  143



>ref|NP_001242510.1| uncharacterized protein LOC100808604 [Glycine max]
 gb|ACU21221.1| unknown [Glycine max]
Length=410

 Score =   171 bits (432),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 121/143 (85%), Positives = 127/143 (89%), Gaps = 7/143 (5%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+T++YEILGV K+ASQDDLKKAY+KAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRHYEILGVSKNASQDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKREIYDQYGE+ALKE    GGG HDPFDI       S F GGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKE-GMGGGGGHDPFDI------FSSFFGGGSSRGRRQRRGED  113

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            VVHPLKVSLEDLY GTSKKLSLS
Sbjct  114  VVHPLKVSLEDLYLGTSKKLSLS  136



>gb|AHA84264.1| seed maturation protein PM37 [Phaseolus vulgaris]
Length=418

 Score =   171 bits (432),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 125/144 (87%), Positives = 131/144 (91%), Gaps = 2/144 (1%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+T+YYEILGV K+ASQDDLKKAY+KAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKNASQDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDI-fqsffggspfggggssrgrrqrrgE  472
            LSDPEKRE+YDQYGE+ALKE    GGG HDPFDI    F GGSPFG GGSSRGRRQRRGE
Sbjct  61   LSDPEKREVYDQYGEDALKE-GMGGGGGHDPFDIFSSFFGGGSPFGSGGSSRGRRQRRGE  119

Query  473  DVVHPLKVSLEDLYNGTSKKLSLS  544
            DVVHPLKVSLEDLY GTSKKLSLS
Sbjct  120  DVVHPLKVSLEDLYLGTSKKLSLS  143



>ref|XP_011093285.1| PREDICTED: chaperone protein dnaJ 3-like [Sesamum indicum]
 ref|XP_011093286.1| PREDICTED: chaperone protein dnaJ 3-like [Sesamum indicum]
Length=421

 Score =   170 bits (431),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 104/145 (72%), Positives = 120/145 (83%), Gaps = 2/145 (1%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKS+  K+YEILGVP  ASQD+LKKAY+KAAIKNHPDKGGDPEKFKELA AYE+
Sbjct  1    MFGRAPKKSNDLKFYEILGVPISASQDELKKAYKKAAIKNHPDKGGDPEKFKELAHAYEI  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDI--fqsffggspfggggssrgrrqrrg  469
            LSDPEKREIYD+YGE+A+KEGMG G   +DPF+I       G     GGG S   R+R+G
Sbjct  61   LSDPEKREIYDEYGEDAVKEGMGGGSHSYDPFNIFESFFGGGFGGGFGGGRSSRSRKRQG  120

Query  470  EDVVHPLKVSLEDLYNGTSKKLSLS  544
            EDVVHPL+VSLEDLYNGT++KLS+S
Sbjct  121  EDVVHPLRVSLEDLYNGTTRKLSIS  145



>ref|XP_003605981.1| DnaJ [Medicago truncatula]
Length=413

 Score =   169 bits (428),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 123/144 (85%), Positives = 126/144 (88%), Gaps = 7/144 (5%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSDST+YYEILGV K ASQDDLKKAY+KAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDSTRYYEILGVSKTASQDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKE-GMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgE  472
            LSDPEKREIYD YGE+ALKE   G GGG HDPFDI       S F GGGSSRGRRQRRGE
Sbjct  61   LSDPEKREIYDTYGEDALKEGMGGGGGGGHDPFDI------FSSFFGGGSSRGRRQRRGE  114

Query  473  DVVHPLKVSLEDLYNGTSKKLSLS  544
            DVVHPLKVSLEDLY GTSKKLSLS
Sbjct  115  DVVHPLKVSLEDLYLGTSKKLSLS  138



>ref|XP_010535721.1| PREDICTED: chaperone protein dnaJ 3 [Tarenaya hassleriana]
Length=423

 Score =   169 bits (428),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 122/144 (85%), Positives = 130/144 (90%), Gaps = 2/144 (1%)
 Frame = +2

Query  116  MFGRAP-KKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYE  292
            MFGR P KKSD+TK+YEILGVPK+ASQ+DLKKAY+KAAIKNHPDKGGDPEKFKELAQAYE
Sbjct  1    MFGRGPSKKSDNTKFYEILGVPKNASQEDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYE  60

Query  293  VLSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgE  472
            VLSDPEKREIYDQYGE+ALKEGMG  GG HDPFDI  S F G    GGGSSRGRRQRRGE
Sbjct  61   VLSDPEKREIYDQYGEDALKEGMGGPGGGHDPFDI-FSSFFGGGPFGGGSSRGRRQRRGE  119

Query  473  DVVHPLKVSLEDLYNGTSKKLSLS  544
            DVVHPLKVSLEDLY GT+KKLSL+
Sbjct  120  DVVHPLKVSLEDLYLGTTKKLSLT  143



>ref|XP_003605980.1| DnaJ [Medicago truncatula]
 gb|AES88177.1| DnaJ-class molecular chaperone [Medicago truncatula]
Length=416

 Score =   169 bits (428),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 123/144 (85%), Positives = 126/144 (88%), Gaps = 4/144 (3%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSDST+YYEILGV K ASQDDLKKAY+KAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDSTRYYEILGVSKTASQDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKE-GMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgE  472
            LSDPEKREIYD YGE+ALKE   G GGG HDPFDI   F      GGGGSSRGRRQRRGE
Sbjct  61   LSDPEKREIYDTYGEDALKEGMGGGGGGGHDPFDI---FSSFFGGGGGGSSRGRRQRRGE  117

Query  473  DVVHPLKVSLEDLYNGTSKKLSLS  544
            DVVHPLKVSLEDLY GTSKKLSLS
Sbjct  118  DVVHPLKVSLEDLYLGTSKKLSLS  141



>ref|XP_009368443.1| PREDICTED: dnaJ protein homolog [Pyrus x bretschneideri]
Length=420

 Score =   169 bits (428),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 129/144 (90%), Positives = 133/144 (92%), Gaps = 1/144 (1%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+T+YYEILGV K AS DDLKKAY+KAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKSASPDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKE-GMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgE  472
            LSDPEKREIYDQYGE+ALKE   G GGG HDPFDIF SFFGGSPFGGGGSSRGRRQRRGE
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGGHDPFDIFSSFFGGSPFGGGGSSRGRRQRRGE  120

Query  473  DVVHPLKVSLEDLYNGTSKKLSLS  544
            DVVH LKVSLEDLY GTSKKLSLS
Sbjct  121  DVVHALKVSLEDLYLGTSKKLSLS  144



>ref|XP_006404506.1| hypothetical protein EUTSA_v10010407mg [Eutrema salsugineum]
 gb|ESQ45959.1| hypothetical protein EUTSA_v10010407mg [Eutrema salsugineum]
Length=421

 Score =   169 bits (428),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 129/144 (90%), Positives = 136/144 (94%), Gaps = 1/144 (1%)
 Frame = +2

Query  116  MFGRAP-KKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYE  292
            MFGR P KKSD+TK+YEILGVPK AS +DLKKAY+KAAIKNHPDKGGDPEKFKELAQAYE
Sbjct  1    MFGRGPSKKSDNTKFYEILGVPKTASPEDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYE  60

Query  293  VLSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgE  472
            VLSDPEKREIYDQYGE+ALKEGMG GGG HDPFDIF SFFGGSPFGGGGSSRGRRQRRGE
Sbjct  61   VLSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFSSFFGGSPFGGGGSSRGRRQRRGE  120

Query  473  DVVHPLKVSLEDLYNGTSKKLSLS  544
            DVVHPLKVSLED+Y GT+KKLSLS
Sbjct  121  DVVHPLKVSLEDVYLGTTKKLSLS  144



>ref|XP_002874044.1| hypothetical protein ARALYDRAFT_489058 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50303.1| hypothetical protein ARALYDRAFT_489058 [Arabidopsis lyrata subsp. 
lyrata]
Length=419

 Score =   169 bits (427),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 122/144 (85%), Positives = 130/144 (90%), Gaps = 1/144 (1%)
 Frame = +2

Query  116  MFGRAP-KKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYE  292
            MFGR P +KSD+TK+YEILGVPK AS +DLKKAY+KAAIKNHPDKGGDPEKFKELAQAYE
Sbjct  1    MFGRGPSRKSDNTKFYEILGVPKTASPEDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYE  60

Query  293  VLSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgE  472
            VLSDPEKREIYDQYGE+ALKEGMG GGG HDPFDIF SFFGG     GG SRGRRQRRGE
Sbjct  61   VLSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFSSFFGGGGNPFGGHSRGRRQRRGE  120

Query  473  DVVHPLKVSLEDLYNGTSKKLSLS  544
            DVVHPLKVSLED+Y GT+KKLSLS
Sbjct  121  DVVHPLKVSLEDVYLGTTKKLSLS  144



>ref|XP_008385581.1| PREDICTED: dnaJ protein homolog [Malus domestica]
Length=420

 Score =   169 bits (427),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 129/144 (90%), Positives = 133/144 (92%), Gaps = 1/144 (1%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+T+YYEILGV K AS DDLKKAY+KAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKSASPDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKE-GMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgE  472
            LSDPEKREIYDQYGE+ALKE   G GGG HDPFDIF SFFGGSPFGGGGSSRGRRQRRGE
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGGHDPFDIFSSFFGGSPFGGGGSSRGRRQRRGE  120

Query  473  DVVHPLKVSLEDLYNGTSKKLSLS  544
            DVVH LKVSLEDLY GTSKKLSLS
Sbjct  121  DVVHALKVSLEDLYLGTSKKLSLS  144



>ref|XP_009388365.1| PREDICTED: dnaJ protein homolog [Musa acuminata subsp. malaccensis]
Length=150

 Score =   161 bits (407),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 85/94 (90%), Positives = 89/94 (95%), Gaps = 1/94 (1%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+TKYYEILGVPKDASQ+DLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKDASQEDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDI  397
            LSDPEKREIYDQYGE+ALKE    GGG H+PFDI
Sbjct  61   LSDPEKREIYDQYGEDALKE-GMGGGGGHNPFDI  93



>emb|CDP15561.1| unnamed protein product [Coffea canephora]
Length=417

 Score =   168 bits (426),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 118/143 (83%), Positives = 126/143 (88%), Gaps = 1/143 (1%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+T+YYEILGV K+AS +DLKKAY+KAAIKNHPDKGGDPEKFKELA AYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKNASPEDLKKAYKKAAIKNHPDKGGDPEKFKELAHAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKREIYDQYGE+ALKEGMG GGG HDPFDI    F        GSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGMHDPFDI-FQTFFNGDPFNRGSSRGRRQRRGED  119

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            VVHPLKVSLEDLY+GT+KKLSLS
Sbjct  120  VVHPLKVSLEDLYSGTTKKLSLS  142



>gb|ACJ85213.1| unknown [Medicago truncatula]
Length=122

 Score =   159 bits (402),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 85/94 (90%), Positives = 89/94 (95%), Gaps = 0/94 (0%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+TKYYEILGV K+AS DDLKKAY KAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVSKNASPDDLKKAYEKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDI  397
            LSDPEKRE+YDQYGE+ALKEGMG GGG HDPFDI
Sbjct  61   LSDPEKREVYDQYGEDALKEGMGGGGGGHDPFDI  94



>ref|XP_002877319.1| hypothetical protein ARALYDRAFT_905503 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53578.1| hypothetical protein ARALYDRAFT_905503 [Arabidopsis lyrata subsp. 
lyrata]
Length=421

 Score =   167 bits (423),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 127/144 (88%), Positives = 134/144 (93%), Gaps = 1/144 (1%)
 Frame = +2

Query  116  MFGRAP-KKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYE  292
            MFGR P KKSD+TK+YEILGVPK+AS +DLKKAY+KAAIKNHPDKGGDPEKFKELAQAYE
Sbjct  1    MFGRGPSKKSDNTKFYEILGVPKNASPEDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYE  60

Query  293  VLSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgE  472
            VLSDPEKREIYDQYGE+ALKEGMG GGG HDPFDIF SFFG SPFG GGSSRGRRQRRGE
Sbjct  61   VLSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFSSFFGRSPFGDGGSSRGRRQRRGE  120

Query  473  DVVHPLKVSLEDLYNGTSKKLSLS  544
            DVVHPLKVSLED+Y GT KKLSLS
Sbjct  121  DVVHPLKVSLEDVYLGTMKKLSLS  144



>ref|XP_010544327.1| PREDICTED: dnaJ protein homolog [Tarenaya hassleriana]
 ref|XP_010544328.1| PREDICTED: dnaJ protein homolog [Tarenaya hassleriana]
Length=419

 Score =   167 bits (422),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 116/145 (80%), Positives = 126/145 (87%), Gaps = 7/145 (5%)
 Frame = +2

Query  116  MFGRA--PKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAY  289
            MFGR    KKSD++++YEILGV KDA+Q+DLKKAY+KAAIKNHPDKGGDPEKFKE+AQAY
Sbjct  1    MFGRGGQQKKSDNSRFYEILGVTKDATQEDLKKAYKKAAIKNHPDKGGDPEKFKEIAQAY  60

Query  290  EVLSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrg  469
            EVLSDPEKREIYDQYGEEALKEGMG  G   DPFDI       S FGGGGSSRGRR+RRG
Sbjct  61   EVLSDPEKREIYDQYGEEALKEGMGGSGPTIDPFDI-----FSSFFGGGGSSRGRRERRG  115

Query  470  EDVVHPLKVSLEDLYNGTSKKLSLS  544
            EDVVHPLKVSLEDLY GT+KKLSLS
Sbjct  116  EDVVHPLKVSLEDLYLGTTKKLSLS  140



>dbj|BAA76883.1| DnaJ homolog protein [Salix gilgiana]
 dbj|BAA76888.1| DnaJ homolog protein [Salix gilgiana]
Length=423

 Score =   167 bits (422),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 120/145 (83%), Positives = 133/145 (92%), Gaps = 2/145 (1%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAP++SD+TKYYE+L V K ASQD+LKKAY+KAAIKNHPDKGGDPEKFKEL+QAYEV
Sbjct  1    MFGRAPRRSDNTKYYEVLAVSKGASQDELKKAYKKAAIKNHPDKGGDPEKFKELSQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKE--GMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrg  469
            LSDP+KREIYDQYGE+ALKE  G G GGG H+PFDIF+SFFGG  FGGG SSRGRRQ++G
Sbjct  61   LSDPDKREIYDQYGEDALKEGMGPGGGGGGHNPFDIFESFFGGGGFGGGSSSRGRRQKQG  120

Query  470  EDVVHPLKVSLEDLYNGTSKKLSLS  544
            EDV HPLKVSLEDLYNGTSKKLSLS
Sbjct  121  EDVAHPLKVSLEDLYNGTSKKLSLS  145



>ref|NP_850653.1| chaperone protein dnaJ 3 [Arabidopsis thaliana]
 gb|AEE77864.1| chaperone protein dnaJ 3 [Arabidopsis thaliana]
Length=343

 Score =   164 bits (416),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 126/144 (88%), Gaps = 2/144 (1%)
 Frame = +2

Query  116  MFGRAP-KKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYE  292
            MFGR P KKSD+TK+YEILGVPK AS +DLKKAY+KAAIKNHPDKGGDPEKFKELAQAYE
Sbjct  1    MFGRGPSKKSDNTKFYEILGVPKSASPEDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYE  60

Query  293  VLSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgE  472
            VLSDPEKREIYDQYGE+ALKEGMG GGG HDPFDI  S F G    GG +SR RRQRRGE
Sbjct  61   VLSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDI-FSSFFGGGPFGGNTSRQRRQRRGE  119

Query  473  DVVHPLKVSLEDLYNGTSKKLSLS  544
            DVVHPLKVSLED+Y GT KKLSLS
Sbjct  120  DVVHPLKVSLEDVYLGTMKKLSLS  143



>gb|AAB86799.1| putative [Arabidopsis thaliana]
 prf||2118338A AtJ2 protein
Length=419

 Score =   166 bits (420),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 128/144 (89%), Gaps = 1/144 (1%)
 Frame = +2

Query  116  MFGRAP-KKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYE  292
            MFGR P +KSD+TK+YEILGVPK A+ +DLKKAY+KAAIKNHPDKGGDPEKFKELAQAYE
Sbjct  1    MFGRGPSRKSDNTKFYEILGVPKTAAPEDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYE  60

Query  293  VLSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgE  472
            VLSDPEKREIYDQYGE+ALKEGMG GGG HDPFDIF SFFG      G  SRGRRQRRGE
Sbjct  61   VLSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFSSFFGSGGHPFGSHSRGRRQRRGE  120

Query  473  DVVHPLKVSLEDLYNGTSKKLSLS  544
            DVVHPLKVSLED+Y GT+KKLSLS
Sbjct  121  DVVHPLKVSLEDVYLGTTKKLSLS  144



>ref|NP_568412.1| chaperone protein dnaJ 2 [Arabidopsis thaliana]
 sp|P42825.2|DNAJ2_ARATH RecName: Full=Chaperone protein dnaJ 2; Short=AtDjA2; Flags: 
Precursor [Arabidopsis thaliana]
 emb|CAC34499.1| DNAJ PROTEIN HOMOLOG ATJ [Arabidopsis thaliana]
 dbj|BAC42997.1| putative DnaJ protein homolog ATJ [Arabidopsis thaliana]
 gb|ABH04586.1| At5g22060 [Arabidopsis thaliana]
 gb|AED92977.1| chaperone protein dnaJ 2 [Arabidopsis thaliana]
Length=419

 Score =   166 bits (419),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 128/144 (89%), Gaps = 1/144 (1%)
 Frame = +2

Query  116  MFGRAP-KKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYE  292
            MFGR P +KSD+TK+YEILGVPK A+ +DLKKAY+KAAIKNHPDKGGDPEKFKELAQAYE
Sbjct  1    MFGRGPSRKSDNTKFYEILGVPKTAAPEDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYE  60

Query  293  VLSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgE  472
            VLSDPEKREIYDQYGE+ALKEGMG GGG HDPFDIF SFFG      G  SRGRRQRRGE
Sbjct  61   VLSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFSSFFGSGGHPFGSHSRGRRQRRGE  120

Query  473  DVVHPLKVSLEDLYNGTSKKLSLS  544
            DVVHPLKVSLED+Y GT+KKLSLS
Sbjct  121  DVVHPLKVSLEDVYLGTTKKLSLS  144



>gb|AAD09517.1| NTFP2, partial [Nicotiana tabacum]
Length=118

 Score =   157 bits (396),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 85/94 (90%), Positives = 88/94 (94%), Gaps = 0/94 (0%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRA KKSD+TKYYEILGVPK AS +DLKKAYRKAAIKNHPDKGGDPE FKELAQAYEV
Sbjct  1    MFGRATKKSDNTKYYEILGVPKTASPEDLKKAYRKAAIKNHPDKGGDPEMFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDI  397
            LSDPEKREIYDQYGE+ALKEGMG GGG HDPFDI
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDI  94



>ref|XP_008232370.1| PREDICTED: dnaJ protein homolog 2-like [Prunus mume]
Length=415

 Score =   165 bits (418),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 115/143 (80%), Gaps = 5/143 (3%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFG A +KSD+TKYY +LGV K++S D+LKKAY+KAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGHASRKSDNTKYYGVLGVSKNSSADELKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  296  LSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgED  475
            LSDPEKREIYDQYGE+ LKEG G G   H+PFD+       +       S  RRQ++GED
Sbjct  61   LSDPEKREIYDQYGEDGLKEGAGGGSTSHNPFDL-----FEAFLNPRYRSHVRRQKQGED  115

Query  476  VVHPLKVSLEDLYNGTSKKLSLS  544
            VVH L+VSLEDLYNGT+KKLSLS
Sbjct  116  VVHTLRVSLEDLYNGTTKKLSLS  138



>ref|NP_189997.1| chaperone protein dnaJ 3 [Arabidopsis thaliana]
 sp|Q94AW8.2|DNAJ3_ARATH RecName: Full=Chaperone protein dnaJ 3; Short=AtDjA3; Short=AtJ3; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAB86892.1| AtJ3 [Arabidopsis thaliana]
 emb|CAB88419.1| dnaJ protein homolog atj3 [Arabidopsis thaliana]
 gb|AAK59592.1| putative dnaJ protein homolog atj3 [Arabidopsis thaliana]
 gb|AAM44926.1| putative DnaJ-like protein atj3 [Arabidopsis thaliana]
 gb|AAM65624.1| dnaJ protein homolog atj3 [Arabidopsis thaliana]
 dbj|BAE98606.1| dnaJ protein homolog atj3 [Arabidopsis thaliana]
 gb|AEE77863.1| chaperone protein dnaJ 3 [Arabidopsis thaliana]
Length=420

 Score =   165 bits (417),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 126/144 (88%), Gaps = 2/144 (1%)
 Frame = +2

Query  116  MFGRAP-KKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYE  292
            MFGR P KKSD+TK+YEILGVPK AS +DLKKAY+KAAIKNHPDKGGDPEKFKELAQAYE
Sbjct  1    MFGRGPSKKSDNTKFYEILGVPKSASPEDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYE  60

Query  293  VLSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgE  472
            VLSDPEKREIYDQYGE+ALKEGMG GGG HDPFDI  S F G    GG +SR RRQRRGE
Sbjct  61   VLSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDI-FSSFFGGGPFGGNTSRQRRQRRGE  119

Query  473  DVVHPLKVSLEDLYNGTSKKLSLS  544
            DVVHPLKVSLED+Y GT KKLSLS
Sbjct  120  DVVHPLKVSLEDVYLGTMKKLSLS  143



>gb|AAK74013.1| AT3g44110/F26G5_60 [Arabidopsis thaliana]
Length=420

 Score =   165 bits (417),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 126/144 (88%), Gaps = 2/144 (1%)
 Frame = +2

Query  116  MFGRAP-KKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYE  292
            MFGR P KKSD+TK+YEILGVPK AS +DLKKAY+KAAIKNHPDKGGDPEKFKELAQAYE
Sbjct  1    MFGRGPSKKSDNTKFYEILGVPKSASPEDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYE  60

Query  293  VLSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgE  472
            VLSDPEKREIYDQYGE+ALKEGMG GGG HDPFDI  S F G    GG +SR RRQRRGE
Sbjct  61   VLSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDI-FSSFFGGGPFGGNTSRQRRQRRGE  119

Query  473  DVVHPLKVSLEDLYNGTSKKLSLS  544
            DVVHPLKVSLED+Y GT KKLSLS
Sbjct  120  DVVHPLKVSLEDVYLGTMKKLSLS  143



>gb|AAB49030.1| DnaJ homolog [Arabidopsis thaliana]
Length=420

 Score =   165 bits (417),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 126/144 (88%), Gaps = 2/144 (1%)
 Frame = +2

Query  116  MFGRAP-KKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYE  292
            MFGR P KKSD+TK+YEILGVPK AS +DLKKAY+KAAIKNHPDKGGDPEKFKELAQAYE
Sbjct  1    MFGRGPSKKSDNTKFYEILGVPKSASPEDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYE  60

Query  293  VLSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgE  472
            VLSDPEKREIYDQYGE+ALKEGMG GGG HDPFDI  S F G    GG +SR RRQRRGE
Sbjct  61   VLSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDI-FSSFFGGGPFGGNTSRQRRQRRGE  119

Query  473  DVVHPLKVSLEDLYNGTSKKLSLS  544
            DVVHPLKVSLED+Y GT KKLSLS
Sbjct  120  DVVHPLKVSLEDVYLGTMKKLSLS  143



>ref|XP_008361658.1| PREDICTED: dnaJ protein homolog [Malus domestica]
 ref|XP_008355256.1| PREDICTED: dnaJ protein homolog [Malus domestica]
Length=420

 Score =   164 bits (415),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 126/144 (88%), Positives = 131/144 (91%), Gaps = 1/144 (1%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+T+YYEILGV + AS DDLKKAY+KAAIKNHPDKGGDPEKFKELA AYE 
Sbjct  1    MFGRAPKKSDNTRYYEILGVSQSASSDDLKKAYKKAAIKNHPDKGGDPEKFKELAHAYEX  60

Query  296  LSDPEKREIYDQYGEEALKE-GMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgE  472
            LSDPEKREIYDQYGE+ALKE   G GGG HDPFDIF SFFGGSPFGGGGSSRGRRQRRGE
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGGHDPFDIFSSFFGGSPFGGGGSSRGRRQRRGE  120

Query  473  DVVHPLKVSLEDLYNGTSKKLSLS  544
            DVVH LKVSLEDLY GTSKKLSLS
Sbjct  121  DVVHALKVSLEDLYLGTSKKLSLS  144



>ref|XP_006400711.1| hypothetical protein EUTSA_v10013655mg [Eutrema salsugineum]
 gb|ESQ42164.1| hypothetical protein EUTSA_v10013655mg [Eutrema salsugineum]
Length=420

 Score =   164 bits (415),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 130/145 (90%), Gaps = 2/145 (1%)
 Frame = +2

Query  116  MFGRAP-KKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYE  292
            MFGR P +KSD+TK+YEILGVPK AS +DLKKAY+KAAIKNHPDKGGDPEKFKELAQAYE
Sbjct  1    MFGRGPSRKSDNTKFYEILGVPKTASPEDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYE  60

Query  293  VLSDPEKREIYDQYGEEALKEGMGSGGGXHDPFDIfqsffggspf-ggggssrgrrqrrg  469
            VLSDPEKRE+YDQYGE+ALKEGMG  GG HDPFDIF SFFG S    GGGSSR RRQRRG
Sbjct  61   VLSDPEKREVYDQYGEDALKEGMGGPGGGHDPFDIFSSFFGQSGNPFGGGSSRARRQRRG  120

Query  470  EDVVHPLKVSLEDLYNGTSKKLSLS  544
            EDVVHPLKVSLEDLY GT+KKLSLS
Sbjct  121  EDVVHPLKVSLEDLYLGTTKKLSLS  145



>gb|KDO48715.1| hypothetical protein CISIN_1g015695mg [Citrus sinensis]
Length=315

 Score =   162 bits (409),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 108/122 (89%), Positives = 111/122 (91%), Gaps = 1/122 (1%)
 Frame = +2

Query  179  KDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEVLSDPEKREIYDQYGEEALKEG  358
            K+ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEVLSDPEKREIYDQYGE+ALKEG
Sbjct  8    KNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEVLSDPEKREIYDQYGEDALKEG  67

Query  359  MGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgEDVVHPLKVSLEDLYNGTSKKLS  538
            MG GGG HDPFDI    F G    GGGSSRGRRQRRGEDV+HPLKVSLEDLYNGTSKKLS
Sbjct  68   MGGGGGAHDPFDI-FQSFFGGSPFGGGSSRGRRQRRGEDVIHPLKVSLEDLYNGTSKKLS  126

Query  539  LS  544
            LS
Sbjct  127  LS  128



>ref|XP_009336413.1| PREDICTED: dnaJ protein homolog [Pyrus x bretschneideri]
Length=420

 Score =   164 bits (415),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 126/144 (88%), Positives = 131/144 (91%), Gaps = 1/144 (1%)
 Frame = +2

Query  116  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  295
            MFGRAPKKSD+T+YYEILGV + AS DDLKKAY+KAAIKNHPDKGGDPEKFKELA AYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSQSASSDDLKKAYKKAAIKNHPDKGGDPEKFKELAHAYEV  60

Query  296  LSDPEKREIYDQYGEEALKE-GMGSGGGXHDPFDIfqsffggspfggggssrgrrqrrgE  472
            LSDPEKREIYDQYGE+ALKE   G GGG HDPFDIF SFFGGSPFGGGGSSRGRRQRRGE
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGGHDPFDIFSSFFGGSPFGGGGSSRGRRQRRGE  120

Query  473  DVVHPLKVSLEDLYNGTSKKLSLS  544
            DVVH LKVSLEDL  GTSKKLSLS
Sbjct  121  DVVHALKVSLEDLCLGTSKKLSLS  144



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 592801777335