BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002C13

Length=616
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009777440.1|  PREDICTED: probable protein S-acyltransferase 1    108   3e-24   Nicotiana sylvestris
ref|XP_009592264.1|  PREDICTED: probable protein S-acyltransferase 1    107   7e-24   Nicotiana tomentosiformis
ref|XP_004249100.1|  PREDICTED: probable protein S-acyltransferase 1    107   2e-23   Solanum lycopersicum
ref|XP_006364757.1|  PREDICTED: probable protein S-acyltransferas...    106   2e-23   Solanum tuberosum [potatoes]
ref|XP_007203017.1|  hypothetical protein PRUPE_ppa017899mg             101   1e-21   
ref|XP_011070038.1|  PREDICTED: probable protein S-acyltransferase 4    100   2e-21   Sesamum indicum [beniseed]
ref|XP_004289442.1|  PREDICTED: probable protein S-acyltransferas...  99.8    4e-21   Fragaria vesca subsp. vesca
gb|KDP21990.1|  hypothetical protein JCGZ_02880                         100   5e-21   Jatropha curcas
ref|XP_008240604.1|  PREDICTED: probable protein S-acyltransferas...  99.4    7e-21   Prunus mume [ume]
ref|XP_011079430.1|  PREDICTED: probable protein S-acyltransferase 4  98.2    1e-20   Sesamum indicum [beniseed]
ref|XP_008392511.1|  PREDICTED: probable protein S-acyltransferase 4  98.2    2e-20   
ref|XP_009373028.1|  PREDICTED: probable protein S-acyltransferase 4  97.8    2e-20   
ref|XP_009336518.1|  PREDICTED: probable protein S-acyltransferase 4  97.4    3e-20   Pyrus x bretschneideri [bai li]
ref|XP_006373664.1|  hypothetical protein POPTR_0016s02580g           96.7    8e-20   
ref|XP_011041324.1|  PREDICTED: probable protein S-acyltransferase 4  97.1    9e-20   Populus euphratica
ref|XP_002323199.2|  hypothetical protein POPTR_0016s02580g           96.7    1e-19   
ref|XP_002523676.1|  zinc finger protein, putative                    96.7    1e-19   Ricinus communis
emb|CDP14342.1|  unnamed protein product                              95.5    1e-19   Coffea canephora [robusta coffee]
ref|XP_009347201.1|  PREDICTED: probable protein S-acyltransferase 4  95.1    2e-19   Pyrus x bretschneideri [bai li]
gb|KJB19166.1|  hypothetical protein B456_003G087100                  92.4    5e-19   Gossypium raimondii
gb|KJB19161.1|  hypothetical protein B456_003G087100                  94.0    5e-19   Gossypium raimondii
emb|CAN79042.1|  hypothetical protein VITISV_043755                   94.7    8e-19   Vitis vinifera
ref|XP_010673207.1|  PREDICTED: probable protein S-acyltransferase 4  92.8    1e-18   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003520465.2|  PREDICTED: probable protein S-acyltransferas...  92.0    3e-18   Glycine max [soybeans]
ref|XP_011467245.1|  PREDICTED: probable protein S-acyltransferas...  91.3    3e-18   Fragaria vesca subsp. vesca
gb|AES81075.2|  DHHC-type zinc finger protein                         92.0    3e-18   Medicago truncatula
ref|XP_007028179.1|  DHHC-type zinc finger family protein, putati...  91.7    4e-18   
ref|XP_002283906.1|  PREDICTED: probable protein S-acyltransferase 4  90.9    7e-18   
ref|XP_003624857.1|  Palmitoyltransferase AKR1                        91.3    8e-18   
ref|XP_010036411.1|  PREDICTED: probable protein S-acyltransferase 4  90.1    1e-17   
ref|XP_006604301.1|  PREDICTED: probable protein S-acyltransferas...  90.5    1e-17   Glycine max [soybeans]
gb|KHN34577.1|  Putative S-acyltransferase                            90.5    1e-17   Glycine soja [wild soybean]
emb|CBI32862.3|  unnamed protein product                              90.1    1e-17   Vitis vinifera
ref|XP_004166916.1|  PREDICTED: probable S-acyltransferase At3g56...  87.0    1e-17   
ref|XP_008443205.1|  PREDICTED: probable protein S-acyltransferase 4  88.6    4e-17   Cucumis melo [Oriental melon]
ref|XP_004493297.1|  PREDICTED: probable S-acyltransferase At3g56...  88.6    4e-17   
ref|XP_004136620.1|  PREDICTED: probable S-acyltransferase At3g56...  88.2    6e-17   Cucumis sativus [cucumbers]
ref|XP_004493294.1|  PREDICTED: probable S-acyltransferase At3g56...  88.2    6e-17   
ref|XP_006430445.1|  hypothetical protein CICLE_v10011689mg           87.4    1e-16   Citrus clementina [clementine]
ref|XP_006481987.1|  PREDICTED: probable protein S-acyltransferas...  87.0    1e-16   Citrus sinensis [apfelsine]
ref|XP_008786791.1|  PREDICTED: probable protein S-acyltransferase 4  86.7    2e-16   Phoenix dactylifera
ref|XP_007161918.1|  hypothetical protein PHAVU_001G108600g           85.5    4e-16   Phaseolus vulgaris [French bean]
ref|XP_008240605.1|  PREDICTED: probable protein S-acyltransferas...  85.1    6e-16   
ref|XP_010922123.1|  PREDICTED: probable protein S-acyltransferase 1  84.7    9e-16   
ref|XP_002323200.2|  hypothetical protein POPTR_0016s02590g           82.4    4e-15   Populus trichocarpa [western balsam poplar]
ref|XP_009411183.1|  PREDICTED: probable protein S-acyltransferase 4  82.8    5e-15   
ref|NP_001190111.1|  putative S-acyltransferase                       82.8    5e-15   Arabidopsis thaliana [mouse-ear cress]
gb|AAM20704.1|  putative protein                                      82.8    6e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002876388.1|  hypothetical protein ARALYDRAFT_486136           82.8    6e-15   
ref|NP_191252.1|  putative S-acyltransferase                          82.4    7e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006430446.1|  hypothetical protein CICLE_v10013374mg           81.6    7e-15   
ref|XP_006482372.1|  PREDICTED: probable protein S-acyltransferas...  81.6    8e-15   
ref|XP_010427545.1|  PREDICTED: probable protein S-acyltransferas...  82.0    1e-14   Camelina sativa [gold-of-pleasure]
ref|XP_006291036.1|  hypothetical protein CARUB_v10017149mg           82.0    1e-14   Capsella rubella
ref|XP_010504604.1|  PREDICTED: probable protein S-acyltransferas...  82.0    1e-14   Camelina sativa [gold-of-pleasure]
ref|XP_009405119.1|  PREDICTED: probable protein S-acyltransferase 1  81.3    1e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002308847.2|  hypothetical protein POPTR_0006s02820g           80.9    2e-14   
ref|XP_006402931.1|  hypothetical protein EUTSA_v10005938mg           81.3    2e-14   Eutrema salsugineum [saltwater cress]
ref|XP_010904714.1|  PREDICTED: probable protein S-acyltransferase 4  80.9    2e-14   Elaeis guineensis
gb|EYU20840.1|  hypothetical protein MIMGU_mgv1a022244mg              80.1    2e-14   Erythranthe guttata [common monkey flower]
ref|XP_009104028.1|  PREDICTED: probable protein S-acyltransferas...  80.9    3e-14   Brassica rapa
emb|CDX67662.1|  BnaA07g17020D                                        80.5    3e-14   
emb|CDY51264.1|  BnaCnng20430D                                        80.5    3e-14   Brassica napus [oilseed rape]
emb|CDY27178.1|  BnaA09g36240D                                        81.3    4e-14   Brassica napus [oilseed rape]
ref|XP_002308848.2|  hypothetical protein POPTR_0006s02830g           79.7    5e-14   
emb|CDX72095.1|  BnaC08g27790D                                        80.1    5e-14   
emb|CBI32863.3|  unnamed protein product                              78.6    7e-14   Vitis vinifera
ref|XP_002278657.2|  PREDICTED: probable protein S-acyltransferase 1  79.0    9e-14   Vitis vinifera
ref|XP_010516297.1|  PREDICTED: probable protein S-acyltransferase 4  79.0    1e-13   
ref|XP_006832911.1|  hypothetical protein AMTR_s00095p00129120        78.6    1e-13   
ref|XP_009116394.1|  PREDICTED: probable protein S-acyltransferase 4  79.0    1e-13   Brassica rapa
gb|EYU20839.1|  hypothetical protein MIMGU_mgv1a022060mg              77.8    1e-13   Erythranthe guttata [common monkey flower]
ref|XP_004493300.1|  PREDICTED: probable S-acyltransferase At2g40...  78.6    1e-13   
ref|XP_011040691.1|  PREDICTED: probable protein S-acyltransferase 1  78.2    1e-13   Populus euphratica
ref|XP_010251763.1|  PREDICTED: probable protein S-acyltransferase 4  77.4    3e-13   Nelumbo nucifera [Indian lotus]
tpg|DAA54192.1|  TPA: hypothetical protein ZEAMMB73_579966            77.8    3e-13   
ref|XP_003520466.1|  PREDICTED: probable protein S-acyltransferas...  76.6    5e-13   Glycine max [soybeans]
emb|CAN79043.1|  hypothetical protein VITISV_043756                   76.6    5e-13   Vitis vinifera
ref|XP_004249102.1|  PREDICTED: probable protein S-acyltransferase 1  76.3    7e-13   Solanum lycopersicum
ref|XP_006364758.1|  PREDICTED: probable protein S-acyltransferas...  76.3    7e-13   Solanum tuberosum [potatoes]
ref|XP_002457656.1|  hypothetical protein SORBIDRAFT_03g011290        76.3    8e-13   
ref|XP_009790623.1|  PREDICTED: probable protein S-acyltransferase 1  76.3    8e-13   Nicotiana sylvestris
gb|KFK26112.1|  hypothetical protein AALP_AA8G204300                  75.9    1e-12   Arabis alpina [alpine rockcress]
ref|XP_009592263.1|  PREDICTED: probable protein S-acyltransferase 1  75.9    1e-12   Nicotiana tomentosiformis
gb|AES81076.2|  DHHC-type zinc finger protein                         75.5    1e-12   Medicago truncatula
ref|XP_008673921.1|  PREDICTED: probable protein S-acyltransferase 4  75.5    1e-12   
ref|XP_003624858.1|  Palmitoyltransferase PFA4                        75.5    1e-12   
emb|CBX24375.1|  hypothetical_protein                                 75.9    2e-12   Oryza glaberrima
gb|ABA96398.1|  zinc finger family protein, putative                  75.9    2e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010233056.1|  PREDICTED: probable protein S-acyltransferase 1  75.1    2e-12   
gb|KDP25918.1|  hypothetical protein JCGZ_23042                       74.7    2e-12   Jatropha curcas
ref|XP_002523674.1|  zinc finger protein, putative                    74.7    2e-12   Ricinus communis
ref|XP_006588475.1|  PREDICTED: uncharacterized protein LOC100805...  74.7    2e-12   
ref|XP_004236711.1|  PREDICTED: protein S-acyltransferase 8           74.7    2e-12   
emb|CBX25421.1|  hypothetical_protein                                 74.7    3e-12   Oryza glaberrima
ref|NP_001242156.1|  uncharacterized protein LOC100805189             74.7    3e-12   
ref|XP_010036410.1|  PREDICTED: probable protein S-acyltransferase 1  74.7    3e-12   Eucalyptus grandis [rose gum]
ref|XP_007140944.1|  hypothetical protein PHAVU_008G154500g           72.8    3e-12   Phaseolus vulgaris [French bean]
ref|XP_007028155.1|  DHHC-type zinc finger family protein, putative   73.9    3e-12   
gb|EEE52711.1|  hypothetical protein OsJ_35120                        74.3    3e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003556158.2|  PREDICTED: protein S-acyltransferase 8-like      74.3    4e-12   Glycine max [soybeans]
ref|XP_004967677.1|  PREDICTED: probable S-acyltransferase At3g56...  73.9    5e-12   
ref|XP_010525442.1|  PREDICTED: probable protein S-acyltransferase 2  73.9    5e-12   Tarenaya hassleriana [spider flower]
gb|EEC67608.1|  hypothetical protein OsI_34983                        73.9    6e-12   Oryza sativa Indica Group [Indian rice]
gb|EAY82169.1|  hypothetical protein OsI_37369                        73.9    6e-12   Oryza sativa Indica Group [Indian rice]
gb|EEE51596.1|  hypothetical protein OsJ_32848                        73.9    6e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009121384.1|  PREDICTED: probable protein S-acyltransferase 3  72.0    6e-12   Brassica rapa
ref|NP_001065672.1|  Os11g0133800                                     73.9    6e-12   
emb|CDY67095.1|  BnaCnng53500D                                        70.9    7e-12   Brassica napus [oilseed rape]
ref|XP_010525441.1|  PREDICTED: probable protein S-acyltransferase 4  73.6    7e-12   Tarenaya hassleriana [spider flower]
ref|NP_001066075.2|  Os12g0131200                                     73.9    7e-12   
ref|XP_010673206.1|  PREDICTED: probable protein S-acyltransferase 1  73.2    8e-12   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011070039.1|  PREDICTED: probable protein S-acyltransferase 1  73.2    8e-12   Sesamum indicum [beniseed]
gb|EMT07586.1|  hypothetical protein F775_13681                       72.8    9e-12   
ref|XP_009384346.1|  PREDICTED: probable protein S-acyltransferase 4  73.2    1e-11   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004961959.1|  PREDICTED: probable S-acyltransferase At4g24...  72.8    1e-11   Setaria italica
ref|XP_006346728.1|  PREDICTED: protein S-acyltransferase 8-like      72.4    1e-11   Solanum tuberosum [potatoes]
ref|XP_006290365.1|  hypothetical protein CARUB_v10017626mg           72.0    1e-11   Capsella rubella
ref|XP_009776185.1|  PREDICTED: protein S-acyltransferase 8-like ...  72.4    1e-11   Nicotiana sylvestris
ref|XP_004290492.1|  PREDICTED: protein S-acyltransferase 8           72.8    1e-11   Fragaria vesca subsp. vesca
ref|XP_003553374.1|  PREDICTED: probable protein S-acyltransferas...  72.4    1e-11   Glycine max [soybeans]
ref|XP_010926775.1|  PREDICTED: probable protein S-acyltransferas...  72.8    1e-11   Elaeis guineensis
ref|XP_004496446.1|  PREDICTED: probable S-acyltransferase At4g24...  72.4    1e-11   Cicer arietinum [garbanzo]
ref|XP_009629927.1|  PREDICTED: protein S-acyltransferase 8-like ...  72.0    2e-11   Nicotiana tomentosiformis
emb|CDX72097.1|  BnaC08g27770D                                        72.0    2e-11   
emb|CDM82986.1|  unnamed protein product                              72.0    2e-11   Triticum aestivum [Canadian hard winter wheat]
gb|EPS67406.1|  hypothetical protein M569_07370                       71.2    2e-11   Genlisea aurea
ref|XP_006436902.1|  hypothetical protein CICLE_v10031377mg           72.0    2e-11   
gb|KDO57156.1|  hypothetical protein CISIN_1g018898mg                 71.2    2e-11   Citrus sinensis [apfelsine]
ref|XP_006464542.1|  PREDICTED: protein S-acyltransferase 8-like      71.2    2e-11   Citrus sinensis [apfelsine]
ref|XP_006427889.1|  hypothetical protein CICLE_v10027028mg           71.2    2e-11   
ref|XP_006493254.1|  PREDICTED: probable protein S-acyltransferas...  72.0    2e-11   Citrus sinensis [apfelsine]
ref|XP_007143565.1|  hypothetical protein PHAVU_007G082300g           72.0    2e-11   Phaseolus vulgaris [French bean]
ref|XP_010111327.1|  putative S-acyltransferase                       71.6    2e-11   
gb|ACF79009.1|  unknown                                               71.6    3e-11   Zea mays [maize]
ref|NP_001149971.1|  LOC100283598                                     71.6    3e-11   Zea mays [maize]
gb|KGN54915.1|  hypothetical protein Csa_4G595980                     71.2    3e-11   Cucumis sativus [cucumbers]
gb|KDP36577.1|  hypothetical protein JCGZ_08344                       71.6    3e-11   Jatropha curcas
ref|XP_008237503.1|  PREDICTED: LOW QUALITY PROTEIN: protein S-ac...  71.2    3e-11   
ref|XP_008465237.1|  PREDICTED: probable protein S-acyltransferase 1  71.2    3e-11   Cucumis melo [Oriental melon]
gb|KJB60018.1|  hypothetical protein B456_009G286000                  71.2    4e-11   Gossypium raimondii
ref|XP_004144683.1|  PREDICTED: probable S-acyltransferase At5g05...  71.2    4e-11   
gb|EYU31116.1|  hypothetical protein MIMGU_mgv1a009087mg              70.9    4e-11   Erythranthe guttata [common monkey flower]
gb|KJB16369.1|  hypothetical protein B456_002G226400                  70.9    4e-11   Gossypium raimondii
ref|XP_002869709.1|  zinc ion binding protein                         71.2    4e-11   Arabidopsis lyrata subsp. lyrata
ref|XP_007199850.1|  hypothetical protein PRUPE_ppa005660mg           71.2    4e-11   
ref|XP_008381852.1|  PREDICTED: LOW QUALITY PROTEIN: protein S-ac...  71.2    4e-11   
ref|XP_009376562.1|  PREDICTED: protein S-acyltransferase 8-like      71.2    4e-11   Pyrus x bretschneideri [bai li]
ref|XP_009377643.1|  PREDICTED: probable protein S-acyltransferase 1  71.2    4e-11   Pyrus x bretschneideri [bai li]
ref|XP_006828800.1|  hypothetical protein AMTR_s00001p00123260        70.9    4e-11   Amborella trichopoda
dbj|BAE98351.1|  hypothetical protein                                 69.7    5e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001759162.1|  predicted protein                                70.9    5e-11   
ref|XP_011079233.1|  PREDICTED: probable protein S-acyltransferas...  70.9    5e-11   Sesamum indicum [beniseed]
gb|ABK25142.1|  unknown                                               70.9    5e-11   Picea sitchensis
ref|XP_011073109.1|  PREDICTED: probable protein S-acyltransferas...  69.3    5e-11   Sesamum indicum [beniseed]
ref|XP_009116393.1|  PREDICTED: LOW QUALITY PROTEIN: probable pro...  70.1    5e-11   Brassica rapa
emb|CDY27179.1|  BnaA09g36230D                                        70.1    6e-11   Brassica napus [oilseed rape]
dbj|BAJ89484.1|  predicted protein                                    70.9    6e-11   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB19167.1|  hypothetical protein B456_003G087200                  70.5    6e-11   Gossypium raimondii
ref|XP_001776677.1|  predicted protein                                70.5    6e-11   
gb|EMT14585.1|  Putative S-acyltransferase                            70.9    6e-11   
ref|XP_010943748.1|  PREDICTED: probable protein S-acyltransferas...  70.5    7e-11   Elaeis guineensis
emb|CAA23000.1|  putative protein                                     70.1    7e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009393417.1|  PREDICTED: protein S-acyltransferase 8-like      70.5    8e-11   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009599608.1|  PREDICTED: protein S-acyltransferase 8-like      70.1    8e-11   Nicotiana tomentosiformis
ref|XP_002876386.1|  zinc finger family protein                       69.7    9e-11   Arabidopsis lyrata subsp. lyrata
ref|NP_194194.2|  DHHC-type zinc finger family protein                70.1    9e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009781054.1|  PREDICTED: protein S-acyltransferase 8-like      69.7    9e-11   Nicotiana sylvestris
ref|XP_010516296.1|  PREDICTED: probable protein S-acyltransferase 1  69.3    9e-11   Camelina sativa [gold-of-pleasure]
ref|XP_010427543.1|  PREDICTED: probable protein S-acyltransferase 1  69.3    9e-11   Camelina sativa [gold-of-pleasure]
ref|XP_002439863.1|  hypothetical protein SORBIDRAFT_09g021530        70.1    1e-10   Sorghum bicolor [broomcorn]
ref|XP_011073108.1|  PREDICTED: probable protein S-acyltransferas...  68.9    1e-10   Sesamum indicum [beniseed]
ref|XP_008790729.1|  PREDICTED: probable protein S-acyltransferas...  70.1    1e-10   Phoenix dactylifera
ref|XP_004964524.1|  PREDICTED: probable S-acyltransferase At3g56...  70.1    1e-10   Setaria italica
ref|NP_001055649.1|  Os05g0436900                                     69.7    1e-10   
ref|XP_002307509.1|  zinc finger family protein                       69.7    1e-10   Populus trichocarpa [western balsam poplar]
ref|XP_008811959.1|  PREDICTED: probable protein S-acyltransferase 1  69.7    1e-10   Phoenix dactylifera
ref|XP_008790730.1|  PREDICTED: probable protein S-acyltransferas...  70.1    1e-10   
ref|XP_010552900.1|  PREDICTED: probable protein S-acyltransferase 3  69.7    1e-10   Tarenaya hassleriana [spider flower]
ref|XP_011044264.1|  PREDICTED: protein S-acyltransferase 8-like      69.7    1e-10   Populus euphratica
ref|XP_003592069.1|  Palmitoyltransferase SWF1                        69.7    1e-10   Medicago truncatula
ref|XP_004970714.1|  PREDICTED: probable S-acyltransferase At4g24...  69.3    1e-10   Setaria italica
ref|XP_006654456.1|  PREDICTED: protein S-acyltransferase 8-like      69.7    1e-10   Oryza brachyantha
ref|XP_006296259.1|  hypothetical protein CARUB_v10025425mg           69.7    1e-10   
emb|CDP14341.1|  unnamed protein product                              69.7    1e-10   Coffea canephora [robusta coffee]
ref|XP_009335282.1|  PREDICTED: probable protein S-acyltransferase 1  69.7    2e-10   Pyrus x bretschneideri [bai li]
ref|XP_006282635.1|  hypothetical protein CARUB_v10004950mg           69.3    2e-10   Capsella rubella
ref|XP_008463061.1|  PREDICTED: protein S-acyltransferase 8-like      69.3    2e-10   
ref|XP_004138367.1|  PREDICTED: probable S-acyltransferase At4g24...  69.3    2e-10   Cucumis sativus [cucumbers]
ref|XP_010517579.1|  PREDICTED: probable protein S-acyltransferase 2  69.3    2e-10   Camelina sativa [gold-of-pleasure]
ref|XP_010679975.1|  PREDICTED: probable protein S-acyltransferase 7  69.3    2e-10   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010681139.1|  PREDICTED: protein S-acyltransferase 8-like ...  69.3    2e-10   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004140962.1|  PREDICTED: probable S-acyltransferase At4g24...  68.9    2e-10   Cucumis sativus [cucumbers]
ref|XP_010508781.1|  PREDICTED: probable protein S-acyltransferase 2  68.9    2e-10   Camelina sativa [gold-of-pleasure]
ref|XP_010505862.1|  PREDICTED: probable protein S-acyltransferase 2  68.9    2e-10   Camelina sativa [gold-of-pleasure]
ref|XP_002985545.1|  hypothetical protein SELMODRAFT_13217            68.2    2e-10   
ref|XP_010423502.1|  PREDICTED: probable protein S-acyltransferase 3  68.9    2e-10   Camelina sativa [gold-of-pleasure]
ref|XP_006411364.1|  hypothetical protein EUTSA_v10016704mg           68.9    2e-10   Eutrema salsugineum [saltwater cress]
ref|XP_010491036.1|  PREDICTED: probable protein S-acyltransferas...  68.6    2e-10   Camelina sativa [gold-of-pleasure]
ref|XP_006290160.1|  hypothetical protein CARUB_v10003828mg           68.6    3e-10   Capsella rubella
ref|XP_007043729.1|  DHHC-type zinc finger family protein             68.9    3e-10   
ref|XP_006398962.1|  hypothetical protein EUTSA_v10015437mg           68.6    3e-10   Eutrema salsugineum [saltwater cress]
ref|XP_010452410.1|  PREDICTED: probable protein S-acyltransferas...  68.6    3e-10   Camelina sativa [gold-of-pleasure]
ref|XP_009130858.1|  PREDICTED: probable protein S-acyltransferase 3  68.6    3e-10   
ref|XP_008441500.1|  PREDICTED: protein S-acyltransferase 8-like      68.6    3e-10   Cucumis melo [Oriental melon]
ref|XP_008791097.1|  PREDICTED: probable protein S-acyltransferase 7  68.6    3e-10   Phoenix dactylifera
ref|NP_001149872.1|  LOC100283500                                     68.6    3e-10   Zea mays [maize]
gb|ACL53585.1|  unknown                                               68.6    3e-10   Zea mays [maize]
ref|XP_004235323.1|  PREDICTED: probable protein S-acyltransferas...  68.6    3e-10   Solanum lycopersicum
ref|XP_003578399.1|  PREDICTED: probable protein S-acyltransferase 7  68.2    4e-10   Brachypodium distachyon [annual false brome]
ref|XP_006420833.1|  hypothetical protein CICLE_v10005034mg           68.2    4e-10   Citrus clementina [clementine]
ref|NP_181632.5|  probable protein S-acyltransferase 2                68.2    4e-10   Arabidopsis thaliana [mouse-ear cress]
gb|KDP35293.1|  hypothetical protein JCGZ_09452                       67.8    4e-10   Jatropha curcas
tpg|DAA48250.1|  TPA: hypothetical protein ZEAMMB73_448859            67.0    4e-10   
tpg|DAA56648.1|  TPA: hypothetical protein ZEAMMB73_944235            67.0    4e-10   
ref|XP_008778432.1|  PREDICTED: probable protein S-acyltransferase 7  68.2    4e-10   Phoenix dactylifera
gb|EPS73403.1|  hypothetical protein M569_01348                       67.8    5e-10   Genlisea aurea
ref|XP_002987463.1|  hypothetical protein SELMODRAFT_235280           67.8    5e-10   Selaginella moellendorffii
ref|XP_002980068.1|  hypothetical protein SELMODRAFT_153626           67.8    5e-10   Selaginella moellendorffii
ref|XP_010929605.1|  PREDICTED: probable protein S-acyltransferase 7  68.2    5e-10   Elaeis guineensis
ref|XP_010250597.1|  PREDICTED: probable protein S-acyltransferas...  67.8    6e-10   Nelumbo nucifera [Indian lotus]
ref|XP_006413408.1|  hypothetical protein EUTSA_v10025973mg           66.2    6e-10   
ref|XP_010250351.1|  PREDICTED: protein S-acyltransferase 8-like ...  66.6    6e-10   Nelumbo nucifera [Indian lotus]
ref|XP_009134039.1|  PREDICTED: probable protein S-acyltransferase 9  67.4    7e-10   Brassica rapa
emb|CDX83171.1|  BnaA03g23350D                                        67.4    8e-10   
gb|ABK25091.1|  unknown                                               67.4    8e-10   Picea sitchensis
emb|CDY21437.1|  BnaC03g27600D                                        67.4    8e-10   Brassica napus [oilseed rape]
ref|XP_002871133.1|  zinc ion binding protein                         67.0    8e-10   Arabidopsis lyrata subsp. lyrata
ref|XP_002442702.1|  hypothetical protein SORBIDRAFT_08g001470        67.4    8e-10   Sorghum bicolor [broomcorn]
ref|NP_001141947.1|  uncharacterized protein LOC100274096             67.0    9e-10   Zea mays [maize]
ref|XP_010927410.1|  PREDICTED: protein S-acyltransferase 8-like ...  66.6    9e-10   
ref|XP_010927409.1|  PREDICTED: protein S-acyltransferase 8-like ...  66.6    9e-10   
ref|XP_010520765.1|  PREDICTED: protein S-acyltransferase 8-like ...  67.0    9e-10   Tarenaya hassleriana [spider flower]
ref|XP_002444861.1|  hypothetical protein SORBIDRAFT_07g000430        67.0    1e-09   Sorghum bicolor [broomcorn]
dbj|BAB11529.1|  unnamed protein product                              66.6    1e-09   Arabidopsis thaliana [mouse-ear cress]
gb|KDO39204.1|  hypothetical protein CISIN_1g014495mg                 67.0    1e-09   Citrus sinensis [apfelsine]
ref|XP_002444687.1|  hypothetical protein SORBIDRAFT_07g026030        67.0    1e-09   Sorghum bicolor [broomcorn]
ref|XP_006487580.1|  PREDICTED: probable protein S-acyltransferas...  67.0    1e-09   Citrus sinensis [apfelsine]
ref|XP_010250340.1|  PREDICTED: protein S-acyltransferase 8-like ...  66.6    1e-09   Nelumbo nucifera [Indian lotus]
ref|XP_003578979.1|  PREDICTED: probable protein S-acyltransferase 1  67.0    1e-09   Brachypodium distachyon [annual false brome]
ref|XP_010433788.1|  PREDICTED: protein S-acyltransferase 8-like      65.5    1e-09   Camelina sativa [gold-of-pleasure]
ref|XP_001757201.1|  predicted protein                                66.6    1e-09   
ref|XP_010680305.1|  PREDICTED: protein S-acyltransferase 8-like      66.6    1e-09   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006645080.1|  PREDICTED: protein S-acyltransferase 8-like      66.6    1e-09   Oryza brachyantha
gb|ABK24698.1|  unknown                                               66.6    1e-09   Picea sitchensis
ref|XP_002532773.1|  zinc finger protein, putative                    66.2    1e-09   Ricinus communis
ref|NP_001062355.1|  Os08g0535400                                     66.6    1e-09   
ref|XP_010250335.1|  PREDICTED: protein S-acyltransferase 8-like ...  66.6    1e-09   Nelumbo nucifera [Indian lotus]
ref|XP_007204900.1|  hypothetical protein PRUPE_ppa006532mg           66.6    1e-09   
ref|XP_009346802.1|  PREDICTED: probable protein S-acyltransferase 7  66.6    1e-09   Pyrus x bretschneideri [bai li]
ref|XP_009368288.1|  PREDICTED: probable protein S-acyltransferase 1  66.6    1e-09   
ref|XP_010110931.1|  putative S-acyltransferase                       66.2    1e-09   
ref|XP_009368290.1|  PREDICTED: probable protein S-acyltransferase 1  66.6    1e-09   
ref|XP_010927408.1|  PREDICTED: protein S-acyltransferase 8-like ...  66.6    1e-09   
ref|XP_010927405.1|  PREDICTED: protein S-acyltransferase 8-like ...  66.6    1e-09   
gb|KJB77223.1|  hypothetical protein B456_012G126300                  64.3    1e-09   Gossypium raimondii
ref|XP_008244866.1|  PREDICTED: probable protein S-acyltransferas...  66.6    1e-09   Prunus mume [ume]
ref|XP_008357698.1|  PREDICTED: probable protein S-acyltransferase 7  66.6    1e-09   
emb|CDY08941.1|  BnaC08g11710D                                        66.2    2e-09   Brassica napus [oilseed rape]
ref|XP_009109242.1|  PREDICTED: protein S-acyltransferase 8-like      66.2    2e-09   Brassica rapa
ref|XP_008347994.1|  PREDICTED: probable protein S-acyltransferase 7  66.6    2e-09   
ref|XP_007031947.1|  DHHC-type zinc finger family protein             66.2    2e-09   
ref|XP_009413500.1|  PREDICTED: probable protein S-acyltransferase 6  66.2    2e-09   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB77224.1|  hypothetical protein B456_012G126300                  65.5    2e-09   Gossypium raimondii
ref|XP_004974018.1|  PREDICTED: probable S-acyltransferase At3g26...  66.2    2e-09   Setaria italica
ref|NP_196126.2|  DHHC-type zinc finger family protein                66.2    2e-09   Arabidopsis thaliana [mouse-ear cress]
emb|CAC00755.1|  putative protein                                     65.5    2e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010448541.1|  PREDICTED: protein S-acyltransferase 8           66.2    2e-09   Camelina sativa [gold-of-pleasure]
ref|XP_010433743.1|  PREDICTED: protein S-acyltransferase 8-like      66.2    2e-09   Camelina sativa [gold-of-pleasure]
gb|EYU35675.1|  hypothetical protein MIMGU_mgv1a007801mg              66.2    2e-09   Erythranthe guttata [common monkey flower]
ref|XP_009411923.1|  PREDICTED: protein S-acyltransferase 8-like      66.2    2e-09   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006366904.1|  PREDICTED: probable protein S-acyltransferas...  66.2    2e-09   Solanum tuberosum [potatoes]
gb|KHG22830.1|  hypothetical protein F383_02837                       65.9    2e-09   Gossypium arboreum [tree cotton]
ref|XP_008366551.1|  PREDICTED: probable protein S-acyltransferase 1  65.9    2e-09   
gb|KJB34047.1|  hypothetical protein B456_006G044900                  65.9    2e-09   Gossypium raimondii
ref|XP_009383391.1|  PREDICTED: probable protein S-acyltransferase 6  65.9    2e-09   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009350714.1|  PREDICTED: probable protein S-acyltransferase 7  62.8    2e-09   Pyrus x bretschneideri [bai li]
ref|NP_191251.2|  putative S-acyltransferase                          65.5    3e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002303739.1|  hypothetical protein POPTR_0003s15900g           65.9    3e-09   
gb|KDO63858.1|  hypothetical protein CISIN_1g013443mg                 65.9    3e-09   
ref|XP_006447007.1|  hypothetical protein CICLE_v10015257mg           65.5    3e-09   
ref|XP_010439003.1|  PREDICTED: protein S-acyltransferase 8-like      65.5    3e-09   
ref|XP_004309653.1|  PREDICTED: probable protein S-acyltransferas...  65.5    3e-09   
ref|XP_006402194.1|  hypothetical protein EUTSA_v10013681mg           65.5    3e-09   
ref|XP_008785852.1|  PREDICTED: protein S-acyltransferase 8-like ...  65.5    3e-09   
ref|XP_006659644.1|  PREDICTED: probable protein S-acyltransferas...  65.5    3e-09   
ref|XP_011021975.1|  PREDICTED: protein S-acyltransferase 8-like ...  65.1    3e-09   
gb|KDP23240.1|  hypothetical protein JCGZ_23073                       65.5    3e-09   
ref|XP_011021973.1|  PREDICTED: protein S-acyltransferase 8-like ...  65.1    3e-09   
dbj|BAK07653.1|  predicted protein                                    65.5    4e-09   
gb|KFK26635.1|  hypothetical protein AALP_AA8G274100                  65.1    4e-09   
ref|XP_004957301.1|  PREDICTED: probable S-acyltransferase At3g26...  65.1    4e-09   
ref|XP_009768845.1|  PREDICTED: probable protein S-acyltransferase 7  65.1    4e-09   
ref|XP_008793921.1|  PREDICTED: protein S-acyltransferase 8-like      65.1    4e-09   
ref|XP_003574837.1|  PREDICTED: probable protein S-acyltransferase 6  65.1    4e-09   
ref|XP_010558122.1|  PREDICTED: probable protein S-acyltransferas...  65.1    4e-09   
gb|KHG28749.1|  hypothetical protein F383_11399                       65.1    4e-09   
ref|XP_010063838.1|  PREDICTED: protein S-acyltransferase 8           65.1    4e-09   
gb|KJB33908.1|  hypothetical protein B456_006G037900                  65.1    5e-09   
ref|XP_006660819.1|  PREDICTED: probable protein S-acyltransferas...  65.1    5e-09   
ref|XP_007159990.1|  hypothetical protein PHAVU_002G283700g           64.7    5e-09   
ref|XP_004972408.1|  PREDICTED: probable S-acyltransferase At4g24...  64.7    5e-09   
ref|XP_011075729.1|  PREDICTED: probable protein S-acyltransferase 7  64.7    5e-09   
ref|XP_010277271.1|  PREDICTED: protein S-acyltransferase 8-like      64.7    5e-09   
ref|XP_009614913.1|  PREDICTED: probable protein S-acyltransferase 7  64.7    5e-09   
gb|EEC84857.1|  hypothetical protein OsI_31977                        64.7    5e-09   
gb|KJB77222.1|  hypothetical protein B456_012G126300                  64.7    5e-09   
ref|NP_001063622.1|  Os09g0508300                                     64.7    5e-09   
gb|EEE55727.1|  hypothetical protein OsJ_04211                        64.7    6e-09   
ref|XP_006347348.1|  PREDICTED: probable protein S-acyltransferas...  64.7    6e-09   
ref|NP_001149898.1|  palmitoyltransferase ZDHHC9                      64.7    6e-09   
ref|XP_007038079.1|  DHHC-type zinc finger family protein isoform 1   64.7    6e-09   
ref|XP_008341259.1|  PREDICTED: probable protein S-acyltransferase 7  64.3    7e-09   
gb|EYU26047.1|  hypothetical protein MIMGU_mgv1a007309mg              64.3    7e-09   
ref|XP_002512693.1|  zinc finger protein, putative                    64.3    7e-09   
ref|XP_004241453.1|  PREDICTED: probable protein S-acyltransferase 7  64.3    7e-09   
tpg|DAA59185.1|  TPA: hypothetical protein ZEAMMB73_503275            63.2    7e-09   
emb|CDP14989.1|  unnamed protein product                              64.3    7e-09   
ref|XP_010250452.1|  PREDICTED: probable protein S-acyltransferase 7  64.3    8e-09   
ref|XP_009773376.1|  PREDICTED: probable protein S-acyltransferase 7  64.3    8e-09   
ref|NP_001044919.1|  Os01g0868200                                     63.9    9e-09   
ref|NP_001151207.1|  palmitoyltransferase ZDHHC9                      64.3    9e-09   
ref|XP_010044898.1|  PREDICTED: probable protein S-acyltransferase 6  63.9    9e-09   
ref|XP_008675588.1|  PREDICTED: probable protein S-acyltransferas...  64.3    9e-09   
ref|XP_008675589.1|  PREDICTED: probable protein S-acyltransferas...  64.3    1e-08   
emb|CDY34198.1|  BnaA02g28420D                                        63.9    1e-08   
emb|CDX79961.1|  BnaA05g01950D                                        63.9    1e-08   
ref|XP_009129462.1|  PREDICTED: probable protein S-acyltransferase 7  63.9    1e-08   
ref|XP_004492999.1|  PREDICTED: probable S-acyltransferase At3g26...  63.9    1e-08   
ref|XP_009347836.1|  PREDICTED: probable protein S-acyltransferase 7  63.9    1e-08   
ref|XP_011020914.1|  PREDICTED: probable protein S-acyltransferase 7  63.9    1e-08   
ref|XP_006844579.1|  hypothetical protein AMTR_s00016p00200180        63.9    1e-08   
ref|XP_009142718.1|  PREDICTED: probable protein S-acyltransferase 2  63.9    1e-08   
emb|CDY28510.1|  BnaC02g36500D                                        63.9    1e-08   
ref|XP_009597116.1|  PREDICTED: probable protein S-acyltransferase 7  63.9    1e-08   
ref|XP_008239524.1|  PREDICTED: probable protein S-acyltransferase 7  63.9    1e-08   
ref|XP_004492998.1|  PREDICTED: probable S-acyltransferase At3g26...  63.9    1e-08   
ref|XP_004304544.1|  PREDICTED: probable protein S-acyltransferase 7  63.9    1e-08   
gb|EEC82766.1|  hypothetical protein OsI_27496                        59.7    1e-08   
ref|XP_009396773.1|  PREDICTED: probable protein S-acyltransferase 7  63.9    1e-08   
ref|XP_010441416.1|  PREDICTED: probable protein S-acyltransferase 9  63.5    1e-08   
gb|EEC71865.1|  hypothetical protein OsI_04574                        63.5    1e-08   
gb|EPS65996.1|  hypothetical protein M569_08778                       63.5    1e-08   
ref|XP_010482306.1|  PREDICTED: probable protein S-acyltransferase 9  63.5    1e-08   
emb|CDY53676.1|  BnaC04g52260D                                        63.5    1e-08   
ref|XP_008675576.1|  PREDICTED: uncharacterized protein LOC103651...  63.5    1e-08   
ref|XP_010528151.1|  PREDICTED: probable protein S-acyltransferase 7  63.5    1e-08   
ref|XP_008675578.1|  PREDICTED: palmitoyltransferase erf2-like is...  63.5    1e-08   
ref|XP_008231065.1|  PREDICTED: probable protein S-acyltransferase 7  63.5    1e-08   
gb|KHG10229.1|  hypothetical protein F383_12963                       63.5    2e-08   
ref|XP_003524474.1|  PREDICTED: probable protein S-acyltransferas...  63.5    2e-08   
gb|KJB51250.1|  hypothetical protein B456_008G209200                  63.2    2e-08   
emb|CDY06951.1|  BnaA04g23640D                                        62.8    2e-08   
ref|XP_008668041.1|  PREDICTED: palmitoyltransferase ZDHHC9 isofo...  63.2    2e-08   
ref|XP_010554747.1|  PREDICTED: probable protein S-acyltransferase 1  63.2    2e-08   
gb|KJB51248.1|  hypothetical protein B456_008G209200                  63.2    2e-08   
ref|XP_010093936.1|  putative S-acyltransferase                       63.2    2e-08   
ref|XP_004301043.1|  PREDICTED: probable protein S-acyltransferase 6  63.2    2e-08   
ref|XP_008392521.1|  PREDICTED: LOW QUALITY PROTEIN: probable pro...  63.2    2e-08   
ref|XP_009385498.1|  PREDICTED: probable protein S-acyltransferase 7  63.2    2e-08   
ref|XP_008392726.1|  PREDICTED: probable protein S-acyltransferase 7  63.2    2e-08   
emb|CDY00176.1|  BnaC09g01250D                                        63.2    2e-08   
ref|XP_009111543.1|  PREDICTED: probable protein S-acyltransferas...  63.2    2e-08   
ref|XP_003624454.1|  Palmitoyltransferase ZDHHC9                      63.2    2e-08   
ref|XP_002273157.1|  PREDICTED: probable protein S-acyltransferas...  63.2    2e-08   
ref|NP_001141238.1|  hypothetical protein                             62.8    2e-08   
ref|XP_002318154.2|  hypothetical protein POPTR_0012s10510g           62.8    2e-08   
emb|CAN71475.1|  hypothetical protein VITISV_038617                   63.2    2e-08   
ref|XP_007151981.1|  hypothetical protein PHAVU_004G091700g           62.8    2e-08   
ref|XP_002511124.1|  Palmitoyltransferase ZDHHC9, putative            62.8    2e-08   
ref|XP_011025558.1|  PREDICTED: protein S-acyltransferase 8-like      62.4    2e-08   
ref|XP_003553969.1|  PREDICTED: probable protein S-acyltransferas...  62.8    2e-08   
emb|CBI21313.3|  unnamed protein product                              62.8    2e-08   
tpg|DAA59190.1|  TPA: hypothetical protein ZEAMMB73_754615            62.8    3e-08   
gb|KHN41298.1|  Putative S-acyltransferase                            62.8    3e-08   
ref|XP_003548096.1|  PREDICTED: protein S-acyltransferase 8-like ...  62.8    3e-08   
gb|KHN00612.1|  Putative S-acyltransferase                            62.4    3e-08   
ref|XP_007209138.1|  hypothetical protein PRUPE_ppa005782mg           62.8    3e-08   
ref|XP_003532462.1|  PREDICTED: probable protein S-acyltransferas...  62.4    3e-08   
ref|XP_002284252.1|  PREDICTED: probable protein S-acyltransferase 7  62.4    3e-08   
ref|XP_006662708.1|  PREDICTED: probable protein S-acyltransferas...  62.8    3e-08   
gb|KHN28546.1|  Putative S-acyltransferase                            62.4    3e-08   
ref|XP_006281747.1|  hypothetical protein CARUB_v10027904mg           62.4    3e-08   
gb|KHN13374.1|  Putative S-acyltransferase                            62.4    3e-08   
ref|XP_009378011.1|  PREDICTED: probable protein S-acyltransferase 7  62.4    3e-08   
ref|XP_009344211.1|  PREDICTED: probable protein S-acyltransferase 7  62.4    3e-08   
emb|CDY52410.1|  BnaC07g49090D                                        62.4    3e-08   
gb|KFK42318.1|  hypothetical protein AALP_AA2G240500                  62.4    3e-08   
ref|XP_003549008.1|  PREDICTED: probable protein S-acyltransferas...  62.4    3e-08   
ref|XP_003548022.1|  PREDICTED: probable protein S-acyltransferas...  62.4    3e-08   
ref|XP_007151749.1|  hypothetical protein PHAVU_004G071400g           62.4    3e-08   
ref|XP_006844684.1|  hypothetical protein AMTR_s00016p00244610        62.4    3e-08   
ref|XP_009342210.1|  PREDICTED: probable protein S-acyltransferase 7  62.4    3e-08   
gb|EAZ07812.1|  hypothetical protein OsI_30070                        62.4    3e-08   
emb|CAN81512.1|  hypothetical protein VITISV_001671                   62.4    3e-08   
ref|XP_003518123.1|  PREDICTED: probable protein S-acyltransferas...  62.4    3e-08   
emb|CDY13668.1|  BnaA06g32550D                                        62.4    4e-08   
ref|XP_009152005.1|  PREDICTED: probable protein S-acyltransferase 7  62.4    4e-08   
emb|CBI15716.3|  unnamed protein product                              62.4    4e-08   
ref|XP_009141958.1|  PREDICTED: probable protein S-acyltransferas...  62.0    4e-08   
gb|EYU31851.1|  hypothetical protein MIMGU_mgv1a006331mg              62.0    4e-08   
ref|XP_009612423.1|  PREDICTED: probable protein S-acyltransferase 7  62.0    4e-08   
ref|XP_010249126.1|  PREDICTED: probable protein S-acyltransferas...  62.0    5e-08   
ref|XP_009383862.1|  PREDICTED: probable protein S-acyltransferas...  62.0    5e-08   
ref|XP_009773560.1|  PREDICTED: probable protein S-acyltransferase 7  62.0    5e-08   
ref|XP_009141957.1|  PREDICTED: probable protein S-acyltransferas...  62.0    5e-08   
ref|XP_004495466.1|  PREDICTED: probable S-acyltransferase At4g24...  58.9    5e-08   
ref|XP_002299362.2|  hypothetical protein POPTR_0001s12750g           62.0    5e-08   
gb|EMS67031.1|  hypothetical protein TRIUR3_31888                     62.0    5e-08   
ref|XP_011023928.1|  PREDICTED: probable protein S-acyltransferas...  62.0    5e-08   
ref|XP_011023929.1|  PREDICTED: probable protein S-acyltransferas...  61.6    6e-08   
ref|XP_011083425.1|  PREDICTED: probable protein S-acyltransferase 7  61.6    6e-08   
ref|XP_004515996.1|  PREDICTED: probable S-acyltransferase At3g26...  61.6    6e-08   
ref|XP_002321733.1|  hypothetical protein POPTR_0015s11400g           61.6    6e-08   
gb|ACJ84401.1|  unknown                                               57.8    6e-08   
ref|XP_003564978.1|  PREDICTED: probable protein S-acyltransferase 7  61.6    6e-08   
ref|XP_011004339.1|  PREDICTED: probable protein S-acyltransferas...  61.6    6e-08   
gb|AFK39395.1|  unknown                                               61.6    6e-08   
ref|XP_010550747.1|  PREDICTED: probable protein S-acyltransferas...  61.6    7e-08   
ref|XP_004515995.1|  PREDICTED: probable S-acyltransferase At3g26...  61.6    7e-08   
ref|XP_010652889.1|  PREDICTED: protein S-acyltransferase 8 isofo...  60.8    7e-08   
emb|CDY57573.1|  BnaC04g56780D                                        61.2    7e-08   
ref|XP_010519475.1|  PREDICTED: probable protein S-acyltransferase 5  61.6    7e-08   
gb|EMT21298.1|  Putative S-acyltransferase                            61.2    8e-08   
ref|XP_009628288.1|  PREDICTED: protein S-acyltransferase 8-like      61.2    8e-08   
ref|NP_001142294.1|  uncharacterized protein LOC100274463             61.2    8e-08   
ref|XP_006473090.1|  PREDICTED: protein S-acyltransferase 8-like      61.2    8e-08   
ref|XP_006434505.1|  hypothetical protein CICLE_v10001285mg           61.2    8e-08   
ref|NP_198922.1|  DHHC-type zinc finger family protein                61.2    8e-08   
ref|NP_001062374.1|  Os08g0539100                                     61.2    9e-08   
ref|XP_009803969.1|  PREDICTED: protein S-acyltransferase 8           61.2    9e-08   
ref|XP_010910251.1|  PREDICTED: probable protein S-acyltransferas...  60.8    9e-08   
gb|KDO83788.1|  hypothetical protein CISIN_1g014261mg                 61.2    9e-08   
ref|XP_010249346.1|  PREDICTED: probable protein S-acyltransferase 7  60.8    9e-08   
ref|XP_003574851.1|  PREDICTED: probable protein S-acyltransferase 7  61.2    9e-08   
ref|XP_010514369.1|  PREDICTED: probable protein S-acyltransferase 7  60.8    9e-08   
ref|XP_010502648.1|  PREDICTED: probable protein S-acyltransferase 7  60.8    1e-07   
dbj|BAB01189.1|  unnamed protein product                              60.8    1e-07   
ref|NP_001060772.1|  Os08g0103400                                     60.5    1e-07   
ref|NP_850638.1|  putative S-acyltransferase                          60.8    1e-07   
ref|XP_002278286.1|  PREDICTED: protein S-acyltransferase 8 isofo...  60.8    1e-07   
dbj|BAJ99902.1|  predicted protein                                    60.8    1e-07   
ref|XP_006395501.1|  hypothetical protein EUTSA_v10004226mg           60.8    1e-07   
ref|XP_002877006.1|  zinc finger family protein                       60.8    1e-07   
gb|EAZ43494.1|  hypothetical protein OsJ_28110                        60.8    1e-07   
gb|KDP22570.1|  hypothetical protein JCGZ_26401                       60.8    1e-07   
ref|XP_010425430.1|  PREDICTED: probable protein S-acyltransferase 7  60.8    1e-07   
ref|XP_006291141.1|  hypothetical protein CARUB_v10017257mg           60.8    1e-07   
gb|KJB28971.1|  hypothetical protein B456_005G077800                  60.8    1e-07   
ref|XP_007161696.1|  hypothetical protein PHAVU_001G090700g           60.8    1e-07   
dbj|BAJ85153.1|  predicted protein                                    60.8    1e-07   
ref|XP_006357344.1|  PREDICTED: protein S-acyltransferase 8-like      60.5    1e-07   
gb|EEE67898.1|  hypothetical protein OsJ_25736                        60.5    1e-07   
ref|XP_010556303.1|  PREDICTED: probable protein S-acyltransferase 7  60.8    1e-07   
ref|XP_002462643.1|  hypothetical protein SORBIDRAFT_02g029440        60.8    1e-07   
gb|EEC82764.1|  hypothetical protein OsI_27491                        60.5    1e-07   
ref|XP_009353491.1|  PREDICTED: probable protein S-acyltransferase 7  60.5    1e-07   
ref|XP_010910250.1|  PREDICTED: probable protein S-acyltransferas...  60.5    1e-07   
gb|KFK34176.1|  hypothetical protein AALP_AA5G110400                  60.5    1e-07   
ref|XP_008390231.1|  PREDICTED: probable protein S-acyltransferase 6  60.5    1e-07   
gb|KFK33610.1|  hypothetical protein AALP_AA5G036400                  60.5    1e-07   
emb|CBI29283.3|  unnamed protein product                              60.5    2e-07   
emb|CDX87017.1|  BnaC03g52870D                                        60.5    2e-07   
ref|XP_010657521.1|  PREDICTED: probable protein S-acyltransferase 7  60.5    2e-07   
ref|XP_009150177.1|  PREDICTED: LOW QUALITY PROTEIN: probable pro...  60.5    2e-07   
ref|XP_004231755.1|  PREDICTED: probable protein S-acyltransferase 7  60.5    2e-07   
ref|XP_003573257.1|  PREDICTED: protein S-acyltransferase 8-like      60.1    2e-07   
ref|XP_006338722.1|  PREDICTED: probable protein S-acyltransferas...  60.1    2e-07   
emb|CAB87904.1|  putative protein                                     60.5    2e-07   
ref|NP_001288988.1|  probable protein S-acyltransferase 5             60.1    2e-07   
ref|NP_190445.2|  putative S-acyltransferase                          60.5    2e-07   
ref|XP_006291034.1|  hypothetical protein CARUB_v10017146mg           60.1    2e-07   
ref|XP_006405397.1|  hypothetical protein EUTSA_v10027785mg           60.1    2e-07   
dbj|BAK03564.1|  predicted protein                                    60.1    2e-07   
emb|CAN74600.1|  hypothetical protein VITISV_021495                   60.1    2e-07   
ref|XP_003518555.1|  PREDICTED: protein S-acyltransferase 8-like ...  60.1    2e-07   
ref|XP_009761768.1|  PREDICTED: probable protein S-acyltransferase 7  60.1    2e-07   
ref|XP_009404189.1|  PREDICTED: probable protein S-acyltransferase 7  60.1    2e-07   
ref|XP_009628445.1|  PREDICTED: probable protein S-acyltransferase 7  60.1    2e-07   
ref|XP_009149794.1|  PREDICTED: probable protein S-acyltransferase 5  59.7    2e-07   
emb|CDY05871.1|  BnaC08g20480D                                        59.7    3e-07   
ref|XP_007019572.1|  DHHC-type zinc finger family protein             59.7    3e-07   
ref|XP_002300909.1|  hypothetical protein POPTR_0002s06610g           59.7    3e-07   
ref|XP_002512891.1|  zinc finger protein, putative                    59.7    3e-07   
emb|CDY37914.1|  BnaA06g19030D                                        59.7    3e-07   
ref|XP_008450142.1|  PREDICTED: probable protein S-acyltransferase 7  59.7    3e-07   
ref|XP_002864027.1|  zinc finger family protein                       59.7    3e-07   
ref|XP_004148004.1|  PREDICTED: probable S-acyltransferase At3g26...  59.7    3e-07   
ref|XP_004168841.1|  PREDICTED: LOW QUALITY PROTEIN: probable S-a...  59.7    3e-07   
ref|XP_010320113.1|  PREDICTED: protein S-acyltransferase 8           59.7    3e-07   
ref|XP_006404219.1|  hypothetical protein EUTSA_v10010352mg           59.7    3e-07   
gb|KJB14945.1|  hypothetical protein B456_002G150100                  59.3    3e-07   
ref|XP_010028971.1|  PREDICTED: probable protein S-acyltransferase 7  59.3    3e-07   
ref|XP_006283837.1|  hypothetical protein CARUB_v10004938mg           59.3    3e-07   
ref|XP_006359052.1|  PREDICTED: protein S-acyltransferase 8-like      59.3    3e-07   
ref|XP_007215386.1|  hypothetical protein PRUPE_ppa005757mg           59.3    3e-07   
ref|XP_009337538.1|  PREDICTED: probable protein S-acyltransferase 7  59.3    4e-07   
ref|XP_009411802.1|  PREDICTED: probable protein S-acyltransferase 7  59.3    4e-07   
ref|XP_002444667.1|  hypothetical protein SORBIDRAFT_07g025730        59.3    4e-07   
ref|XP_002870656.1|  zinc finger family protein                       59.3    4e-07   



>ref|XP_009777440.1| PREDICTED: probable protein S-acyltransferase 1 [Nicotiana sylvestris]
Length=482

 Score =   108 bits (271),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 58/75 (77%), Gaps = 4/75 (5%)
 Frame = +1

Query  325  MAQGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKH  504
            M + K K  RLYQVWKGSNKFL+GGRLIFGPDVASLFLS LLIAGPA AFCIKV   I+H
Sbjct  1    MVREKHKPLRLYQVWKGSNKFLWGGRLIFGPDVASLFLSTLLIAGPALAFCIKVSCVIRH  60

Query  505  ----HKDGSSWYPIL  537
                HKD   WYPIL
Sbjct  61   RIKEHKDAGPWYPIL  75



>ref|XP_009592264.1| PREDICTED: probable protein S-acyltransferase 1 [Nicotiana tomentosiformis]
Length=482

 Score =   107 bits (268),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 58/75 (77%), Gaps = 4/75 (5%)
 Frame = +1

Query  325  MAQGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKH  504
            M + K K  RLYQVWKGSNKFL+GGRLIFGPDV+SLFLS LLIAGPA AFCIKV   I+H
Sbjct  1    MVREKHKPLRLYQVWKGSNKFLWGGRLIFGPDVSSLFLSTLLIAGPALAFCIKVSCVIRH  60

Query  505  ----HKDGSSWYPIL  537
                HKD   WYPIL
Sbjct  61   RIKEHKDAGPWYPIL  75



>ref|XP_004249100.1| PREDICTED: probable protein S-acyltransferase 1 [Solanum lycopersicum]
Length=482

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/76 (70%), Positives = 58/76 (76%), Gaps = 4/76 (5%)
 Frame = +1

Query  325  MAQGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKH  504
            M + K K  +LYQVWKGSNKFL GGRLIFGPDV+SLFLS LLIAGPA AFCIKV   I+H
Sbjct  1    MVREKHKPLKLYQVWKGSNKFLLGGRLIFGPDVSSLFLSTLLIAGPALAFCIKVSCVIRH  60

Query  505  ----HKDGSSWYPILL  540
                HKD   WYPIL+
Sbjct  61   RIREHKDAGPWYPILV  76



>ref|XP_006364757.1| PREDICTED: probable protein S-acyltransferase 4-like [Solanum 
tuberosum]
Length=482

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/76 (70%), Positives = 58/76 (76%), Gaps = 4/76 (5%)
 Frame = +1

Query  325  MAQGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKH  504
            M + K K  +LYQVWKGSNKFL GGRLIFGPDV+SLFLS LLIAGPA AFCIKV   I+H
Sbjct  1    MVREKHKPLKLYQVWKGSNKFLLGGRLIFGPDVSSLFLSTLLIAGPALAFCIKVSCVIRH  60

Query  505  ----HKDGSSWYPILL  540
                HKD   WYPIL+
Sbjct  61   RIKEHKDAGPWYPILV  76



>ref|XP_007203017.1| hypothetical protein PRUPE_ppa017899mg, partial [Prunus persica]
 gb|EMJ04216.1| hypothetical protein PRUPE_ppa017899mg, partial [Prunus persica]
Length=443

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 53/75 (71%), Positives = 57/75 (76%), Gaps = 4/75 (5%)
 Frame = +1

Query  325  MAQGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKH  504
            MAQ K K  RLYQVWKGSN FL GGRLIFGPDVASL LS LL+AGPA AFCIKVY  IKH
Sbjct  1    MAQNKPK--RLYQVWKGSNNFLCGGRLIFGPDVASLLLSTLLVAGPAVAFCIKVYLKIKH  58

Query  505  HKDGSSWYPILLXWS  549
             K+    YP+L+  S
Sbjct  59   GKNTD--YPVLIVGS  71



>ref|XP_011070038.1| PREDICTED: probable protein S-acyltransferase 4 [Sesamum indicum]
Length=415

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 56/76 (74%), Gaps = 4/76 (5%)
 Frame = +1

Query  325  MAQGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKH  504
            M   K + KRLYQVW+G+NKFLFGGRLIFGPDVASLFLS  LI  PA AFC+K+ S I+H
Sbjct  1    MDVAKPETKRLYQVWRGNNKFLFGGRLIFGPDVASLFLSSFLIVSPAVAFCVKILSIIRH  60

Query  505  ----HKDGSSWYPILL  540
                +KD   WY +++
Sbjct  61   PLSENKDAVPWYSVII  76



>ref|XP_004289442.1| PREDICTED: probable protein S-acyltransferase 4 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=432

 Score = 99.8 bits (247),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 49/77 (64%), Positives = 57/77 (74%), Gaps = 5/77 (6%)
 Frame = +1

Query  334  GKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKHHKD  513
             + K KRLYQVWKGSN F FGGRL+FGPDVASL LS+LLIA PA AFCIKVY+ ++H  D
Sbjct  2    ARDKPKRLYQVWKGSNNFFFGGRLVFGPDVASLTLSVLLIAVPAMAFCIKVYAKLQHVSD  61

Query  514  -----GSSWYPILLXWS  549
                  S WYP+L+  S
Sbjct  62   VTKTEDSIWYPVLIVAS  78



>gb|KDP21990.1| hypothetical protein JCGZ_02880 [Jatropha curcas]
Length=509

 Score =   100 bits (249),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 54/74 (73%), Gaps = 2/74 (3%)
 Frame = +1

Query  334  GKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNI--KHH  507
             K K KRLYQVWKGSN+F  GGRLIFGPDVAS+FLS LLIAGPA AFCIK Y  I  K  
Sbjct  15   AKDKPKRLYQVWKGSNRFFCGGRLIFGPDVASMFLSTLLIAGPAIAFCIKTYLKIVDKDT  74

Query  508  KDGSSWYPILLXWS  549
            K    WYP+L+  S
Sbjct  75   KHPDHWYPVLIVGS  88



>ref|XP_008240604.1| PREDICTED: probable protein S-acyltransferase 4 isoform X1 [Prunus 
mume]
Length=451

 Score = 99.4 bits (246),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 53/77 (69%), Positives = 57/77 (74%), Gaps = 4/77 (5%)
 Frame = +1

Query  325  MAQGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIK-  501
            MAQ K K  RLYQVWKGSN F  GGRLIFGPDVASL LS LL+AGPA AFCIKVY  IK 
Sbjct  1    MAQNKPK--RLYQVWKGSNHFFCGGRLIFGPDVASLLLSTLLVAGPAVAFCIKVYFKIKK  58

Query  502  -HHKDGSSWYPILLXWS  549
             +  D S WYP+L+  S
Sbjct  59   GNVTDYSLWYPVLIVGS  75



>ref|XP_011079430.1| PREDICTED: probable protein S-acyltransferase 4 [Sesamum indicum]
Length=409

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 57/76 (75%), Gaps = 4/76 (5%)
 Frame = +1

Query  325  MAQGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKH  504
            M   K K +RLYQVW+GSN+FLFGGRLIFGPDV+SLFLS  LIAGPA AFCIK+   I+H
Sbjct  1    MEIEKPKPQRLYQVWRGSNRFLFGGRLIFGPDVSSLFLSTFLIAGPALAFCIKISCIIRH  60

Query  505  ----HKDGSSWYPILL  540
                +K   SWY +++
Sbjct  61   RIRENKPALSWYSVMI  76



>ref|XP_008392511.1| PREDICTED: probable protein S-acyltransferase 4 [Malus domestica]
Length=439

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 51/77 (66%), Positives = 56/77 (73%), Gaps = 4/77 (5%)
 Frame = +1

Query  325  MAQGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKH  504
            MAQ K K  RLYQVWKGSN F  GGRLIFGPDVASL LS LLIAGPA AFC+KVY  IK 
Sbjct  1    MAQNKTK--RLYQVWKGSNNFFCGGRLIFGPDVASLLLSTLLIAGPAVAFCLKVYLKIKD  58

Query  505  HKDGSS--WYPILLXWS  549
             K+ +   W P+L+  S
Sbjct  59   EKNKNENLWLPVLVIGS  75



>ref|XP_009373028.1| PREDICTED: probable protein S-acyltransferase 4 [Pyrus x bretschneideri]
 ref|XP_009348983.1| PREDICTED: probable protein S-acyltransferase 4 [Pyrus x bretschneideri]
Length=439

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 57/77 (74%), Gaps = 4/77 (5%)
 Frame = +1

Query  325  MAQGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKH  504
            MAQ K K  RLYQVWKGSN F  GGRLIFGPDVASL LS LLIAGPA AFC+KVY  IK 
Sbjct  1    MAQNKPK--RLYQVWKGSNNFFCGGRLIFGPDVASLLLSTLLIAGPAVAFCLKVYLKIKD  58

Query  505  --HKDGSSWYPILLXWS  549
              +K+ S W P+L+  S
Sbjct  59   EKNKNESLWLPVLVVGS  75



>ref|XP_009336518.1| PREDICTED: probable protein S-acyltransferase 4 [Pyrus x bretschneideri]
 ref|XP_009336520.1| PREDICTED: probable protein S-acyltransferase 4 [Pyrus x bretschneideri]
 ref|XP_009336521.1| PREDICTED: probable protein S-acyltransferase 4 [Pyrus x bretschneideri]
Length=439

 Score = 97.4 bits (241),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 51/77 (66%), Positives = 58/77 (75%), Gaps = 4/77 (5%)
 Frame = +1

Query  325  MAQGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKH  504
            MAQ K K  R+YQVWKGSN F+ GGRLIFGPDVASL LS LLIAGPA AFC+KVY  IK 
Sbjct  1    MAQNKPK--RVYQVWKGSNNFICGGRLIFGPDVASLLLSTLLIAGPAVAFCLKVYLKIKD  58

Query  505  --HKDGSSWYPILLXWS  549
              +K+ S W P+L+  S
Sbjct  59   EKNKNESLWLPVLVIAS  75



>ref|XP_006373664.1| hypothetical protein POPTR_0016s02580g [Populus trichocarpa]
 gb|ERP51461.1| hypothetical protein POPTR_0016s02580g [Populus trichocarpa]
Length=485

 Score = 96.7 bits (239),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 54/71 (76%), Gaps = 2/71 (3%)
 Frame = +1

Query  343  KVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNI--KHHKDG  516
            K KRLYQVW+GSN+F  GGRLIFGPDVAS+FLSMLLIA PA  FCIKVY+ I  K  K+ 
Sbjct  6    KPKRLYQVWRGSNRFFCGGRLIFGPDVASIFLSMLLIAAPAIGFCIKVYNKILDKGTKNP  65

Query  517  SSWYPILLXWS  549
            + WYP+    S
Sbjct  66   ARWYPVFFVGS  76



>ref|XP_011041324.1| PREDICTED: probable protein S-acyltransferase 4 [Populus euphratica]
 ref|XP_011041325.1| PREDICTED: probable protein S-acyltransferase 4 [Populus euphratica]
Length=515

 Score = 97.1 bits (240),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 54/71 (76%), Gaps = 2/71 (3%)
 Frame = +1

Query  343  KVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNI--KHHKDG  516
            K KRLYQVWKGSN+F  GGRLIFGPDVAS+FLSMLL+A PA  FCIKVY+ I  K  K+ 
Sbjct  36   KPKRLYQVWKGSNRFFCGGRLIFGPDVASIFLSMLLVAAPAIGFCIKVYNKILDKGTKNP  95

Query  517  SSWYPILLXWS  549
            + WYP+    S
Sbjct  96   ARWYPVFFVGS  106



>ref|XP_002323199.2| hypothetical protein POPTR_0016s02580g [Populus trichocarpa]
 gb|EEF04960.2| hypothetical protein POPTR_0016s02580g [Populus trichocarpa]
Length=514

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 54/71 (76%), Gaps = 2/71 (3%)
 Frame = +1

Query  343  KVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNI--KHHKDG  516
            K KRLYQVW+GSN+F  GGRLIFGPDVAS+FLSMLLIA PA  FCIKVY+ I  K  K+ 
Sbjct  35   KPKRLYQVWRGSNRFFCGGRLIFGPDVASIFLSMLLIAAPAIGFCIKVYNKILDKGTKNP  94

Query  517  SSWYPILLXWS  549
            + WYP+    S
Sbjct  95   ARWYPVFFVGS  105



>ref|XP_002523676.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF38711.1| zinc finger protein, putative [Ricinus communis]
Length=498

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 53/71 (75%), Gaps = 2/71 (3%)
 Frame = +1

Query  334  GKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNI--KHH  507
              AK KRLYQVWKGSN+F  GGRLIFGPDVAS+FLS LLIAGPA AFCIK Y  I  K  
Sbjct  15   SNAKPKRLYQVWKGSNRFFCGGRLIFGPDVASMFLSTLLIAGPAIAFCIKTYLKIVDKDT  74

Query  508  KDGSSWYPILL  540
            K+   W P+L+
Sbjct  75   KNPFHWCPVLI  85



>emb|CDP14342.1| unnamed protein product [Coffea canephora]
Length=438

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 60/80 (75%), Gaps = 5/80 (6%)
 Frame = +1

Query  325  MAQGKAKV-KRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIK  501
            MAQ K +  KRLYQVWKG+N+F  GGRLIFGP+VASL +S  LIA PA AFCIKVY  I+
Sbjct  1    MAQQKPRPRKRLYQVWKGNNRFFCGGRLIFGPEVASLLVSTALIAVPAIAFCIKVYFIIR  60

Query  502  HH-KDGS---SWYPILLXWS  549
            HH K+G    SWYP+L+  S
Sbjct  61   HHIKEGKPDISWYPVLVIGS  80



>ref|XP_009347201.1| PREDICTED: probable protein S-acyltransferase 4 [Pyrus x bretschneideri]
 ref|XP_009347202.1| PREDICTED: probable protein S-acyltransferase 4 [Pyrus x bretschneideri]
Length=438

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/73 (66%), Positives = 55/73 (75%), Gaps = 4/73 (5%)
 Frame = +1

Query  325  MAQGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIK-  501
            MAQ K    RLYQVWKGSNKF  GGRLIFGPDVASL LS +L+AGPA AFC+KVY  IK 
Sbjct  1    MAQNKPS--RLYQVWKGSNKFFCGGRLIFGPDVASLLLSTILVAGPAVAFCLKVYFKIKN  58

Query  502  -HHKDGSSWYPIL  537
             + K+ + W P+L
Sbjct  59   GNQKNDNLWLPVL  71



>gb|KJB19166.1| hypothetical protein B456_003G087100 [Gossypium raimondii]
Length=277

 Score = 92.4 bits (228),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 46/68 (68%), Positives = 51/68 (75%), Gaps = 1/68 (1%)
 Frame = +1

Query  340  AKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKHHK-DG  516
             K KRLYQVWKGSN+F  GGRLIFGPDVASLFLS  LIAGPA AFCI++Y  IKH   + 
Sbjct  8    TKSKRLYQVWKGSNRFFCGGRLIFGPDVASLFLSTFLIAGPAIAFCIRMYIKIKHENTNA  67

Query  517  SSWYPILL  540
               Y IL+
Sbjct  68   GRCYSILI  75



>gb|KJB19161.1| hypothetical protein B456_003G087100 [Gossypium raimondii]
 gb|KJB19162.1| hypothetical protein B456_003G087100 [Gossypium raimondii]
 gb|KJB19163.1| hypothetical protein B456_003G087100 [Gossypium raimondii]
 gb|KJB19164.1| hypothetical protein B456_003G087100 [Gossypium raimondii]
 gb|KJB19165.1| hypothetical protein B456_003G087100 [Gossypium raimondii]
Length=433

 Score = 94.0 bits (232),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 46/68 (68%), Positives = 51/68 (75%), Gaps = 1/68 (1%)
 Frame = +1

Query  340  AKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKHHK-DG  516
             K KRLYQVWKGSN+F  GGRLIFGPDVASLFLS  LIAGPA AFCI++Y  IKH   + 
Sbjct  8    TKSKRLYQVWKGSNRFFCGGRLIFGPDVASLFLSTFLIAGPAIAFCIRMYIKIKHENTNA  67

Query  517  SSWYPILL  540
               Y IL+
Sbjct  68   GRCYSILI  75



>emb|CAN79042.1| hypothetical protein VITISV_043755 [Vitis vinifera]
Length=616

 Score = 94.7 bits (234),  Expect = 8e-19, Method: Composition-based stats.
 Identities = 45/88 (51%), Positives = 58/88 (66%), Gaps = 1/88 (1%)
 Frame = +1

Query  328  AQGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKHH  507
            A  ++K KRLYQVWKG+N+F  GGRLIFGPDVASLFLS LLIAGP   FC+K++  IK  
Sbjct  195  AADRSKPKRLYQVWKGANRFFCGGRLIFGPDVASLFLSTLLIAGPGIGFCLKIHYKIKED  254

Query  508  KDG-SSWYPILLXWSSSCHSGPYVSLFD  588
             D     +   + W S    G ++++ D
Sbjct  255  DDDYGRXFAHHVVWYSIMAVGAFLTILD  282



>ref|XP_010673207.1| PREDICTED: probable protein S-acyltransferase 4 [Beta vulgaris 
subsp. vulgaris]
Length=420

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 53/67 (79%), Gaps = 3/67 (4%)
 Frame = +1

Query  334  GKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKHHKD  513
            G  K KRL++VWKG+NKFL GGRLIFGPDVAS+FLS +LIAGPA AFCIK++      KD
Sbjct  3    GTNKPKRLFEVWKGNNKFLCGGRLIFGPDVASMFLSNVLIAGPALAFCIKMFLK---GKD  59

Query  514  GSSWYPI  534
             S WYP+
Sbjct  60   NSKWYPV  66



>ref|XP_003520465.2| PREDICTED: probable protein S-acyltransferase 4-like [Glycine 
max]
 gb|KHN10875.1| Putative S-acyltransferase [Glycine soja]
Length=454

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 59/87 (68%), Gaps = 4/87 (5%)
 Frame = +1

Query  292  VLPSSNSQV*LMAQGKA--KVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPA  465
            ++ + N Q+     G A  + +RLYQVW+G NKF  GGRL+FGPDVASLFL+  LIAGPA
Sbjct  1    MVENRNPQMGDSPSGNAGHRQRRLYQVWRGGNKFFCGGRLVFGPDVASLFLTTFLIAGPA  60

Query  466  TAFCIKVYSNIKHHKD--GSSWYPILL  540
             AFC+K+Y  IK   D     W+P+L+
Sbjct  61   IAFCVKIYLKIKKTDDLIHDYWFPVLI  87



>ref|XP_011467245.1| PREDICTED: probable protein S-acyltransferase 4 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=407

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = +1

Query  334  GKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKH  504
             + K KRLYQVWKGSN F FGGRL+FGPDVASL LS+LLIA PA AFCIKVY+ ++H
Sbjct  2    ARDKPKRLYQVWKGSNNFFFGGRLVFGPDVASLTLSVLLIAVPAMAFCIKVYAKLQH  58



>gb|AES81075.2| DHHC-type zinc finger protein [Medicago truncatula]
Length=459

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 60/94 (64%), Gaps = 8/94 (9%)
 Frame = +1

Query  292  VLPSSNSQV*LMAQG----KAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAG  459
            ++ S NSQ+     G      K +RLYQVW+G NKFL GGRL+FGPDVASLFL+  LIA 
Sbjct  1    MIRSRNSQIGSSPSGGGAHDMKPRRLYQVWRGGNKFLCGGRLVFGPDVASLFLTTFLIAA  60

Query  460  PATAFCIKVYSNIKHHK----DGSSWYPILLXWS  549
            PA AFC+K+Y   KH K    D   W P+++  S
Sbjct  61   PAIAFCVKMYLKAKHEKANNGDHLFWCPVVIVGS  94



>ref|XP_007028179.1| DHHC-type zinc finger family protein, putative isoform 1 [Theobroma 
cacao]
 ref|XP_007028180.1| DHHC-type zinc finger family protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOY08681.1| DHHC-type zinc finger family protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOY08682.1| DHHC-type zinc finger family protein, putative isoform 1 [Theobroma 
cacao]
Length=454

 Score = 91.7 bits (226),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 46/68 (68%), Positives = 52/68 (76%), Gaps = 2/68 (3%)
 Frame = +1

Query  343  KVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKHH--KDG  516
            K KRLY+VWKGSN+F  GGRLIFGPDVASLFLS LLIAGPA AFCI++Y  I+    K  
Sbjct  8    KPKRLYRVWKGSNRFFCGGRLIFGPDVASLFLSTLLIAGPAIAFCIRMYIKIRDENTKHV  67

Query  517  SSWYPILL  540
               YPIL+
Sbjct  68   DRCYPILV  75



>ref|XP_002283906.1| PREDICTED: probable protein S-acyltransferase 4 [Vitis vinifera]
 ref|XP_010653674.1| PREDICTED: probable protein S-acyltransferase 4 [Vitis vinifera]
 ref|XP_010653675.1| PREDICTED: probable protein S-acyltransferase 4 [Vitis vinifera]
Length=438

 Score = 90.9 bits (224),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 45/88 (51%), Positives = 58/88 (66%), Gaps = 1/88 (1%)
 Frame = +1

Query  328  AQGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKHH  507
            A  ++K KRLYQVWKG+N+F  GGRLIFGPDVASLFLS LLIAGP   FC+K++  IK  
Sbjct  17   AADRSKPKRLYQVWKGANRFFCGGRLIFGPDVASLFLSTLLIAGPGIGFCLKIHYKIKED  76

Query  508  KDG-SSWYPILLXWSSSCHSGPYVSLFD  588
             D     +   + W S    G ++++ D
Sbjct  77   DDDYGRTFAHHVVWYSIMAVGAFLTILD  104



>ref|XP_003624857.1| Palmitoyltransferase AKR1 [Medicago truncatula]
Length=522

 Score = 91.3 bits (225),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 60/94 (64%), Gaps = 8/94 (9%)
 Frame = +1

Query  292  VLPSSNSQV*LMAQGKA----KVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAG  459
            ++ S NSQ+     G      K +RLYQVW+G NKFL GGRL+FGPDVASLFL+  LIA 
Sbjct  1    MIRSRNSQIGSSPSGGGAHDMKPRRLYQVWRGGNKFLCGGRLVFGPDVASLFLTTFLIAA  60

Query  460  PATAFCIKVYSNIKHHK----DGSSWYPILLXWS  549
            PA AFC+K+Y   KH K    D   W P+++  S
Sbjct  61   PAIAFCVKMYLKAKHEKANNGDHLFWCPVVIVGS  94



>ref|XP_010036411.1| PREDICTED: probable protein S-acyltransferase 4 [Eucalyptus grandis]
 ref|XP_010036412.1| PREDICTED: probable protein S-acyltransferase 4 [Eucalyptus grandis]
 gb|KCW47959.1| hypothetical protein EUGRSUZ_K01693 [Eucalyptus grandis]
 gb|KCW47960.1| hypothetical protein EUGRSUZ_K01693 [Eucalyptus grandis]
Length=430

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 51/61 (84%), Gaps = 1/61 (2%)
 Frame = +1

Query  325  MAQGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKH  504
            MA+  AK +RLYQVWKGSN+F  GGRLIFGPDVAS+ LS+LLIAGPA AFCI+ +S ++ 
Sbjct  1    MAE-DAKPRRLYQVWKGSNRFFCGGRLIFGPDVASVLLSILLIAGPAIAFCIRAHSKMED  59

Query  505  H  507
            H
Sbjct  60   H  60



>ref|XP_006604301.1| PREDICTED: probable protein S-acyltransferase 4-like [Glycine 
max]
Length=454

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 53/72 (74%), Gaps = 4/72 (6%)
 Frame = +1

Query  343  KVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKHHKDG--  516
            K +RLYQVW+G NKF  GGRL+FGPDVASLFL+  LIAGPA AFC+K+Y  IK   DG  
Sbjct  20   KQRRLYQVWRGGNKFFCGGRLVFGPDVASLFLTTFLIAGPAIAFCVKIYLKIK-KTDGLI  78

Query  517  -SSWYPILLXWS  549
               W+P+L+  S
Sbjct  79   HDYWFPVLIVGS  90



>gb|KHN34577.1| Putative S-acyltransferase [Glycine soja]
Length=454

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 53/72 (74%), Gaps = 4/72 (6%)
 Frame = +1

Query  343  KVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKHHKDG--  516
            K +RLYQVW+G NKF  GGRL+FGPDVASLFL+  LIAGPA AFC+K+Y  IK   DG  
Sbjct  20   KQRRLYQVWRGGNKFFCGGRLVFGPDVASLFLTTFLIAGPAIAFCVKIYLKIK-KTDGLI  78

Query  517  -SSWYPILLXWS  549
               W+P+L+  S
Sbjct  79   HDYWFPVLIVGS  90



>emb|CBI32862.3| unnamed protein product [Vitis vinifera]
Length=428

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/88 (51%), Positives = 58/88 (66%), Gaps = 1/88 (1%)
 Frame = +1

Query  328  AQGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKHH  507
            A  ++K KRLYQVWKG+N+F  GGRLIFGPDVASLFLS LLIAGP   FC+K++  IK  
Sbjct  17   AADRSKPKRLYQVWKGANRFFCGGRLIFGPDVASLFLSTLLIAGPGIGFCLKIHYKIKED  76

Query  508  KDG-SSWYPILLXWSSSCHSGPYVSLFD  588
             D     +   + W S    G ++++ D
Sbjct  77   DDDYGRTFAHHVVWYSIMAVGAFLTILD  104



>ref|XP_004166916.1| PREDICTED: probable S-acyltransferase At3g56930-like [Cucumis 
sativus]
Length=189

 Score = 87.0 bits (214),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 52/73 (71%), Gaps = 3/73 (4%)
 Frame = +1

Query  325  MAQGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKH  504
            MA  K K KRLYQVW+GSN+F  GGRLIFGPDV+SLFLS+ LIA PA AFCIK+   I  
Sbjct  1    MATPK-KPKRLYQVWRGSNRFFCGGRLIFGPDVSSLFLSICLIAVPAVAFCIKIILKIHD  59

Query  505  HKD--GSSWYPIL  537
             K      W+P+L
Sbjct  60   EKPPGNDRWFPVL  72



>ref|XP_008443205.1| PREDICTED: probable protein S-acyltransferase 4 [Cucumis melo]
Length=434

 Score = 88.6 bits (218),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 53/74 (72%), Gaps = 3/74 (4%)
 Frame = +1

Query  325  MAQGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKH  504
            MA  K K KRLYQVW+GSN+F  GGRLIFGPDV+SLFLS+ LIA PA AFCIK+   I  
Sbjct  1    MATPK-KPKRLYQVWRGSNRFFCGGRLIFGPDVSSLFLSICLIAVPAVAFCIKIVLKIHD  59

Query  505  HKD--GSSWYPILL  540
             K    + W+P+L 
Sbjct  60   EKPPGNTRWFPVLF  73



>ref|XP_004493297.1| PREDICTED: probable S-acyltransferase At3g56930-like isoform 
X4 [Cicer arietinum]
Length=423

 Score = 88.6 bits (218),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 49/68 (72%), Gaps = 2/68 (3%)
 Frame = +1

Query  343  KVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKHHKDGSS  522
            K +RLYQVW+G NKFL GGRL+FGPDVASLFL+  LI GPA  FC+K+Y   K  K G  
Sbjct  22   KPRRLYQVWRGGNKFLCGGRLVFGPDVASLFLTSFLIVGPAITFCVKIYLEAKKEKAGDH  81

Query  523  --WYPILL  540
              W P+++
Sbjct  82   VFWCPVMI  89



>ref|XP_004136620.1| PREDICTED: probable S-acyltransferase At3g56930-like [Cucumis 
sativus]
 gb|KGN59402.1| hypothetical protein Csa_3G816150 [Cucumis sativus]
Length=434

 Score = 88.2 bits (217),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 52/74 (70%), Gaps = 3/74 (4%)
 Frame = +1

Query  325  MAQGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKH  504
            MA  K K KRLYQVW+GSN+F  GGRLIFGPDV+SLFLS+ LIA PA AFCIK+   I  
Sbjct  1    MATPK-KPKRLYQVWRGSNRFFCGGRLIFGPDVSSLFLSICLIAVPAVAFCIKIILKIHD  59

Query  505  HKD--GSSWYPILL  540
             K      W+P+L 
Sbjct  60   EKPPGNDRWFPVLF  73



>ref|XP_004493294.1| PREDICTED: probable S-acyltransferase At3g56930-like isoform 
X1 [Cicer arietinum]
 ref|XP_004493295.1| PREDICTED: probable S-acyltransferase At3g56930-like isoform 
X2 [Cicer arietinum]
 ref|XP_004493296.1| PREDICTED: probable S-acyltransferase At3g56930-like isoform 
X3 [Cicer arietinum]
Length=453

 Score = 88.2 bits (217),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 49/68 (72%), Gaps = 2/68 (3%)
 Frame = +1

Query  343  KVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKHHKDGSS  522
            K +RLYQVW+G NKFL GGRL+FGPDVASLFL+  LI GPA  FC+K+Y   K  K G  
Sbjct  22   KPRRLYQVWRGGNKFLCGGRLVFGPDVASLFLTSFLIVGPAITFCVKIYLEAKKEKAGDH  81

Query  523  --WYPILL  540
              W P+++
Sbjct  82   VFWCPVMI  89



>ref|XP_006430445.1| hypothetical protein CICLE_v10011689mg [Citrus clementina]
 gb|ESR43685.1| hypothetical protein CICLE_v10011689mg [Citrus clementina]
Length=457

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +1

Query  343  KVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKH  504
            K KRLYQVWKGSN+F  GG L+FGPDVASLFLS +LIAGPA AFC+K Y  I+H
Sbjct  10   KPKRLYQVWKGSNRFFCGGLLVFGPDVASLFLSTILIAGPAIAFCVKSYLKIRH  63



>ref|XP_006481987.1| PREDICTED: probable protein S-acyltransferase 4-like [Citrus 
sinensis]
Length=457

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +1

Query  343  KVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKH  504
            K KRLYQVWKGSN+F  GG L+FGPDVASLFLS +LIAGPA AFC+K Y  I+H
Sbjct  10   KPKRLYQVWKGSNRFFCGGLLVFGPDVASLFLSTILIAGPAIAFCVKSYLKIRH  63



>ref|XP_008786791.1| PREDICTED: probable protein S-acyltransferase 4 [Phoenix dactylifera]
 ref|XP_008786792.1| PREDICTED: probable protein S-acyltransferase 4 [Phoenix dactylifera]
Length=439

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = +1

Query  337  KAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKHHK  510
            + K KRLYQVWKGSN+F  GGRLIFGPDVAS+FL+ LLIAGPA  FC ++ S I H++
Sbjct  4    QPKPKRLYQVWKGSNRFFCGGRLIFGPDVASIFLTTLLIAGPAITFCYQIISKILHYE  61



>ref|XP_007161918.1| hypothetical protein PHAVU_001G108600g [Phaseolus vulgaris]
 gb|ESW33912.1| hypothetical protein PHAVU_001G108600g [Phaseolus vulgaris]
Length=429

 Score = 85.5 bits (210),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 49/65 (75%), Gaps = 2/65 (3%)
 Frame = +1

Query  343  KVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKHHKDGSS  522
            + KR+Y+VW+G NKF  GGR+IFGPDVASLFL+  LIA PA  FC+K+Y  IK+  D +S
Sbjct  20   QQKRVYEVWRGGNKFFCGGRMIFGPDVASLFLTTFLIAAPAITFCVKIYLQIKNTSDLTS  79

Query  523  --WYP  531
              W+P
Sbjct  80   EFWFP  84



>ref|XP_008240605.1| PREDICTED: probable protein S-acyltransferase 4 isoform X2 [Prunus 
mume]
Length=422

 Score = 85.1 bits (209),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 43/53 (81%), Gaps = 2/53 (4%)
 Frame = +1

Query  325  MAQGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIK  483
            MAQ K K  RLYQVWKGSN F  GGRLIFGPDVASL LS LL+AGPA AFCIK
Sbjct  1    MAQNKPK--RLYQVWKGSNHFFCGGRLIFGPDVASLLLSTLLVAGPAVAFCIK  51



>ref|XP_010922123.1| PREDICTED: probable protein S-acyltransferase 1 [Elaeis guineensis]
Length=439

 Score = 84.7 bits (208),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 48/69 (70%), Gaps = 7/69 (10%)
 Frame = +1

Query  349  KRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFC------IKVYSNIKHHK  510
            KR+YQVWKGSNKF  GGRLIFGPD ASL L+MLLI GPA  FC      I  Y+  +HH 
Sbjct  8    KRVYQVWKGSNKFFCGGRLIFGPDAASLLLTMLLICGPAVTFCGHIISKIHQYNKTEHHD  67

Query  511  DGSSWYPIL  537
            D  S+ P+L
Sbjct  68   D-QSYQPML  75



>ref|XP_002323200.2| hypothetical protein POPTR_0016s02590g [Populus trichocarpa]
 gb|EEF04961.2| hypothetical protein POPTR_0016s02590g [Populus trichocarpa]
Length=398

 Score = 82.4 bits (202),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = +1

Query  343  KVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKHHKDGSS  522
            K +RLYQ+WKG+NKFL GGR +FGPD +SLFL+  LI GPA AFCIK+   I  + D   
Sbjct  8    KSRRLYQIWKGNNKFLCGGRAVFGPDASSLFLTTFLIGGPAIAFCIKMLLLIIRNDDPQY  67

Query  523  WYPILL  540
             YP+L+
Sbjct  68   DYPVLV  73



>ref|XP_009411183.1| PREDICTED: probable protein S-acyltransferase 4 [Musa acuminata 
subsp. malaccensis]
Length=453

 Score = 82.8 bits (203),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 46/62 (74%), Gaps = 2/62 (3%)
 Frame = +1

Query  337  KAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKHHKDG  516
            +A  +RLYQVWKG+N+F  GGRLIFGPDVASL LS LLI GPA  FC ++   IK H+D 
Sbjct  7    QANSRRLYQVWKGNNRFFCGGRLIFGPDVASLLLSTLLIVGPAITFCCQII--IKLHEDE  64

Query  517  SS  522
             S
Sbjct  65   KS  66



>ref|NP_001190111.1| putative S-acyltransferase [Arabidopsis thaliana]
 gb|AEE79588.1| putative S-acyltransferase [Arabidopsis thaliana]
Length=441

 Score = 82.8 bits (203),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 53/73 (73%), Gaps = 2/73 (3%)
 Frame = +1

Query  325  MAQGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNI--  498
            MA  + K+KRLYQVW+GSNKFL GGRLIFGPD +SL+LS +LI GPA  F +K+Y+ +  
Sbjct  1    MAWNETKLKRLYQVWRGSNKFLCGGRLIFGPDASSLYLSTILILGPAVMFFVKMYTKMAD  60

Query  499  KHHKDGSSWYPIL  537
               K+ +   PIL
Sbjct  61   PRTKNPNLCIPIL  73



>gb|AAM20704.1| putative protein [Arabidopsis thaliana]
Length=477

 Score = 82.8 bits (203),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 53/73 (73%), Gaps = 2/73 (3%)
 Frame = +1

Query  325  MAQGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNI--  498
            MA  + K+KRLYQVW+GSNKFL GGRLIFGPD +SL+LS +LI GPA  F +K+Y+ +  
Sbjct  1    MAWNETKLKRLYQVWRGSNKFLCGGRLIFGPDASSLYLSTILILGPAVMFFVKMYTKMAD  60

Query  499  KHHKDGSSWYPIL  537
               K+ +   PIL
Sbjct  61   PRTKNPNLCIPIL  73



>ref|XP_002876388.1| hypothetical protein ARALYDRAFT_486136 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52647.1| hypothetical protein ARALYDRAFT_486136 [Arabidopsis lyrata subsp. 
lyrata]
Length=473

 Score = 82.8 bits (203),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 53/73 (73%), Gaps = 2/73 (3%)
 Frame = +1

Query  325  MAQGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNI--  498
            MA  + K+KRLYQVW+GSNKFL GGRLIFGPD +SL+LS +LI GPA  F +K+Y+ +  
Sbjct  1    MAWNETKLKRLYQVWRGSNKFLCGGRLIFGPDASSLYLSTILILGPAVMFFVKMYTKMAD  60

Query  499  KHHKDGSSWYPIL  537
               K+ +   PIL
Sbjct  61   PRTKNPNLCIPIL  73



>ref|NP_191252.1| putative S-acyltransferase [Arabidopsis thaliana]
 sp|Q9M1K5.1|ZDH13_ARATH RecName: Full=Probable protein S-acyltransferase 4; AltName: 
Full=Probable palmitoyltransferase At3g56930; AltName: Full=Zinc 
finger DHHC domain-containing protein At3g56930 [Arabidopsis 
thaliana]
 emb|CAB72163.1| putative protein [Arabidopsis thaliana]
 dbj|BAC42316.1| unknown protein [Arabidopsis thaliana]
 gb|AAP40360.1| unknown protein [Arabidopsis thaliana]
 gb|AEE79587.1| putative S-acyltransferase [Arabidopsis thaliana]
Length=477

 Score = 82.4 bits (202),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 53/73 (73%), Gaps = 2/73 (3%)
 Frame = +1

Query  325  MAQGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNI--  498
            MA  + K+KRLYQVW+GSNKFL GGRLIFGPD +SL+LS +LI GPA  F +K+Y+ +  
Sbjct  1    MAWNETKLKRLYQVWRGSNKFLCGGRLIFGPDASSLYLSTILILGPAVMFFVKMYTKMAD  60

Query  499  KHHKDGSSWYPIL  537
               K+ +   PIL
Sbjct  61   PRTKNPNLCIPIL  73



>ref|XP_006430446.1| hypothetical protein CICLE_v10013374mg [Citrus clementina]
 gb|ESR43686.1| hypothetical protein CICLE_v10013374mg [Citrus clementina]
Length=385

 Score = 81.6 bits (200),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 50/67 (75%), Gaps = 1/67 (1%)
 Frame = +1

Query  340  AKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKHHKDGS  519
            AK KRLYQ+WKG+NKF+ GGR++FGPD ASLFL+ +LI  PA AFCIK+   IK      
Sbjct  3    AKTKRLYQLWKGNNKFICGGRIVFGPDAASLFLTSILIGAPAIAFCIKMLLMIKQENPFF  62

Query  520  SWYPILL  540
            + YP+L+
Sbjct  63   N-YPVLI  68



>ref|XP_006482372.1| PREDICTED: probable protein S-acyltransferase 2-like [Citrus 
sinensis]
Length=406

 Score = 81.6 bits (200),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 50/71 (70%), Gaps = 1/71 (1%)
 Frame = +1

Query  328  AQGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKHH  507
                AK KRLYQ+WKG+NKF+ GGR++FGPD ASLFL+ +LI  PA AFCIK+   IK  
Sbjct  20   VSSNAKTKRLYQLWKGNNKFICGGRIVFGPDAASLFLTSILIGAPAIAFCIKMLLMIKQE  79

Query  508  KDGSSWYPILL  540
                + YP+L+
Sbjct  80   NPFFN-YPVLI  89



>ref|XP_010427545.1| PREDICTED: probable protein S-acyltransferase 4 isoform X2 [Camelina 
sativa]
Length=478

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +1

Query  325  MAQGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVY  489
            MA  + K+KRLYQVW+GSNKFL GGRLIFGPD +SL+LS +LI GPA  F +K+Y
Sbjct  1    MAWNETKLKRLYQVWRGSNKFLCGGRLIFGPDASSLYLSTILILGPAVMFFVKMY  55



>ref|XP_006291036.1| hypothetical protein CARUB_v10017149mg [Capsella rubella]
 ref|XP_006291037.1| hypothetical protein CARUB_v10017149mg [Capsella rubella]
 gb|EOA23934.1| hypothetical protein CARUB_v10017149mg [Capsella rubella]
 gb|EOA23935.1| hypothetical protein CARUB_v10017149mg [Capsella rubella]
Length=474

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +1

Query  325  MAQGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVY  489
            MA  + K+KRLYQVW+GSNKFL GGRLIFGPD +SL+LS +LI GPA  F +K+Y
Sbjct  1    MAWNETKLKRLYQVWRGSNKFLCGGRLIFGPDASSLYLSTILILGPAVMFFVKMY  55



>ref|XP_010504604.1| PREDICTED: probable protein S-acyltransferase 4 isoform X1 [Camelina 
sativa]
Length=476

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +1

Query  325  MAQGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVY  489
            MA  + K+KRLYQVW+GSNKFL GGRLIFGPD +SL+LS +LI GPA  F +K+Y
Sbjct  1    MAWNETKLKRLYQVWRGSNKFLCGGRLIFGPDASSLYLSTILILGPAVMFFVKMY  55



>ref|XP_009405119.1| PREDICTED: probable protein S-acyltransferase 1 [Musa acuminata 
subsp. malaccensis]
Length=433

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +1

Query  343  KVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKHHK  510
            +++RLYQVWKG+N+F  GGRLIFGPD ASL LSMLLIAGP+ AFC +V + I +H+
Sbjct  3    RLRRLYQVWKGNNRFWCGGRLIFGPDGASLSLSMLLIAGPSIAFCSQVLAKILNHE  58



>ref|XP_002308847.2| hypothetical protein POPTR_0006s02820g [Populus trichocarpa]
 gb|EEE92370.2| hypothetical protein POPTR_0006s02820g [Populus trichocarpa]
Length=421

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +1

Query  343  KVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKV  486
            K KRLYQVWKGSN+F  GGRLI GPDVAS+FL+ LLIA PA AFCIK 
Sbjct  6    KPKRLYQVWKGSNRFFCGGRLILGPDVASIFLTTLLIAAPAIAFCIKT  53



>ref|XP_006402931.1| hypothetical protein EUTSA_v10005938mg [Eutrema salsugineum]
 gb|ESQ44384.1| hypothetical protein EUTSA_v10005938mg [Eutrema salsugineum]
Length=475

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 52/73 (71%), Gaps = 2/73 (3%)
 Frame = +1

Query  325  MAQGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNI--  498
            MA  + K+KRLYQVW+GSNKFL GGRLIFGPD +SL+LS +LI GPA  F +++Y  +  
Sbjct  1    MAWNETKLKRLYQVWRGSNKFLCGGRLIFGPDASSLYLSTILILGPAVMFFVRMYLKMAD  60

Query  499  KHHKDGSSWYPIL  537
             H K+     P+L
Sbjct  61   PHTKNPKLCIPVL  73



>ref|XP_010904714.1| PREDICTED: probable protein S-acyltransferase 4 [Elaeis guineensis]
Length=446

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = +1

Query  334  GKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKHHK  510
             + K  RLYQVW+GSN+F  GGRLIFGPDVASLFL+  LI+GPA  FC ++ S I +++
Sbjct  3    AQPKPNRLYQVWRGSNRFFCGGRLIFGPDVASLFLTTFLISGPAITFCYQIISKIHYYE  61



>gb|EYU20840.1| hypothetical protein MIMGU_mgv1a022244mg, partial [Erythranthe 
guttata]
Length=372

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +1

Query  325  MAQGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKH  504
            M   + K +R+YQ W+GSN F+FGGRL+FGPDV+ LF S  LI GPA AFC+K+   IKH
Sbjct  1    MDVKERKPQRIYQAWRGSNTFVFGGRLVFGPDVSPLFFSTFLIVGPAFAFCVKISFIIKH  60

Query  505  HKDGSS  522
              + + 
Sbjct  61   RTNRNE  66



>ref|XP_009104028.1| PREDICTED: probable protein S-acyltransferase 4 isoform X1 [Brassica 
rapa]
 ref|XP_009104029.1| PREDICTED: probable protein S-acyltransferase 4 isoform X1 [Brassica 
rapa]
Length=475

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +1

Query  325  MAQGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVY  489
            MA  + K+KRLYQVW+GSNKFL GGRLIFGPD +SL+LS +LI GP+  F +K+Y
Sbjct  1    MAWNETKLKRLYQVWRGSNKFLCGGRLIFGPDASSLYLSTILILGPSVMFFVKMY  55



>emb|CDX67662.1| BnaA07g17020D [Brassica napus]
Length=475

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +1

Query  325  MAQGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVY  489
            MA  + K+KRLYQVW+GSNKFL GGRLIFGPD +SL+LS +LI GP+  F +K+Y
Sbjct  1    MAWNETKLKRLYQVWRGSNKFLCGGRLIFGPDASSLYLSTILILGPSVMFFVKMY  55



>emb|CDY51264.1| BnaCnng20430D [Brassica napus]
Length=473

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +1

Query  325  MAQGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVY  489
            MA  + K+KRLYQVW+GSNKFL GGRLIFGPD +SL+LS +LI GP+  F +K+Y
Sbjct  1    MAWNETKLKRLYQVWRGSNKFLCGGRLIFGPDASSLYLSTILILGPSVMFFVKMY  55



>emb|CDY27178.1| BnaA09g36240D [Brassica napus]
Length=900

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 34/55 (62%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +1

Query  325  MAQGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVY  489
            MA  + K+KRLYQVW+GSNKFL GGRLIFGPD +SL+L+ +LI  P+  F +K+Y
Sbjct  1    MAWNETKLKRLYQVWRGSNKFLCGGRLIFGPDASSLYLTTILILAPSVTFLVKMY  55



>ref|XP_002308848.2| hypothetical protein POPTR_0006s02830g [Populus trichocarpa]
 gb|EEE92371.2| hypothetical protein POPTR_0006s02830g [Populus trichocarpa]
Length=401

 Score = 79.7 bits (195),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 46/67 (69%), Gaps = 0/67 (0%)
 Frame = +1

Query  340  AKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKHHKDGS  519
             K KRLYQ+WKG+NKFL GGR +FGPD  SLFL+  LI GPATAFCIK+   +    D  
Sbjct  7    TKSKRLYQLWKGNNKFLCGGRAVFGPDAGSLFLTTFLIGGPATAFCIKMLLLLVRKDDPC  66

Query  520  SWYPILL  540
               P+L+
Sbjct  67   YDIPVLV  73



>emb|CDX72095.1| BnaC08g27790D [Brassica napus]
Length=473

 Score = 80.1 bits (196),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 48/67 (72%), Gaps = 5/67 (7%)
 Frame = +1

Query  325  MAQGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVY-----  489
            MA  + K+KRLYQVW+GSNKFL GGRLIFGPD +SL+L+ +LI  P+  F +K+Y     
Sbjct  1    MAWNETKLKRLYQVWRGSNKFLCGGRLIFGPDASSLYLTTILILAPSVTFLVKMYLKMED  60

Query  490  SNIKHHK  510
            S  KH K
Sbjct  61   SRTKHPK  67



>emb|CBI32863.3| unnamed protein product [Vitis vinifera]
Length=359

 Score = 78.6 bits (192),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 44/64 (69%), Gaps = 1/64 (2%)
 Frame = +1

Query  349  KRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKHHKDGSSWY  528
            KRLYQ WKG NKFL GGRLIFGPDVASLFLS LLI  P   FCIK+   IK   D    Y
Sbjct  8    KRLYQAWKGRNKFLCGGRLIFGPDVASLFLSTLLIGVPGFTFCIKMLVKIK-SDDPHFKY  66

Query  529  PILL  540
            P+L 
Sbjct  67   PVLF  70



>ref|XP_002278657.2| PREDICTED: probable protein S-acyltransferase 1 [Vitis vinifera]
 ref|XP_010653676.1| PREDICTED: probable protein S-acyltransferase 1 [Vitis vinifera]
 ref|XP_010653677.1| PREDICTED: probable protein S-acyltransferase 1 [Vitis vinifera]
 ref|XP_010653678.1| PREDICTED: probable protein S-acyltransferase 1 [Vitis vinifera]
Length=417

 Score = 79.0 bits (193),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 44/64 (69%), Gaps = 1/64 (2%)
 Frame = +1

Query  349  KRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKHHKDGSSWY  528
            KRLYQ WKG NKFL GGRLIFGPDVASLFLS LLI  P   FCIK+   IK   D    Y
Sbjct  26   KRLYQAWKGRNKFLCGGRLIFGPDVASLFLSTLLIGVPGFTFCIKMLVKIK-SDDPHFKY  84

Query  529  PILL  540
            P+L 
Sbjct  85   PVLF  88



>ref|XP_010516297.1| PREDICTED: probable protein S-acyltransferase 4 [Camelina sativa]
Length=473

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +1

Query  325  MAQGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVY  489
            MA  + K+KRLYQVW+GSNKFL GGRLIFGPD +SL+LS +LI  PA  F +K+Y
Sbjct  1    MAWNETKLKRLYQVWRGSNKFLCGGRLIFGPDASSLYLSTILILCPAVMFFVKMY  55



>ref|XP_006832911.1| hypothetical protein AMTR_s00095p00129120 [Amborella trichopoda]
 gb|ERM98189.1| hypothetical protein AMTR_s00095p00129120 [Amborella trichopoda]
Length=415

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = +1

Query  340  AKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKHH  507
            A  KRLYQVWKGSN+F  GGRLIFGPDV S+FLS  LIAGPA  FC  V + I  H
Sbjct  10   ATPKRLYQVWKGSNRFFCGGRLIFGPDVGSVFLSTFLIAGPAGLFCSLVATKIIEH  65



>ref|XP_009116394.1| PREDICTED: probable protein S-acyltransferase 4 [Brassica rapa]
 ref|XP_009116395.1| PREDICTED: probable protein S-acyltransferase 4 [Brassica rapa]
Length=473

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +1

Query  325  MAQGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVY  489
            MA  + K+KRLYQVW+GSNKFL GGRLIFGPD +SL+L+ +LI  P+  F +K+Y
Sbjct  1    MAWNETKLKRLYQVWRGSNKFLCGGRLIFGPDASSLYLTTILILAPSVTFLVKMY  55



>gb|EYU20839.1| hypothetical protein MIMGU_mgv1a022060mg, partial [Erythranthe 
guttata]
Length=342

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = +1

Query  349  KRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKH  504
            KRLYQ+WKG NKFL GGRLIFGPD +SL LS  LI GPA  FCIK +S + +
Sbjct  10   KRLYQIWKGRNKFLCGGRLIFGPDASSLVLSTFLIGGPALTFCIKTFSRLSN  61



>ref|XP_004493300.1| PREDICTED: probable S-acyltransferase At2g40990-like isoform 
X1 [Cicer arietinum]
 ref|XP_004493301.1| PREDICTED: probable S-acyltransferase At2g40990-like isoform 
X2 [Cicer arietinum]
 ref|XP_004493302.1| PREDICTED: probable S-acyltransferase At2g40990-like isoform 
X3 [Cicer arietinum]
Length=421

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +1

Query  322  LMAQGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKV  486
            L      K KRLYQ+WKG+NKFLFGGRL+FG D +SLFL+  LI GPA  FCI++
Sbjct  24   LEEPSNGKTKRLYQLWKGNNKFLFGGRLVFGQDASSLFLTSFLIGGPAITFCIRM  78



>ref|XP_011040691.1| PREDICTED: probable protein S-acyltransferase 1 [Populus euphratica]
Length=405

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +1

Query  343  KVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKHHKDGSS  522
            + KRLYQ+WKG+NKFL GGR +FGPD  SLFL+  LI GPATAFCIK+   +    D   
Sbjct  12   QSKRLYQLWKGNNKFLCGGRAVFGPDAGSLFLTTFLIGGPATAFCIKMLLLLVRKDDPCY  71

Query  523  WYPILL  540
              P+L+
Sbjct  72   DIPVLV  77



>ref|XP_010251763.1| PREDICTED: probable protein S-acyltransferase 4 [Nelumbo nucifera]
 ref|XP_010251764.1| PREDICTED: probable protein S-acyltransferase 4 [Nelumbo nucifera]
 ref|XP_010251765.1| PREDICTED: probable protein S-acyltransferase 4 [Nelumbo nucifera]
Length=419

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = +1

Query  343  KVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIK  501
            K KRLYQ WKGSN F  GGR+IFGPDV+SLFLS  LI GPA  FCI+ ++  K
Sbjct  10   KPKRLYQAWKGSNNFFCGGRMIFGPDVSSLFLSTFLIGGPALTFCIQSFAKAK  62



>tpg|DAA54192.1| TPA: hypothetical protein ZEAMMB73_579966 [Zea mays]
Length=516

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = +1

Query  322  LMAQGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYS  492
            LM +     +RLYQVWKGSNKFLFGGRLIFGPD  SLFLS +LIA P    C +  +
Sbjct  98   LMGEPPPDRRRLYQVWKGSNKFLFGGRLIFGPDAGSLFLSTVLIASPLAGLCFQCVT  154



>ref|XP_003520466.1| PREDICTED: probable protein S-acyltransferase 3-like [Glycine 
max]
Length=413

 Score = 76.6 bits (187),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 48/64 (75%), Gaps = 1/64 (2%)
 Frame = +1

Query  349  KRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKHHKDGSSWY  528
            KRLYQ WKG+NKFL GGRL+FG D +SLFL+  LI GPAT FCI++ +++K  +D     
Sbjct  32   KRLYQAWKGNNKFLCGGRLVFGQDASSLFLTSFLIGGPATTFCIRMLASLK-EEDPHFSN  90

Query  529  PILL  540
            P+L+
Sbjct  91   PVLI  94



>emb|CAN79043.1| hypothetical protein VITISV_043756 [Vitis vinifera]
Length=417

 Score = 76.6 bits (187),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 43/64 (67%), Gaps = 1/64 (2%)
 Frame = +1

Query  349  KRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKHHKDGSSWY  528
            KRLYQ W G NKFL GGRLIFGPDVASLFLS LLI  P   FCIK+   IK   D    Y
Sbjct  26   KRLYQAWXGRNKFLCGGRLIFGPDVASLFLSTLLIGVPGFTFCIKMLVKIK-SDDPHFKY  84

Query  529  PILL  540
            P+L 
Sbjct  85   PVLF  88



>ref|XP_004249102.1| PREDICTED: probable protein S-acyltransferase 1 [Solanum lycopersicum]
Length=412

 Score = 76.3 bits (186),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 40/54 (74%), Gaps = 1/54 (2%)
 Frame = +1

Query  325  MAQGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKV  486
            M   K K KRLYQVWKG NKFL GGRLIFGPD ASL+LS  LI  PA  FCIK+
Sbjct  17   MDTSKLK-KRLYQVWKGRNKFLCGGRLIFGPDAASLYLSTFLIGAPALTFCIKM  69



>ref|XP_006364758.1| PREDICTED: probable protein S-acyltransferase 3-like [Solanum 
tuberosum]
Length=412

 Score = 76.3 bits (186),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = +1

Query  349  KRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKV  486
            KRLYQVWKG NKFL GGRLIFGPD ASL+LS  LI  PA  FCIK+
Sbjct  24   KRLYQVWKGRNKFLCGGRLIFGPDAASLYLSTFLIGAPALTFCIKM  69



>ref|XP_002457656.1| hypothetical protein SORBIDRAFT_03g011290 [Sorghum bicolor]
 gb|EES02776.1| hypothetical protein SORBIDRAFT_03g011290 [Sorghum bicolor]
Length=431

 Score = 76.3 bits (186),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = +1

Query  325  MAQGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIK  501
            M +     +RLYQVWKGSNKFLFGGRLIFGPD  SLFLS +LIA P    C +  + + 
Sbjct  1    MGERAPDRRRLYQVWKGSNKFLFGGRLIFGPDAGSLFLSTVLIASPLAGLCFQCVTKLN  59



>ref|XP_009790623.1| PREDICTED: probable protein S-acyltransferase 1 [Nicotiana sylvestris]
Length=416

 Score = 76.3 bits (186),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = +1

Query  349  KRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKV  486
            KRLYQVWKG NKFL GGRLIFGPD ASL+LS  LI  PA  FCIK+
Sbjct  24   KRLYQVWKGRNKFLCGGRLIFGPDAASLYLSTFLIGAPALTFCIKM  69



>gb|KFK26112.1| hypothetical protein AALP_AA8G204300 [Arabis alpina]
Length=413

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 44/64 (69%), Gaps = 2/64 (3%)
 Frame = +1

Query  301  SSNSQV*LMAQGKAKVK--RLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAF  474
            SS  Q+ + A     +   RLY+ WKG+N+F FGGRLIFGPDVASLFL+  LI  PA  F
Sbjct  18   SSGDQILMTASTSKHIPQIRLYKAWKGNNRFCFGGRLIFGPDVASLFLTSFLIGAPALTF  77

Query  475  CIKV  486
            CI++
Sbjct  78   CIRM  81



>ref|XP_009592263.1| PREDICTED: probable protein S-acyltransferase 1 [Nicotiana tomentosiformis]
Length=417

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = +1

Query  349  KRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKV  486
            KRLYQVWKG NKFL GGRLIFGPD ASL+LS  LI  PA  FCIK+
Sbjct  24   KRLYQVWKGRNKFLCGGRLIFGPDAASLYLSTFLIGTPALTFCIKM  69



>gb|AES81076.2| DHHC-type zinc finger protein [Medicago truncatula]
Length=411

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +1

Query  343  KVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKV  486
            K +RLYQVWKG+NKFLFGGR++FG D +SLFL+  LI GPA  FCI++
Sbjct  26   KNRRLYQVWKGNNKFLFGGRVVFGQDASSLFLTTFLIGGPAITFCIRM  73



>ref|XP_008673921.1| PREDICTED: probable protein S-acyltransferase 4 [Zea mays]
Length=418

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = +1

Query  325  MAQGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYS  492
            M +     +RLYQVWKGSNKFLFGGRLIFGPD  SLFLS +LIA P    C +  +
Sbjct  1    MGEPPPDRRRLYQVWKGSNKFLFGGRLIFGPDAGSLFLSTVLIASPLAGLCFQCVT  56



>ref|XP_003624858.1| Palmitoyltransferase PFA4 [Medicago truncatula]
Length=414

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +1

Query  343  KVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKV  486
            K +RLYQVWKG+NKFLFGGR++FG D +SLFL+  LI GPA  FCI++
Sbjct  26   KNRRLYQVWKGNNKFLFGGRVVFGQDASSLFLTTFLIGGPAITFCIRM  73



>emb|CBX24375.1| hypothetical_protein [Oryza glaberrima]
Length=688

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 37/56 (66%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = +1

Query  331  QGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNI  498
            Q  AK KRLYQVWKG+N FL GGRLI GPD ASL LSM LI GPA  F  ++ S I
Sbjct  14   QLHAKPKRLYQVWKGNNVFLCGGRLIIGPDAASLLLSMFLILGPAIVFSYQMESTI  69



>gb|ABA96398.1| zinc finger family protein, putative [Oryza sativa Japonica Group]
Length=690

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 37/56 (66%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = +1

Query  331  QGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNI  498
            Q  AK KRLYQVWKG+N FL GGRLI GPD ASL LSM LI GPA  F  ++ S I
Sbjct  14   QLHAKPKRLYQVWKGNNIFLCGGRLIIGPDAASLLLSMFLILGPAIVFSYQMESTI  69



>ref|XP_010233056.1| PREDICTED: probable protein S-acyltransferase 1 [Brachypodium 
distachyon]
Length=408

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 47/74 (64%), Gaps = 4/74 (5%)
 Frame = +1

Query  331  QGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFC----IKVYSNI  498
            + + K +RLYQVW+G+NKFL GGRLIFGPD  SLFLS +LIAGP    C     K+ S+ 
Sbjct  2    EEEPKRRRLYQVWRGNNKFLCGGRLIFGPDAGSLFLSTVLIAGPLVGLCCQCITKMNSSS  61

Query  499  KHHKDGSSWYPILL  540
              H       P+L+
Sbjct  62   PDHNQQVLGLPVLI  75



>gb|KDP25918.1| hypothetical protein JCGZ_23042 [Jatropha curcas]
Length=393

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +1

Query  325  MAQGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKV  486
            M   K+   RLYQ+WKG+NKFL GGR +FGPD  SLFL+  LI GPA AFCIK+
Sbjct  1    MDPPKSTPVRLYQLWKGNNKFLCGGRFVFGPDAGSLFLTSFLIGGPAIAFCIKM  54



>ref|XP_002523674.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF38709.1| zinc finger protein, putative [Ricinus communis]
Length=380

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +1

Query  325  MAQGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKV  486
            M   K++  RLY +WKG+N FL GGR +FGPD  SLFL+ LLI GPA AFCIK+
Sbjct  1    MDPPKSRSMRLYHLWKGNNTFLCGGRFVFGPDSGSLFLTSLLIGGPAIAFCIKI  54



>ref|XP_006588475.1| PREDICTED: uncharacterized protein LOC100805189 isoform X1 [Glycine 
max]
Length=425

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 48/65 (74%), Gaps = 1/65 (2%)
 Frame = +1

Query  349  KRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKHH-KDGSSW  525
            +R+YQVWKGSNKF+ GGRL+FGPD  SLF+++LLI  P   FC+ V S+++H     +S 
Sbjct  4    RRVYQVWKGSNKFICGGRLVFGPDARSLFVTLLLIIVPVIIFCVCVASHLRHEFSSYNSG  63

Query  526  YPILL  540
            Y IL+
Sbjct  64   YAILV  68



>ref|XP_004236711.1| PREDICTED: protein S-acyltransferase 8 [Solanum lycopersicum]
Length=387

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 45/68 (66%), Gaps = 1/68 (1%)
 Frame = +1

Query  340  AKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKHH-KDG  516
            AK KRLYQ WKG+NKFL GGRLIFGPD  SL ++  LI  P   FC+ V SN+ H    G
Sbjct  2    AKPKRLYQSWKGNNKFLLGGRLIFGPDAKSLIITFTLILVPVVIFCVFVASNLAHKFTAG  61

Query  517  SSWYPILL  540
            S  Y IL+
Sbjct  62   SIGYAILV  69



>emb|CBX25421.1| hypothetical_protein [Oryza glaberrima]
Length=467

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = +1

Query  331  QGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKHHK  510
            Q  AK KRLYQVWKG+N FL GGRLI GPD ASL LSM LI GPA  F  ++ S I   +
Sbjct  14   QLHAKPKRLYQVWKGNNIFLCGGRLIIGPDAASLLLSMFLILGPAIVFSYQIESTIHRSQ  73



>ref|NP_001242156.1| uncharacterized protein LOC100805189 [Glycine max]
 gb|ACU18037.1| unknown [Glycine max]
Length=436

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 48/65 (74%), Gaps = 1/65 (2%)
 Frame = +1

Query  349  KRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKHH-KDGSSW  525
            +R+YQVWKGSNKF+ GGRL+FGPD  SLF+++LLI  P   FC+ V S+++H     +S 
Sbjct  4    RRVYQVWKGSNKFICGGRLVFGPDARSLFVTLLLIIVPVIIFCVCVASHLRHEFSSYNSG  63

Query  526  YPILL  540
            Y IL+
Sbjct  64   YAILV  68



>ref|XP_010036410.1| PREDICTED: probable protein S-acyltransferase 1 [Eucalyptus grandis]
Length=434

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +1

Query  325  MAQGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKV  486
            +A   A  +RLYQVWKG+NKFL GGRL+FGPD AS+ L+  LI GPA  FCIK+
Sbjct  23   LAYPGALPRRLYQVWKGNNKFLCGGRLVFGPDAASVLLTTTLIGGPAITFCIKM  76



>ref|XP_007140944.1| hypothetical protein PHAVU_008G154500g [Phaseolus vulgaris]
 gb|ESW12938.1| hypothetical protein PHAVU_008G154500g [Phaseolus vulgaris]
Length=280

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 46/63 (73%), Gaps = 1/63 (2%)
 Frame = +1

Query  352  RLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKHHKDGSSWYP  531
            RLYQVWKG+NKFL GGRL+FG D +SLFL+  LI GPA  FCI++  ++K  +D     P
Sbjct  33   RLYQVWKGNNKFLCGGRLVFGQDASSLFLTSFLIGGPAITFCIRMLLSLK-KEDPHFSNP  91

Query  532  ILL  540
            +L+
Sbjct  92   VLI  94



>ref|XP_007028155.1| DHHC-type zinc finger family protein, putative [Theobroma cacao]
 gb|EOY08657.1| DHHC-type zinc finger family protein, putative [Theobroma cacao]
Length=381

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = +1

Query  349  KRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKV  486
            KR+YQVWKG+NKF  GGR+IFGPD +SLFL+  LI  PA AFCIKV
Sbjct  34   KRIYQVWKGNNKFCCGGRMIFGPDASSLFLTSFLIGCPAIAFCIKV  79



>gb|EEE52711.1| hypothetical protein OsJ_35120 [Oryza sativa Japonica Group]
Length=395

 Score = 74.3 bits (181),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = +1

Query  331  QGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKHHK  510
            Q  AK KRLYQVWKG+N FL GGRLI GPD ASL LSM LI GPA  F  ++ S I   +
Sbjct  14   QLHAKPKRLYQVWKGNNIFLCGGRLIIGPDAASLLLSMFLILGPAIVFSYQMESTIHRSQ  73



>ref|XP_003556158.2| PREDICTED: protein S-acyltransferase 8-like [Glycine max]
Length=425

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 46/64 (72%), Gaps = 1/64 (2%)
 Frame = +1

Query  349  KRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKHHKDG-SSW  525
            KR+YQVWKGSNKF+ GGRL+FGPD  SLF+++LLI  P   FCI V  +++H     +S 
Sbjct  4    KRVYQVWKGSNKFICGGRLVFGPDARSLFVTLLLIIVPVIIFCICVARHLRHELSSYNSG  63

Query  526  YPIL  537
            Y IL
Sbjct  64   YAIL  67



>ref|XP_004967677.1| PREDICTED: probable S-acyltransferase At3g56930-like [Setaria 
italica]
Length=409

 Score = 73.9 bits (180),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = +1

Query  325  MAQGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIK  501
            M + +   +RLYQVWKGSNKFL GGRLIFGPD  SLFLS ++IA P    C +  + + 
Sbjct  3    MGEPEPDRRRLYQVWKGSNKFLCGGRLIFGPDAGSLFLSTVMIASPLVGLCFQCVTKLN  61



>ref|XP_010525442.1| PREDICTED: probable protein S-acyltransferase 2 [Tarenaya hassleriana]
Length=412

 Score = 73.9 bits (180),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = +1

Query  325  MAQGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKH  504
            M+    K KR+YQ+W G+NKF  GGRLIFGPD +S+ L+M +I  P+  FC+++   I+H
Sbjct  21   MSLQSPKPKRIYQLWPGNNKFCCGGRLIFGPDASSVLLTMCMIGAPSIGFCVRMIYLIRH  80

Query  505  HK  510
            H 
Sbjct  81   HD  82



>gb|EEC67608.1| hypothetical protein OsI_34983 [Oryza sativa Indica Group]
Length=454

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = +1

Query  331  QGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKHHK  510
            Q  AK KRLYQVWKG+N FL GGRLI GPD ASL LSM LI GPA  F  ++ S I   +
Sbjct  14   QLHAKPKRLYQVWKGNNIFLCGGRLIIGPDAASLLLSMFLILGPAIVFSYQMESTIHRSQ  73



>gb|EAY82169.1| hypothetical protein OsI_37369 [Oryza sativa Indica Group]
Length=474

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = +1

Query  331  QGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKHHK  510
            Q  AK KRLYQVWKG+N FL GGRLI GPD ASL LSM LI GPA  F  ++ S I   +
Sbjct  14   QLHAKPKRLYQVWKGNNIFLCGGRLIIGPDAASLLLSMFLILGPAIVFSYQMESTIHRSQ  73



>gb|EEE51596.1| hypothetical protein OsJ_32848 [Oryza sativa Japonica Group]
Length=467

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = +1

Query  331  QGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKHHK  510
            Q  AK KRLYQVWKG+N FL GGRLI GPD ASL LSM LI GPA  F  ++ S I   +
Sbjct  14   QLHAKPKRLYQVWKGNNIFLCGGRLIIGPDAASLLLSMFLILGPAIVFSYQMESTIHRSQ  73



>ref|XP_009121384.1| PREDICTED: probable protein S-acyltransferase 3 [Brassica rapa]
Length=261

 Score = 72.0 bits (175),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 43/64 (67%), Gaps = 2/64 (3%)
 Frame = +1

Query  301  SSNSQV*LMAQGKAKVK--RLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAF  474
            SS+  + +MA     +   RLY+ WKG+N+F  GGRLIFGPDV SLFL+  LI  PA  F
Sbjct  18   SSHDHILMMASTSKHIPEIRLYKAWKGNNRFFCGGRLIFGPDVNSLFLTSFLIGAPALTF  77

Query  475  CIKV  486
            CI++
Sbjct  78   CIRM  81



>ref|NP_001065672.1| Os11g0133800 [Oryza sativa Japonica Group]
 gb|ABA91396.1| zinc finger family protein, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF27517.1| Os11g0133800 [Oryza sativa Japonica Group]
Length=483

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = +1

Query  331  QGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKHHK  510
            Q  AK KRLYQVWKG+N FL GGRLI GPD ASL LSM LI GPA  F  ++ S I   +
Sbjct  14   QLHAKPKRLYQVWKGNNIFLCGGRLIIGPDAASLLLSMFLILGPAIVFSYQMESTIHRSQ  73



>emb|CDY67095.1| BnaCnng53500D [Brassica napus]
Length=201

 Score = 70.9 bits (172),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +1

Query  325  MAQGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKV  486
            M++ K+   RLY+ WKG+N+F  GGRLIFGPDV SLFL+  LI  PA  FCI++
Sbjct  1    MSKKKSSQIRLYKAWKGNNRFFCGGRLIFGPDVNSLFLTSFLIGAPALTFCIRM  54



>ref|XP_010525441.1| PREDICTED: probable protein S-acyltransferase 4 [Tarenaya hassleriana]
Length=477

 Score = 73.6 bits (179),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 51/73 (70%), Gaps = 2/73 (3%)
 Frame = +1

Query  325  MAQGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKH  504
            MA  + K KRLYQVW+GSNKFL GGRLIFGPD +SL+LS LLI GPA  FC+K+Y  I  
Sbjct  1    MAWDENKPKRLYQVWRGSNKFLCGGRLIFGPDASSLYLSSLLIVGPAIMFCVKMYMKIND  60

Query  505  --HKDGSSWYPIL  537
               K+     P+L
Sbjct  61   PLTKNADRCIPVL  73



>ref|NP_001066075.2| Os12g0131200 [Oryza sativa Japonica Group]
 dbj|BAF29094.2| Os12g0131200 [Oryza sativa Japonica Group]
Length=531

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = +1

Query  331  QGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKHHK  510
            Q  AK KRLYQVWKG+N FL GGRLI GPD ASL LSM LI GPA  F  ++ S I   +
Sbjct  14   QLHAKPKRLYQVWKGNNIFLCGGRLIIGPDAASLLLSMFLILGPAIVFSYQMESTIHRSQ  73



>ref|XP_010673206.1| PREDICTED: probable protein S-acyltransferase 1 [Beta vulgaris 
subsp. vulgaris]
Length=418

 Score = 73.2 bits (178),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 42/62 (68%), Gaps = 0/62 (0%)
 Frame = +1

Query  322  LMAQGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIK  501
            + +   AK +RLY+VW G+NKFL GGRL+ GPD  SL+LS  LI  PA  FCI++   I+
Sbjct  29   MQSTRSAKPERLYRVWPGNNKFLCGGRLVLGPDAGSLYLSSFLIGCPAITFCIRMLIRIR  88

Query  502  HH  507
             H
Sbjct  89   EH  90



>ref|XP_011070039.1| PREDICTED: probable protein S-acyltransferase 1 [Sesamum indicum]
Length=415

 Score = 73.2 bits (178),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = +1

Query  352  RLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKV  486
            RLYQVWKG NKFL GGRLIFGPD AS+ LS  LI GPA AFCI++
Sbjct  24   RLYQVWKGRNKFLCGGRLIFGPDGASVVLSTFLIGGPALAFCIRM  68



>gb|EMT07586.1| hypothetical protein F775_13681 [Aegilops tauschii]
Length=394

 Score = 72.8 bits (177),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 43/68 (63%), Gaps = 4/68 (6%)
 Frame = +1

Query  349  KRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFC----IKVYSNIKHHKDG  516
            +RLYQVW+GSNKFL GGRLIFGPD  SLFLS +LI GP    C     K+ S+    K  
Sbjct  79   RRLYQVWRGSNKFLCGGRLIFGPDAGSLFLSTVLIIGPLVGLCCQCITKMNSSTSDQKKN  138

Query  517  SSWYPILL  540
                P+L+
Sbjct  139  VLGLPVLI  146



>ref|XP_009384346.1| PREDICTED: probable protein S-acyltransferase 4 [Musa acuminata 
subsp. malaccensis]
Length=439

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = +1

Query  337  KAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKV  486
            ++K  RLYQ WKG+N+F  GGR IFGPDV+SLFLS  LIAGP+  FC ++
Sbjct  7    QSKPLRLYQAWKGNNRFFCGGRFIFGPDVSSLFLSTFLIAGPSITFCYQI  56



>ref|XP_004961959.1| PREDICTED: probable S-acyltransferase At4g24630-like [Setaria 
italica]
Length=429

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = +1

Query  340  AKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKHH  507
            A+ +R+Y+ WKG+NKFLFGGRLIFGPD  SL LS+ LI  P   FC  V  +++HH
Sbjct  2    ARPQRVYEAWKGNNKFLFGGRLIFGPDAKSLILSVSLIVVPVLVFCAFVARHLRHH  57



>ref|XP_006346728.1| PREDICTED: protein S-acyltransferase 8-like [Solanum tuberosum]
Length=387

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 45/68 (66%), Gaps = 1/68 (1%)
 Frame = +1

Query  340  AKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKHH-KDG  516
            AK KR+YQ WKG+NKFL  GRLIFGPD  SL ++ +LI  P   FC+ V SN+ H    G
Sbjct  2    AKPKRVYQSWKGNNKFLLDGRLIFGPDAKSLIITFMLILVPVVIFCVFVASNLAHKFTTG  61

Query  517  SSWYPILL  540
            S  Y IL+
Sbjct  62   SIGYAILV  69



>ref|XP_006290365.1| hypothetical protein CARUB_v10017626mg [Capsella rubella]
 gb|EOA23263.1| hypothetical protein CARUB_v10017626mg [Capsella rubella]
Length=328

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = +1

Query  325  MAQGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKH  504
            M     + KR+YQVW G NKF  GGRL+FGPD +SL L++ +I GPA  FCI++   I+ 
Sbjct  1    MTSQNPERKRIYQVWPGKNKFYCGGRLVFGPDASSLLLTICMIGGPAITFCIRMAFLIQD  60

Query  505  H  507
            H
Sbjct  61   H  61



>ref|XP_009776185.1| PREDICTED: protein S-acyltransferase 8-like isoform X1 [Nicotiana 
sylvestris]
Length=388

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 45/68 (66%), Gaps = 1/68 (1%)
 Frame = +1

Query  340  AKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKHH-KDG  516
            AK +R+YQ WKG+NKFLF GRLIFGPD  SL ++  LI  P   FC+ V  N+ H    G
Sbjct  2    AKPERVYQSWKGNNKFLFDGRLIFGPDAKSLIVTFTLILVPVVTFCVFVARNLVHEFSTG  61

Query  517  SSWYPILL  540
            S+ Y I++
Sbjct  62   STGYAIMV  69



>ref|XP_004290492.1| PREDICTED: protein S-acyltransferase 8 [Fragaria vesca subsp. 
vesca]
Length=431

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = +1

Query  349  KRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKHH  507
            KR+YQVWKGSNKF+ GGRLIFGPD  SL +++LLI  P   FC+ V  +++H 
Sbjct  3    KRVYQVWKGSNKFILGGRLIFGPDARSLLVTLLLIIAPVIVFCVFVAWHLRHE  55



>ref|XP_003553374.1| PREDICTED: probable protein S-acyltransferase 4-like isoform 
X1 [Glycine max]
Length=413

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 53/79 (67%), Gaps = 2/79 (3%)
 Frame = +1

Query  304  SNSQV*LMAQGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIK  483
            S S++  M     K +R+Y+VWKG+NKFL GGRL+FG D +SLFL+  LI GPA  FCI+
Sbjct  17   SPSRIVSMESSNVK-QRVYRVWKGNNKFLCGGRLVFGQDASSLFLTSFLIGGPAITFCIR  75

Query  484  VYSNIKHHKDGSSWYPILL  540
            +  ++K  +D     P+L+
Sbjct  76   MLVSLK-EEDPHFSNPVLI  93



>ref|XP_010926775.1| PREDICTED: probable protein S-acyltransferase 7 isoform X1 [Elaeis 
guineensis]
Length=472

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 45/77 (58%), Gaps = 4/77 (5%)
 Frame = +1

Query  289  LVLPSSNSQV*LMAQGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPAT  468
            +V P   S    +A    +  R+Y+VWKGSNKF   GR IFGPDV SLFL++ LI  P +
Sbjct  3    VVPPPRGSDPAAVAAEDGEAPRVYEVWKGSNKFFLEGRFIFGPDVRSLFLTIFLIVAPVS  62

Query  469  AFCI----KVYSNIKHH  507
             FC+    K+  +  HH
Sbjct  63   IFCVFVARKLMDDFSHH  79



>ref|XP_004496446.1| PREDICTED: probable S-acyltransferase At4g24630-like [Cicer arietinum]
Length=422

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 45/60 (75%), Gaps = 2/60 (3%)
 Frame = +1

Query  349  KRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKHHKDGSSWY  528
            KR+YQVWKGSNKF+FGGRL+FGPD  SL +++ LI  P   FC+ V  +++H  + SS+Y
Sbjct  4    KRVYQVWKGSNKFIFGGRLVFGPDARSLLITLSLIIVPVIIFCVFVARHLRH--EFSSYY  61



>ref|XP_009629927.1| PREDICTED: protein S-acyltransferase 8-like isoform X1 [Nicotiana 
tomentosiformis]
Length=388

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 45/68 (66%), Gaps = 1/68 (1%)
 Frame = +1

Query  340  AKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKHH-KDG  516
            AK KR++Q WKG+NKFLF GRLIFGPD  SL ++  LI  P   FC+ V  N+ H    G
Sbjct  2    AKPKRVFQSWKGNNKFLFDGRLIFGPDAKSLIVTFTLILVPVVTFCVFVARNLVHEFSTG  61

Query  517  SSWYPILL  540
            S+ Y I++
Sbjct  62   STGYAIMV  69



>emb|CDX72097.1| BnaC08g27770D [Brassica napus]
Length=361

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 42/62 (68%), Gaps = 0/62 (0%)
 Frame = +1

Query  325  MAQGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKH  504
            M+    + KR+YQVW G NKFL GGRL+FGPD +SL L+  +I GP+  FCI++   I H
Sbjct  1    MSCQNHERKRIYQVWPGKNKFLCGGRLVFGPDASSLLLTTCMIGGPSITFCIRIAFLIGH  60

Query  505  HK  510
             +
Sbjct  61   RR  62



>emb|CDM82986.1| unnamed protein product [Triticum aestivum]
Length=409

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 45/74 (61%), Gaps = 4/74 (5%)
 Frame = +1

Query  331  QGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFC----IKVYSNI  498
            + +   +RLYQVW+GSNKFL GGRLIFGPD  SLFLS +LI GP    C     K+ S+ 
Sbjct  2    EEEPNRRRLYQVWRGSNKFLCGGRLIFGPDAGSLFLSTVLIIGPLVGLCCQCITKMNSST  61

Query  499  KHHKDGSSWYPILL  540
               K      P+L+
Sbjct  62   SDQKKNVLGLPVLI  75



>gb|EPS67406.1| hypothetical protein M569_07370, partial [Genlisea aurea]
Length=324

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = +1

Query  349  KRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKH  504
            KRLYQVW G NKFL GGRLIFGPD +SL LS  LI GPA  F  K+   I H
Sbjct  1    KRLYQVWHGRNKFLCGGRLIFGPDASSLVLSTFLIGGPAVTFAAKMAVRIAH  52



>ref|XP_006436902.1| hypothetical protein CICLE_v10031377mg [Citrus clementina]
 gb|ESR50142.1| hypothetical protein CICLE_v10031377mg [Citrus clementina]
Length=482

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 40/62 (65%), Gaps = 4/62 (6%)
 Frame = +1

Query  334  GKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCI----KVYSNIK  501
            G++ + R YQ WKGSN F  GGRLIFGPDV SLFL++ LI  P   FC+    K+  N  
Sbjct  50   GESGLVRTYQAWKGSNVFFLGGRLIFGPDVRSLFLTIFLIVAPVAVFCVFVARKLMDNFP  109

Query  502  HH  507
            HH
Sbjct  110  HH  111



>gb|KDO57156.1| hypothetical protein CISIN_1g018898mg [Citrus sinensis]
Length=349

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = +1

Query  340  AKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKHH  507
            AK +R+YQVWKG NKF+F GRLIFGPD  S+ +++LLI  P   FC  V  N+ H 
Sbjct  2    AKPQRVYQVWKGRNKFMFNGRLIFGPDAKSIVVTLLLILVPIVTFCSNVARNLLHE  57



>ref|XP_006464542.1| PREDICTED: protein S-acyltransferase 8-like [Citrus sinensis]
Length=349

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = +1

Query  340  AKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKHH  507
            AK +R+YQVWKG NKF+F GRLIFGPD  S+ +++LLI  P   FC  V  N+ H 
Sbjct  2    AKPQRVYQVWKGRNKFMFNGRLIFGPDAKSIVVTLLLILVPIVTFCSNVARNLLHE  57



>ref|XP_006427889.1| hypothetical protein CICLE_v10027028mg, partial [Citrus clementina]
 gb|ESR41129.1| hypothetical protein CICLE_v10027028mg, partial [Citrus clementina]
Length=345

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = +1

Query  340  AKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKHH  507
            AK +R+YQVWKG NKF+F GRLIFGPD  S+ +++LLI  P   FC  V  N+ H 
Sbjct  2    AKPQRVYQVWKGRNKFMFNGRLIFGPDAKSIVVTLLLILVPIVTFCSNVARNLLHE  57



>ref|XP_006493254.1| PREDICTED: probable protein S-acyltransferase 5-like [Citrus 
sinensis]
 gb|KDO64486.1| hypothetical protein CISIN_1g013191mg [Citrus sinensis]
Length=448

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 40/62 (65%), Gaps = 4/62 (6%)
 Frame = +1

Query  334  GKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCI----KVYSNIK  501
            G++ + R YQ WKGSN F  GGRLIFGPDV SLFL++ LI  P   FC+    K+  N  
Sbjct  16   GESGLVRTYQAWKGSNVFFLGGRLIFGPDVRSLFLTIFLIVAPVAVFCVFVARKLMDNFP  75

Query  502  HH  507
            HH
Sbjct  76   HH  77



>ref|XP_007143565.1| hypothetical protein PHAVU_007G082300g [Phaseolus vulgaris]
 gb|ESW15559.1| hypothetical protein PHAVU_007G082300g [Phaseolus vulgaris]
Length=427

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = +1

Query  349  KRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKHH  507
            KR+YQ W+GSNKF+ GGRL+FGPD  SLF+++LLI  P   FC+ V S+++H 
Sbjct  4    KRVYQDWRGSNKFICGGRLVFGPDARSLFVTLLLIIVPVIIFCVCVASHLRHE  56



>ref|XP_010111327.1| putative S-acyltransferase [Morus notabilis]
 gb|EXC30805.1| putative S-acyltransferase [Morus notabilis]
Length=421

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +1

Query  325  MAQGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKV  486
            M   K K +RLYQVWKG+NKFL GGR++FG D  SL L+  LI GPA  FC ++
Sbjct  18   MTPPKTKPRRLYQVWKGNNKFLCGGRVVFGHDAGSLILTSFLIGGPAITFCTRM  71



>gb|ACF79009.1| unknown [Zea mays]
 gb|ACF83706.1| unknown [Zea mays]
 gb|AFW78173.1| palmitoyltransferase ZDHHC9 [Zea mays]
Length=432

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = +1

Query  340  AKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKHH  507
            A+ +R+Y+ WKG+NKF FGGRLIFGPD  SL LS+ LI  P   FC  V  +++HH
Sbjct  2    ARPQRVYEAWKGNNKFFFGGRLIFGPDAKSLILSVSLIVAPVLVFCGFVARHLRHH  57



>ref|NP_001149971.1| LOC100283598 [Zea mays]
 gb|ACG37371.1| palmitoyltransferase ZDHHC9 [Zea mays]
Length=433

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = +1

Query  340  AKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKHH  507
            A+ +R+Y+ WKG+NKF FGGRLIFGPD  SL LS+ LI  P   FC  V  +++HH
Sbjct  2    ARPQRVYEAWKGNNKFFFGGRLIFGPDAKSLILSVSLIVAPVLVFCGFVARHLRHH  57



>gb|KGN54915.1| hypothetical protein Csa_4G595980 [Cucumis sativus]
Length=409

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = +1

Query  337  KAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIK  501
            K   +RLY VWKG+NKFL GGRL+FG D ASLFL+  LI GPA  FCI++   I+
Sbjct  21   KPPQRRLYHVWKGNNKFLCGGRLVFGQDGASLFLTSFLIGGPAITFCIRMLVAIR  75



>gb|KDP36577.1| hypothetical protein JCGZ_08344 [Jatropha curcas]
Length=429

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = +1

Query  349  KRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKH  504
            KR+Y+VWKGSNKF+ GGRLIFGPD  SL +++LLI  P   FC+ V  +++H
Sbjct  3    KRVYEVWKGSNKFILGGRLIFGPDARSLIVTLLLIIVPVVIFCVFVARHLRH  54



>ref|XP_008237503.1| PREDICTED: LOW QUALITY PROTEIN: protein S-acyltransferase 8-like 
[Prunus mume]
Length=413

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = +1

Query  349  KRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKHH  507
            KR+Y+VWKGSNKF+ GGRLIFGPD  SL +++LLI  P   FC+ V  +++H 
Sbjct  3    KRVYEVWKGSNKFILGGRLIFGPDAKSLLVTLLLIIAPVVIFCVFVAWHLRHE  55



>ref|XP_008465237.1| PREDICTED: probable protein S-acyltransferase 1 [Cucumis melo]
Length=409

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = +1

Query  337  KAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIK  501
            K   +RLY VWKG+NKFL GGRL+FG D ASLFL+  LI GPA  FCI++   I+
Sbjct  21   KPPQRRLYHVWKGNNKFLCGGRLVFGQDGASLFLTSFLIGGPAITFCIRMLVAIR  75



>gb|KJB60018.1| hypothetical protein B456_009G286000 [Gossypium raimondii]
Length=428

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +1

Query  349  KRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKH  504
            KR+Y+VWKGSNKF  GGRLIFGPD  SL +++LLI+ P+  FCI V  +++H
Sbjct  3    KRVYEVWKGSNKFFLGGRLIFGPDARSLPVTLLLISVPSIIFCIFVARHLRH  54



>ref|XP_004144683.1| PREDICTED: probable S-acyltransferase At5g05070-like [Cucumis 
sativus]
 ref|XP_004165215.1| PREDICTED: probable S-acyltransferase At5g05070-like [Cucumis 
sativus]
Length=416

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = +1

Query  337  KAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIK  501
            K   +RLY VWKG+NKFL GGRL+FG D ASLFL+  LI GPA  FCI++   I+
Sbjct  21   KPPQRRLYHVWKGNNKFLCGGRLVFGQDGASLFLTSFLIGGPAITFCIRMLVAIR  75



>gb|EYU31116.1| hypothetical protein MIMGU_mgv1a009087mg [Erythranthe guttata]
Length=353

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = +1

Query  349  KRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKHH  507
            KR+YQVWKG NKF FGGRL+FGPDV SL  ++LLI  P   FC  V + + H 
Sbjct  5    KRVYQVWKGKNKFFFGGRLMFGPDVGSLIFTLLLILAPVFVFCALVATKLLHE  57



>gb|KJB16369.1| hypothetical protein B456_002G226400 [Gossypium raimondii]
Length=390

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = +1

Query  349  KRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIK  501
            KR YQVWKG+NKF  GGR+I GPD +SLFL+  LI  PA AFCIK+  +IK
Sbjct  34   KRSYQVWKGNNKFCCGGRIILGPDASSLFLTSFLIGCPAIAFCIKMALHIK  84



>ref|XP_002869709.1| zinc ion binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45968.1| zinc ion binding protein [Arabidopsis lyrata subsp. lyrata]
Length=408

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +1

Query  346  VKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKHH  507
             KR++QVWKGSNKF+ GGRLIFGPD  SL L++LLI  P   FC+ V  +++H 
Sbjct  2    TKRVFQVWKGSNKFILGGRLIFGPDARSLPLTLLLIIVPVVLFCVFVARHLRHE  55



>ref|XP_007199850.1| hypothetical protein PRUPE_ppa005660mg [Prunus persica]
 gb|EMJ01049.1| hypothetical protein PRUPE_ppa005660mg [Prunus persica]
Length=449

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = +1

Query  349  KRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKHH  507
            KR+Y+VWKGSNKF+ GGRLIFGPD  SL +++LLI  P   FC+ V  +++H 
Sbjct  3    KRVYEVWKGSNKFILGGRLIFGPDAKSLLVTLLLIIAPVVIFCVFVAWHLRHE  55



>ref|XP_008381852.1| PREDICTED: LOW QUALITY PROTEIN: protein S-acyltransferase 8 [Malus 
domestica]
Length=431

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = +1

Query  349  KRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKHH  507
            KR+Y+VWKGSNKF+ GGRLIFGPD  SL +++LLI  P   FC+ V  +++H 
Sbjct  4    KRVYEVWKGSNKFILGGRLIFGPDARSLLVTLLLIIAPVIIFCVFVAWHLRHE  56



>ref|XP_009376562.1| PREDICTED: protein S-acyltransferase 8-like [Pyrus x bretschneideri]
 ref|XP_009376563.1| PREDICTED: protein S-acyltransferase 8-like [Pyrus x bretschneideri]
 ref|XP_009376564.1| PREDICTED: protein S-acyltransferase 8-like [Pyrus x bretschneideri]
 ref|XP_009376575.1| PREDICTED: protein S-acyltransferase 8-like [Pyrus x bretschneideri]
 ref|XP_009376576.1| PREDICTED: protein S-acyltransferase 8-like [Pyrus x bretschneideri]
 ref|XP_009376577.1| PREDICTED: protein S-acyltransferase 8-like [Pyrus x bretschneideri]
Length=430

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = +1

Query  349  KRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKHH  507
            KR+Y+VWKGSNKF+ GGRLIFGPD  SL +++LLI  P   FC+ V  +++H 
Sbjct  4    KRVYEVWKGSNKFILGGRLIFGPDARSLLVTLLLIIAPVIIFCVFVAWHLRHE  56



>ref|XP_009377643.1| PREDICTED: probable protein S-acyltransferase 1 [Pyrus x bretschneideri]
Length=467

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 47/64 (73%), Gaps = 1/64 (2%)
 Frame = +1

Query  349  KRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKHHKDGSSWY  528
            +RLY VW+G+NKFL GGR++FG D ASLFL+  LI  PA AFCI++   ++  +DG   Y
Sbjct  27   ERLYLVWQGNNKFLCGGRIVFGHDAASLFLTSFLIGCPALAFCIRMLVMMR-RQDGHYDY  85

Query  529  PILL  540
            P+L+
Sbjct  86   PVLI  89



>ref|XP_006828800.1| hypothetical protein AMTR_s00001p00123260 [Amborella trichopoda]
 gb|ERM96216.1| hypothetical protein AMTR_s00001p00123260 [Amborella trichopoda]
Length=419

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = +1

Query  349  KRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKHH  507
            KR YQVWKG+N+F  GGR+IFGPDV SLF+++LLI  P   FC+ +  +++H 
Sbjct  13   KRTYQVWKGNNRFFLGGRVIFGPDVRSLFITILLILVPIVIFCVFIARHLRHQ  65



>dbj|BAE98351.1| hypothetical protein [Arabidopsis thaliana]
Length=289

 Score = 69.7 bits (169),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = +1

Query  349  KRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKHH  507
            +R++QVWKGSNKF+ GGRLIFGPD  SL L++LLI  P   FC+ V  +++H 
Sbjct  3    QRVFQVWKGSNKFILGGRLIFGPDARSLPLTLLLIIVPVVLFCVFVARHLRHE  55



>ref|XP_001759162.1| predicted protein [Physcomitrella patens]
 gb|EDQ75846.1| predicted protein [Physcomitrella patens]
Length=430

 Score = 70.9 bits (172),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 41/57 (72%), Gaps = 0/57 (0%)
 Frame = +1

Query  349  KRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKHHKDGS  519
            KR+YQVWKGSN+F   GRL+FGPDV SL +++ LI  PA  FC+ V  ++ HH D +
Sbjct  14   KRVYQVWKGSNRFFLCGRLVFGPDVRSLGVTVFLIVAPAVCFCVFVGRHLLHHFDNN  70



>ref|XP_011079233.1| PREDICTED: probable protein S-acyltransferase 1 isoform X1 [Sesamum 
indicum]
Length=400

 Score = 70.9 bits (172),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = +1

Query  349  KRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKV  486
            KR YQVW+G NKFL GGRLIFGPD AS+ LS  LI GPA  FCI++
Sbjct  24   KRRYQVWRGRNKFLCGGRLIFGPDGASILLSAFLIGGPALTFCIQM  69



>gb|ABK25142.1| unknown [Picea sitchensis]
Length=449

 Score = 70.9 bits (172),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 39/60 (65%), Gaps = 4/60 (7%)
 Frame = +1

Query  340  AKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCI----KVYSNIKHH  507
            A  KR+YQ WKGSNKF F GR IFGPDV SL L+ +LI  PAT FC+    K+     HH
Sbjct  21   ASEKRVYQSWKGSNKFFFAGRFIFGPDVRSLVLTFVLILAPATIFCVFVARKLLDKFSHH  80



>ref|XP_011073109.1| PREDICTED: probable protein S-acyltransferase 7 isoform X2 [Sesamum 
indicum]
Length=264

 Score = 69.3 bits (168),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 39/64 (61%), Gaps = 0/64 (0%)
 Frame = +1

Query  328  AQGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKHH  507
            + G A+V R YQ W G NKF  GGRLIFGPDV SLF ++ L+  PA  FC+ +   +   
Sbjct  9    SHGAAEVLRTYQAWPGKNKFCLGGRLIFGPDVGSLFFTLFLMLAPAVVFCVFIARKLMDE  68

Query  508  KDGS  519
              G+
Sbjct  69   FSGN  72



>ref|XP_009116393.1| PREDICTED: LOW QUALITY PROTEIN: probable protein S-acyltransferase 
1 [Brassica rapa]
Length=332

 Score = 70.1 bits (170),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +1

Query  325  MAQGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKV  486
            M+    + KR+YQVW G NKFL GGRL+FGPD +SL L+  +I GP+  FCI++
Sbjct  1    MSCQNHERKRIYQVWPGKNKFLCGGRLVFGPDASSLLLTTCMIGGPSITFCIRI  54



>emb|CDY27179.1| BnaA09g36230D [Brassica napus]
Length=332

 Score = 70.1 bits (170),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +1

Query  325  MAQGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKV  486
            M+    + KR+YQVW G NKFL GGRL+FGPD +SL L+  +I GP+  FCI++
Sbjct  1    MSCQNHERKRIYQVWPGKNKFLCGGRLVFGPDASSLLLTTCMIGGPSITFCIRI  54



>dbj|BAJ89484.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=465

 Score = 70.9 bits (172),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +1

Query  349  KRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYS  492
            KRLYQ WKG+N FL GGRLI GPD ASL LS  L+AGPA  FC ++ S
Sbjct  16   KRLYQAWKGNNVFLCGGRLILGPDAASLLLSSFLVAGPAIVFCYQMQS  63



>gb|KJB19167.1| hypothetical protein B456_003G087200 [Gossypium raimondii]
Length=379

 Score = 70.5 bits (171),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 47/69 (68%), Gaps = 2/69 (3%)
 Frame = +1

Query  334  GKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKHHKD  513
             K   KR+YQ W+G+NKF  GGR++ GPD +SLFL+  LI  P+ AFCIK+  N+K  +D
Sbjct  17   SKPMRKRIYQAWQGNNKFCCGGRILLGPDASSLFLTSFLIGCPSIAFCIKMSVNVK--ED  74

Query  514  GSSWYPILL  540
             S  + IL+
Sbjct  75   DSLNFHILI  83



>ref|XP_001776677.1| predicted protein [Physcomitrella patens]
 gb|EDQ58513.1| predicted protein [Physcomitrella patens]
Length=435

 Score = 70.5 bits (171),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 42/63 (67%), Gaps = 0/63 (0%)
 Frame = +1

Query  349  KRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKHHKDGSSWY  528
            KR+Y+VW GSN+F   GRLIFGPDV SL +++ LI  P+T FCI V  ++ HH  G    
Sbjct  3    KRVYEVWNGSNRFFLCGRLIFGPDVRSLLVTVFLIVAPSTCFCIFVGRHLLHHFSGGGGV  62

Query  529  PIL  537
             I+
Sbjct  63   AII  65



>gb|EMT14585.1| Putative S-acyltransferase [Aegilops tauschii]
Length=466

 Score = 70.9 bits (172),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +1

Query  349  KRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYS  492
            KRLYQ WKG+N FL GGRLI GPD ASL LS  L+AGPA  FC ++ S
Sbjct  17   KRLYQAWKGNNVFLCGGRLILGPDAASLLLSSFLVAGPAIVFCYQMQS  64



>ref|XP_010943748.1| PREDICTED: probable protein S-acyltransferase 7 isoform X1 [Elaeis 
guineensis]
Length=445

 Score = 70.5 bits (171),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = +1

Query  340  AKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKV  486
             +  R+Y+VWKGSNKF  GGR IFGPDV SLFL+M LI  P + FC+ V
Sbjct  20   GEAPRVYKVWKGSNKFFLGGRFIFGPDVRSLFLTMFLIIAPVSIFCVFV  68



>emb|CAA23000.1| putative protein [Arabidopsis thaliana]
 emb|CAB79373.1| putative protein [Arabidopsis thaliana]
Length=374

 Score = 70.1 bits (170),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +1

Query  346  VKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKHH  507
             +R++QVWKGSNKF+ GGRLIFGPD  SL L++LLI  P   FC+ V  +++H 
Sbjct  2    TQRVFQVWKGSNKFILGGRLIFGPDARSLPLTLLLIIVPVVLFCVFVARHLRHE  55



>ref|XP_009393417.1| PREDICTED: protein S-acyltransferase 8-like [Musa acuminata subsp. 
malaccensis]
Length=420

 Score = 70.5 bits (171),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = +1

Query  349  KRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKH  504
            KR+YQ WKG NKFL GGRLIFGPD  SLF+++ LI  P   FC+ V  N+ H
Sbjct  3    KRVYQAWKGKNKFLLGGRLIFGPDARSLFITVSLIVVPVVIFCVFVARNLLH  54



>ref|XP_009599608.1| PREDICTED: protein S-acyltransferase 8-like [Nicotiana tomentosiformis]
Length=379

 Score = 70.1 bits (170),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 44/68 (65%), Gaps = 1/68 (1%)
 Frame = +1

Query  340  AKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKHH-KDG  516
            A  KR+YQ WK +NKFL GGRLIFGPD  SL ++  LI  P   FC+ V  N+ H  + G
Sbjct  2    AMPKRVYQSWKANNKFLLGGRLIFGPDAKSLIITFTLILVPVVLFCVFVARNLVHELQPG  61

Query  517  SSWYPILL  540
            S+ Y IL+
Sbjct  62   SAGYTILV  69



>ref|XP_002876386.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52645.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=338

 Score = 69.7 bits (169),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +1

Query  325  MAQGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKH  504
            M+    + KR+YQVW   NKF  GGRL+FGPD +SL L+  +I GPA  FCI++   I H
Sbjct  1    MSSQNPERKRIYQVWPAKNKFYCGGRLVFGPDASSLLLTTCMIGGPAITFCIRMAYLISH  60



>ref|NP_194194.2| DHHC-type zinc finger family protein [Arabidopsis thaliana]
 sp|Q9SB58.2|ZDH19_ARATH RecName: Full=Protein S-acyltransferase 8; AltName: Full=Probable 
palmitoyltransferase At4g24630; AltName: Full=Zinc finger 
DHHC domain-containing protein At4g24630 [Arabidopsis thaliana]
 gb|AEE84935.1| DHHC-type zinc finger family protein [Arabidopsis thaliana]
Length=407

 Score = 70.1 bits (170),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +1

Query  346  VKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKHH  507
             +R++QVWKGSNKF+ GGRLIFGPD  SL L++LLI  P   FC+ V  +++H 
Sbjct  2    TQRVFQVWKGSNKFILGGRLIFGPDARSLPLTLLLIIVPVVLFCVFVARHLRHE  55



>ref|XP_009781054.1| PREDICTED: protein S-acyltransferase 8-like [Nicotiana sylvestris]
Length=379

 Score = 69.7 bits (169),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 44/68 (65%), Gaps = 1/68 (1%)
 Frame = +1

Query  340  AKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKHH-KDG  516
            A  KR+YQ WK +NKFL GGRLIFGPD  SL ++  LI  P   FC+ V  N+ H  + G
Sbjct  2    AMPKRVYQSWKANNKFLLGGRLIFGPDAKSLIITFTLILVPVVIFCVFVARNLVHELQPG  61

Query  517  SSWYPILL  540
            S+ Y IL+
Sbjct  62   SAGYAILV  69



>ref|XP_010516296.1| PREDICTED: probable protein S-acyltransferase 1 [Camelina sativa]
Length=334

 Score = 69.3 bits (168),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +1

Query  325  MAQGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKV  486
            M+    + KR YQVW G NKF  GGRL+FGPD +SL L++ +I GPA  FCI++
Sbjct  1    MSSQSPERKRFYQVWPGKNKFYCGGRLVFGPDASSLLLTICMIGGPAITFCIRM  54



>ref|XP_010427543.1| PREDICTED: probable protein S-acyltransferase 1 [Camelina sativa]
Length=334

 Score = 69.3 bits (168),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +1

Query  325  MAQGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKV  486
            M+    + KR YQVW G NKF  GGRL+FGPD +SL L++ +I GPA  FCI++
Sbjct  1    MSSQSPERKRFYQVWPGKNKFYCGGRLVFGPDASSLLLTICMIGGPAITFCIRM  54



>ref|XP_002439863.1| hypothetical protein SORBIDRAFT_09g021530 [Sorghum bicolor]
 gb|EES18293.1| hypothetical protein SORBIDRAFT_09g021530 [Sorghum bicolor]
Length=430

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = +1

Query  340  AKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKHH  507
            A+ +R+Y+ WKG+NKF FGGRLIFGPD  SL LS+ LI  P   FC  V  +++HH
Sbjct  2    ARPQRVYEAWKGNNKFFFGGRLIFGPDAKSLILSVSLIVIPVLVFCGFVARHLRHH  57



>ref|XP_011073108.1| PREDICTED: probable protein S-acyltransferase 7 isoform X1 [Sesamum 
indicum]
Length=314

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = +1

Query  328  AQGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCI  480
            + G A+V R YQ W G NKF  GGRLIFGPDV SLF ++ L+  PA  FC+
Sbjct  9    SHGAAEVLRTYQAWPGKNKFCLGGRLIFGPDVGSLFFTLFLMLAPAVVFCV  59



>ref|XP_008790729.1| PREDICTED: probable protein S-acyltransferase 7 isoform X1 [Phoenix 
dactylifera]
Length=466

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 40/64 (63%), Gaps = 4/64 (6%)
 Frame = +1

Query  328  AQGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCI----KVYSN  495
            A    +  R+Y+VWKGSNKF  GGR IFGPD  SLFL+M LI  P + FC+    K+  +
Sbjct  37   AAADGEAPRVYEVWKGSNKFFLGGRFIFGPDARSLFLTMFLIIVPMSIFCVFVARKLMDD  96

Query  496  IKHH  507
              HH
Sbjct  97   FYHH  100



>ref|XP_004964524.1| PREDICTED: probable S-acyltransferase At3g56930-like [Setaria 
italica]
Length=476

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +1

Query  331  QGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYS  492
            Q +AK +RLYQ WKG+N FL GGRLIFGPD ASL L++ LI  P   FC ++ S
Sbjct  27   QLEAKPRRLYQAWKGNNIFLCGGRLIFGPDAASLLLTVFLIISPTIIFCYQMKS  80



>ref|NP_001055649.1| Os05g0436900 [Oryza sativa Japonica Group]
 dbj|BAF17563.1| Os05g0436900 [Oryza sativa Japonica Group]
 gb|EEC79290.1| hypothetical protein OsI_20094 [Oryza sativa Indica Group]
 gb|EEE63845.1| hypothetical protein OsJ_18669 [Oryza sativa Japonica Group]
Length=429

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 43/61 (70%), Gaps = 3/61 (5%)
 Frame = +1

Query  325  MAQGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKH  504
            MAQ +   KR+Y+ WKG+N+FLFGGRLIFGPD  SL +S+ LI  P   FC+ V  +++H
Sbjct  1    MAQPQ---KRVYEAWKGNNRFLFGGRLIFGPDAKSLLVSVSLIVVPVLVFCVFVARHLRH  57

Query  505  H  507
             
Sbjct  58   Q  58



>ref|XP_002307509.1| zinc finger family protein [Populus trichocarpa]
 gb|EEE94505.1| zinc finger family protein [Populus trichocarpa]
Length=422

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = +1

Query  349  KRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKHH  507
            KR+++VWKGSNKF+ GGRLIFGPD  SL +++LLI  P   FC+ V  +++H 
Sbjct  3    KRVFEVWKGSNKFILGGRLIFGPDARSLIVTLLLIIVPVIIFCVFVVRHLRHE  55



>ref|XP_008811959.1| PREDICTED: probable protein S-acyltransferase 1 [Phoenix dactylifera]
Length=436

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = +1

Query  337  KAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKHHK  510
            + K KRLYQVWKGSN+F  GGRLIFGPD ASL L+ LLI+GPA  FC ++ + I  ++
Sbjct  4    QPKPKRLYQVWKGSNRFFCGGRLIFGPDAASLLLTTLLISGPAITFCYQIIAKICQYE  61



>ref|XP_008790730.1| PREDICTED: probable protein S-acyltransferase 7 isoform X2 [Phoenix 
dactylifera]
Length=457

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 40/64 (63%), Gaps = 4/64 (6%)
 Frame = +1

Query  328  AQGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCI----KVYSN  495
            A    +  R+Y+VWKGSNKF  GGR IFGPD  SLFL+M LI  P + FC+    K+  +
Sbjct  37   AAADGEAPRVYEVWKGSNKFFLGGRFIFGPDARSLFLTMFLIIVPMSIFCVFVARKLMDD  96

Query  496  IKHH  507
              HH
Sbjct  97   FYHH  100



>ref|XP_010552900.1| PREDICTED: probable protein S-acyltransferase 3 [Tarenaya hassleriana]
Length=369

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 52/85 (61%), Gaps = 7/85 (8%)
 Frame = +1

Query  295  LPSSNSQV*LMAQGKAKVK--RLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPAT  468
            +P ++  + + A     +   R Y+VWKG+NKF   G LIFGPDV+SLFL+  LI  PA 
Sbjct  12   VPPADHHIDMSASTSKSISQIRAYKVWKGNNKFCCKGMLIFGPDVSSLFLTSFLIGAPAF  71

Query  469  AFCIKVYSNIKHHKDGSSW--YPIL  537
            AFCI++   I   ++G  W  YP+L
Sbjct  72   AFCIRMLVRI---RNGDPWFNYPVL  93



>ref|XP_011044264.1| PREDICTED: protein S-acyltransferase 8-like [Populus euphratica]
Length=424

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = +1

Query  349  KRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKHH  507
            KR+++VWKGSNKF+ GGRLIFGPD  SL +++LLI  P   FC+ V  +++H 
Sbjct  3    KRVFEVWKGSNKFILGGRLIFGPDARSLIVTLLLIIVPVIIFCVFVVRHLRHE  55



>ref|XP_003592069.1| Palmitoyltransferase SWF1 [Medicago truncatula]
 gb|AES62320.1| DHHC type zinc finger protein [Medicago truncatula]
Length=422

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = +1

Query  349  KRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKH  504
            KR+YQVWKGSNKF+ GGRL+FGPD  SL +++ LI  P   FC+ V  +++H
Sbjct  4    KRVYQVWKGSNKFILGGRLVFGPDARSLLITLSLIIVPVIIFCVFVARHLRH  55



>ref|XP_004970714.1| PREDICTED: probable S-acyltransferase At4g24630-like [Setaria 
italica]
Length=356

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 42/61 (69%), Gaps = 3/61 (5%)
 Frame = +1

Query  325  MAQGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKH  504
            MAQ +   +R+YQ WKG N+F FGGRLIFGPDV SL LS+ LI  P   FC+ V  +++H
Sbjct  1    MAQPQ---QRVYQAWKGDNRFFFGGRLIFGPDVKSLGLSVALIVVPVAFFCVFVARHLRH  57

Query  505  H  507
             
Sbjct  58   Q  58



>ref|XP_006654456.1| PREDICTED: protein S-acyltransferase 8-like [Oryza brachyantha]
Length=429

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 43/61 (70%), Gaps = 3/61 (5%)
 Frame = +1

Query  325  MAQGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKH  504
            MAQ +   KR+Y+ WKG+N+FLFGGRLIFGPD  SL +S+ LI  P   FC+ V  +++H
Sbjct  1    MAQPQ---KRVYETWKGNNRFLFGGRLIFGPDAKSLLVSVSLILVPVLVFCVFVARHLRH  57

Query  505  H  507
             
Sbjct  58   Q  58



>ref|XP_006296259.1| hypothetical protein CARUB_v10025425mg [Capsella rubella]
 gb|EOA29157.1| hypothetical protein CARUB_v10025425mg [Capsella rubella]
Length=412

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 42/63 (67%), Gaps = 2/63 (3%)
 Frame = +1

Query  298  PSSNSQV*LMAQGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFC  477
            PS +    + +    K KR+YQ+W G+NKF  GGRL+FGPD +SL LS  +I GPA  FC
Sbjct  13   PSDDET--MFSHDHHKPKRIYQLWPGNNKFYCGGRLVFGPDASSLLLSTAMIGGPALTFC  70

Query  478  IKV  486
            I++
Sbjct  71   IRM  73



>emb|CDP14341.1| unnamed protein product [Coffea canephora]
Length=426

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 37/55 (67%), Gaps = 0/55 (0%)
 Frame = +1

Query  349  KRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKHHKD  513
            KRLYQVWKG NKFL GGR IFGPD +S+ LS  LI  PA  FC+K+   +    D
Sbjct  22   KRLYQVWKGRNKFLCGGRFIFGPDGSSVLLSTFLIGAPALTFCMKMLLRLSEVDD  76



>ref|XP_009335282.1| PREDICTED: probable protein S-acyltransferase 1 [Pyrus x bretschneideri]
Length=467

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 46/64 (72%), Gaps = 1/64 (2%)
 Frame = +1

Query  349  KRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKHHKDGSSWY  528
            +RLY VW+G+NKFL GGR++FG D ASLFL+  LI  PA AFC ++   ++  +DG   Y
Sbjct  27   ERLYLVWQGNNKFLCGGRIVFGHDAASLFLTSFLIGCPALAFCTRMLVMMR-RQDGHYDY  85

Query  529  PILL  540
            P+L+
Sbjct  86   PVLI  89



>ref|XP_006282635.1| hypothetical protein CARUB_v10004950mg [Capsella rubella]
 gb|EOA15533.1| hypothetical protein CARUB_v10004950mg [Capsella rubella]
Length=406

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +1

Query  346  VKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKHH  507
             KR++Q WKGSNKF+ GGRLIFGPD  SL L++LLI  P   FC+ V  +++H 
Sbjct  2    TKRVFQAWKGSNKFILGGRLIFGPDARSLPLTLLLIIVPVALFCVFVARHLRHE  55



>ref|XP_008463061.1| PREDICTED: protein S-acyltransferase 8-like [Cucumis melo]
Length=424

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = +1

Query  352  RLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKH  504
            R+YQVWKGSNKF+ GGRLIFGPD  SL +++LLI  P   FC  V  +++H
Sbjct  4    RVYQVWKGSNKFILGGRLIFGPDARSLLVTILLITVPVIIFCAFVARHLRH  54



>ref|XP_004138367.1| PREDICTED: probable S-acyltransferase At4g24630-like [Cucumis 
sativus]
 gb|KGN45888.1| hypothetical protein Csa_6G017040 [Cucumis sativus]
Length=424

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = +1

Query  352  RLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKH  504
            R+YQVWKGSNKF+ GGRLIFGPD  SL +++LLI  P   FC  V  +++H
Sbjct  4    RVYQVWKGSNKFILGGRLIFGPDARSLLVTILLITVPVIIFCAFVARHLRH  54



>ref|XP_010517579.1| PREDICTED: probable protein S-acyltransferase 2 [Camelina sativa]
Length=414

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +1

Query  325  MAQGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKV  486
            M     K KR+YQ+W G+NKF  GGRL+FGPD +SL L+ ++I GPA  FCI++
Sbjct  19   MFSQDRKPKRIYQLWPGNNKFYCGGRLVFGPDASSLLLTTVMIGGPALTFCIRM  72



>ref|XP_010679975.1| PREDICTED: probable protein S-acyltransferase 7 [Beta vulgaris 
subsp. vulgaris]
Length=439

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = +1

Query  352  RLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKH  504
            R+YQ WKGSNKFL  G+LIFGPDV SLFL++ LIA P   FC+ V   + H
Sbjct  21   RVYQTWKGSNKFLLQGQLIFGPDVRSLFLTIFLIAAPIAVFCVFVARKLMH  71



>ref|XP_010681139.1| PREDICTED: protein S-acyltransferase 8-like isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=411

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = +1

Query  349  KRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKH  504
            KR+YQ WKGSNKFLFGGR+I GPD  SL +++ LI  PA  FCI V  +++H
Sbjct  3    KRVYQAWKGSNKFLFGGRVILGPDAKSLLVTVSLITVPAVIFCIFVAWHLRH  54



>ref|XP_004140962.1| PREDICTED: probable S-acyltransferase At4g24630-like [Cucumis 
sativus]
 ref|XP_004160314.1| PREDICTED: probable S-acyltransferase At4g24630-like [Cucumis 
sativus]
 gb|KGN46123.1| hypothetical protein Csa_6G055930 [Cucumis sativus]
Length=427

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 44/65 (68%), Gaps = 1/65 (2%)
 Frame = +1

Query  349  KRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKHH-KDGSSW  525
            KR+YQVWKGSNKF+ GGRLIFGPD  SL +++ LI  P   FC  V  N+ H  K  ++ 
Sbjct  3    KRVYQVWKGSNKFILGGRLIFGPDARSLIVTISLITVPVIIFCAFVARNLVHEFKPYNAG  62

Query  526  YPILL  540
            Y +L+
Sbjct  63   YAVLV  67



>ref|XP_010508781.1| PREDICTED: probable protein S-acyltransferase 2 [Camelina sativa]
Length=415

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +1

Query  325  MAQGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKV  486
            M     K KR+YQ+W G+NKF  GGRL+FGPD +SL L+ ++I GPA  FCI++
Sbjct  19   MYSHDHKPKRIYQLWPGNNKFYCGGRLVFGPDASSLLLTTVMIGGPALTFCIRM  72



>ref|XP_010505862.1| PREDICTED: probable protein S-acyltransferase 2 [Camelina sativa]
Length=414

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +1

Query  325  MAQGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKV  486
            M     K KR+YQ+W G+NKF  GGRL+FGPD +SL L+ ++I GPA  FCI++
Sbjct  19   MFSQDRKPKRIYQLWPGNNKFYCGGRLVFGPDASSLLLTTVMIGGPALTFCIRM  72



>ref|XP_002985545.1| hypothetical protein SELMODRAFT_13217, partial [Selaginella moellendorffii]
 ref|XP_002987024.1| hypothetical protein SELMODRAFT_13225, partial [Selaginella moellendorffii]
 gb|EFJ11867.1| hypothetical protein SELMODRAFT_13225, partial [Selaginella moellendorffii]
 gb|EFJ13419.1| hypothetical protein SELMODRAFT_13217, partial [Selaginella moellendorffii]
Length=309

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +1

Query  352  RLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIK  501
            R+YQVWKGSNKF  GGRLIFGPDV SL +++ LI  P   FC+ V S ++
Sbjct  1    RVYQVWKGSNKFFLGGRLIFGPDVRSLLVTLFLIIVPVVIFCVFVASRLR  50



>ref|XP_010423502.1| PREDICTED: probable protein S-acyltransferase 3 [Camelina sativa]
Length=412

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = +1

Query  352  RLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKV  486
            RLY+ WKG+N+F  GGRLIFGPDV+SLFL+  LI  PA  FCI++
Sbjct  37   RLYKAWKGNNRFFCGGRLIFGPDVSSLFLTSFLIGAPALTFCIRM  81



>ref|XP_006411364.1| hypothetical protein EUTSA_v10016704mg [Eutrema salsugineum]
 gb|ESQ52817.1| hypothetical protein EUTSA_v10016704mg [Eutrema salsugineum]
Length=425

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +1

Query  325  MAQGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKV  486
            M    +K KR+YQ+W G+NKF  GGRL+FGPD +SL L+  +I GPA  FCI++
Sbjct  25   MFSHDSKPKRIYQLWPGNNKFYCGGRLVFGPDASSLLLTTAMIGGPALTFCIRM  78



>ref|XP_010491036.1| PREDICTED: probable protein S-acyltransferase 3 isoform X1 [Camelina 
sativa]
Length=412

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = +1

Query  352  RLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKV  486
            RLY+ WKG+N+F  GGRLIFGPDV+SLFL+  LI  PA  FCI++
Sbjct  37   RLYKAWKGNNRFFCGGRLIFGPDVSSLFLTSFLIGAPALTFCIRM  81



>ref|XP_006290160.1| hypothetical protein CARUB_v10003828mg [Capsella rubella]
 gb|EOA23058.1| hypothetical protein CARUB_v10003828mg [Capsella rubella]
Length=413

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = +1

Query  352  RLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKV  486
            RLY+ WKG+N+F  GGRLIFGPDV+SLFL+  LI  PA  FCI++
Sbjct  37   RLYKAWKGNNRFFCGGRLIFGPDVSSLFLTSFLIGAPALTFCIRM  81



>ref|XP_007043729.1| DHHC-type zinc finger family protein [Theobroma cacao]
 gb|EOX99560.1| DHHC-type zinc finger family protein [Theobroma cacao]
Length=423

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 43/73 (59%), Gaps = 3/73 (4%)
 Frame = +1

Query  295  LPSSNSQV*LMAQGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAF  474
            L  SN ++       A   R+YQVWKGSN+F  GGRL+FGPDV S+FL++ LI  P   F
Sbjct  10   LSDSNRRI---IDTSATTLRVYQVWKGSNRFCLGGRLVFGPDVRSIFLTISLIVMPVILF  66

Query  475  CIKVYSNIKHHKD  513
            C  V   + H  D
Sbjct  67   CAFVSQRLIHEFD  79



>ref|XP_006398962.1| hypothetical protein EUTSA_v10015437mg [Eutrema salsugineum]
 gb|ESQ40415.1| hypothetical protein EUTSA_v10015437mg [Eutrema salsugineum]
Length=415

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = +1

Query  352  RLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKV  486
            RLY+ WKG+N+F  GGRLIFGPDV+SLFL+  LI  PA  FCI++
Sbjct  37   RLYKAWKGNNRFCCGGRLIFGPDVSSLFLTSFLIGAPALTFCIRM  81



>ref|XP_010452410.1| PREDICTED: probable protein S-acyltransferase 3 isoform X1 [Camelina 
sativa]
Length=412

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = +1

Query  352  RLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKV  486
            RLY+ WKG+N+F  GGRLIFGPDV+SLFL+  LI  PA  FCI++
Sbjct  37   RLYKAWKGNNRFFCGGRLIFGPDVSSLFLTSFLIGAPALTFCIRM  81



>ref|XP_009130858.1| PREDICTED: probable protein S-acyltransferase 3 [Brassica rapa]
Length=400

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = +1

Query  352  RLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKV  486
            RLY+ WKG+N+F  GGRLIFGPDV+SLFL+  LI  PA  FCI++
Sbjct  35   RLYKAWKGNNRFFCGGRLIFGPDVSSLFLTSFLIGAPALTFCIRM  79



>ref|XP_008441500.1| PREDICTED: protein S-acyltransferase 8-like [Cucumis melo]
Length=427

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 44/65 (68%), Gaps = 1/65 (2%)
 Frame = +1

Query  349  KRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKHH-KDGSSW  525
            KR+YQVWKGSNKF+ GGRLIFGPD  SL +++ LI  P   FC  V  N+ H  K  ++ 
Sbjct  3    KRVYQVWKGSNKFILGGRLIFGPDARSLIVTISLITLPVIIFCAFVARNLVHEFKPYNAG  62

Query  526  YPILL  540
            Y +L+
Sbjct  63   YAVLV  67



>ref|XP_008791097.1| PREDICTED: probable protein S-acyltransferase 7 [Phoenix dactylifera]
Length=445

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = +1

Query  298  PSSNSQV*LMAQGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFC  477
            P  ++   +  +   ++ R+Y+VWKGSN F   GR IFGPDV SLFL+++LI  P + FC
Sbjct  7    PRGSTPAAMATEADVEMPRVYEVWKGSNIFFLQGRFIFGPDVRSLFLTIILIVAPVSVFC  66

Query  478  IKV  486
            I V
Sbjct  67   IFV  69



>ref|NP_001149872.1| LOC100283500 [Zea mays]
 gb|ACG37057.1| palmitoyltransferase ZDHHC9 [Zea mays]
Length=434

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = +1

Query  334  GKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKV  486
            G  +  RLYQVW+GSN+F   GR IFGPDV S+FL+M+LI  P   FC+ V
Sbjct  11   GAGEQPRLYQVWRGSNEFFLQGRFIFGPDVRSVFLTMILIIAPVVVFCLFV  61



>gb|ACL53585.1| unknown [Zea mays]
 gb|AFW61611.1| palmitoyltransferase ZDHHC9 [Zea mays]
Length=434

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = +1

Query  334  GKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKV  486
            G  +  RLYQVW+GSN+F   GR IFGPDV S+FL+M+LI  P   FC+ V
Sbjct  11   GAGEQPRLYQVWRGSNEFFLQGRFIFGPDVRSVFLTMILIIAPVVVFCLFV  61



>ref|XP_004235323.1| PREDICTED: probable protein S-acyltransferase 7 isoform X1 [Solanum 
lycopersicum]
Length=438

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 40/65 (62%), Gaps = 0/65 (0%)
 Frame = +1

Query  292  VLPSSNSQV*LMAQGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATA  471
            V P  +S     A  +A   R YQVWKGSNKF+  GR IFGPDV S+F+++ LI  P   
Sbjct  4    VAPPKSSDSGDGATNQAAFIRTYQVWKGSNKFILQGRFIFGPDVRSVFMTIFLIVAPVAV  63

Query  472  FCIKV  486
            FC+ V
Sbjct  64   FCVFV  68



>ref|XP_003578399.1| PREDICTED: probable protein S-acyltransferase 7 [Brachypodium 
distachyon]
Length=442

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = +1

Query  328  AQGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKH  504
            A   A+  R+YQVW+GSN+FL  GR IFGPDV SLFL++ LI  P   FCI V  ++ +
Sbjct  10   AGSSAEQPRVYQVWRGSNEFLLQGRFIFGPDVRSLFLTVFLILAPVLVFCIFVARHLTN  68



>ref|XP_006420833.1| hypothetical protein CICLE_v10005034mg [Citrus clementina]
 gb|ESR34073.1| hypothetical protein CICLE_v10005034mg [Citrus clementina]
Length=423

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +1

Query  325  MAQGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKV  486
            +    ++  RLYQVWKG+N+F  GGRLIFGPDV S+FL++ LI  P   FC+ V
Sbjct  17   IIDSNSETLRLYQVWKGTNRFCCGGRLIFGPDVRSIFLTLFLIVTPVILFCVFV  70



>ref|NP_181632.5| probable protein S-acyltransferase 2 [Arabidopsis thaliana]
 sp|O80685.3|ZDHC4_ARATH RecName: Full=Probable protein S-acyltransferase 2; AltName: 
Full=Probable palmitoyltransferase At2g40990; AltName: Full=Zinc 
finger DHHC domain-containing protein At2g40990 [Arabidopsis 
thaliana]
 gb|AEC09910.1| probable S-acyltransferas [Arabidopsis thaliana]
Length=411

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 39/55 (71%), Gaps = 0/55 (0%)
 Frame = +1

Query  322  LMAQGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKV  486
            +M     K KR+YQ+W G+N+F  GGRL+FGPD +SL L+  +I GPA  FCI++
Sbjct  18   IMFSQDHKPKRIYQLWPGNNRFYCGGRLVFGPDASSLLLTTAMIGGPALTFCIRM  72



>gb|KDP35293.1| hypothetical protein JCGZ_09452 [Jatropha curcas]
Length=352

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = +1

Query  349  KRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKHH  507
            KR+YQVWKG N FLF GRLIFGPD  SL +++LLI  P   FC  V  N  H 
Sbjct  3    KRVYQVWKGRNIFLFNGRLIFGPDAKSLVVTILLIVVPVIIFCTNVARNFFHE  55



>tpg|DAA48250.1| TPA: hypothetical protein ZEAMMB73_448859 [Zea mays]
Length=277

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = +1

Query  334  GKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKV  486
            G  +  R+YQVW+GSN+F   GR IFGPDV S+FL+M LI  P   FC+ V
Sbjct  10   GAGEQPRVYQVWRGSNEFFLQGRFIFGPDVRSVFLTMFLIIAPVVVFCVFV  60



>tpg|DAA56648.1| TPA: hypothetical protein ZEAMMB73_944235 [Zea mays]
Length=274

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 42/61 (69%), Gaps = 3/61 (5%)
 Frame = +1

Query  325  MAQGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKH  504
            MAQ +   +R+YQ WKG N+F FGGRLIFGP+V SL +S+ LI  P   FC+ V  +++H
Sbjct  1    MAQPQ---QRVYQAWKGDNRFFFGGRLIFGPNVKSLGVSVALIVIPVAVFCVFVAHHLRH  57

Query  505  H  507
             
Sbjct  58   Q  58



>ref|XP_008778432.1| PREDICTED: probable protein S-acyltransferase 7 [Phoenix dactylifera]
Length=422

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 38/57 (67%), Gaps = 4/57 (7%)
 Frame = +1

Query  349  KRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCI----KVYSNIKHH  507
            KRLYQVWKGSN+F  GGRLIFGPDV SL L++ LI  P   F +    ++    KHH
Sbjct  25   KRLYQVWKGSNRFFLGGRLIFGPDVRSLVLTIFLIVTPVILFAVFVSQRLVDEFKHH  81



>gb|EPS73403.1| hypothetical protein M569_01348, partial [Genlisea aurea]
Length=399

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = +1

Query  349  KRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKHH  507
            KR++QVWKG N FLFGGRL FGPD  SL L++ LI  P   FCI V  +++H 
Sbjct  3    KRVHQVWKGKNVFLFGGRLFFGPDAKSLLLTLFLIIAPVVVFCIFVAWHLRHE  55



>ref|XP_002987463.1| hypothetical protein SELMODRAFT_235280 [Selaginella moellendorffii]
 gb|EFJ11550.1| hypothetical protein SELMODRAFT_235280 [Selaginella moellendorffii]
Length=431

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = +1

Query  349  KRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNI  498
            +R+YQ W+GSNKFLF GRLIFGPDV SL +++ L+ GPA  FC+ V  ++
Sbjct  3    ERVYQSWQGSNKFLFHGRLIFGPDVRSLLVTLFLLIGPAVIFCVFVARDL  52



>ref|XP_002980068.1| hypothetical protein SELMODRAFT_153626 [Selaginella moellendorffii]
 gb|EFJ18938.1| hypothetical protein SELMODRAFT_153626 [Selaginella moellendorffii]
Length=431

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = +1

Query  349  KRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNI  498
            +R+YQ W+GSNKFLF GRLIFGPDV SL +++ L+ GPA  FC+ V  ++
Sbjct  3    ERVYQSWQGSNKFLFHGRLIFGPDVRSLLVTLFLLIGPAVIFCVFVARDL  52



>ref|XP_010929605.1| PREDICTED: probable protein S-acyltransferase 7 [Elaeis guineensis]
Length=445

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = +1

Query  298  PSSNSQV*LMAQGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFC  477
            P  ++   ++ +   ++ R+Y+VWKGSN F   GR IFGPDV SLFL++ LI  P + FC
Sbjct  7    PRGSNPAAMVTEADVEMPRVYEVWKGSNIFFLQGRFIFGPDVRSLFLTIFLIVAPVSVFC  66

Query  478  IKV  486
            + V
Sbjct  67   VFV  69



>ref|XP_010250597.1| PREDICTED: probable protein S-acyltransferase 7 isoform X1 [Nelumbo 
nucifera]
Length=456

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 36/55 (65%), Gaps = 4/55 (7%)
 Frame = +1

Query  352  RLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCI----KVYSNIKH  504
            R YQ WKGSN F   GR IFGPDV SLFL++ LIA P T FCI    K+ S+  H
Sbjct  27   RTYQTWKGSNIFFLQGRFIFGPDVRSLFLTIFLIAAPVTVFCIFVARKLMSDFSH  81



>ref|XP_006413408.1| hypothetical protein EUTSA_v10025973mg [Eutrema salsugineum]
 gb|ESQ54861.1| hypothetical protein EUTSA_v10025973mg [Eutrema salsugineum]
Length=270

 Score = 66.2 bits (160),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = +1

Query  349  KRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKHH  507
            +R+++ WKGSNKF+FGGRLIFGPD  S+ +++LLI  P   FCI V  +++H 
Sbjct  3    QRVFEAWKGSNKFIFGGRLIFGPDARSVPVTVLLIIVPVILFCIFVARHLRHE  55



>ref|XP_010250351.1| PREDICTED: protein S-acyltransferase 8-like isoform X4 [Nelumbo 
nucifera]
Length=294

 Score = 66.6 bits (161),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 44/66 (67%), Gaps = 1/66 (2%)
 Frame = +1

Query  346  VKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKHH-KDGSS  522
             KR+Y+ WKGSNKF  GGRLIFGPD  SL +++LLI  P   FC  V  +++H  +  ++
Sbjct  2    AKRVYEAWKGSNKFFCGGRLIFGPDARSLIVTVLLILVPVIIFCTLVARHLRHEFRSYNA  61

Query  523  WYPILL  540
             Y IL+
Sbjct  62   GYAILV  67



>ref|XP_009134039.1| PREDICTED: probable protein S-acyltransferase 9 [Brassica rapa]
Length=416

 Score = 67.4 bits (163),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = +1

Query  352  RLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKHH  507
            R+Y+ WKGSNKFLFGGRLIFGPD  SL  ++LLI  P T F + V ++++H 
Sbjct  4    RVYEAWKGSNKFLFGGRLIFGPDAWSLPFTLLLIITPVTLFSVFVATHLRHE  55



>emb|CDX83171.1| BnaA03g23350D [Brassica napus]
Length=437

 Score = 67.4 bits (163),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = +1

Query  352  RLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKHH  507
            R+Y+ WKGSNKFLFGGRLIFGPD  SL  ++LLI  P T F + V ++++H 
Sbjct  4    RVYEAWKGSNKFLFGGRLIFGPDAWSLPFTLLLIITPVTLFSVFVATHLRHE  55



>gb|ABK25091.1| unknown [Picea sitchensis]
Length=429

 Score = 67.4 bits (163),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 40/58 (69%), Gaps = 4/58 (7%)
 Frame = +1

Query  346  VKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNI----KHH  507
             +R+YQ+W+GSNKF  GGRLIFGPDV SLFL++ +I  P   FC  V +N+     HH
Sbjct  23   TRRVYQLWEGSNKFFLGGRLIFGPDVRSLFLTIFMIIVPLAIFCAFVANNLLDKFSHH  80



>emb|CDY21437.1| BnaC03g27600D [Brassica napus]
Length=462

 Score = 67.4 bits (163),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = +1

Query  352  RLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKHH  507
            R+Y+ WKGSNKFLFGGRLIFGPD  SL  ++LLI  P T F + V ++++H 
Sbjct  4    RVYEAWKGSNKFLFGGRLIFGPDAWSLPFTLLLIITPVTLFSVFVATHLRHE  55



>ref|XP_002871133.1| zinc ion binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47392.1| zinc ion binding protein [Arabidopsis lyrata subsp. lyrata]
Length=413

 Score = 67.0 bits (162),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = +1

Query  352  RLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKH  504
            R Y+ WKG+N+F  GGRLIFGPDV+SLFL+  LI  PA  FCI++   IK+
Sbjct  37   RFYKAWKGNNRFCCGGRLIFGPDVSSLFLTSFLIGAPALTFCIRMLLWIKN  87



>ref|XP_002442702.1| hypothetical protein SORBIDRAFT_08g001470 [Sorghum bicolor]
 gb|EES16540.1| hypothetical protein SORBIDRAFT_08g001470 [Sorghum bicolor]
Length=494

 Score = 67.4 bits (163),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 42/67 (63%), Gaps = 0/67 (0%)
 Frame = +1

Query  283  VLLVLPSSNSQV*LMAQGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGP  462
            V+++ PS   +     + +AK +R+YQ WKG+N FL GGRL+FGPD  SL L+  LI  P
Sbjct  31   VIVMKPSEPPEDEQPQEQEAKPRRIYQAWKGNNIFLCGGRLMFGPDAPSLLLTTFLIVAP  90

Query  463  ATAFCIK  483
               FC +
Sbjct  91   TIIFCYQ  97



>ref|NP_001141947.1| uncharacterized protein LOC100274096 [Zea mays]
 gb|ACF87360.1| unknown [Zea mays]
 tpg|DAA48251.1| TPA: hypothetical protein ZEAMMB73_448859 [Zea mays]
Length=435

 Score = 67.0 bits (162),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = +1

Query  334  GKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKV  486
            G  +  R+YQVW+GSN+F   GR IFGPDV S+FL+M LI  P   FC+ V
Sbjct  10   GAGEQPRVYQVWRGSNEFFLQGRFIFGPDVRSVFLTMFLIIAPVVVFCVFV  60



>ref|XP_010927410.1| PREDICTED: protein S-acyltransferase 8-like isoform X4 [Elaeis 
guineensis]
Length=329

 Score = 66.6 bits (161),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = +1

Query  349  KRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKH  504
            KR+YQ WK  NKF+FGGRLIFGPD  SLF+S+ LI  P   FCI V  ++ H
Sbjct  3    KRVYQDWKARNKFVFGGRLIFGPDARSLFISVSLILVPVAIFCIFVARHLLH  54



>ref|XP_010927409.1| PREDICTED: protein S-acyltransferase 8-like isoform X3 [Elaeis 
guineensis]
Length=334

 Score = 66.6 bits (161),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = +1

Query  349  KRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKH  504
            KR+YQ WK  NKF+FGGRLIFGPD  SLF+S+ LI  P   FCI V  ++ H
Sbjct  3    KRVYQDWKARNKFVFGGRLIFGPDARSLFISVSLILVPVAIFCIFVARHLLH  54



>ref|XP_010520765.1| PREDICTED: protein S-acyltransferase 8-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010520766.1| PREDICTED: protein S-acyltransferase 8-like isoform X2 [Tarenaya 
hassleriana]
 ref|XP_010520767.1| PREDICTED: protein S-acyltransferase 8-like isoform X1 [Tarenaya 
hassleriana]
Length=428

 Score = 67.0 bits (162),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +1

Query  349  KRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKHH  507
            KR+Y+ WKGSNKF+ GGRLIFGPD  SL  ++LLI  P   FC+ V  +++H 
Sbjct  3    KRVYEAWKGSNKFILGGRLIFGPDARSLPFTLLLIIVPVILFCVFVARHLRHE  55



>ref|XP_002444861.1| hypothetical protein SORBIDRAFT_07g000430 [Sorghum bicolor]
 gb|EES14356.1| hypothetical protein SORBIDRAFT_07g000430 [Sorghum bicolor]
Length=409

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 37/60 (62%), Gaps = 0/60 (0%)
 Frame = +1

Query  325  MAQGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKH  504
            MA  K K +R+YQVWKG N  L GGR IFGPD  +  +S  LIA P   FC+ V  N+ H
Sbjct  1    MATPKHKQRRVYQVWKGKNIILCGGRFIFGPDAKATLISFALIAIPVAVFCVFVARNLIH  60



>dbj|BAB11529.1| unnamed protein product [Arabidopsis thaliana]
Length=339

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = +1

Query  352  RLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKV  486
            R Y+ WKG+N+F  GGRLIFGPDV+SL+L+  LI  PA  FCI++
Sbjct  37   RFYKAWKGNNRFCCGGRLIFGPDVSSLYLTSFLIGAPALTFCIRM  81



>gb|KDO39204.1| hypothetical protein CISIN_1g014495mg [Citrus sinensis]
Length=423

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +1

Query  325  MAQGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKV  486
            +    ++  RLY+VWKG+N+F  GGRLIFGPDV S+FL++ LI  P   FC+ V
Sbjct  17   IIDSNSETLRLYEVWKGTNRFCCGGRLIFGPDVRSIFLTLFLIVTPVILFCVFV  70



>ref|XP_002444687.1| hypothetical protein SORBIDRAFT_07g026030 [Sorghum bicolor]
 gb|EES14182.1| hypothetical protein SORBIDRAFT_07g026030 [Sorghum bicolor]
Length=434

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = +1

Query  334  GKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKV  486
            G  +  R+YQVW+GSN+F   GR IFGPDV S+FL+M LI  P   FC+ V
Sbjct  10   GAGEQPRVYQVWRGSNEFFLQGRFIFGPDVRSVFLTMFLIIAPVVVFCVFV  60



>ref|XP_006487580.1| PREDICTED: probable protein S-acyltransferase 7-like isoform 
X1 [Citrus sinensis]
 ref|XP_006487581.1| PREDICTED: probable protein S-acyltransferase 7-like isoform 
X2 [Citrus sinensis]
Length=423

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +1

Query  325  MAQGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKV  486
            +    ++  RLY+VWKG+N+F  GGRLIFGPDV S+FL++ LI  P   FC+ V
Sbjct  17   IIDSNSETLRLYEVWKGTNRFCCGGRLIFGPDVRSIFLTLFLIVTPVILFCVFV  70



>ref|XP_010250340.1| PREDICTED: protein S-acyltransferase 8-like isoform X2 [Nelumbo 
nucifera]
Length=372

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 44/65 (68%), Gaps = 1/65 (2%)
 Frame = +1

Query  349  KRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKHH-KDGSSW  525
            KR+Y+ WKGSNKF  GGRLIFGPD  SL +++LLI  P   FC  V  +++H  +  ++ 
Sbjct  3    KRVYEAWKGSNKFFCGGRLIFGPDARSLIVTVLLILVPVIIFCTLVARHLRHEFRSYNAG  62

Query  526  YPILL  540
            Y IL+
Sbjct  63   YAILV  67



>ref|XP_003578979.1| PREDICTED: probable protein S-acyltransferase 1 [Brachypodium 
distachyon]
Length=466

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 43/68 (63%), Gaps = 2/68 (3%)
 Frame = +1

Query  289  LVLPSSNSQV*LMAQGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPAT  468
            +++PSS ++  L    + + KRLYQ WKG+N FL GGRLI G D  SL L+  LI GPA 
Sbjct  1    MMVPSSEAE--LPTSTQQQPKRLYQAWKGNNIFLCGGRLILGRDAPSLLLTTFLIVGPAI  58

Query  469  AFCIKVYS  492
             FC  + S
Sbjct  59   VFCYHMQS  66



>ref|XP_010433788.1| PREDICTED: protein S-acyltransferase 8-like [Camelina sativa]
Length=256

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +1

Query  349  KRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKHH  507
            KR+++ WKGSNKF+ GGRLIFGPD  SL  ++LLI  P   FC+ V  +++H 
Sbjct  3    KRVFEAWKGSNKFILGGRLIFGPDARSLPATLLLIIVPVALFCVFVARHLRHE  55



>ref|XP_001757201.1| predicted protein [Physcomitrella patens]
 gb|EDQ78060.1| predicted protein [Physcomitrella patens]
Length=437

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +1

Query  349  KRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKHH  507
            +R+YQVWKGSN+F   GRLIFGPDV SL +++ LI  P+  FC  V  ++ HH
Sbjct  3    QRVYQVWKGSNRFFLCGRLIFGPDVRSLAVTIFLIVAPSVCFCNFVGRHLLHH  55



>ref|XP_010680305.1| PREDICTED: protein S-acyltransferase 8-like [Beta vulgaris subsp. 
vulgaris]
Length=407

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = +1

Query  349  KRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKH  504
            KR+YQ WKGSN FL  GRLIFGPD  SL +S+LLI  P+  FC  V SN+ H
Sbjct  3    KRVYQAWKGSNIFLCNGRLIFGPDARSLTVSVLLILVPSVIFCTFVASNLLH  54



>ref|XP_006645080.1| PREDICTED: protein S-acyltransferase 8-like [Oryza brachyantha]
Length=418

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = +1

Query  340  AKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKHH  507
            A+ +R+Y+ WKG+N+F FGGRLIFGPD  SL  S+ LI  P   FC  V  +++H 
Sbjct  2    AQPQRVYEAWKGNNRFFFGGRLIFGPDAKSLLFSVALIVVPVVIFCAFVARHLRHQ  57



>gb|ABK24698.1| unknown [Picea sitchensis]
Length=442

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 43/65 (66%), Gaps = 1/65 (2%)
 Frame = +1

Query  346  VKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKHHKDG-SS  522
             KR+YQVWKGSNKF   GRLIFGPDV SL +++ LI  P   FC+ V   + H+  G +S
Sbjct  2    AKRVYQVWKGSNKFFLCGRLIFGPDVRSLVVTVFLIVIPVVIFCVFVAGKLLHNFPGYNS  61

Query  523  WYPIL  537
             Y IL
Sbjct  62   GYAIL  66



>ref|XP_002532773.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF29612.1| zinc finger protein, putative [Ricinus communis]
Length=350

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = +1

Query  349  KRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKHH  507
            K +YQVWKG N FLF GRLIFGPD  SL +++LLI  P   FC  V  N+ H 
Sbjct  3    KLVYQVWKGRNIFLFNGRLIFGPDAKSLVVTILLIVVPVIIFCTNVAKNLLHE  55



>ref|NP_001062355.1| Os08g0535400 [Oryza sativa Japonica Group]
 dbj|BAD01220.1| putative DHHC-type zinc finger domain-containing protein [Oryza 
sativa Japonica Group]
 dbj|BAD13105.1| putative DHHC-type zinc finger domain-containing protein [Oryza 
sativa Japonica Group]
 dbj|BAF24269.1| Os08g0535400 [Oryza sativa Japonica Group]
 dbj|BAG92543.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AEP20521.1| DHHC-type zinc finger domain-containing protein [Oryza sativa 
Japonica Group]
Length=416

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +1

Query  352  RLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKV  486
            R+YQVW+GSN+F   GR IFGPDV S+FL+M LI  P  AFC+ V
Sbjct  21   RVYQVWRGSNEFFLRGRFIFGPDVRSIFLTMFLIVAPVVAFCVFV  65



>ref|XP_010250335.1| PREDICTED: protein S-acyltransferase 8-like isoform X1 [Nelumbo 
nucifera]
Length=420

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 44/65 (68%), Gaps = 1/65 (2%)
 Frame = +1

Query  349  KRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKHH-KDGSSW  525
            KR+Y+ WKGSNKF  GGRLIFGPD  SL +++LLI  P   FC  V  +++H  +  ++ 
Sbjct  3    KRVYEAWKGSNKFFCGGRLIFGPDARSLIVTVLLILVPVIIFCTLVARHLRHEFRSYNAG  62

Query  526  YPILL  540
            Y IL+
Sbjct  63   YAILV  67



>ref|XP_007204900.1| hypothetical protein PRUPE_ppa006532mg [Prunus persica]
 gb|EMJ06099.1| hypothetical protein PRUPE_ppa006532mg [Prunus persica]
Length=407

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 42/62 (68%), Gaps = 1/62 (2%)
 Frame = +1

Query  352  RLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPATAFCIKVYSNIKHHKDGSSWYP  531
            RLY VW+G+NKFL GGR++FG D ASLFL+  LI  PA  FCI++   +K    G   YP
Sbjct  19   RLYLVWQGNNKFLCGGRIVFGHDAASLFLTSFLIGCPALTFCIRMLVTMKGEH-GHYDYP  77

Query  532  IL  537
            +L
Sbjct  78   VL  79



>ref|XP_009346802.1| PREDICTED: probable protein S-acyltransferase 7 [Pyrus x bretschneideri]
Length=449

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 41/73 (56%), Gaps = 0/73 (0%)
 Frame = +1

Query  289  LVLPSSNSQV*LMAQGKAKVKRLYQVWKGSNKFLFGGRLIFGPDVASLFLSMLLIAGPAT  468
            +V P   S     + G A   R+YQ WKGSN F F GR +FGPDV SL L++ LI  P T
Sbjct  3    VVPPPQRSDPASGSAGAADDLRVYQNWKGSNIFFFEGRFVFGPDVRSLGLTIFLIVAPVT  62

Query  469  AFCIKVYSNIKHH  507
             FCI V   +  H
Sbjct  63   IFCIFVARKLMDH  75



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 856559115090