BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002C09

Length=245
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

pdb|2VB2|X  Chain X, Crystal Structure Of Cu(I)cusf                   81.6    7e-18   Escherichia coli BL21(DE3)
ref|WP_032233950.1|  copper-binding protein                           80.9    7e-18   
pdb|3E6Z|X  Chain X, 1.0 A Structure Of Cusf-W44a-Cu(Ii) Residues...  81.3    8e-18   Escherichia coli [E. coli]
gb|EGJ94078.1|  cation efflux system protein cusF                     80.5    8e-18   Shigella flexneri K-671
gb|EJL17496.1|  periplasmic copper/silver-binding protein             81.3    8e-18   Shigella flexneri 6603-63
pdb|1ZEQ|X  Chain X, 1.5 A Structure Of Apo-Cusf Residues 6-88 Fr...  81.3    9e-18   Escherichia coli [E. coli]
pdb|2QCP|X  Chain X, 1.0 A Structure Of Cusf-Ag(I) Residues 10-88...  81.3    9e-18   Escherichia coli str. K-12 substr. W3110
ref|WP_001305544.1|  cation transporter                               80.1    9e-18   
ref|WP_044721049.1|  copper-binding protein                           82.0    9e-18   Escherichia coli [E. coli]
ref|WP_032320208.1|  copper-binding protein                           81.6    1e-17   Shigella flexneri
ref|WP_000709884.1|  cation transporter                               81.6    1e-17   Escherichia coli [E. coli]
ref|WP_000709876.1|  MULTISPECIES: cation transporter                 81.6    1e-17   Escherichia
ref|WP_032204746.1|  copper-binding protein                           81.6    1e-17   Escherichia coli [E. coli]
ref|WP_040077517.1|  copper-binding protein                           81.6    1e-17   Escherichia coli [E. coli]
ref|WP_038340318.1|  copper-binding protein                           81.6    1e-17   Escherichia coli [E. coli]
gb|KFH77770.1|  copper-binding protein                                81.6    1e-17   Escherichia coli [E. coli]
ref|WP_001601831.1|  cation efflux system protein CusF                81.6    1e-17   Escherichia coli [E. coli]
ref|WP_000709877.1|  MULTISPECIES: cation transporter                 81.6    1e-17   Enterobacteriaceae
ref|WP_032280454.1|  copper-binding protein                           81.6    1e-17   Escherichia coli [E. coli]
ref|WP_021525579.1|  cation efflux system protein CusF                81.6    1e-17   Escherichia coli [E. coli]
ref|WP_001612578.1|  cation efflux system protein CusF                81.6    1e-17   Escherichia coli [E. coli]
ref|WP_000709859.1|  cation transporter                               81.6    1e-17   Escherichia coli [E. coli]
gb|KFH94591.1|  copper-binding protein                                81.6    1e-17   Escherichia coli [E. coli]
ref|WP_000709886.1|  cation transporter                               81.6    1e-17   Escherichia fergusonii
ref|WP_032205806.1|  copper-binding protein                           81.6    1e-17   Escherichia coli [E. coli]
ref|WP_016244363.1|  cation efflux system protein CusF                81.6    1e-17   Escherichia coli [E. coli]
ref|WP_000709863.1|  cation transporter                               81.6    1e-17   Escherichia coli [E. coli]
ref|WP_000709860.1|  cation transporter                               81.6    1e-17   Enterobacteriaceae
ref|WP_042961724.1|  copper-binding protein                           81.6    1e-17   
ref|WP_029401572.1|  copper-binding protein                           81.6    1e-17   Escherichia coli [E. coli]
ref|WP_033807665.1|  copper-binding protein                           81.6    1e-17   Escherichia coli [E. coli]
ref|WP_001381846.1|  cation efflux system protein CusF                81.6    1e-17   Escherichia coli [E. coli]
ref|WP_001576958.1|  cation efflux system protein CusF                81.6    1e-17   Escherichia coli [E. coli]
ref|WP_000709858.1|  cation transporter                               81.6    1e-17   Escherichia coli [E. coli]
ref|WP_000709873.1|  MULTISPECIES: cation transporter                 81.6    1e-17   Enterobacteriaceae
ref|WP_000709870.1|  MULTISPECIES: periplasmic copper- and silver...  81.6    1e-17   Enterobacteriaceae
ref|WP_000709865.1|  cation transporter                               81.6    1e-17   Enterobacteriaceae
ref|WP_000709864.1|  cation efflux system protein CusF                81.6    1e-17   Escherichia coli [E. coli]
ref|WP_033868452.1|  copper-binding protein                           81.6    1e-17   Escherichia coli [E. coli]
ref|WP_001224007.1|  cation transporter                               81.6    1e-17   Escherichia coli [E. coli]
ref|WP_024243600.1|  copper-binding protein                           81.6    1e-17   Escherichia coli [E. coli]
ref|WP_001487014.1|  cation efflux system protein CusF                81.6    1e-17   Escherichia coli [E. coli]
gb|KFH90026.1|  copper-binding protein                                81.6    1e-17   Escherichia coli [E. coli]
ref|WP_023156492.1|  cation efflux system protein CusF                81.6    1e-17   Escherichia coli [E. coli]
ref|WP_000753226.1|  MULTISPECIES: cation transporter                 81.6    1e-17   Escherichia
ref|WP_000709881.1|  cation transporter                               81.6    1e-17   Escherichia coli [E. coli]
gb|EHU13917.1|  periplasmic copper/silver-binding protein             81.3    1e-17   Escherichia coli DEC1A
ref|WP_001597667.1|  cation efflux system protein CusF                81.6    1e-17   Escherichia coli [E. coli]
ref|WP_001558773.1|  cation efflux system protein CusF                81.6    1e-17   Escherichia coli [E. coli]
ref|WP_001522508.1|  cation efflux system protein CusF                81.6    1e-17   Enterobacteriaceae
gb|EKI42802.1|  cation efflux system protein CusF                     81.3    1e-17   Escherichia coli 3006
ref|WP_000709861.1|  cation efflux system protein CusF                81.3    1e-17   Escherichia coli [E. coli]
gb|ENG06681.1|  cation efflux system protein CusF                     81.3    1e-17   Escherichia coli P0305260.3
ref|WP_001462306.1|  cation efflux system protein CusF                81.3    1e-17   Escherichia coli [E. coli]
ref|WP_033557456.1|  copper-binding protein                           81.3    1e-17   Escherichia coli [E. coli]
ref|WP_032183576.1|  copper-binding protein                           81.3    1e-17   Escherichia
ref|WP_000709880.1|  MULTISPECIES: cation transporter                 81.3    1e-17   Proteobacteria [purple bacteria]
ref|WP_021540815.1|  cation efflux system protein CusF                81.3    1e-17   Escherichia coli [E. coli]
gb|KFI00403.1|  copper-binding protein                                81.3    1e-17   Escherichia coli [E. coli]
ref|WP_000709879.1|  MULTISPECIES: cation transporter                 81.3    1e-17   Enterobacteriaceae
ref|WP_000709871.1|  cation efflux system protein CusF                81.3    1e-17   Escherichia sp. TW14182
ref|WP_000709885.1|  cation transporter                               81.3    1e-17   Escherichia coli [E. coli]
gb|KFH78617.1|  copper-binding protein                                81.3    1e-17   Escherichia coli [E. coli]
ref|WP_001479112.1|  cation efflux system protein CusF                81.3    1e-17   Escherichia coli [E. coli]
ref|WP_000709878.1|  cation transporter                               81.3    1e-17   Escherichia coli [E. coli]
gb|EGW77147.1|  cation efflux system protein cusF                     81.3    1e-17   Escherichia coli 2534-86
ref|WP_000709882.1|  MULTISPECIES: cation transporter                 81.3    1e-17   Shigella
ref|WP_001398748.1|  cation efflux system protein CusF                81.3    1e-17   Escherichia coli [E. coli]
ref|WP_021575043.1|  cation efflux system protein CusF                81.3    2e-17   Escherichia coli [E. coli]
ref|WP_000709883.1|  cation transporter                               81.3    2e-17   Shigella
ref|WP_000753225.1|  cation transporter                               80.9    2e-17   Escherichia
ref|WP_032256123.1|  copper-binding protein                           80.1    5e-17   Escherichia coli [E. coli]
gb|EHN99611.1|  hypothetical protein ESPG_01722                       78.2    5e-17   Escherichia coli H397
gb|KGM73041.1|  Periplasmic copper-binding protein                    80.1    5e-17   Escherichia coli [E. coli]
ref|WP_001561598.1|  cation efflux system protein CusF                79.7    6e-17   Escherichia coli [E. coli]
ref|WP_000709862.1|  cation efflux system protein CusF                79.7    6e-17   Escherichia
ref|WP_000709872.1|  MULTISPECIES: cation efflux system protein CusF  79.7    6e-17   Escherichia
ref|WP_001224008.1|  cation transporter                               79.7    6e-17   Enterobacteriaceae
ref|WP_000709869.1|  cation transporter                               79.7    6e-17   Escherichia coli [E. coli]
ref|WP_001400041.1|  cation efflux system protein CusF                79.7    6e-17   Escherichia coli [E. coli]
ref|WP_032170876.1|  copper-binding protein                           79.7    6e-17   Escherichia coli [E. coli]
ref|WP_034173308.1|  copper-binding protein                           79.7    7e-17   Escherichia coli [E. coli]
ref|WP_029400252.1|  copper-binding protein                           79.7    7e-17   Escherichia coli [E. coli]
ref|WP_016159133.1|  MULTISPECIES: cation efflux system protein CusF  79.7    7e-17   Escherichia
ref|WP_021550393.1|  cation efflux system protein CusF                79.7    7e-17   Escherichia
ref|WP_001717824.1|  cation efflux system protein CusF                79.7    7e-17   Escherichia coli [E. coli]
ref|WP_000753227.1|  cation efflux system protein CusF                79.3    7e-17   Escherichia
ref|WP_033554945.1|  copper-binding protein                           79.3    7e-17   Escherichia coli [E. coli]
ref|WP_000709867.1|  cation efflux system protein CusF                79.3    8e-17   Escherichia
ref|WP_000709874.1|  MULTISPECIES: cation transporter                 79.3    8e-17   Enterobacteriaceae
gb|EKI45674.1|  cation efflux system protein CusF                     79.3    8e-17   Escherichia coli 07798
ref|WP_044712089.1|  copper-binding protein                           79.3    8e-17   Escherichia albertii
ref|WP_001357854.1|  cation transporter                               79.3    8e-17   Escherichia
ref|WP_042003289.1|  copper-binding protein                           79.3    8e-17   Escherichia coli [E. coli]
ref|WP_021531109.1|  cation efflux system protein CusF                79.3    8e-17   Escherichia coli [E. coli]
ref|WP_001700488.1|  cation efflux system protein CusF                79.3    8e-17   Escherichia coli [E. coli]
ref|WP_001668456.1|  cation efflux system protein CusF                79.3    9e-17   Escherichia coli [E. coli]
ref|WP_044067106.1|  copper-binding protein                           79.3    1e-16   Enterobacteriaceae
ref|WP_000709866.1|  cation transporter                               78.6    1e-16   Escherichia coli [E. coli]
ref|WP_032084404.1|  copper-binding protein                           78.6    2e-16   Escherichia coli [E. coli]
ref|WP_000709868.1|  cation transporter                               78.2    2e-16   Escherichia coli [E. coli]
gb|EIP36888.1|  cation efflux system protein CusF                     78.2    2e-16   Escherichia coli EC4013
ref|WP_000709875.1|  cation transporter                               78.2    3e-16   Enterobacteriaceae
gb|EMV42379.1|  cation efflux system protein CusF                     77.8    3e-16   Escherichia coli 2875000
ref|WP_001708729.1|  cation efflux system protein CusF                77.8    3e-16   Escherichia coli [E. coli]
gb|ETJ27596.1|  Cation efflux system protein CusF                     77.8    3e-16   Escherichia coli DORA_A_5_14_21
ref|WP_024216681.1|  copper-binding protein                           77.8    4e-16   Escherichia coli [E. coli]
ref|WP_038355225.1|  copper-binding protein                           77.4    4e-16   Escherichia marmotae
gb|KHH47113.1|  copper-binding protein                                77.4    5e-16   Escherichia coli [E. coli]
gb|AAW63704.1|  unknown                                               74.3    6e-15   Citrobacter sp. MY-5
ref|WP_012133441.1|  copper-binding protein                           64.7    3e-11   
gb|KGY20539.1|  copper-binding protein                                64.7    3e-11   
ref|WP_041143858.1|  copper-binding protein                           64.3    5e-11   Raoultella ornithinolytica
ref|WP_043001508.1|  copper-binding protein                           63.5    8e-11   Citrobacter sp. MGH 55
ref|WP_044256696.1|  MULTISPECIES: copper-binding protein             63.5    8e-11   Gammaproteobacteria
ref|WP_042320897.1|  copper-binding protein                           62.8    2e-10   Citrobacter farmeri
ref|WP_032698007.1|  copper-binding protein                           62.4    2e-10   Raoultella
gb|KFD13643.1|  CusF family cation efflux system protein              62.4    2e-10   Raoultella planticola ATCC 33531
ref|WP_044348423.1|  copper-binding protein                           62.4    3e-10   Raoultella ornithinolytica
ref|WP_015585239.1|  MULTISPECIES: periplasmic copper-binding pro...  62.0    3e-10   Enterobacteriaceae
ref|WP_023565969.1|  periplasmic copper-binding protein               59.7    6e-10   Escherichia coli [E. coli]
ref|WP_032689703.1|  copper-binding protein                           60.8    9e-10   Raoultella ornithinolytica
ref|WP_023296988.1|  Cu(I)/Ag(I) efflux system periplasmic protei...  60.1    2e-09   Enterobacteriaceae
ref|WP_025714123.1|  copper-binding protein                           60.1    2e-09   Klebsiella sp. 10982
ref|WP_012543002.1|  copper-binding protein                           60.1    2e-09   Klebsiella variicola
gb|AIE01540.1|  copper-binding protein                                59.7    2e-09   Klebsiella variicola
ref|WP_008807070.1|  copper-binding protein                           59.7    2e-09   Klebsiella variicola
ref|WP_023323569.1|  Cu(I)/Ag(I) efflux system periplasmic protei...  59.7    2e-09   Klebsiella
ref|WP_004206718.1|  periplasmic copper-binding protein               59.7    3e-09   Klebsiella
ref|WP_032418103.1|  copper-binding protein                           59.7    3e-09   Klebsiella pneumoniae
ref|WP_022064527.1|  cation efflux system protein CusF                59.7    3e-09   
ref|WP_032731860.1|  MULTISPECIES: copper-binding protein             59.7    3e-09   Klebsiella
emb|CDL61891.1|  Cation efflux system protein CusF precursor          58.5    3e-09   Klebsiella pneumoniae IS39
ref|WP_040245722.1|  copper-binding protein                           59.3    3e-09   Klebsiella pneumoniae
ref|WP_012969046.1|  copper-binding protein                           59.3    3e-09   Klebsiella variicola
ref|WP_016160208.1|  hypothetical protein                             59.3    3e-09   Klebsiella
ref|WP_032736753.1|  MULTISPECIES: copper-binding protein             59.3    3e-09   Klebsiella
ref|WP_042894147.1|  copper-binding protein                           59.3    3e-09   Klebsiella aerogenes
ref|WP_023342515.1|  Cu(I)/Ag(I) efflux system periplasmic protei...  59.3    3e-09   Klebsiella pneumoniae
emb|CDL50139.1|  Cation efflux system protein CusF precursor          58.9    3e-09   Klebsiella pneumoniae ISC21
ref|WP_032740383.1|  MULTISPECIES: copper-binding protein             59.3    3e-09   Klebsiella
gb|EJK92704.1|  periplasmic copper-binding protein                    58.9    3e-09   Klebsiella pneumoniae subsp. pneumoniae DSM 30104
ref|WP_023291814.1|  MULTISPECIES: Cu(I)/Ag(I) efflux system peri...  59.3    3e-09   Klebsiella
emb|CDL09419.1|  Cation efflux system protein CusF precursor          58.9    3e-09   Klebsiella pneumoniae IS43
gb|ESN46144.1|  Cu(I)/Ag(I) efflux system periplasmic protein CusF    59.3    3e-09   Klebsiella variicola
ref|WP_021441118.1|  cation efflux system protein CusF precursor      59.3    4e-09   Klebsiella
ref|WP_004894569.1|  periplasmic copper-binding protein               59.3    4e-09   Klebsiella pneumoniae
ref|WP_044245279.1|  copper-binding protein                           59.3    4e-09   Klebsiella pneumoniae
ref|WP_032433444.1|  copper-binding protein                           59.3    4e-09   Klebsiella pneumoniae
ref|WP_017900885.1|  copper-binding protein                           59.3    4e-09   Klebsiella
ref|WP_004186842.1|  copper-binding protein                           59.3    4e-09   Klebsiella pneumoniae
ref|WP_016529489.1|  periplasmic copper-binding protein               58.9    4e-09   
ref|WP_040148409.1|  copper-binding protein                           59.3    4e-09   Klebsiella pneumoniae
ref|WP_021462623.1|  copper-binding protein                           59.3    4e-09   Enterobacteriaceae
ref|WP_032105401.1|  copper-binding protein                           59.3    4e-09   Klebsiella pneumoniae
ref|WP_015368490.1|  Cation efflux system protein CusF precursor      59.3    4e-09   Enterobacteriaceae
ref|WP_040175037.1|  copper-binding protein                           59.3    4e-09   Klebsiella pneumoniae
ref|WP_023313901.1|  Cu(I)/Ag(I) efflux system periplasmic protei...  59.3    4e-09   Klebsiella pneumoniae
gb|EKB81124.1|  hypothetical protein HMPREF1306_00373                 59.3    4e-09   Klebsiella pneumoniae subsp. pneumoniae WGLW2
ref|WP_032420886.1|  copper-binding protein                           59.3    4e-09   Klebsiella pneumoniae
ref|WP_025983237.1|  copper-binding protein                           59.3    4e-09   Enterobacteriaceae
ref|WP_023287080.1|  Cu(I)/Ag(I) efflux system periplasmic protei...  59.3    4e-09   Klebsiella pneumoniae
ref|WP_004197273.1|  cation efflux system protein CusF                59.3    4e-09   Klebsiella
ref|WP_015959364.1|  copper-binding protein                           59.3    4e-09   Klebsiella pneumoniae
ref|WP_025368487.1|  copper-binding protein                           58.9    4e-09   Klebsiella
ref|WP_025862174.1|  copper-binding protein                           58.9    4e-09   Klebsiella
gb|EKB63352.1|  hypothetical protein HMPREF1305_04523                 59.3    4e-09   Klebsiella pneumoniae subsp. pneumoniae WGLW1
gb|KDL12233.1|  hypothetical protein AF38_05168                       58.9    4e-09   Klebsiella pneumoniae MGH 52
ref|WP_015704246.1|  copper-binding protein                           58.9    4e-09   Klebsiella aerogenes
ref|WP_038808522.1|  copper-binding protein                           58.9    4e-09   Klebsiella pneumoniae
gb|EWE05867.1|  Cu(I)/Ag(I) efflux system periplasmic protein CusF    58.9    4e-09   Klebsiella pneumoniae BIDMC 47
ref|WP_044650381.1|  copper-binding protein                           58.9    4e-09   Klebsiella
ref|WP_004192220.1|  MULTISPECIES: copper-binding protein             58.9    4e-09   Enterobacteriaceae
gb|KHF68784.1|  copper-binding protein                                58.9    4e-09   Klebsiella pneumoniae
gb|EGF63421.1|  cation efflux system protein CusF                     58.9    4e-09   Klebsiella sp. MS 92-3
ref|WP_004214146.1|  MULTISPECIES: periplasmic copper-binding pro...  58.9    4e-09   Klebsiella
ref|WP_023317482.1|  Cu(I)/Ag(I) efflux system periplasmic protei...  58.9    4e-09   Klebsiella pneumoniae
ref|WP_020079739.1|  copper-binding protein                           58.9    4e-09   Klebsiella aerogenes
ref|WP_004222368.1|  copper-binding protein                           58.9    4e-09   Klebsiella
ref|WP_032715529.1|  copper-binding protein                           58.9    5e-09   Klebsiella aerogenes
gb|KHF54506.1|  copper-binding protein                                58.9    5e-09   Klebsiella pneumoniae
gb|KGT63428.1|  cation efflux system protein CusF                     58.9    5e-09   Klebsiella pneumoniae MRSN 1319
ref|WP_025987660.1|  copper-binding protein                           58.9    5e-09   Klebsiella
ref|WP_021314307.1|  copper-binding protein                           58.9    5e-09   Klebsiella pneumoniae
ref|WP_002887266.1|  copper-binding protein                           58.5    5e-09   Enterobacteriaceae
gb|EWF66303.1|  Cu(I)/Ag(I) efflux system periplasmic protein CusF    58.5    5e-09   Klebsiella pneumoniae MGH 35
ref|WP_032432083.1|  copper-binding protein                           58.5    6e-09   Klebsiella pneumoniae
ref|WP_040183256.1|  copper-binding protein                           58.5    6e-09   Klebsiella pneumoniae
ref|WP_032456949.1|  copper-binding protein                           58.5    6e-09   Enterobacteriaceae
ref|WP_040903073.1|  copper-binding protein                           58.5    6e-09   Yokenella regensburgei
gb|EHM50332.1|  cation efflux system protein CusF                     58.5    6e-09   Yokenella regensburgei ATCC 43003
ref|WP_012737331.1|  copper-binding protein                           57.0    2e-08   Enterobacteriaceae
ref|WP_004872501.1|  copper-binding protein                           57.0    2e-08   Klebsiella pneumoniae
ref|WP_032713604.1|  copper-binding protein                           57.0    3e-08   Klebsiella aerogenes
ref|WP_023177625.1|  periplasmic copper-binding protein               57.0    3e-08   Salmonella enterica
ref|WP_000559535.1|  hypothetical protein                             56.6    3e-08   Salmonella enterica
ref|WP_038253833.1|  copper-binding protein                           56.6    3e-08   Yokenella regensburgei
gb|KFD24617.1|  CusF family cation efflux system protein              56.6    3e-08   Yokenella regensburgei ATCC 49455
ref|WP_043015501.1|  copper-binding protein                           55.8    5e-08   Citrobacter
ref|WP_003021945.1|  MULTISPECIES: copper-binding protein             55.8    6e-08   Citrobacter
ref|WP_016149747.1|  MULTISPECIES: periplasmic copper-binding pro...  55.8    6e-08   Enterobacteriaceae
ref|WP_003831139.1|  copper-binding protein                           55.8    6e-08   Citrobacter portucalensis
ref|WP_008784023.1|  copper-binding protein                           55.8    6e-08   Citrobacter portucalensis
ref|WP_032942611.1|  copper-binding protein                           55.8    6e-08   Citrobacter portucalensis
ref|WP_032709759.1|  copper-binding protein                           55.5    9e-08   Klebsiella aerogenes
ref|WP_042285728.1|  copper-binding protein                           55.1    1e-07   Citrobacter sedlakii
ref|WP_023182882.1|  periplasmic copper-binding protein               55.1    1e-07   Salmonella enterica
ref|WP_006685618.1|  copper-binding protein                           54.7    2e-07   Citrobacter youngae
ref|WP_038638538.1|  copper-binding protein                           54.7    2e-07   Citrobacter freundii
ref|WP_042309919.1|  copper-binding protein                           54.3    2e-07   Enterobacteriaceae
ref|WP_016155925.1|  periplasmic copper-binding protein               53.9    3e-07   Enterobacteriaceae
ref|WP_003835715.1|  periplasmic copper-binding protein               53.9    3e-07   Citrobacter freundii
ref|WP_003847477.1|  periplasmic copper-binding protein               53.5    4e-07   Citrobacter freundii
gb|EIQ79192.1|  cation efflux system protein CusF                     53.1    4e-07   Shigella flexneri 1235-66
ref|WP_040232621.1|  copper-binding protein                           53.5    4e-07   Citrobacter pasteurii
gb|KHE09672.1|  copper-binding protein                                52.8    7e-07   Citrobacter braakii
ref|WP_016152151.1|  MULTISPECIES: periplasmic copper-binding pro...  52.8    8e-07   Citrobacter
ref|WP_015062723.1|  Cation efflux system protein CusF precursor      48.5    2e-05   Salmonella
emb|CDL28814.1|  Cation efflux system protein CusF precursor          48.1    3e-05   Escherichia coli ISC7
ref|WP_035891064.1|  hypothetical protein                             46.2    1e-04   Kluyvera ascorbata
ref|WP_039031776.1|  copper-binding protein                           46.2    1e-04   Leclercia adecarboxylata
ref|WP_035600913.1|  copper ABC transporter substrate-binding pro...  44.3    8e-04   Edwardsiella tarda



>pdb|2VB2|X Chain X, Crystal Structure Of Cu(I)cusf
 pdb|2VB3|X Chain X, Crystal Structure Of Ag(I)cusf
Length=88

 Score = 81.6 bits (200),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 39/40 (98%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSL QDIKVSQ
Sbjct  49   MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ  88



>ref|WP_032233950.1| copper-binding protein, partial [Escherichia coli]
Length=63

 Score = 80.9 bits (198),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 39/40 (98%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSL QDIKVSQ
Sbjct  24   MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ  63



>pdb|3E6Z|X Chain X, 1.0 A Structure Of Cusf-W44a-Cu(Ii) Residues 10-88 From 
Escherichia Coli
Length=80

 Score = 81.3 bits (199),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 39/40 (98%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSL QDIKVSQ
Sbjct  41   MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ  80



>gb|EGJ94078.1| cation efflux system protein cusF [Shigella flexneri K-671]
Length=42

 Score = 80.5 bits (197),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 39/40 (98%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSL QDIKVSQ
Sbjct  3    MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ  42



>gb|EJL17496.1| periplasmic copper/silver-binding protein [Shigella flexneri 
6603-63]
Length=81

 Score = 81.3 bits (199),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 39/40 (98%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSL QDIKVSQ
Sbjct  42   MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ  81



>pdb|1ZEQ|X Chain X, 1.5 A Structure Of Apo-Cusf Residues 6-88 From Escherichia 
Coli
Length=84

 Score = 81.3 bits (199),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 39/40 (98%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSL QDIKVSQ
Sbjct  45   MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ  84



>pdb|2QCP|X Chain X, 1.0 A Structure Of Cusf-Ag(I) Residues 10-88 From Escherichia 
Coli
Length=80

 Score = 81.3 bits (199),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 39/40 (98%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSL QDIKVSQ
Sbjct  41   MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ  80



>ref|WP_001305544.1| cation transporter [Escherichia coli]
 gb|EHP67516.1| cation efflux system protein CusF [Escherichia coli 4_1_47FAA]
Length=40

 Score = 80.1 bits (196),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 39/40 (98%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSL QDIKVSQ
Sbjct  1    MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ  40



>ref|WP_044721049.1| copper-binding protein [Escherichia coli]
Length=110

 Score = 82.0 bits (201),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 39/40 (98%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSL QDIKVSQ
Sbjct  71   MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ  110



>ref|WP_032320208.1| copper-binding protein [Shigella flexneri]
Length=108

 Score = 81.6 bits (200),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/40 (98%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSL QDIKVSQ
Sbjct  69   MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ  108



>ref|WP_000709884.1| cation transporter [Escherichia coli]
 gb|EIL01965.1| periplasmic copper-binding protein [Escherichia coli O103:H25 
str. CVM9340]
 gb|EYX84287.1| copper-binding protein [Escherichia coli O156:H25 str. 2011C-3602]
 gb|EYZ23117.1| copper-binding protein [Escherichia coli O103:H25 str. 2010C-4529]
 gb|KHH97077.1| copper-binding protein [Escherichia coli]
Length=110

 Score = 81.6 bits (200),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/40 (98%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSL QDIKVSQ
Sbjct  71   MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ  110



>ref|WP_000709876.1| MULTISPECIES: cation transporter [Escherichia]
 gb|EGB71537.1| gcusF [Escherichia coli TW10509]
Length=110

 Score = 81.6 bits (200),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/40 (98%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSL QDIKVSQ
Sbjct  71   MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ  110



>ref|WP_032204746.1| copper-binding protein [Escherichia coli]
 gb|EYZ04085.1| copper-binding protein [Escherichia coli O177:NM str. 2010C-4558]
Length=110

 Score = 81.6 bits (200),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/40 (98%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSL QDIKVSQ
Sbjct  71   MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ  110



>ref|WP_040077517.1| copper-binding protein [Escherichia coli]
 gb|KIG70800.1| copper-binding protein [Escherichia coli]
Length=110

 Score = 81.6 bits (200),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/40 (98%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSL QDIKVSQ
Sbjct  71   MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ  110



>ref|WP_038340318.1| copper-binding protein [Escherichia coli]
Length=110

 Score = 81.6 bits (200),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/40 (98%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSL QDIKVSQ
Sbjct  71   MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ  110



>gb|KFH77770.1| copper-binding protein [Escherichia coli]
Length=110

 Score = 81.6 bits (200),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/40 (98%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSL QDIKVSQ
Sbjct  71   MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ  110



>ref|WP_001601831.1| cation efflux system protein CusF [Escherichia coli]
 gb|ELG91141.1| cation efflux system protein CusF [Escherichia coli KTE146]
Length=110

 Score = 81.6 bits (200),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/40 (98%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSL QDIKVSQ
Sbjct  71   MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ  110



>ref|WP_000709877.1| MULTISPECIES: cation transporter [Escherichia]
 ref|YP_002411424.1| periplasmic copper-binding protein [Escherichia coli UMN026]
 emb|CAR11878.1| periplasmic copper-binding protein [Escherichia coli UMN026]
 gb|EFF01446.1| periplasmic copper-binding protein [Escherichia coli FVEC1412]
 gb|EFI20818.1| periplasmic copper-binding protein [Escherichia coli FVEC1302]
 gb|EFJ71350.1| cation efflux system protein CusF [Escherichia coli MS 198-1]
 gb|EGI51842.1| cation efflux system protein CusF [Escherichia coli H299]
 gb|EGW73301.1| cation efflux system protein cusF [Escherichia coli STEC_C165-02]
 gb|EIL61725.1| periplasmic copper-binding protein [Escherichia coli 576-1]
 gb|ELC02166.1| cation efflux system protein CusF [Escherichia coli KTE2]
 gb|ELC49039.1| cation efflux system protein CusF [Escherichia coli KTE26]
 gb|ELC77502.1| cation efflux system protein CusF [Escherichia coli KTE181]
 gb|ELD07954.1| cation efflux system protein CusF [Escherichia coli KTE204]
 gb|ELD23666.1| cation efflux system protein CusF [Escherichia coli KTE208]
 gb|ELD37320.1| cation efflux system protein CusF [Escherichia coli KTE213]
 gb|ELD55309.1| cation efflux system protein CusF [Escherichia coli KTE228]
 gb|ELD80843.1| cation efflux system protein CusF [Escherichia coli KTE235]
 gb|ELD84464.1| cation efflux system protein CusF [Escherichia coli KTE236]
 gb|ELD90911.1| cation efflux system protein CusF [Escherichia coli KTE237]
 gb|ELE62802.1| cation efflux system protein CusF [Escherichia coli KTE76]
 gb|ELE73854.1| cation efflux system protein CusF [Escherichia coli KTE80]
 gb|ELE84447.1| cation efflux system protein CusF [Escherichia coli KTE83]
 gb|ELF02538.1| cation efflux system protein CusF [Escherichia coli KTE116]
 gb|ELG08122.1| cation efflux system protein CusF [Escherichia coli KTE54]
 gb|ELG75039.1| cation efflux system protein CusF [Escherichia coli KTE140]
 gb|ELG85384.1| cation efflux system protein CusF [Escherichia coli KTE144]
 gb|ELH01682.1| cation efflux system protein CusF [Escherichia coli KTE158]
 gb|ELH25229.1| cation efflux system protein CusF [Escherichia coli KTE190]
 gb|ELI13127.1| cation efflux system protein CusF [Escherichia coli KTE105]
 gb|ELI48015.1| cation efflux system protein CusF [Escherichia coli KTE122]
 gb|ELI61468.1| cation efflux system protein CusF [Escherichia coli KTE128]
 gb|ELJ47275.1| cation efflux system protein CusF [Escherichia coli KTE177]
 gb|ELJ74143.1| cation efflux system protein CusF [Escherichia coli KTE82]
 gb|ELJ89724.1| cation efflux system protein CusF [Escherichia coli KTE95]
 gb|EMD14787.1| periplasmic copper-binding protein [Escherichia coli SEPT362]
 gb|EOU53343.1| cation efflux system protein CusF [Escherichia coli KTE231]
 gb|EOV16980.1| cation efflux system protein CusF [Escherichia coli KTE199]
 gb|EOV25823.1| cation efflux system protein CusF [Escherichia coli KTE200]
 gb|EOV66507.1| cation efflux system protein CusF [Escherichia coli KTE68]
 gb|EOW23895.1| cation efflux system protein CusF [Escherichia coli KTE121]
 gb|EOW40067.1| cation efflux system protein CusF [Escherichia coli KTE127]
 gb|EOW53266.1| cation efflux system protein CusF [Escherichia coli KTE134]
 gb|EOW69080.1| cation efflux system protein CusF [Escherichia sp. KTE172]
 gb|EOW71173.1| cation efflux system protein CusF [Escherichia coli KTE170]
 gb|EOW96649.1| cation efflux system protein CusF [Escherichia coli KTE1]
 gb|EOX10323.1| cation efflux system protein CusF [Escherichia coli KTE225]
 gb|EQN39549.1| cation efflux system protein CusF [Escherichia coli HVH 10 (4-6832164)]
 gb|EQN80229.1| cation efflux system protein CusF [Escherichia coli HVH 22 (4-2258986)]
 gb|EQO08458.1| cation efflux system protein CusF [Escherichia coli HVH 29 (4-3418073)]
 gb|EQO72850.1| cation efflux system protein CusF [Escherichia coli HVH 41 (4-2677849)]
 gb|EQO81620.1| cation efflux system protein CusF [Escherichia coli HVH 45 (4-3129918)]
 gb|EQP26150.1| cation efflux system protein CusF [Escherichia coli HVH 63 (4-2542528)]
 gb|EQP37157.1| cation efflux system protein CusF [Escherichia coli HVH 69 (4-2837072)]
 gb|EQP95113.1| cation efflux system protein CusF [Escherichia coli HVH 85 (4-0792144)]
 gb|EQQ07199.1| cation efflux system protein CusF [Escherichia coli HVH 88 (4-5854636)]
 gb|EQQ60163.1| cation efflux system protein CusF [Escherichia coli HVH 106 (4-6881831)]
 gb|EQQ67917.1| cation efflux system protein CusF [Escherichia coli HVH 110 (4-6978754)]
 gb|EQQ95785.1| cation efflux system protein CusF [Escherichia coli HVH 113 (4-7535473)]
 gb|EQR23608.1| cation efflux system protein CusF [Escherichia coli HVH 119 (4-6879578)]
 gb|EQR36008.1| cation efflux system protein CusF [Escherichia coli HVH 122 (4-6851606)]
 gb|EQR69193.1| cation efflux system protein CusF [Escherichia coli HVH 130 (4-7036876)]
 gb|EQR71935.1| cation efflux system protein CusF [Escherichia coli HVH 134 (4-6073441)]
 gb|EQR75102.1| cation efflux system protein CusF [Escherichia coli HVH 133 (4-4466519)]
 gb|EQR76774.1| cation efflux system protein CusF [Escherichia coli HVH 135 (4-4449320)]
 gb|EQS06978.1| cation efflux system protein CusF [Escherichia coli HVH 140 (4-5894387)]
 gb|EQS23521.1| cation efflux system protein CusF [Escherichia coli HVH 145 (4-5672112)]
 gb|EQS50355.1| cation efflux system protein CusF [Escherichia coli HVH 151 (4-5755573)]
 gb|EQS73903.1| cation efflux system protein CusF [Escherichia coli HVH 163 (4-4697553)]
 gb|EQS90392.1| cation efflux system protein CusF [Escherichia coli HVH 167 (4-6073565)]
 gb|EQT13288.1| cation efflux system protein CusF [Escherichia coli HVH 173 (3-9175482)]
 gb|EQT39799.1| cation efflux system protein CusF [Escherichia coli HVH 183 (4-3205932)]
 gb|EQT63663.1| cation efflux system protein CusF [Escherichia coli HVH 188 (4-2356988)]
 gb|EQT79124.1| cation efflux system protein CusF [Escherichia coli HVH 189 (4-3220125)]
 gb|EQU49773.1| cation efflux system protein CusF [Escherichia coli HVH 206 (4-3128229)]
 gb|EQU62785.1| cation efflux system protein CusF [Escherichia coli HVH 208 (4-3112292)]
 gb|EQU86406.1| cation efflux system protein CusF [Escherichia coli HVH 215 (4-3008371)]
 gb|EQV25273.1| cation efflux system protein CusF [Escherichia coli HVH 223 (4-2976528)]
 gb|EQV82182.1| cation efflux system protein CusF [Escherichia coli KOEGE 68 
(182a)]
 gb|EQV85525.1| cation efflux system protein CusF [Escherichia coli KOEGE 62 
(175a)]
 gb|EQV92326.1| cation efflux system protein CusF [Escherichia coli KOEGE 73 
(195a)]
 gb|EQW32466.1| cation efflux system protein CusF [Escherichia coli UMEA 3033-1]
 gb|EQX36822.1| cation efflux system protein CusF [Escherichia coli UMEA 3163-1]
 gb|ERA68638.1| cation efflux system protein CusF [Escherichia coli HVH 155 (4-4509048)]
 gb|ESA30836.1| Cation efflux system protein CusF precursor [Escherichia coli 
SCD2]
 gb|ESA92446.1| cation efflux system protein CusF [Escherichia coli 907713]
 gb|ESD30130.1| cation efflux system protein CusF [Escherichia coli 907715]
 gb|ESD57055.1| cation efflux system protein CusF [Escherichia coli 908521]
 gb|ESD62072.1| cation efflux system protein CusF [Escherichia coli 908522]
 gb|ESD96673.1| cation efflux system protein CusF [Escherichia coli 908616]
 gb|ESD96782.1| cation efflux system protein CusF [Escherichia coli 908585]
 gb|ETE25439.1| cation transporter [Escherichia coli LAU-EC10]
 emb|CDK49078.1| Cation efflux system protein CusF precursor [Escherichia coli 
IS1]
 gb|EYB38893.1| copper-binding protein [Escherichia coli]
 gb|EYE07326.1| cation efflux system protein CusF [Escherichia coli 1-110-08_S4_C1]
 gb|EYZ97215.1| copper-binding protein [Escherichia coli O119:H4 str. 03-3458]
 gb|KDA75174.1| cation efflux system protein CusF [Escherichia coli 2-005-03_S3_C2]
 gb|KDG65529.1| cation efflux system protein CusF [Escherichia coli MGH 58]
 gb|KDH01603.1| cation efflux system protein CusF [Escherichia coli UCI 65]
 gb|KDW72286.1| cation efflux system protein CusF [Escherichia coli 1-392-07_S1_C1]
 gb|KDW81678.1| cation efflux system protein CusF [Escherichia coli 1-392-07_S1_C2]
 gb|KDX52628.1| cation efflux system protein CusF [Escherichia coli 2-177-06_S4_C1]
 gb|KDY08035.1| cation efflux system protein CusF [Escherichia coli 2-316-03_S4_C1]
 gb|KEJ18222.1| cation efflux system protein CusF [Escherichia coli 6-175-07_S1_C2]
 gb|KEJ32097.1| cation efflux system protein CusF [Escherichia coli 2-316-03_S1_C1]
 gb|KEJ32559.1| cation efflux system protein CusF [Escherichia coli 2-316-03_S1_C2]
 gb|KEM54707.1| cation efflux system protein CusF [Escherichia coli 6-175-07_S1_C3]
 gb|KEP20018.1| copper-binding protein [Escherichia coli]
Length=110

 Score = 81.6 bits (200),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/40 (98%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSL QDIKVSQ
Sbjct  71   MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ  110



>ref|WP_032280454.1| copper-binding protein [Escherichia coli]
 gb|EZJ89502.1| cation efflux system protein CusF [Escherichia coli 1-250-04_S3_C1]
 gb|KEO38067.1| cation efflux system protein CusF [Escherichia coli 1-250-04_S3_C2]
Length=110

 Score = 81.6 bits (200),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/40 (98%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSL QDIKVSQ
Sbjct  71   MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ  110



>ref|WP_021525579.1| cation efflux system protein CusF [Escherichia coli]
 gb|EQP78438.1| cation efflux system protein CusF [Escherichia coli HVH 79 (4-2512823)]
Length=110

 Score = 81.6 bits (200),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/40 (98%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSL QDIKVSQ
Sbjct  71   MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ  110



>ref|WP_001612578.1| cation efflux system protein CusF [Escherichia coli]
 gb|ELH42630.1| cation efflux system protein CusF [Escherichia coli KTE196]
 gb|ELI33240.1| cation efflux system protein CusF [Escherichia coli KTE117]
 gb|EZB21183.1| copper-binding protein [Escherichia coli O169:H41 str. F9792]
 gb|EZK25427.1| cation efflux system protein CusF [Escherichia coli 2-011-08_S1_C2]
Length=110

 Score = 81.6 bits (200),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/40 (98%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSL QDIKVSQ
Sbjct  71   MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ  110



>ref|WP_000709859.1| cation transporter [Escherichia coli]
 gb|EFW72904.1| Cation efflux system protein CusF precursor [Escherichia coli 
EC4100B]
Length=110

 Score = 81.6 bits (200),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/40 (98%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSL QDIKVSQ
Sbjct  71   MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ  110



>gb|KFH94591.1| copper-binding protein [Escherichia coli]
Length=110

 Score = 81.6 bits (200),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/40 (98%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSL QDIKVSQ
Sbjct  71   MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ  110



>ref|WP_000709886.1| cation transporter [Escherichia fergusonii]
 ref|YP_002383644.1| copper-binding protein [Escherichia fergusonii ATCC 35469]
 emb|CAQ90033.1| periplasmic copper-binding protein [Escherichia fergusonii ATCC 
35469]
 gb|EGC08672.1| cation efflux system protein cusF [Escherichia fergusonii B253]
 gb|EGC96092.1| periplasmic copper-binding protein [Escherichia fergusonii ECD227]
Length=110

 Score = 81.6 bits (200),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/40 (98%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSL QDIKVSQ
Sbjct  71   MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ  110



>ref|WP_032205806.1| copper-binding protein [Escherichia coli]
 gb|EYY57421.1| copper-binding protein [Escherichia coli O165:H25 str. 2010C-4874]
 gb|KHJ19196.1| copper-binding protein [Escherichia coli]
Length=110

 Score = 81.6 bits (200),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/40 (98%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSL QDIKVSQ
Sbjct  71   MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ  110



>ref|WP_016244363.1| cation efflux system protein CusF [Escherichia coli]
 gb|EOW10142.1| cation efflux system protein CusF [Escherichia coli KTE102]
Length=110

 Score = 81.6 bits (200),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/40 (98%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSL QDIKVSQ
Sbjct  71   MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ  110



>ref|WP_000709863.1| cation transporter [Escherichia coli]
 gb|EFZ56341.1| cation efflux system protein cusF [Escherichia coli LT-68]
 gb|EIG90147.1| cation efflux system protein CusF [Escherichia coli 97.0246]
 gb|ELG29578.1| cation efflux system protein CusF [Escherichia coli KTE78]
 gb|ELG32904.1| cation efflux system protein CusF [Escherichia coli KTE79]
 gb|EQN33742.1| cation efflux system protein CusF [Escherichia coli HVH 6 (3-8296502)]
 gb|EZD99006.1| copper-binding protein [Escherichia coli O145:H28 str. 2009C-3292]
 gb|KDV35857.1| copper-binding protein [Escherichia coli O145:H25 str. 07-3858]
 gb|KEN15491.1| cation efflux system protein CusF [Escherichia coli 7-233-03_S4_C2]
 gb|KHH08164.1| copper-binding protein [Escherichia coli]
 gb|KHI79766.1| copper-binding protein [Escherichia coli]
 gb|KIH37307.1| copper-binding protein [Escherichia coli]
Length=110

 Score = 81.6 bits (200),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/40 (98%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSL QDIKVSQ
Sbjct  71   MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ  110



>ref|WP_000709860.1| cation transporter [Escherichia coli]
 gb|ACB16052.1| cation efflux system protein CusF [Escherichia coli SMS-3-5]
 gb|ESD05247.1| cation efflux system protein CusF [Escherichia coli 907672]
 gb|ESD70653.1| cation efflux system protein CusF [Escherichia coli 908525]
Length=110

 Score = 81.6 bits (200),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/40 (98%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSL QDIKVSQ
Sbjct  71   MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ  110



>ref|WP_042961724.1| copper-binding protein [Escherichia coli]
 gb|KFH81046.1| copper-binding protein [Escherichia coli]
Length=110

 Score = 81.6 bits (200),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/40 (98%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSL QDIKVSQ
Sbjct  71   MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ  110



>ref|WP_029401572.1| copper-binding protein [Escherichia coli]
Length=110

 Score = 81.6 bits (200),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/40 (98%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSL QDIKVSQ
Sbjct  71   MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ  110



>ref|WP_033807665.1| copper-binding protein [Escherichia coli]
Length=110

 Score = 81.6 bits (200),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/40 (98%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSL QDIKVSQ
Sbjct  71   MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ  110



>ref|WP_001381846.1| cation efflux system protein CusF [Escherichia coli]
 gb|ENA66603.1| cation efflux system protein CusF [Escherichia coli 178900]
Length=110

 Score = 81.6 bits (200),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/40 (98%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSL QDIKVSQ
Sbjct  71   MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ  110



>ref|WP_001576958.1| cation efflux system protein CusF [Escherichia coli]
 gb|ELF52135.1| cation efflux system protein CusF [Escherichia coli KTE8]
 gb|EQO09917.1| cation efflux system protein CusF [Escherichia coli HVH 28 (4-0907367)]
Length=110

 Score = 81.6 bits (200),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/40 (98%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSL QDIKVSQ
Sbjct  71   MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ  110



>ref|WP_000709858.1| cation transporter [Escherichia coli]
 gb|EHN83924.1| cation efflux system protein CusF [Escherichia coli TA124]
Length=110

 Score = 81.6 bits (200),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/40 (98%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSL QDIKVSQ
Sbjct  71   MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ  110



>ref|WP_000709873.1| MULTISPECIES: cation transporter [Enterobacteriaceae]
 ref|NP_706420.1| periplasmic copper-binding protein [Shigella flexneri 2a str. 
301]
 ref|NP_752590.1| periplasmic copper-binding protein [Escherichia coli CFT073]
 ref|NP_836194.1| periplasmic copper-binding protein [Shigella flexneri 2a str. 
2457T]
 ref|YP_002328046.1| copper-binding protein [Escherichia coli O127:H6 str. E2348/69]
 ref|YP_002406574.1| periplasmic copper-binding protein [Escherichia coli IAI39]
 ref|YP_002555467.1| Cation efflux system protein cusF [Escherichia coli LF82]
 ref|YP_006118879.1| copper-binding protein [Escherichia coli O83:H1 str. NRG 857C]
 sp|Q8CWA3.1|CUSF_ECOL6 RecName: Full=Cation efflux system protein CusF; Flags: Precursor 
[Escherichia coli CFT073]
 gb|AAN79134.1|AE016757_38 Hypothetical protein cusX precursor [Escherichia coli CFT073]
 gb|AAN42127.1| conserved hypothetical protein [Shigella flexneri 2a str. 301]
 gb|AAP16000.1| hypothetical protein S0482 [Shigella flexneri 2a str. 2457T]
 gb|ABG68632.1| conserved hypothetical protein [Escherichia coli 536]
 gb|ABF02766.1| conserved hypothetical protein [Shigella flexneri 5 str. 8401]
 gb|EDU65817.1| cation efflux system protein CusF [Escherichia coli 53638]
 gb|EDV67004.1| cation efflux system protein CusF [Escherichia coli F11]
 emb|CAS08021.1| periplasmic copper-binding protein [Escherichia coli O127:H6 
str. E2348/69]
 emb|CAR16685.1| periplasmic copper-binding protein [Escherichia coli IAI39]
 emb|CAP75072.1| Cation efflux system protein cusF [Escherichia coli LF82]
 gb|EEJ49001.1| cation efflux system protein CusF [Escherichia coli 83972]
 dbj|BAI54043.1| putative cation efflux system protein CusC [Escherichia coli 
SE15]
 gb|ADA72851.1| Cation efflux system protein cusF precursor [Shigella flexneri 
2002017]
 gb|EFF06901.1| cation efflux system protein cusF [Escherichia coli B185]
 gb|EFJ54874.1| cation efflux system protein CusF [Escherichia coli MS 185-1]
 gb|EFJ58896.1| cation efflux system protein CusF [Escherichia coli MS 200-1]
 gb|EFJ90671.1| cation efflux system protein CusF [Escherichia coli MS 45-1]
 gb|ADN45219.1| cation efflux system protein CusF [Escherichia coli ABU 83972]
 gb|EFR18740.1| cation efflux system protein cusF [Escherichia coli 2362-75]
 gb|ADR25945.1| periplasmic copper-binding protein [Escherichia coli O83:H1 str. 
NRG 857C]
 gb|EFS11292.1| cation efflux system protein cusF [Shigella flexneri 2a str. 
2457T]
 gb|EFU50742.1| cation efflux system protein CusF [Escherichia coli MS 153-1]
 gb|EFZ76473.1| cation efflux system protein cusF [Escherichia coli RN587/1]
 gb|EGB62934.1| periplasmic copper-binding protein [Escherichia coli M863]
 gb|EGB75616.1| cation efflux system protein CusF [Escherichia coli MS 57-2]
 gb|EGB79776.1| cation efflux system protein CusF [Escherichia coli MS 60-1]
 gb|EGE65872.1| cation efflux system protein cusF [Escherichia coli STEC_7v]
 gb|EGH38842.1| cation efflux system protein CusF precursor [Escherichia coli 
AA86]
 gb|EGI16609.1| cation efflux system protein CusF [Escherichia coli M605]
 gb|EGI21915.1| cation efflux system protein CusF [Escherichia coli M718]
 gb|EGI26855.1| cation efflux system protein CusF [Escherichia coli TA206]
 gb|EGJ91118.1| cation efflux system protein cusF [Shigella flexneri 4343-70]
 gb|EGJ91842.1| cation efflux system protein cusF [Shigella flexneri 2747-71]
 gb|EGJ98643.1| periplasmic copper/silver-binding protein [Shigella flexneri 
2930-71]
 gb|EGK27446.1| cation efflux system protein cusF [Shigella flexneri K-218]
 gb|EGK41111.1| cation efflux system protein cusF [Shigella flexneri K-304]
 gb|AEG35326.1| Periplasmic copper-binding protein [Escherichia coli NA114]
 gb|EGX09733.1| cation efflux system protein cusF [Escherichia coli STEC_MHI813]
 gb|AEQ11410.1| periplasmic copper- and silver-binding protein [Escherichia coli 
O7:K1 str. CE10]
 gb|AER83222.1| periplasmic copper-binding protein [Escherichia coli str. 'clone 
D i2']
 gb|AER88141.1| periplasmic copper-binding protein [Escherichia coli str. 'clone 
D i14']
 gb|EHN96094.1| cation efflux system protein cusF [Escherichia coli E101]
 gb|EHU15994.1| periplasmic copper/silver-binding protein [Escherichia coli DEC1C]
 gb|EHU19084.1| periplasmic copper/silver-binding protein [Escherichia coli DEC1B]
 gb|EHU27680.1| cation efflux system protein CusF [Escherichia coli DEC1D]
 gb|EHU31748.1| periplasmic copper/silver-binding protein [Escherichia coli DEC1E]
 gb|EHU33084.1| cation efflux system protein CusF [Escherichia coli DEC2A]
 gb|EHU43858.1| periplasmic copper/silver-binding protein [Escherichia coli DEC2B]
 gb|EHU48241.1| periplasmic copper/silver-binding protein [Escherichia coli DEC2D]
 gb|EHU49888.1| periplasmic copper/silver-binding protein [Escherichia coli DEC2C]
 gb|EHU62894.1| periplasmic copper/silver-binding protein [Escherichia coli DEC2E]
 gb|EIA37743.1| periplasmic copper-binding protein [Escherichia coli SCI-07]
 gb|EID61091.1| periplasmic copper-binding protein [Shigella flexneri 5a str. 
M90T]
 gb|EIG79456.1| cation efflux system protein CusF [Escherichia coli 1.2741]
 gb|EII84438.1| cation efflux system protein CusF [Escherichia coli 3003]
 gb|EII93404.1| cation efflux system protein CusF [Escherichia coli TW07793]
 gb|EIQ32768.1| cation efflux system protein CusF [Shigella flexneri K-404]
 gb|EKI31857.1| cation efflux system protein CusF [Escherichia coli ARS4.2123]
 gb|ELC38653.1| cation efflux system protein CusF [Escherichia coli KTE25]
 gb|ELC52748.1| cation efflux system protein CusF [Escherichia coli KTE28]
 gb|ELC58779.1| cation efflux system protein CusF [Escherichia coli KTE39]
 gb|ELC66829.1| cation efflux system protein CusF [Escherichia coli KTE178]
 gb|ELC74948.1| cation efflux system protein CusF [Escherichia coli KTE187]
 gb|ELC84120.1| cation efflux system protein CusF [Escherichia coli KTE188]
 gb|ELC86298.1| cation efflux system protein CusF [Escherichia coli KTE189]
 gb|ELC90909.1| cation efflux system protein CusF [Escherichia coli KTE193]
 gb|ELC92635.1| cation efflux system protein CusF [Escherichia coli KTE191]
 gb|ELD01940.1| cation efflux system protein CusF [Escherichia coli KTE201]
 gb|ELD16110.1| cation efflux system protein CusF [Escherichia coli KTE206]
 gb|ELD40963.1| cation efflux system protein CusF [Escherichia coli KTE214]
 gb|ELD44659.1| cation efflux system protein CusF [Escherichia coli KTE216]
 gb|ELD52736.1| cation efflux system protein CusF [Escherichia coli KTE220]
 gb|ELD64375.1| cation efflux system protein CusF [Escherichia coli KTE230]
 gb|ELD92849.1| cation efflux system protein CusF [Escherichia coli KTE47]
 gb|ELD99879.1| cation efflux system protein CusF [Escherichia coli KTE49]
 gb|ELE07875.1| cation efflux system protein CusF [Escherichia coli KTE53]
 gb|ELE35094.1| cation efflux system protein CusF [Escherichia coli KTE60]
 gb|ELE42406.1| cation efflux system protein CusF [Escherichia coli KTE67]
 gb|ELE92769.1| cation efflux system protein CusF [Escherichia coli KTE87]
 gb|ELF31769.1| cation efflux system protein CusF [Escherichia coli KTE162]
 gb|ELF45548.1| cation efflux system protein CusF [Escherichia coli KTE6]
 gb|ELF59610.1| cation efflux system protein CusF [Escherichia coli KTE17]
 gb|ELF66387.1| cation efflux system protein CusF [Escherichia coli KTE18]
 gb|ELF69165.1| cation efflux system protein CusF [Escherichia coli KTE45]
 gb|ELF77290.1| cation efflux system protein CusF [Escherichia coli KTE23]
 gb|ELF99709.1| cation efflux system protein CusF [Escherichia coli KTE46]
 gb|ELG19396.1| cation efflux system protein CusF [Escherichia coli KTE63]
 gb|ELG80805.1| cation efflux system protein CusF [Escherichia coli KTE141]
 gb|ELH06383.1| cation efflux system protein CusF [Escherichia coli KTE165]
 gb|ELH27337.1| cation efflux system protein CusF [Escherichia coli KTE173]
 gb|ELH29211.1| cation efflux system protein CusF [Escherichia coli KTE175]
 gb|ELH62062.1| cation efflux system protein CusF [Escherichia coli KTE209]
 gb|ELH73630.1| cation efflux system protein CusF [Escherichia coli KTE211]
 gb|ELH77313.1| cation efflux system protein CusF [Escherichia coli KTE217]
 gb|ELH87912.1| cation efflux system protein CusF [Escherichia coli KTE218]
 gb|ELH92159.1| cation efflux system protein CusF [Escherichia coli KTE223]
 gb|ELI11565.1| cation efflux system protein CusF [Escherichia coli KTE104]
 gb|ELI16022.1| cation efflux system protein CusF [Escherichia coli KTE106]
 gb|ELI32658.1| cation efflux system protein CusF [Escherichia coli KTE112]
 gb|ELI46668.1| cation efflux system protein CusF [Escherichia coli KTE124]
 gb|ELI70828.1| cation efflux system protein CusF [Escherichia coli KTE131]
 gb|ELI78774.1| cation efflux system protein CusF [Escherichia coli KTE137]
 gb|ELI88444.1| cation efflux system protein CusF [Escherichia coli KTE139]
 gb|ELI99391.1| cation efflux system protein CusF [Escherichia coli KTE150]
 gb|ELJ02460.1| cation efflux system protein CusF [Escherichia coli KTE148]
 gb|ELJ05104.1| cation efflux system protein CusF [Escherichia coli KTE153]
 gb|ELJ17542.1| cation efflux system protein CusF [Escherichia coli KTE160]
 gb|ELJ31859.1| cation efflux system protein CusF [Escherichia coli KTE167]
 gb|ELJ42967.1| cation efflux system protein CusF [Escherichia coli KTE174]
 gb|ELJ89206.1| cation efflux system protein CusF [Escherichia coli KTE94]
 gb|ELJ96257.1| cation efflux system protein CusF [Escherichia coli KTE97]
 gb|ELJ99460.1| cation efflux system protein CusF [Escherichia coli KTE99]
 gb|ELL39687.1| periplasmic copper-binding protein [Escherichia coli J96]
 emb|CCQ07578.1| Cation efflux system protein CusF precursor [Escherichia coli 
Nissle 1917]
 gb|EMU84272.1| cation efflux system protein CusF [Escherichia coli MP021017.9]
 gb|EMU85823.1| cation efflux system protein CusF [Escherichia coli MP021017.6]
 gb|EMU87917.1| cation efflux system protein CusF [Escherichia coli MP021017.5]
 gb|EMU98845.1| cation efflux system protein CusF [Escherichia coli MP021017.4]
 gb|EMV00571.1| cation efflux system protein CusF [Escherichia coli MP021017.3]
 gb|EMV02202.1| cation efflux system protein CusF [Escherichia coli MP021017.2]
 gb|EMV09763.1| cation efflux system protein CusF [Escherichia coli MP021017.10]
 gb|EMV13986.1| cation efflux system protein CusF [Escherichia coli MP021017.11]
 gb|EMV29266.1| cation efflux system protein CusF [Escherichia coli MP021017.12]
 gb|EMV89910.1| cation efflux system protein CusF [Escherichia coli 2861200]
 gb|EMX41986.1| cation efflux system protein CusF [Escherichia coli MP021017.1]
 gb|ENA18929.1| cation efflux system protein CusF [Escherichia coli BCE008_MS-13]
 gb|ENB20908.1| cation efflux system protein CusF [Escherichia coli BCE008_MS-01]
 gb|EOR51311.1| periplasmic copper-binding protein [Escherichia coli ATCC 25922]
 gb|EOU56854.1| cation efflux system protein CusF [Escherichia coli KTE19]
 gb|EOV11322.1| cation efflux system protein CusF [Escherichia coli KTE195]
 gb|EOV82307.1| cation efflux system protein CusF [Escherichia coli KTE73]
 gb|EOW22698.1| cation efflux system protein CusF [Escherichia coli KTE108]
 gb|EOW39013.1| cation efflux system protein CusF [Escherichia coli KTE126]
 gb|EOX12742.1| cation efflux system protein CusF [Escherichia coli KTE226]
 gb|EOX24819.1| cation efflux system protein CusF [Escherichia coli KTE185]
 emb|CDC77822.1| putative uncharacterized protein ylcC [Escherichia coli CAG:4]
 gb|EQN08584.1| cation efflux system protein CusF [Escherichia coli HVH 2 (4-6943160)]
 gb|EQN23935.1| cation efflux system protein CusF [Escherichia coli HVH 4 (4-7276109)]
 gb|EQN34550.1| cation efflux system protein CusF [Escherichia coli HVH 9 (4-6942539)]
 gb|EQN38420.1| cation efflux system protein CusF [Escherichia coli HVH 7 (4-7315031)]
 gb|EQN54071.1| cation efflux system protein CusF [Escherichia coli HVH 13 (4-7634056)]
 gb|EQN55009.1| cation efflux system protein CusF [Escherichia coli HVH 16 (4-7649002)]
 gb|EQN56411.1| cation efflux system protein CusF [Escherichia coli HVH 17 (4-7473087)]
 gb|EQN64679.1| cation efflux system protein CusF [Escherichia coli HVH 20 (4-5865042)]
 gb|EQN83103.1| cation efflux system protein CusF [Escherichia coli HVH 21 (4-4517873)]
 gb|EQN99196.1| cation efflux system protein CusF [Escherichia coli HVH 27 (4-7449267)]
 gb|EQO22399.1| cation efflux system protein CusF [Escherichia coli HVH 31 (4-2602156)]
 gb|EQO44888.1| cation efflux system protein CusF [Escherichia coli HVH 37 (4-2773848)]
 gb|EQO48198.1| cation efflux system protein CusF [Escherichia coli HVH 39 (4-2679949)]
 gb|EQO54702.1| cation efflux system protein CusF [Escherichia coli HVH 40 (4-1219782)]
 gb|EQO91431.1| cation efflux system protein CusF [Escherichia coli HVH 46 (4-2758776)]
 gb|EQO97644.1| cation efflux system protein CusF [Escherichia coli HVH 53 (4-0631051)]
 gb|EQO98538.1| cation efflux system protein CusF [Escherichia coli HVH 51 (4-2172526)]
 gb|EQP11814.1| cation efflux system protein CusF [Escherichia coli HVH 56 (4-2153033)]
 gb|EQP14644.1| cation efflux system protein CusF [Escherichia coli HVH 58 (4-2839709)]
 gb|EQP23328.1| cation efflux system protein CusF [Escherichia coli HVH 61 (4-2736020)]
 gb|EQP41673.1| cation efflux system protein CusF [Escherichia coli HVH 68 (4-0888028)]
 gb|EQP56233.1| cation efflux system protein CusF [Escherichia coli HVH 74 (4-1034782)]
 gb|EQP59411.1| cation efflux system protein CusF [Escherichia coli HVH 70 (4-2963531)]
 gb|EQP72673.1| cation efflux system protein CusF [Escherichia coli HVH 78 (4-2735946)]
 gb|EQP77135.1| cation efflux system protein CusF [Escherichia coli HVH 77 (4-2605759)]
 gb|EQP96811.1| cation efflux system protein CusF [Escherichia coli HVH 84 (4-1021478)]
 gb|EQQ11082.1| cation efflux system protein CusF [Escherichia coli HVH 89 (4-5885604)]
 gb|EQQ17854.1| cation efflux system protein CusF [Escherichia coli HVH 90 (4-3191362)]
 gb|EQQ29370.1| cation efflux system protein CusF [Escherichia coli HVH 95 (4-6074464)]
 gb|EQQ31354.1| cation efflux system protein CusF [Escherichia coli HVH 92 (4-5930790)]
 gb|EQQ35481.1| cation efflux system protein CusF [Escherichia coli HVH 100 (4-2850729)]
 gb|EQQ49927.1| cation efflux system protein CusF [Escherichia coli HVH 96 (4-5934869)]
 gb|EQQ55877.1| cation efflux system protein CusF [Escherichia coli HVH 103 (4-5904188)]
 gb|EQQ78731.1| cation efflux system protein CusF [Escherichia coli HVH 111 (4-7039018)]
 gb|EQQ79983.1| cation efflux system protein CusF [Escherichia coli HVH 109 (4-6977162)]
 gb|EQQ91920.1| cation efflux system protein CusF [Escherichia coli HVH 112 (4-5987253)]
 gb|EQQ93281.1| cation efflux system protein CusF [Escherichia coli HVH 114 (4-7037740)]
 gb|EQR09435.1| cation efflux system protein CusF [Escherichia coli HVH 116 (4-6879942)]
 gb|EQR20498.1| cation efflux system protein CusF [Escherichia coli HVH 117 (4-6857191)]
 gb|EQR33301.1| cation efflux system protein CusF [Escherichia coli HVH 120 (4-6978681)]
 gb|EQR68897.1| cation efflux system protein CusF [Escherichia coli HVH 132 (4-6876862)]
 gb|EQR96528.1| cation efflux system protein CusF [Escherichia coli HVH 138 (4-6066704)]
 gb|EQS08492.1| cation efflux system protein CusF [Escherichia coli HVH 141 (4-5995973)]
 gb|EQS17339.1| cation efflux system protein CusF [Escherichia coli HVH 143 (4-5674999)]
 gb|EQS23724.1| cation efflux system protein CusF [Escherichia coli HVH 142 (4-5627451)]
 gb|EQS28262.1| cation efflux system protein CusF [Escherichia coli HVH 144 (4-4451937)]
 gb|EQS42244.1| cation efflux system protein CusF [Escherichia coli HVH 149 (4-4451880)]
 gb|EQS42423.1| cation efflux system protein CusF [Escherichia coli HVH 146 (4-3189767)]
 gb|EQS53868.1| cation efflux system protein CusF [Escherichia coli HVH 154 (4-5636698)]
 gb|EQS55427.1| cation efflux system protein CusF [Escherichia coli HVH 153 (3-9344314)]
 gb|EQS61774.1| cation efflux system protein CusF [Escherichia coli HVH 158 (4-3224287)]
 gb|EQS69446.1| cation efflux system protein CusF [Escherichia coli HVH 161 (4-3119890)]
 gb|EQS85767.1| cation efflux system protein CusF [Escherichia coli HVH 162 (4-5627982)]
 gb|EQT01457.1| cation efflux system protein CusF [Escherichia coli HVH 169 (4-1075578)]
 gb|EQT04409.1| cation efflux system protein CusF [Escherichia coli HVH 171 (4-3191958)]
 gb|EQT17117.1| cation efflux system protein CusF [Escherichia coli HVH 172 (4-3248542)]
 gb|EQT27443.1| cation efflux system protein CusF [Escherichia coli HVH 176 (4-3428664)]
 gb|EQT29816.1| cation efflux system protein CusF [Escherichia coli HVH 175 (4-3405184)]
 gb|EQT48696.1| cation efflux system protein CusF [Escherichia coli HVH 184 (4-3343286)]
 gb|EQT54243.1| cation efflux system protein CusF [Escherichia coli HVH 185 (4-2876639)]
 gb|EQT56511.1| cation efflux system protein CusF [Escherichia coli HVH 187 (4-4471660)]
 gb|EQT62907.1| cation efflux system protein CusF [Escherichia coli HVH 186 (4-3405044)]
 gb|EQT69173.1| cation efflux system protein CusF [Escherichia coli HVH 190 (4-3255514)]
 gb|EQT98725.1| cation efflux system protein CusF [Escherichia coli HVH 194 (4-2356805)]
 gb|EQU16182.1| cation efflux system protein CusF [Escherichia coli HVH 198 (4-3206106)]
 gb|EQU26046.1| cation efflux system protein CusF [Escherichia coli HVH 197 (4-4466217)]
 gb|EQU40889.1| cation efflux system protein CusF [Escherichia coli HVH 202 (4-3163997)]
 gb|EQU45310.1| cation efflux system protein CusF [Escherichia coli HVH 204 (4-3112802)]
 gb|EQU57348.1| cation efflux system protein CusF [Escherichia coli HVH 205 (4-3094677)]
 gb|EQU61186.1| cation efflux system protein CusF [Escherichia coli HVH 207 (4-3113221)]
 gb|EQU80402.1| cation efflux system protein CusF [Escherichia coli HVH 212 (3-9305343)]
 gb|EQU99235.1| cation efflux system protein CusF [Escherichia coli HVH 216 (4-3042952)]
 gb|EQV04057.1| cation efflux system protein CusF [Escherichia coli HVH 218 (4-4500903)]
 gb|EQV12526.1| cation efflux system protein CusF [Escherichia coli HVH 220 (4-5876842)]
 gb|EQV30181.1| cation efflux system protein CusF [Escherichia coli HVH 227 (4-2277670)]
 gb|EQV34800.1| cation efflux system protein CusF [Escherichia coli KOEGE 30 
(63a)]
 gb|EQV58562.1| cation efflux system protein CusF [Escherichia coli KOEGE 43 
(105a)]
 gb|EQV60292.1| cation efflux system protein CusF [Escherichia coli KOEGE 44 
(106a)]
 gb|EQV71475.1| cation efflux system protein CusF [Escherichia coli KOEGE 61 
(174a)]
 gb|EQV73516.1| cation efflux system protein CusF [Escherichia coli KOEGE 58 
(171a)]
 gb|EQV90770.1| cation efflux system protein CusF [Escherichia coli KOEGE 70 
(185a)]
 gb|EQW22343.1| cation efflux system protein CusF [Escherichia coli UMEA 3022-1]
 gb|EQW22735.1| cation efflux system protein CusF [Escherichia coli UMEA 3014-1]
 gb|EQW54441.1| cation efflux system protein CusF [Escherichia coli UMEA 3087-1]
 gb|EQW58577.1| cation efflux system protein CusF [Escherichia coli UMEA 3097-1]
 gb|EQW68178.1| cation efflux system protein CusF [Escherichia coli UMEA 3108-1]
 gb|EQW72543.1| cation efflux system protein CusF [Escherichia coli UMEA 3113-1]
 gb|EQW74184.1| cation efflux system protein CusF [Escherichia coli UMEA 3117-1]
 gb|EQW83178.1| cation efflux system protein CusF [Escherichia coli UMEA 3121-1]
 gb|EQX10215.1| cation efflux system protein CusF [Escherichia coli UMEA 3155-1]
 gb|EQX14418.1| cation efflux system protein CusF [Escherichia coli UMEA 3159-1]
 gb|EQX22329.1| cation efflux system protein CusF [Escherichia coli UMEA 3160-1]
 gb|EQX23342.1| cation efflux system protein CusF [Escherichia coli UMEA 3161-1]
 gb|EQX38626.1| cation efflux system protein CusF [Escherichia coli UMEA 3172-1]
 gb|EQX46740.1| cation efflux system protein CusF [Escherichia coli UMEA 3175-1]
 gb|EQX48215.1| cation efflux system protein CusF [Escherichia coli UMEA 3173-1]
 gb|EQX61404.1| cation efflux system protein CusF [Escherichia coli UMEA 3178-1]
 gb|EQX69658.1| cation efflux system protein CusF [Escherichia coli UMEA 3185-1]
 gb|EQX78822.1| cation efflux system protein CusF [Escherichia coli UMEA 3193-1]
 gb|EQY13554.1| cation efflux system protein CusF [Escherichia coli UMEA 3208-1]
 gb|EQY23998.1| cation efflux system protein CusF [Escherichia coli UMEA 3216-1]
 gb|EQY28232.1| cation efflux system protein CusF [Escherichia coli UMEA 3217-1]
 gb|EQY35185.1| cation efflux system protein CusF [Escherichia coli UMEA 3220-1]
 gb|EQY48702.1| cation efflux system protein CusF [Escherichia coli UMEA 3222-1]
 gb|EQY60690.1| cation efflux system protein CusF [Escherichia coli UMEA 3244-1]
 gb|EQY62225.1| cation efflux system protein CusF [Escherichia coli UMEA 3233-1]
 gb|EQY71951.1| cation efflux system protein CusF [Escherichia coli UMEA 3264-1]
 gb|EQY75675.1| cation efflux system protein CusF [Escherichia coli UMEA 3257-1]
 gb|EQY79624.1| cation efflux system protein CusF [Escherichia coli UMEA 3268-1]
 gb|EQZ07378.1| cation efflux system protein CusF [Escherichia coli UMEA 3337-1]
 gb|EQZ16658.1| cation efflux system protein CusF [Escherichia coli UMEA 3341-1]
 gb|EQZ24890.1| cation efflux system protein CusF [Escherichia coli UMEA 3585-1]
 gb|EQZ31230.1| cation efflux system protein CusF [Escherichia coli UMEA 3490-1]
 gb|EQZ43557.1| cation efflux system protein CusF [Escherichia coli UMEA 3617-1]
 gb|EQZ53497.1| cation efflux system protein CusF [Escherichia coli UMEA 3656-1]
 gb|EQZ69719.1| cation efflux system protein CusF [Escherichia coli UMEA 3671-1]
 gb|EQZ81298.1| cation efflux system protein CusF [Escherichia coli UMEA 3687-1]
 gb|EQZ81699.1| cation efflux system protein CusF [Escherichia coli UMEA 3694-1]
 gb|EQZ84206.1| cation efflux system protein CusF [Escherichia coli UMEA 3705-1]
 gb|EQZ93093.1| cation efflux system protein CusF [Escherichia coli UMEA 3707-1]
 gb|EQZ97534.1| cation efflux system protein CusF [Escherichia coli UMEA 3703-1]
 gb|ERA12471.1| cation efflux system protein CusF [Escherichia coli UMEA 3821-1]
 gb|ERA28488.1| cation efflux system protein CusF [Escherichia coli UMEA 3899-1]
 gb|ERA35034.1| cation efflux system protein CusF [Escherichia coli UMEA 3955-1]
 gb|ERA40040.1| cation efflux system protein CusF [Escherichia coli UMEA 4075-1]
 gb|ERA48437.1| cation efflux system protein CusF [Escherichia coli UMEA 4207-1]
 gb|ERA77418.1| cation efflux system protein CusF [Escherichia coli HVH 156 (4-3206505)]
 gb|ERA78814.1| cation efflux system protein CusF [Escherichia coli HVH 157 (4-3406229)]
 gb|ERA83273.1| cation efflux system protein CusF [Escherichia coli HVH 159 (4-5818141)]
 gb|ERA91867.1| cation efflux system protein CusF [Escherichia coli HVH 160 (4-5695937)]
 gb|ERA96434.1| cation efflux system protein CusF [Escherichia coli HVH 228 (4-7787030)]
 gb|ERB11272.1| cation efflux system protein CusF [Escherichia coli KOEGE 10 
(25a)]
 gb|ERF50978.1| cation efflux system protein CusF [Escherichia coli UMEA 3652-1]
 gb|ERO89452.1| cation efflux system protein CusF [Escherichia coli BWH 24]
 gb|ERO95409.1| cation efflux system protein CusF [Escherichia coli BIDMC 19C]
 gb|ESA68982.1| cation efflux system protein CusF [Escherichia coli 113290]
 gb|ESA89587.1| cation efflux system protein CusF [Escherichia coli 907779]
 gb|ESA98831.1| cation efflux system protein CusF [Escherichia coli 909945-2]
 gb|ESC91357.1| cation efflux system protein CusF [Escherichia coli 907446]
 gb|ESC96776.1| cation efflux system protein CusF [Escherichia coli 907391]
 gb|ESD09630.1| cation efflux system protein CusF [Escherichia coli 907700]
 gb|ESD21301.1| cation efflux system protein CusF [Escherichia coli 907701]
 gb|ESD39568.1| cation efflux system protein CusF [Escherichia coli 907892]
 gb|ESD40361.1| cation efflux system protein CusF [Escherichia coli 908519]
 gb|ESD58748.1| cation efflux system protein CusF [Escherichia coli 908524]
 gb|ESD98954.1| cation efflux system protein CusF [Escherichia coli 908624]
 gb|ESE05766.1| cation efflux system protein CusF [Escherichia coli 908632]
 gb|ESE19729.1| cation efflux system protein CusF [Escherichia coli 908691]
 gb|ESE27972.1| cation efflux system protein CusF [Escherichia coli A35218R]
 gb|ESE35353.1| cation efflux system protein CusF [Escherichia coli A25922R]
 gb|AGY83490.1| cation transporter [Escherichia coli JJ1886]
 gb|ESK20541.1| cation efflux system protein CusF [Escherichia coli UMEA 3290-1]
 gb|ESK21143.1| cation efflux system protein CusF [Escherichia coli UMEA 3426-1]
 gb|ESK31636.1| cation efflux system protein CusF [Escherichia coli UMEA 3693-1]
 gb|ESK32406.1| cation efflux system protein CusF [Escherichia coli UMEA 3342-1]
 gb|ESL44505.1| cation efflux system protein CusF [Escherichia coli BIDMC 38]
 gb|ESM40697.1| cation efflux system protein CusF [Escherichia coli BWH 32]
 gb|ESP25608.1| cation efflux system protein CusF [Escherichia coli HVH 86 (4-7026218)]
 gb|ESP48261.1| cation efflux system protein CusF [Escherichia coli HVH 108 (4-6924867)]
 gb|ETE07486.1| cation transporter [Escherichia coli LAU-EC8]
 gb|ETE18607.1| cation transporter [Escherichia coli LAU-EC6]
 gb|ETE32112.1| cation transporter [Escherichia coli LAU-EC7]
 gb|ETE36312.1| cation transporter [Escherichia coli LAU-EC9]
 gb|ETF21885.1| cation efflux system protein CusF [Escherichia coli HVH 177 (4-2876612)]
 gb|ETF22072.1| cation efflux system protein CusF [Escherichia coli HVH 83 (4-2051087)]
 gb|ETF30125.1| cation efflux system protein CusF [Escherichia coli HVH 23 (4-6066488)]
 gb|ETF33116.1| cation efflux system protein CusF [Escherichia coli UMEA 3489-1]
 gb|ETJ67721.1| cation transporter [Escherichia coli ATCC 35150]
 emb|CDK51343.1| Cation efflux system protein CusF precursor [Escherichia coli 
IS5]
 emb|CDL06575.1| Cation efflux system protein CusF precursor [Escherichia coli 
IS35]
 emb|CDK85757.1| Cation efflux system protein CusF precursor [Escherichia coli 
IS29]
 gb|AHG13222.1| Cation efflux system protein CusF precursor [Escherichia coli 
O145:H28 str. RM13516]
 gb|AHG07290.1| Cation efflux system protein CusF precursor [Escherichia coli 
O145:H28 str. RM13514]
 gb|ETX74685.1| cation efflux system protein CusF [Escherichia coli BIDMC 43b]
 gb|ETX83872.1| cation efflux system protein CusF [Escherichia coli BIDMC 43a]
 gb|ETX93574.1| cation efflux system protein CusF [Escherichia coli BIDMC 20B]
 gb|ETX97704.1| cation efflux system protein CusF [Escherichia coli BIDMC 20A]
 gb|ETY01275.1| cation efflux system protein CusF [Escherichia coli BIDMC 19B]
 gb|ETY04441.1| cation efflux system protein CusF [Escherichia coli BIDMC 19A]
 gb|ETY10618.1| cation efflux system protein CusF [Escherichia coli BIDMC 17B]
 gb|ETY14565.1| cation efflux system protein CusF [Escherichia coli BIDMC 17A]
 gb|ETY22399.1| cation efflux system protein CusF [Escherichia coli BIDMC 15]
 gb|ETY27676.1| cation efflux system protein CusF [Escherichia coli BIDMC 9]
 gb|ETY34277.1| cation efflux system protein CusF [Escherichia coli BIDMC 3]
 gb|ETY40453.1| cation efflux system protein CusF [Escherichia coli BIDMC 2B]
 gb|ETY43812.1| cation efflux system protein CusF [Escherichia coli BWH 34]
 gb|ETY63457.1| cation efflux system protein CusF [Escherichia coli BIDMC 6]
 emb|CDL48949.1| Cation efflux system protein CusF precursor [Escherichia coli 
ISC41]
 gb|EYB40472.1| copper-binding protein [Escherichia coli]
 gb|EYB51082.1| copper-binding protein [Escherichia coli]
 gb|EYB62054.1| copper-binding protein [Escherichia coli]
 gb|EYV14601.1| copper-binding protein [Escherichia coli O145:NM str. 2010C-3526]
 gb|EYV20439.1| copper-binding protein [Escherichia coli O145:NM str. 2010C-3521]
 gb|EYV26520.1| copper-binding protein [Escherichia coli O145:NM str. 2010C-3517]
 gb|EYV29993.1| copper-binding protein [Escherichia coli O145:NM str. 2010C-3518]
 gb|EYV32983.1| copper-binding protein [Escherichia coli O145:NM str. 2010C-3516]
 gb|EYV40944.1| copper-binding protein [Escherichia coli O145:NM str. 2010C-3511]
 gb|EYV42789.1| copper-binding protein [Escherichia coli O145:NM str. 2010C-3510]
 gb|EYV48066.1| copper-binding protein [Escherichia coli O145:NM str. 2010C-3509]
 gb|EYV48951.1| copper-binding protein [Escherichia coli O145:NM str. 2010C-3507]
 gb|EYV98466.1| copper-binding protein [Escherichia coli O86:H34 str. 99-3124]
 gb|EYW91704.1| copper-binding protein [Escherichia coli O145:NM str. 08-4270]
 gb|EYZ16279.1| copper-binding protein [Escherichia coli O145:NM str. 2010C-4557C2]
 gb|EYZ72078.1| copper-binding protein [Escherichia coli O145:NM str. 06-3484]
 gb|EZE93667.1| copper-binding protein [Escherichia coli O145:NM str. 2010C-3508]
 gb|EZQ62146.1| cation efflux system protein CusF [Escherichia coli BIDMC 83]
 gb|EZQ67733.1| cation efflux system protein CusF [Escherichia coli BIDMC 82]
 gb|AHY63563.1| Cation efflux system protein CusF precursor [Escherichia coli 
O145:H28 str. RM12761]
 gb|AHY69117.1| Cation efflux system protein CusF precursor [Escherichia coli 
O145:H28 str. RM12581]
 gb|KCW94268.1| copper-binding protein [Escherichia coli]
 gb|KDF78476.1| cation efflux system protein CusF [Escherichia coli BIDMC 58]
 gb|KDF82312.1| cation efflux system protein CusF [Escherichia coli BIDMC 62]
 gb|KDF82954.1| cation efflux system protein CusF [Escherichia coli BIDMC 63]
 gb|KDF92887.1| cation efflux system protein CusF [Escherichia coli BIDMC 64]
 gb|KDG00919.1| cation efflux system protein CusF [Escherichia coli BIDMC 70]
 gb|KDG08767.1| cation efflux system protein CusF [Escherichia coli BIDMC 71]
 gb|KDG31108.1| cation efflux system protein CusF [Escherichia coli BIDMC 76]
 gb|KDG32681.1| cation efflux system protein CusF [Escherichia coli BIDMC 75]
 gb|KDG35582.1| cation efflux system protein CusF [Escherichia coli BIDMC 78]
 gb|KDG46310.1| cation efflux system protein CusF [Escherichia coli BIDMC 79]
 gb|KDG52741.1| cation efflux system protein CusF [Escherichia coli CHS 69]
 gb|KDG53550.1| cation efflux system protein CusF [Escherichia coli CHS 68]
 gb|KDG75929.1| cation efflux system protein CusF [Escherichia coli UCI 51]
 gb|KDM73633.1| copper-binding protein [Escherichia coli O145:H28 str. 4865/96]
 gb|KDM81344.1| copper-binding protein [Escherichia coli]
 gb|KDN07483.1| Cation efflux system protein CusF precursor [Escherichia coli]
 emb|CDN80933.1| hypothetical protein EC958_0680 [Escherichia coli O25b:H4-ST131]
 gb|KDO88917.1| copper-binding protein [Escherichia coli]
 gb|KDT08960.1| cation efflux system protein CusF [Escherichia coli 2-011-08_S4_C1]
 gb|KDT23992.1| cation efflux system protein CusF [Escherichia coli 2-011-08_S4_C3]
 gb|KDT45038.1| cation efflux system protein CusF [Escherichia coli 3-105-05_S4_C2]
 gb|KDT81675.1| cation efflux system protein CusF [Escherichia coli 3-475-03_S1_C1]
 gb|KDW26234.1| cation efflux system protein CusF [Escherichia coli 2-156-04_S4_C1]
 gb|KDX44741.1| cation efflux system protein CusF [Escherichia coli 2-156-04_S4_C3]
 gb|KDX55325.1| cation efflux system protein CusF [Escherichia coli 2-210-07_S4_C2]
 gb|KDX61335.1| cation efflux system protein CusF [Escherichia coli 2-210-07_S4_C3]
 gb|KDY22350.1| cation efflux system protein CusF [Escherichia coli 2-316-03_S4_C3]
 gb|KDY42943.1| cation efflux system protein CusF [Escherichia coli 2-427-07_S4_C2]
 gb|KEJ14936.1| cation efflux system protein CusF [Escherichia coli 8-415-05_S4_C2]
 gb|KEJ16498.1| cation efflux system protein CusF [Escherichia coli 8-415-05_S4_C1]
 gb|KEJ34619.1| cation efflux system protein CusF [Escherichia coli 8-415-05_S4_C3]
 gb|KEJ41728.1| cation efflux system protein CusF [Escherichia coli 2-460-02_S1_C3]
 gb|KEJ62412.1| cation efflux system protein CusF [Escherichia coli 3-020-07_S4_C1]
 gb|KEJ81109.1| cation efflux system protein CusF [Escherichia coli 6-175-07_S3_C2]
 gb|KEL98253.1| cation efflux system protein CusF [Escherichia coli 6-175-07_S3_C1]
 gb|KEM05926.1| cation efflux system protein CusF [Escherichia coli 6-175-07_S3_C3]
 gb|KEM23841.1| cation efflux system protein CusF [Escherichia coli 6-319-05_S3_C1]
 gb|KEM33884.1| cation efflux system protein CusF [Escherichia coli 6-319-05_S3_C2]
 gb|KEM66183.1| cation efflux system protein CusF [Escherichia coli 6-319-05_S3_C3]
 gb|KEM93983.1| cation efflux system protein CusF [Escherichia coli 2-222-05_S4_C1]
 gb|KEN35467.1| cation efflux system protein CusF [Escherichia coli 8-415-05_S3_C3]
 gb|KEN44771.1| cation efflux system protein CusF [Escherichia coli 8-415-05_S3_C1]
 gb|KEN76396.1| cation efflux system protein CusF [Escherichia coli 8-415-05_S3_C2]
 gb|KEO41774.1| cation efflux system protein CusF [Escherichia coli 2-460-02_S1_C2]
 gb|AID77628.1| copper-binding protein [Escherichia coli Nissle 1917]
 gb|KEP04595.1| copper-binding protein [Escherichia coli]
 gb|KEP06734.1| copper-binding protein [Escherichia coli]
 gb|KEP14374.1| copper-binding protein [Escherichia coli]
 gb|KFD76794.1| copper-binding protein [Escherichia coli]
 gb|AIL17040.1| cation efflux system protein CusF [Escherichia coli ATCC 25922]
 gb|AIL34423.1| Cation efflux system protein CusF [Shigella flexneri 2003036]
 gb|AIL39339.1| Cation efflux system protein CusF [Shigella flexneri Shi06HN006]
 gb|KFZ99609.1| cation efflux system protein CusF [Shigella flexneri]
 gb|KGP49912.1| copper-binding protein [Escherichia coli]
 gb|KGP53903.1| copper-binding protein [Escherichia coli]
 emb|CDX05766.1| Cation efflux system protein cusF precursor,Cation efflux system 
protein CusF precursor,periplasmic copper-binding protein,Uncharacterized 
conserved protein,Copper binding periplasmic 
protein CusF [Shigella flexneri]
 gb|AIX62330.1| copper-binding protein [Escherichia coli]
 gb|KHI27510.1| copper-binding protein [Escherichia coli]
 gb|KHI43495.1| copper-binding protein [Escherichia coli]
 gb|AJO82446.1| copper-binding protein [Escherichia coli]
Length=110

 Score = 81.6 bits (200),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/40 (98%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSL QDIKVSQ
Sbjct  71   MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ  110



>ref|WP_000709870.1| MULTISPECIES: periplasmic copper- and silver-binding protein 
[Enterobacteriaceae]
 ref|NP_415105.1| periplasmic copper- and silver-binding protein [Escherichia coli 
str. K-12 substr. MG1655]
 ref|YP_001457383.1| periplasmic copper-binding protein [Escherichia coli HS]
 ref|YP_001729472.1| copper-binding protein [Escherichia coli str. K-12 substr. DH10B]
 ref|YP_001729573.1| copper-binding protein [Escherichia coli str. K-12 substr. DH10B]
 ref|YP_488860.1| periplasmic copper-binding protein [Escherichia coli str. K-12 
substr. W3110]
 sp|P77214.1|CUSF_ECOLI RecName: Full=Cation efflux system protein CusF; Flags: Precursor 
[Escherichia coli K-12]
 gb|AAB40771.1| hypothetical protein [Escherichia coli]
 gb|AAC73674.1| periplasmic copper- and silver-binding protein [Escherichia coli 
str. K-12 substr. MG1655]
 dbj|BAA35207.1| periplasmic copper-binding protein [Escherichia coli str. K-12 
substr. W3110]
 gb|AAW63707.1| unknown [Citrobacter sp. MY-5]
 gb|ABV05000.1| cation efflux system protein CusF [Escherichia coli HS]
 gb|ACA78697.1| conserved hypothetical protein [Escherichia coli ATCC 8739]
 gb|ACB01694.1| periplasmic copper-binding protein [Escherichia coli str. K-12 
substr. DH10B]
 gb|ACB01795.1| periplasmic copper-binding protein [Escherichia coli str. K-12 
substr. DH10B]
 gb|ACR63996.1| periplasmic copper-binding protein [Escherichia coli BW2952]
 gb|ACX40684.1| periplasmic copper-binding protein [Escherichia coli DH1]
 emb|CBG33432.1| cation efflux system protein [Escherichia coli 042]
 gb|EFI87499.1| cation efflux system protein CusF [Escherichia coli MS 196-1]
 gb|EFJ68449.1| cation efflux system protein CusF [Escherichia coli MS 175-1]
 gb|EFK14945.1| cation efflux system protein CusF [Escherichia coli MS 116-1]
 emb|CBJ00107.1| cation efflux system protein [Escherichia coli ETEC H10407]
 gb|EFQ02433.1| cation efflux system protein cusF [Escherichia coli 1827-70]
 dbj|BAJ42397.1| periplasmic copper-binding protein [Escherichia coli DH1]
 gb|EGB34683.1| cusF protein [Escherichia coli E1520]
 gb|EGB39265.1| cusF protein [Escherichia coli E482]
 gb|EGI32321.1| cation efflux system protein CusF [Escherichia coli TA143]
 gb|AEE55247.1| cation efflux system protein CusF [Escherichia coli UMNK88]
 gb|EGU25261.1| periplasmic copper-binding protein [Escherichia coli XH140A]
 gb|EGV45652.1| periplasmic copper-binding protein [Escherichia coli XH001]
 gb|EGX12707.1| cation efflux system protein cusF [Escherichia coli G58-1]
 dbj|BAL37742.1| periplasmic copper-binding protein [Escherichia coli str. K-12 
substr. MDS42]
 gb|EIE36059.1| cation efflux system protein cusF [Escherichia coli J53]
 gb|EIG49618.1| cation efflux system protein CusF [Escherichia coli H730]
 gb|EIL61711.1| periplasmic copper-binding protein [Escherichia coli 75]
 gb|EJZ49405.1| cation efflux system protein CusF [Escherichia sp. 1_1_43]
 gb|EKJ80161.1| cation efflux system protein cusF [Escherichia coli AD30]
 gb|ELC11659.1| cation efflux system protein CusF [Escherichia coli KTE10]
 gb|ELE04705.1| cation efflux system protein CusF [Escherichia coli KTE51]
 gb|ELE12900.1| cation efflux system protein CusF [Escherichia coli KTE56]
 gb|ELF77487.1| cation efflux system protein CusF [Escherichia coli KTE42]
 gb|ELG05876.1| cation efflux system protein CusF [Escherichia coli KTE50]
 gb|ELH57929.1| cation efflux system protein CusF [Escherichia coli KTE202]
 gb|ELI44886.1| cation efflux system protein CusF [Escherichia coli KTE120]
 gb|ELI58981.1| cation efflux system protein CusF [Escherichia coli KTE125]
 emb|CCP95603.1| Cation efflux system protein CusF precursor [Escherichia coli 
O10:K5(L):H4 str. ATCC 23506]
 gb|EMD14694.1| periplasmic copper-binding protein [Escherichia coli S17]
 gb|EMV47394.1| cation efflux system protein CusF [Escherichia coli BCE019_MS-13]
 gb|EMV64326.1| cation efflux system protein CusF [Escherichia coli 2872000]
 gb|EMV64946.1| cation efflux system protein CusF [Escherichia coli 2871950]
 gb|EMW37461.1| cation efflux system protein CusF [Escherichia coli 2785200]
 gb|EMW63757.1| cation efflux system protein CusF [Escherichia coli 2762100]
 gb|EMW86733.1| cation efflux system protein CusF [Escherichia coli 2731150]
 gb|EMW90352.1| cation efflux system protein CusF [Escherichia coli 180050]
 gb|EMX26590.1| cation efflux system protein CusF [Escherichia coli MP021566.1]
 gb|EMX32455.1| cation efflux system protein CusF [Escherichia coli MP021561.2]
 gb|EMZ74992.1| cation efflux system protein CusF [Escherichia coli 2846750]
 gb|EMZ95130.1| cation efflux system protein CusF [Escherichia coli P0305260.1]
 gb|ENA07638.1| cation efflux system protein CusF [Escherichia coli P0299438.2]
 gb|ENA24775.1| cation efflux system protein CusF [Escherichia coli 201600.1]
 gb|ENA34577.1| cation efflux system protein CusF [Escherichia coli BCE007_MS-11]
 gb|ENA83769.1| cation efflux system protein CusF [Escherichia coli 2730450]
 gb|ENB30694.1| cation efflux system protein CusF [Escherichia coli BCE030_MS-09]
 gb|ENB40615.1| cation efflux system protein CusF [Escherichia coli BCE032_MS-12]
 gb|ENB90215.1| cation efflux system protein CusF [Escherichia coli P0299438.10]
 gb|ENC07567.1| cation efflux system protein CusF [Escherichia coli P0299438.4]
 gb|ENC36747.1| cation efflux system protein CusF [Escherichia coli P0299438.9]
 gb|END60141.1| cation efflux system protein CusF [Escherichia coli BCE006_MS-23]
 gb|END99494.1| cation efflux system protein CusF [Escherichia coli P0301904.3]
 gb|ENE12537.1| cation efflux system protein CusF [Escherichia coli P0305260.2]
 gb|ENF79219.1| cation efflux system protein CusF [Escherichia coli P0305260.10]
 gb|ENF87826.1| cation efflux system protein CusF [Escherichia coli P0305260.11]
 gb|ENF91114.1| cation efflux system protein CusF [Escherichia coli P0305260.12]
 gb|ENF93955.1| cation efflux system protein CusF [Escherichia coli P0305260.13]
 gb|ENF99644.1| cation efflux system protein CusF [Escherichia coli P0305260.15]
 gb|ENG08100.1| cation efflux system protein CusF [Escherichia coli P0305260.4]
 gb|ENG18023.1| cation efflux system protein CusF [Escherichia coli P0305260.5]
 gb|ENG22147.1| cation efflux system protein CusF [Escherichia coli P0305260.6]
 gb|ENG29719.1| cation efflux system protein CusF [Escherichia coli P0305260.8]
 gb|ENG37383.1| cation efflux system protein CusF [Escherichia coli P0305260.9]
 gb|EOU55165.1| cation efflux system protein CusF [Escherichia coli KTE35]
 gb|EOU99541.1| cation efflux system protein CusF [Escherichia coli KTE34]
 gb|EOV29298.1| cation efflux system protein CusF [Escherichia coli KTE198]
 gb|EOW18018.1| cation efflux system protein CusF [Escherichia coli KTE103]
 gb|EOW27002.1| cation efflux system protein CusF [Escherichia coli KTE107]
 gb|EOW50158.1| cation efflux system protein CusF [Escherichia coli KTE130]
 gb|EOW50632.1| cation efflux system protein CusF [Escherichia coli KTE132]
 gb|EQO62112.1| cation efflux system protein CusF [Escherichia coli HVH 43 (4-2173468)]
 gb|EQO74202.1| cation efflux system protein CusF [Escherichia coli HVH 44 (4-2298570)]
 gb|EQQ29463.1| cation efflux system protein CusF [Escherichia coli HVH 91 (4-4638751)]
 gb|EQT43057.1| cation efflux system protein CusF [Escherichia coli HVH 182 (4-0985554)]
 gb|EQV15341.1| cation efflux system protein CusF [Escherichia coli HVH 221 (4-3136817)]
 gb|EQX59754.1| cation efflux system protein CusF [Escherichia coli UMEA 3174-1]
 gb|EQX87653.1| cation efflux system protein CusF [Escherichia coli UMEA 3199-1]
 gb|EQX90329.1| cation efflux system protein CusF [Escherichia coli UMEA 3200-1]
 gb|EQY32242.1| cation efflux system protein CusF [Escherichia coli UMEA 3212-1]
 gb|EQZ04309.1| cation efflux system protein CusF [Escherichia coli UMEA 3318-1]
 gb|EQZ04761.1| cation efflux system protein CusF [Escherichia coli UMEA 3329-1]
 gb|EQZ43157.1| cation efflux system protein CusF [Escherichia coli UMEA 3592-1]
 gb|EQZ45944.1| cation efflux system protein CusF [Escherichia coli UMEA 3609-1]
 gb|ERA09869.1| cation efflux system protein CusF [Escherichia coli UMEA 3718-1]
 gb|ERB04906.1| cation efflux system protein CusF [Escherichia coli KOEGE 3 (4a)]
 gb|ERB19714.1| cation efflux system protein CusF [Escherichia coli UMEA 3144-1]
 gb|AGX32710.1| periplasmic copper- and silver-binding protein [synthetic Escherichia 
coli C321.deltaA]
 gb|ESD97735.1| cation efflux system protein CusF [Escherichia coli 908658]
 gb|ESK03458.1| cation efflux system protein CusF [Escherichia coli HVH 50 (4-2593475)]
 gb|ESL43103.1| cation efflux system protein CusF [Escherichia coli BIDMC 37]
 gb|ESP21539.1| cation efflux system protein CusF [Escherichia coli HVH 136 (4-5970458)]
 gb|ESP49438.1| cation efflux system protein CusF [Escherichia coli UMEA 3148-1]
 emb|CDJ71032.1| copper-binding protein [Escherichia coli str. K-12 substr. MC4100]
 gb|ESS94952.1| Cation efflux system protein CusF precursor [Escherichia coli 
CE549]
 gb|EST60520.1| periplasmic copper-binding protein [Escherichia coli ECC-Z]
 gb|EST74503.1| periplasmic copper-binding protein [Escherichia coli ECA-0157]
 gb|AHF25979.1| periplasmic copper- and silver-binding protein [uncultured bacterium 
Contigcl_1559]
 emb|CDK83677.1| Cation efflux system protein CusF precursor [Escherichia coli 
IS25]
 gb|ETS24776.1| cation transporter [Escherichia coli O6:H16:CFA/II str. B2C]
 gb|EYB50338.1| copper-binding protein [Escherichia coli]
 gb|EYD87415.1| cation efflux system protein CusF [Escherichia coli 1-176-05_S3_C2]
 gb|EYD90522.1| cation efflux system protein CusF [Escherichia coli 1-176-05_S1_C1]
 gb|EYE14823.1| cation efflux system protein CusF [Escherichia coli 1-110-08_S3_C3]
 gb|EYE27987.1| cation efflux system protein CusF [Escherichia coli 1-110-08_S3_C1]
 gb|EYE29285.1| cation efflux system protein CusF [Escherichia coli 1-110-08_S3_C2]
 gb|EYV95585.1| copper-binding protein [Escherichia coli O6:H16 str. 99-3165]
 gb|EZA41113.1| copper-binding protein [Escherichia coli O103:H11 str. 04-3023]
 gb|EZA71219.1| copper-binding protein [Escherichia coli O25:NM str. E2539C1]
 gb|EZA75833.1| copper-binding protein [Escherichia coli O6:H16 str. F5656C1]
 gb|EZB54309.1| copper-binding protein [Escherichia coli O15:H18 str. K1516]
 gb|EZJ76862.1| cation efflux system protein CusF [Escherichia coli 1-392-07_S3_C3]
 gb|EZK01712.1| cation efflux system protein CusF [Escherichia coli 1-250-04_S1_C3]
 gb|EZK09974.1| cation efflux system protein CusF [Escherichia coli 1-176-05_S1_C3]
 gb|EZK24040.1| cation efflux system protein CusF [Escherichia coli 1-176-05_S1_C2]
 emb|CDP72469.1| Cation efflux system protein [Escherichia coli]
 gb|KDP18301.1| copper-binding protein [Escherichia coli]
 gb|KDS99548.1| cation efflux system protein CusF [Escherichia coli 2-011-08_S1_C3]
 gb|KDT22749.1| cation efflux system protein CusF [Escherichia coli 2-052-05_S3_C1]
 gb|KDT30187.1| cation efflux system protein CusF [Escherichia coli 3-105-05_S1_C1]
 gb|KDT61053.1| cation efflux system protein CusF [Escherichia coli 3-373-03_S3_C1]
 gb|KDU07168.1| cation efflux system protein CusF [Escherichia coli 3-105-05_S3_C3]
 gb|KDU31444.1| cation efflux system protein CusF [Escherichia coli 3-373-03_S4_C2]
 gb|KDU49640.1| cation efflux system protein CusF [Escherichia coli 3-475-03_S4_C2]
 gb|KDU53523.1| cation efflux system protein CusF [Escherichia coli 3-373-03_S4_C1]
 gb|KDU59485.1| cation efflux system protein CusF [Escherichia coli 4-203-08_S1_C1]
 gb|KDV88139.1| cation efflux system protein CusF [Escherichia coli 2-052-05_S3_C3]
 gb|KDV91918.1| cation efflux system protein CusF [Escherichia coli 2-052-05_S4_C3]
 gb|KDW09900.1| cation efflux system protein CusF [Escherichia coli 2-156-04_S1_C3]
 gb|KDW11517.1| cation efflux system protein CusF [Escherichia coli 2-156-04_S3_C3]
 gb|KDW50525.1| cation efflux system protein CusF [Escherichia coli 1-392-07_S3_C2]
 gb|KDW97416.1| cation efflux system protein CusF [Escherichia coli 1-392-07_S3_C1]
 gb|KDX24838.1| cation efflux system protein CusF [Escherichia coli 1-250-04_S1_C2]
 gb|KDX28824.1| cation efflux system protein CusF [Escherichia coli 1-250-04_S1_C1]
 gb|KDX44714.1| cation efflux system protein CusF [Escherichia coli 2-177-06_S3_C2]
 gb|KDX52958.1| cation efflux system protein CusF [Escherichia coli 2-210-07_S3_C1]
 gb|KDX82898.1| cation efflux system protein CusF [Escherichia coli 2-222-05_S3_C3]
 gb|KDY13958.1| cation efflux system protein CusF [Escherichia coli 2-316-03_S4_C2]
 gb|KDY39067.1| cation efflux system protein CusF [Escherichia coli 2-427-07_S4_C1]
 gb|KDZ00449.1| cation efflux system protein CusF [Escherichia coli 2-474-04_S1_C2]
 gb|KDZ19056.1| cation efflux system protein CusF [Escherichia coli 3-020-07_S1_C1]
 gb|KDZ20734.1| cation efflux system protein CusF [Escherichia coli 3-020-07_S1_C2]
 gb|KDZ28285.1| cation efflux system protein CusF [Escherichia coli 3-020-07_S1_C3]
 gb|KDZ29216.1| cation efflux system protein CusF [Escherichia coli 3-020-07_S1_C3]
 gb|KDZ58581.1| cation efflux system protein CusF [Escherichia coli 3-073-06_S1_C2]
 gb|KDZ82821.1| cation efflux system protein CusF [Escherichia coli 3-105-05_S1_C3]
 gb|KEK91601.1| cation efflux system protein CusF [Escherichia coli 4-203-08_S1_C3]
 gb|KEK91768.1| cation efflux system protein CusF [Escherichia coli 4-203-08_S1_C2]
 gb|KEK92082.1| cation efflux system protein CusF [Escherichia coli 4-203-08_S3_C3]
 gb|KEL06361.1| cation efflux system protein CusF [Escherichia coli 4-203-08_S3_C2]
 gb|KEL25828.1| cation efflux system protein CusF [Escherichia coli 3-373-03_S4_C3]
 gb|KEL29620.1| cation efflux system protein CusF [Escherichia coli 5-366-08_S4_C2]
 gb|KEL29875.1| cation efflux system protein CusF [Escherichia coli 5-172-05_S4_C2]
 gb|KEL36814.1| cation efflux system protein CusF [Escherichia coli 5-172-05_S4_C1]
 gb|KEL57971.1| cation efflux system protein CusF [Escherichia coli 5-172-05_S1_C3]
 gb|KEL58446.1| cation efflux system protein CusF [Escherichia coli 5-172-05_S4_C3]
 gb|KEM11991.1| cation efflux system protein CusF [Escherichia coli 6-175-07_S4_C2]
 gb|KEM13548.1| cation efflux system protein CusF [Escherichia coli 6-175-07_S4_C1]
 gb|KEM44215.1| cation efflux system protein CusF [Escherichia coli 6-319-05_S4_C2]
 gb|KEM50816.1| cation efflux system protein CusF [Escherichia coli 6-175-07_S4_C3]
 gb|KEM72352.1| cation efflux system protein CusF [Escherichia coli 6-319-05_S4_C3]
 gb|KEM95094.1| cation efflux system protein CusF [Escherichia coli 6-537-08_S4_C1]
 gb|KEN28140.1| cation efflux system protein CusF [Escherichia coli 8-415-05_S1_C1]
 gb|KEN36638.1| cation efflux system protein CusF [Escherichia coli 7-233-03_S4_C1]
 gb|KEN60260.1| cation efflux system protein CusF [Escherichia coli 7-233-03_S4_C3]
 gb|KEN67068.1| cation efflux system protein CusF [Escherichia coli 6-537-08_S4_C2]
 gb|KEN79767.1| cation efflux system protein CusF [Escherichia coli 2-052-05_S3_C2]
 gb|KEN92254.1| cation efflux system protein CusF [Escherichia coli 2-222-05_S3_C1]
 gb|KEO03223.1| cation efflux system protein CusF [Escherichia coli 2-222-05_S3_C2]
 gb|KEO14498.1| cation efflux system protein CusF [Escherichia coli 8-415-05_S1_C2]
 gb|KEO15581.1| cation efflux system protein CusF [Escherichia coli 2-177-06_S3_C3]
 gb|KEO28240.1| cation efflux system protein CusF [Escherichia coli 5-366-08_S4_C1]
 gb|KEP11567.1| copper-binding protein [Escherichia coli]
 gb|AIF35942.1| copper-binding protein [Escherichia coli KLY]
 emb|CDU39660.1| Cation efflux system protein [Escherichia coli]
 emb|CEE10745.1| cation efflux system protein CusF [Escherichia coli]
 gb|AIN31062.1| periplasmic copper- and silver-binding protein [Escherichia coli 
BW25113]
 gb|KGA84372.1| copper-binding protein [Escherichia coli]
 emb|CDY55869.1| copper / silver efflux transport system-periplasmic binding protein, 
subunit of copper/silver transporting efflux system 
[Escherichia coli]
 emb|CDZ19439.1| copper / silver efflux transport system-periplasmic binding protein, 
subunit of copper/silver transporting efflux system 
[Escherichia coli]
 gb|KGL70661.1| periplasmic copper-binding protein [Escherichia coli NCTC 50110]
 gb|KGM64026.1| Periplasmic copper-binding protein [Escherichia coli]
 gb|KGP09051.1| copper-binding protein [Escherichia coli]
 gb|KGP15794.1| copper-binding protein [Escherichia coli]
 gb|KGP19021.1| copper-binding protein [Escherichia coli]
 gb|KGP37906.1| copper-binding protein [Escherichia coli]
 gb|KGT05193.1| copper-binding protein [Escherichia coli]
 gb|KGT10896.1| copper-binding protein [Escherichia coli]
 gb|KGT17035.1| copper-binding protein [Escherichia coli]
 gb|KGT17165.1| copper-binding protein [Escherichia coli]
 gb|KGT27474.1| copper-binding protein [Escherichia coli]
 gb|KGT30488.1| copper-binding protein [Escherichia coli]
 gb|KHD42616.1| copper-binding protein [Escherichia coli]
 gb|KHD44415.1| copper-binding protein [Escherichia coli]
 gb|KHD48173.1| copper-binding protein [Escherichia coli]
 gb|KHD56656.1| copper-binding protein [Escherichia coli]
 gb|KHH49704.1| copper-binding protein [Escherichia coli]
 gb|KHH64017.1| copper-binding protein [Escherichia coli]
 gb|KHH87609.1| copper-binding protein [Escherichia coli]
 gb|KHI13103.1| copper-binding protein [Escherichia coli]
 gb|KHI17429.1| copper-binding protein [Escherichia coli]
 gb|KHI22296.1| copper-binding protein [Escherichia coli]
 gb|KHI52247.1| copper-binding protein [Escherichia coli]
 gb|AIZ31090.1| periplasmic copper- and silver-binding protein [Escherichia coli 
ER2796]
 gb|AIZ54415.1| periplasmic copper- and silver-binding protein [Escherichia coli 
K-12]
 gb|AIZ92284.1| copper-binding protein [Escherichia coli str. K-12 substr. MG1655]
 gb|AJB50724.1| copper-binding protein [Escherichia coli]
 gb|KIE81009.1| copper-binding protein [Escherichia coli]
 gb|KIG79376.1| copper-binding protein [Escherichia coli]
 gb|KIG99679.1| copper-binding protein [Escherichia coli]
 gb|AJF55313.1| periplasmic copper- and silver-binding protein [Escherichia coli 
1303]
 gb|KIZ57516.1| copper-binding protein [Escherichia coli]
 gb|KIZ58212.1| copper-binding protein [Escherichia coli]
 gb|KIZ72729.1| copper-binding protein [Escherichia coli]
 gb|KIZ81671.1| copper-binding protein [Escherichia coli]
 gb|KIZ88138.1| copper-binding protein [Escherichia coli]
 gb|KIZ89488.1| copper-binding protein [Escherichia coli]
 gb|KIZ93099.1| copper-binding protein [Escherichia coli]
 gb|KIZ95837.1| copper-binding protein [Escherichia coli]
 gb|KJA04696.1| copper-binding protein [Escherichia coli]
Length=110

 Score = 81.6 bits (200),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/40 (98%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSL QDIKVSQ
Sbjct  71   MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ  110



>ref|WP_000709865.1| cation transporter [Escherichia coli]
 ref|YP_002386027.1| periplasmic copper-binding protein [Escherichia coli IAI1]
 ref|YP_002401680.1| copper-binding protein [Escherichia coli 55989]
 ref|YP_006780422.1| copper-binding protein [Escherichia coli O104:H4 str. 2011C-3493]
 gb|ABV19755.1| cation efflux system protein CusF [Escherichia coli O139:H28 
str. E24377A]
 gb|EDX39541.1| cation efflux system protein CusF [Escherichia coli 101-1]
 dbj|BAG76161.1| putative cation efflux system protein CusC [Escherichia coli 
SE11]
 emb|CAU96437.1| periplasmic copper-binding protein [Escherichia coli 55989]
 emb|CAQ97425.1| periplasmic copper-binding protein [Escherichia coli IAI1]
 emb|CAQ31040.1| periplasmic copper/silver-binding protein, subunit of copper/silver 
transporting efflux system [Escherichia coli BL21(DE3)]
 gb|ACT30095.1| periplasmic copper-binding protein [Escherichia coli 'BL21-Gold(DE3)pLysS 
AG']
 gb|ACT38221.1| periplasmic copper-binding protein [Escherichia coli B str. REL606]
 gb|ACT42414.1| periplasmic copper-binding protein [Escherichia coli BL21(DE3)]
 gb|EFE64627.1| cation efflux system protein cusF [Escherichia coli B088]
 gb|EFJ95678.1| cation efflux system protein CusF [Escherichia coli MS 115-1]
 gb|EFK24233.1| cation efflux system protein CusF [Escherichia coli MS 187-1]
 gb|EFN35897.1| periplasmic copper-binding protein [Escherichia coli W]
 gb|ADT74153.1| periplasmic copper-binding protein [Escherichia coli W]
 gb|EFZ70311.1| cation efflux system protein cusF [Escherichia coli OK1357]
 gb|ADX51875.1| periplasmic copper-binding protein [Escherichia coli KO11FL]
 gb|EGB41205.1| cusF protein [Escherichia coli H120]
 gb|EGB58816.1| cusF protein [Escherichia coli H489]
 gb|EGB89398.1| cation efflux system protein CusF [Escherichia coli MS 117-3]
 gb|EGC10561.1| cusF protein [Escherichia coli E1167]
 gb|EGR64864.1| periplasmic copper-binding protein [Escherichia coli O104:H4 
str. 01-09591]
 gb|EGR75760.1| periplasmic copper-binding protein [Escherichia coli O104:H4 
str. LB226692]
 gb|EGT66705.1| hypothetical protein C22711_0733 [Escherichia coli O104:H4 str. 
C227-11]
 gb|EGW75853.1| cation efflux system protein cusF [Escherichia coli STEC_B2F1]
 gb|EGX25172.1| cation efflux system protein cusF [Escherichia coli TX1999]
 gb|EHF18826.1| cation efflux system protein CusF [Escherichia coli O104:H4 str. 
04-8351]
 gb|EHF20696.1| cation efflux system protein CusF [Escherichia coli O104:H4 str. 
C227-11]
 gb|EHF27367.1| cation efflux system protein CusF [Escherichia coli O104:H4 str. 
C236-11]
 gb|EHF37640.1| cation efflux system protein CusF [Escherichia coli O104:H4 str. 
09-7901]
 gb|EHF39925.1| cation efflux system protein CusF [Escherichia coli O104:H4 str. 
11-4404]
 gb|EHF43987.1| cation efflux system protein CusF [Escherichia coli O104:H4 str. 
11-3677]
 gb|EHF46267.1| cation efflux system protein CusF [Escherichia coli O104:H4 str. 
11-4522]
 gb|EHF49296.1| cation efflux system protein CusF [Escherichia coli O104:H4 str. 
11-4623]
 gb|EHF61770.1| cation efflux system protein CusF [Escherichia coli O104:H4 str. 
11-4632 C1]
 gb|EHF65957.1| cation efflux system protein CusF [Escherichia coli O104:H4 str. 
11-4632 C2]
 gb|EHF68437.1| cation efflux system protein CusF [Escherichia coli O104:H4 str. 
11-4632 C3]
 gb|EHF78809.1| cation efflux system protein CusF [Escherichia coli O104:H4 str. 
11-4632 C5]
 gb|EHF82457.1| cation efflux system protein CusF [Escherichia coli O104:H4 str. 
11-4632 C4]
 gb|EHV81797.1| cation efflux system protein CusF [Escherichia coli DEC7A]
 gb|EHV90625.1| periplasmic copper/silver-binding protein [Escherichia coli DEC7C]
 gb|EHV95101.1| periplasmic copper/silver-binding protein [Escherichia coli DEC7D]
 gb|EHV99866.1| periplasmic copper/silver-binding protein [Escherichia coli DEC7B]
 gb|EHW04898.1| cation efflux system protein CusF [Escherichia coli DEC7E]
 gb|EHW94953.1| periplasmic copper/silver-binding protein [Escherichia coli DEC10E]
 gb|EHX50352.1| periplasmic copper/silver-binding protein [Escherichia coli DEC13A]
 gb|EHX64709.1| periplasmic copper/silver-binding protein [Escherichia coli DEC13B]
 gb|EHX68828.1| periplasmic copper/silver-binding protein [Escherichia coli DEC13D]
 gb|EHX69077.1| periplasmic copper/silver-binding protein [Escherichia coli DEC13C]
 gb|EHX80079.1| periplasmic copper/silver-binding protein [Escherichia coli DEC13E]
 gb|EHX82284.1| cation efflux system protein CusF [Escherichia coli DEC14A]
 gb|EHX85920.1| periplasmic copper/silver-binding protein [Escherichia coli DEC14B]
 gb|EHX93497.1| periplasmic copper/silver-binding protein [Escherichia coli DEC14C]
 gb|EHX96624.1| periplasmic copper/silver-binding protein [Escherichia coli DEC14D]
 gb|AFH19127.1| periplasmic copper-binding protein [Escherichia coli KO11FL]
 gb|AFH10289.1| periplasmic copper-binding protein [Escherichia coli W]
 gb|EIE53831.1| periplasmic copper-binding protein [Escherichia coli AI27]
 gb|EIH02811.1| cation efflux system protein CusF [Escherichia coli 5.0588]
 gb|EIH26521.1| cation efflux system protein CusF [Escherichia coli 1.2264]
 gb|EIH35779.1| cation efflux system protein CusF [Escherichia coli 96.0497]
 gb|EIH43354.1| cation efflux system protein CusF [Escherichia coli 99.0741]
 gb|EIL80417.1| periplasmic copper-binding protein [Escherichia coli CUMT8]
 gb|EIQ67369.1| cation efflux system protein CusF [Escherichia coli EPECa12]
 gb|EJK97446.1| cation efflux system protein cusF [Escherichia coli STEC_O31]
 gb|AFS58411.1| periplasmic copper-binding protein [Escherichia coli O104:H4 
str. 2009EL-2050]
 gb|AFS75621.1| periplasmic copper-binding protein [Escherichia coli O104:H4 
str. 2011C-3493]
 gb|AFS85078.1| periplasmic copper-binding protein [Escherichia coli O104:H4 
str. 2009EL-2071]
 gb|EKJ61624.1| cation efflux system protein CusF [Escherichia coli 0.1288]
 emb|CCK45734.1| hypothetical protein BN16_10491 [Escherichia coli chi7122]
 emb|CCJ43033.1| hypothetical protein BN17_03561 [Escherichia coli]
 gb|EKY88375.1| cation efflux system protein CusF [Escherichia coli O104:H4 str. 
11-02030]
 gb|EKY88507.1| cation efflux system protein CusF [Escherichia coli O104:H4 str. 
11-02033-1]
 gb|EKY89825.1| cation efflux system protein CusF [Escherichia coli O104:H4 str. 
11-02092]
 gb|EKZ03630.1| cation efflux system protein CusF [Escherichia coli O104:H4 str. 
11-02093]
 gb|EKZ04532.1| cation efflux system protein CusF [Escherichia coli O104:H4 str. 
11-02281]
 gb|EKZ07001.1| cation efflux system protein CusF [Escherichia coli O104:H4 str. 
11-02318]
 gb|EKZ19286.1| cation efflux system protein CusF [Escherichia coli O104:H4 str. 
11-02913]
 gb|EKZ21509.1| cation efflux system protein CusF [Escherichia coli O104:H4 str. 
11-03943]
 gb|EKZ22031.1| cation efflux system protein CusF [Escherichia coli O104:H4 str. 
11-03439]
 gb|EKZ33618.1| cation efflux system protein CusF [Escherichia coli O104:H4 str. 
11-04080]
 gb|EKZ35215.1| cation efflux system protein CusF [Escherichia coli O104:H4 str. 
Ec11-9450]
 gb|EKZ35402.1| cation efflux system protein CusF [Escherichia coli O104:H4 str. 
Ec11-9990]
 gb|EKZ46783.1| cation efflux system protein CusF [Escherichia coli O104:H4 str. 
Ec11-4984]
 gb|EKZ48658.1| cation efflux system protein CusF [Escherichia coli O104:H4 str. 
Ec11-4986]
 gb|EKZ55584.1| cation efflux system protein CusF [Escherichia coli O104:H4 str. 
Ec11-4987]
 gb|EKZ64085.1| cation efflux system protein CusF [Escherichia coli O104:H4 str. 
Ec11-5603]
 gb|EKZ70873.1| cation efflux system protein CusF [Escherichia coli O104:H4 str. 
Ec11-4988]
 gb|EKZ71691.1| cation efflux system protein CusF [Escherichia coli O104:H4 str. 
Ec11-5604]
 gb|EKZ76193.1| cation efflux system protein CusF [Escherichia coli O104:H4 str. 
Ec12-0465]
 gb|EKZ80759.1| cation efflux system protein CusF [Escherichia coli O104:H4 str. 
Ec11-6006]
 gb|EKZ87011.1| cation efflux system protein CusF [Escherichia coli O104:H4 str. 
Ec12-0466]
 gb|EKZ92456.1| cation efflux system protein CusF [Escherichia coli O104:H4 str. 
Ec11-9941]
 gb|ELD31513.1| cation efflux system protein CusF [Escherichia coli KTE212]
 gb|ELD66464.1| cation efflux system protein CusF [Escherichia coli KTE233]
 gb|ELD73132.1| cation efflux system protein CusF [Escherichia coli KTE234]
 gb|ELE65617.1| cation efflux system protein CusF [Escherichia coli KTE77]
 gb|ELF11468.1| cation efflux system protein CusF [Escherichia coli KTE119]
 gb|ELF15675.1| cation efflux system protein CusF [Escherichia coli KTE142]
 gb|ELG00996.1| cation efflux system protein CusF [Escherichia coli KTE48]
 gb|ELG44244.1| cation efflux system protein CusF [Escherichia coli KTE101]
 gb|ELG96429.1| cation efflux system protein CusF [Escherichia coli KTE154]
 gb|ELH54324.1| cation efflux system protein CusF [Escherichia coli KTE203]
 gb|ELI83453.1| cation efflux system protein CusF [Escherichia coli KTE138]
 gb|ELJ18550.1| cation efflux system protein CusF [Escherichia coli KTE163]
 gb|ELJ29124.1| cation efflux system protein CusF [Escherichia coli KTE166]
 gb|ELJ61247.1| cation efflux system protein CusF [Escherichia coli KTE232]
 emb|CCQ01937.1| Cation efflux system protein CusF precursor [Escherichia coli 
O5:K4(L):H4 str. ATCC 23502]
 gb|AGC86021.1| copper-binding protein [Escherichia coli APEC O78]
 gb|EMS05149.1| periplasmic copper-binding protein [Escherichia coli O104:H4 
str. E92/11]
 gb|EMS08270.1| periplasmic copper-binding protein [Escherichia coli O104:H4 
str. E112/10]
 gb|EMU65196.1| cation efflux system protein CusF [Escherichia coli MP021552.7]
 gb|EMU66899.1| cation efflux system protein CusF [Escherichia coli MP021552.11]
 gb|EMU71770.1| cation efflux system protein CusF [Escherichia coli MP021552.12]
 gb|EMW84142.1| cation efflux system protein CusF [Escherichia coli 180600]
 gb|EMX01413.1| cation efflux system protein CusF [Escherichia coli ThroopD]
 gb|EMX04229.1| cation efflux system protein CusF [Escherichia coli P0304777.1]
 gb|EMX10241.1| cation efflux system protein CusF [Escherichia coli P0302308.1]
 gb|EMX11586.1| cation efflux system protein CusF [Escherichia coli 174750]
 gb|EMX43520.1| cation efflux system protein CusF [Escherichia coli MP021552.8]
 gb|EMX59978.1| cation efflux system protein CusF [Escherichia coli MP020940.1]
 gb|EMX65624.1| cation efflux system protein CusF [Escherichia coli Jurua 18/11]
 gb|EMX72124.1| cation efflux system protein CusF [Escherichia coli Envira 10/1]
 gb|EMX77678.1| cation efflux system protein CusF [Escherichia coli Envira 8/11]
 gb|EMX80705.1| cation efflux system protein CusF [Escherichia coli 2726800]
 gb|EMX93386.1| cation efflux system protein CusF [Escherichia coli BCE001_MS16]
 gb|EMZ69017.1| cation efflux system protein CusF [Escherichia coli 174900]
 gb|EMZ99589.1| cation efflux system protein CusF [Escherichia coli P0304816.1]
 gb|ENA07895.1| cation efflux system protein CusF [Escherichia coli P0299917.1]
 gb|ENA87269.1| cation efflux system protein CusF [Escherichia coli 2730350]
 gb|ENB98878.1| cation efflux system protein CusF [Escherichia coli P0299438.11]
 gb|ENC15413.1| cation efflux system protein CusF [Escherichia coli P0299438.5]
 gb|ENC21196.1| cation efflux system protein CusF [Escherichia coli P0299438.6]
 gb|ENC23130.1| cation efflux system protein CusF [Escherichia coli P0299438.7]
 gb|ENC27494.1| cation efflux system protein CusF [Escherichia coli P0299438.8]
 gb|ENC36983.1| cation efflux system protein CusF [Escherichia coli P02997067.6]
 gb|END02413.1| cation efflux system protein CusF [Escherichia coli P0302308.10]
 gb|END05471.1| cation efflux system protein CusF [Escherichia coli P0302308.11]
 gb|END14649.1| cation efflux system protein CusF [Escherichia coli P0302308.3]
 gb|END17241.1| cation efflux system protein CusF [Escherichia coli P0302308.2]
 gb|END24509.1| cation efflux system protein CusF [Escherichia coli P0302308.5]
 gb|END28378.1| cation efflux system protein CusF [Escherichia coli P0302308.4]
 gb|END35105.1| cation efflux system protein CusF [Escherichia coli 179100]
 gb|END44628.1| cation efflux system protein CusF [Escherichia coli 2854350]
 gb|ENE58693.1| cation efflux system protein CusF [Escherichia coli P0304777.11]
 gb|ENE69125.1| cation efflux system protein CusF [Escherichia coli P0304777.12]
 gb|ENE71164.1| cation efflux system protein CusF [Escherichia coli P0304777.13]
 gb|ENE75836.1| cation efflux system protein CusF [Escherichia coli P0304777.14]
 gb|ENE81034.1| cation efflux system protein CusF [Escherichia coli P0304777.15]
 gb|ENE85728.1| cation efflux system protein CusF [Escherichia coli P0304777.2]
 gb|ENE89081.1| cation efflux system protein CusF [Escherichia coli P0304777.3]
 gb|ENF02814.1| cation efflux system protein CusF [Escherichia coli P0304777.7]
 gb|ENF06861.1| cation efflux system protein CusF [Escherichia coli P0304777.5]
 gb|ENF13921.1| cation efflux system protein CusF [Escherichia coli P0304777.8]
 gb|ENF15185.1| cation efflux system protein CusF [Escherichia coli P0304777.9]
 gb|ENF22718.1| cation efflux system protein CusF [Escherichia coli P0304816.11]
 gb|ENF26368.1| cation efflux system protein CusF [Escherichia coli P0304816.10]
 gb|ENF34585.1| cation efflux system protein CusF [Escherichia coli P0304816.12]
 gb|ENF38145.1| cation efflux system protein CusF [Escherichia coli P0304816.14]
 gb|ENF40714.1| cation efflux system protein CusF [Escherichia coli P0304816.15]
 gb|ENF42532.1| cation efflux system protein CusF [Escherichia coli P0304816.13]
 gb|ENF56197.1| cation efflux system protein CusF [Escherichia coli P0304816.6]
 gb|ENF56355.1| cation efflux system protein CusF [Escherichia coli P0304816.2]
 gb|ENF64036.1| cation efflux system protein CusF [Escherichia coli P0304816.7]
 gb|ENF73539.1| cation efflux system protein CusF [Escherichia coli P0304816.8]
 gb|ENF76326.1| cation efflux system protein CusF [Escherichia coli P0304816.9]
 gb|ENG88595.1| cation efflux system protein CusF [Escherichia coli 178200]
 gb|ENH07302.1| cation efflux system protein CusF [Escherichia coli 178850]
 gb|ENH23922.1| cation efflux system protein CusF [Escherichia coli P0302308.14]
 gb|ENH24378.1| cation efflux system protein CusF [Escherichia coli P0302308.12]
 gb|ENH26066.1| cation efflux system protein CusF [Escherichia coli P0302308.13]
 gb|ENH37164.1| cation efflux system protein CusF [Escherichia coli P0304816.4]
 gb|ENH38242.1| cation efflux system protein CusF [Escherichia coli P0304816.3]
 gb|ENH42716.1| cation efflux system protein CusF [Escherichia coli P0304816.5]
 gb|EOV38649.1| cation efflux system protein CusF [Escherichia coli KTE222]
 gb|EOV44077.1| cation efflux system protein CusF [Escherichia coli KTE221]
 gb|EOV64915.1| cation efflux system protein CusF [Escherichia coli KTE64]
 gb|EOW09977.1| cation efflux system protein CusF [Escherichia coli KTE100]
 gb|EQN71389.1| cation efflux system protein CusF [Escherichia coli HVH 18 (4-8589585)]
 gb|EQP85446.1| cation efflux system protein CusF [Escherichia coli HVH 82 (4-2209276)]
 gb|EQS01449.1| cation efflux system protein CusF [Escherichia coli HVH 139 (4-3192644)]
 gb|EQS58316.1| cation efflux system protein CusF [Escherichia coli HVH 150 (4-3258106)]
 gb|EQV45980.1| cation efflux system protein CusF [Escherichia coli KOEGE 40 
(102a)]
 gb|EQW15108.1| cation efflux system protein CusF [Escherichia coli KOEGE 131 
(358a)]
 gb|EQW91644.1| cation efflux system protein CusF [Escherichia coli UMEA 3124-1]
 gb|EQY01637.1| cation efflux system protein CusF [Escherichia coli UMEA 3201-1]
 gb|EQY68251.1| cation efflux system protein CusF [Escherichia coli UMEA 3240-1]
 gb|EQY92538.1| cation efflux system protein CusF [Escherichia coli UMEA 3314-1]
 gb|EQZ20050.1| cation efflux system protein CusF [Escherichia coli UMEA 3355-1]
 gb|ERA09709.1| cation efflux system protein CusF [Escherichia coli UMEA 3805-1]
 gb|ERB09508.1| cation efflux system protein CusF [Escherichia coli KOEGE 7 (16a)]
 gb|ERB23870.1| cation efflux system protein CusF [Escherichia coli UMEA 3151-1]
 gb|ERC62809.1| cation efflux system protein CusF [Escherichia coli TW07509]
 gb|ERF90555.1| cation transporter [Escherichia coli O104:H21 str. CFSAN002236]
 gb|ERF96796.1| cation transporter [Escherichia coli O104:H21 str. CFSAN002237]
 gb|AGW07983.1| cation transporter [Escherichia coli LY180]
 gb|ESC92505.1| cation efflux system protein CusF [Escherichia coli 113302]
 gb|ESD74308.1| cation efflux system protein CusF [Escherichia coli 908555]
 gb|ESK09339.1| cation efflux system protein CusF [Escherichia coli UMEA 3336-1]
 gb|ESL25843.1| cation efflux system protein CusF [Escherichia coli BIDMC 39]
 gb|ESP10277.1| cation efflux system protein CusF [Escherichia coli HVH 36 (4-5675286)]
 gb|ESP48691.1| cation efflux system protein CusF [Escherichia coli HVH 152 (4-3447545)]
 gb|EST66146.1| periplasmic copper-binding protein [Escherichia coli P4-96]
 gb|EST70797.1| periplasmic copper-binding protein [Escherichia coli P4-NR]
 emb|CDK75293.1| Cation efflux system protein CusF precursor [Klebsiella pneumoniae 
IS22]
 gb|AHM28603.1| copper-binding protein [Escherichia coli]
 gb|AHM35530.1| copper-binding protein [Escherichia coli]
 gb|AHM40127.1| copper-binding protein [Escherichia coli]
 gb|EYB48594.1| copper-binding protein [Escherichia coli]
 gb|EYD92062.1| cation efflux system protein CusF [Escherichia coli 1-176-05_S3_C1]
 gb|EYX61936.1| copper-binding protein [Escherichia coli O104:H4 str. 2011EL-1675A]
 gb|EYZ46230.1| copper-binding protein [Escherichia coli O91:H14 str. 06-3691]
 gb|EYZ57689.1| copper-binding protein [Escherichia coli O79:H7 str. 06-3501]
 gb|EZA02498.1| copper-binding protein [Escherichia coli O174:H21 str. 03-3269]
 gb|EZA64489.1| copper-binding protein [Escherichia coli O104:H21 str. 94-3025]
 gb|EZD81255.1| copper-binding protein [Escherichia coli O39:NM str. F8704-2]
 gb|EZD90438.1| copper-binding protein [Escherichia coli O91:H14 str. 2009C-3227]
 gb|EZE29416.1| copper-binding protein [Escherichia coli O91:NM str. 2009C-3745]
 gb|EZE65925.1| copper-binding protein [Escherichia coli O91:H21 str. 2009C-4646]
 gb|EZJ31247.1| cation efflux system protein CusF [Escherichia coli 1-392-07_S4_C2]
 gb|EZJ47562.1| cation efflux system protein CusF [Escherichia coli 1-250-04_S4_C2]
 gb|EZJ58292.1| cation efflux system protein CusF [Escherichia coli 1-250-04_S4_C1]
 gb|EZJ79033.1| cation efflux system protein CusF [Escherichia coli 1-182-04_S3_C3]
 gb|EZJ90328.1| cation efflux system protein CusF [Escherichia coli 1-182-04_S3_C2]
 gb|EZJ98796.1| cation efflux system protein CusF [Escherichia coli 1-182-04_S1_C3]
 gb|EZK03644.1| cation efflux system protein CusF [Escherichia coli 1-182-04_S3_C1]
 gb|EZK18376.1| cation efflux system protein CusF [Escherichia coli 2-005-03_S1_C3]
 gb|EZK32916.1| cation efflux system protein CusF [Escherichia coli 1-182-04_S1_C1]
 gb|EZK36174.1| cation efflux system protein CusF [Escherichia coli 2-005-03_S1_C2]
 gb|EZK52828.1| cation efflux system protein CusF [Escherichia coli 2-005-03_S1_C1]
 gb|KDA65411.1| cation efflux system protein CusF [Escherichia coli 2-052-05_S1_C1]
 gb|KDA70076.1| cation efflux system protein CusF [Escherichia coli 1-182-04_S1_C2]
 gb|KDG67579.1| cation efflux system protein CusF [Escherichia coli MGH 57]
 gb|KDG81184.1| cation efflux system protein CusF [Escherichia coli UCI 53]
 gb|KDT16679.1| cation efflux system protein CusF [Escherichia coli 2-052-05_S1_C3]
 gb|KDT77130.1| cation efflux system protein CusF [Escherichia coli 3-373-03_S1_C2]
 gb|KDU34271.1| cation efflux system protein CusF [Escherichia coli 3-373-03_S1_C3]
 gb|KDU42537.1| cation efflux system protein CusF [Escherichia coli 3-373-03_S1_C1]
 gb|KDV46831.1| copper-binding protein [Escherichia coli O91:H21 str. 2009C-3740]
 gb|KDW24937.1| cation efflux system protein CusF [Escherichia coli 2-177-06_S1_C1]
 gb|KDW36856.1| cation efflux system protein CusF [Escherichia coli 2-177-06_S1_C2]
 gb|KDW43963.1| cation efflux system protein CusF [Escherichia coli 2-177-06_S4_C2]
 gb|KDW44268.1| cation efflux system protein CusF [Escherichia coli 2-177-06_S1_C3]
 gb|KDW50979.1| cation efflux system protein CusF [Escherichia coli 2-005-03_S3_C1]
 gb|KDW63598.1| cation efflux system protein CusF [Escherichia coli 2-005-03_S3_C3]
 gb|KDW85021.1| cation efflux system protein CusF [Escherichia coli 2-210-07_S4_C1]
 gb|KDX07969.1| cation efflux system protein CusF [Escherichia coli 2-177-06_S4_C3]
 gb|KDX88172.1| cation efflux system protein CusF [Escherichia coli 2-316-03_S3_C1]
 gb|KDX91438.1| cation efflux system protein CusF [Escherichia coli 2-222-05_S4_C2]
 gb|KDY31469.1| cation efflux system protein CusF [Escherichia coli 2-427-07_S3_C1]
 gb|KDY32258.1| cation efflux system protein CusF [Escherichia coli 2-427-07_S3_C3]
 gb|KDZ05884.1| cation efflux system protein CusF [Escherichia coli 2-474-04_S4_C2]
 gb|KDZ12414.1| cation efflux system protein CusF [Escherichia coli 2-474-04_S4_C3]
 gb|KDZ79553.1| cation efflux system protein CusF [Escherichia coli 3-105-05_S1_C2]
 gb|KEK77179.1| cation efflux system protein CusF [Escherichia coli 3-475-03_S3_C1]
 gb|KEL38423.1| cation efflux system protein CusF [Escherichia coli 5-172-05_S3_C3]
 gb|KEN87497.1| cation efflux system protein CusF [Escherichia coli 2-474-04_S4_C1]
 gb|KEO19431.1| cation efflux system protein CusF [Escherichia coli 2-222-05_S4_C3]
 gb|KEO94625.1| copper-binding protein [Escherichia coli]
 gb|KFF40091.1| copper-binding protein [Escherichia coli]
 gb|KFF51981.1| copper-binding protein [Escherichia coli]
 gb|KFV22583.1| copper-binding protein [Escherichia coli]
 gb|KFV27367.1| copper-binding protein [Escherichia coli]
 gb|KFV37855.1| copper-binding protein [Escherichia coli]
 gb|KGI51172.1| Cation efflux system protein CusF precursor [Escherichia coli]
 gb|KGM59915.1| Periplasmic copper-binding protein [Escherichia coli G3/10]
 gb|KHG71506.1| copper-binding protein [Escherichia coli]
 gb|KHG81245.1| copper-binding protein [Escherichia coli]
 gb|KHG83210.1| copper-binding protein [Escherichia coli]
 gb|KHG88139.1| copper-binding protein [Escherichia coli]
 gb|KHH07478.1| copper-binding protein [Escherichia coli]
 gb|KHH27188.1| copper-binding protein [Escherichia coli]
 gb|KHH28555.1| copper-binding protein [Escherichia coli]
 gb|KHH37304.1| copper-binding protein [Escherichia coli]
 gb|KHH42205.1| copper-binding protein [Escherichia coli]
 gb|KHH47131.1| copper-binding protein [Escherichia coli]
 gb|KHH74987.1| copper-binding protein [Escherichia coli]
 gb|KHH77130.1| copper-binding protein [Escherichia coli]
 gb|KHI00277.1| copper-binding protein [Escherichia coli]
 gb|KHI03992.1| copper-binding protein [Escherichia coli]
 gb|KHI36086.1| copper-binding protein [Escherichia coli]
 gb|KHI50318.1| copper-binding protein [Escherichia coli]
 gb|KHI54397.1| copper-binding protein [Escherichia coli]
 gb|KHI65604.1| copper-binding protein [Escherichia coli]
 gb|KHI72165.1| copper-binding protein [Escherichia coli]
 gb|KHI85315.1| copper-binding protein [Escherichia coli]
 gb|KHJ14300.1| copper-binding protein [Escherichia coli]
 gb|AIZ86124.1| copper-binding protein [Escherichia coli]
 emb|CCQ27468.2| periplasmic copper-and silver-binding protein [Escherichia coli]
 gb|KIG26701.1| copper-binding protein [Escherichia coli C691-71 (14b)]
 gb|KIG31579.1| copper-binding protein [Escherichia coli]
 gb|KIG48933.1| copper-binding protein [Escherichia coli]
 gb|KIG83970.1| copper-binding protein [Escherichia coli]
 gb|KIH24986.1| copper-binding protein [Escherichia coli]
 gb|KIH25315.1| copper-binding protein [Escherichia coli]
 gb|AJE54895.1| cation efflux system protein CusF [Escherichia coli]
 gb|AJF75906.1| copper-binding protein [Escherichia coli]
 gb|KIN86626.1| copper-binding protein [Escherichia coli]
 gb|AJH09462.1| copper-binding protein [Escherichia coli]
 gb|KIQ39032.1| copper-binding protein [Escherichia coli]
 gb|KIQ43864.1| copper-binding protein [Escherichia coli]
 gb|KJD60161.1| copper-binding protein [Escherichia coli]
 gb|KJD64978.1| copper-binding protein [Escherichia coli]
 gb|KJD70564.1| copper-binding protein [Escherichia coli]
 gb|KJD70821.1| copper-binding protein [Escherichia coli]
 gb|KJD72051.1| copper-binding protein [Escherichia coli]
 gb|KJD88646.1| copper-binding protein [Escherichia coli]
Length=110

 Score = 81.6 bits (200),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/40 (98%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSL QDIKVSQ
Sbjct  71   MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ  110



>ref|WP_000709864.1| cation efflux system protein CusF [Escherichia coli]
 gb|EMX21845.1| cation efflux system protein CusF [Escherichia coli P0301867.1]
 gb|EMX90170.1| cation efflux system protein CusF [Escherichia coli 2719100]
 gb|ENA47285.1| cation efflux system protein CusF [Escherichia coli P0301867.2]
 gb|ENC93264.1| cation efflux system protein CusF [Escherichia coli P0301867.11]
 gb|END09952.1| cation efflux system protein CusF [Escherichia coli P0301867.8]
 gb|END95522.1| cation efflux system protein CusF [Escherichia coli P0301867.13]
 gb|ENG99684.1| cation efflux system protein CusF [Escherichia coli P0301867.3]
 gb|ENH04566.1| cation efflux system protein CusF [Escherichia coli P0301867.5]
 gb|ENH10680.1| cation efflux system protein CusF [Escherichia coli P0301867.7]
 gb|KEM43436.1| cation efflux system protein CusF [Escherichia coli 6-537-08_S1_C1]
 gb|KEN52115.1| cation efflux system protein CusF [Escherichia coli 6-537-08_S1_C2]
 gb|KEN59889.1| cation efflux system protein CusF [Escherichia coli 6-537-08_S1_C3]
 gb|KHH65385.1| copper-binding protein [Escherichia coli]
 gb|KIG55589.1| copper-binding protein [Escherichia coli]
Length=110

 Score = 81.6 bits (200),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/40 (98%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSL QDIKVSQ
Sbjct  71   MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ  110



>ref|WP_033868452.1| copper-binding protein [Escherichia coli]
 gb|KEL75389.1| cation efflux system protein CusF [Escherichia coli 5-366-08_S3_C3]
 gb|KEL93864.1| cation efflux system protein CusF [Escherichia coli 5-366-08_S3_C1]
Length=110

 Score = 81.6 bits (200),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/40 (98%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSL QDIKVSQ
Sbjct  71   MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ  110



>ref|WP_001224007.1| cation transporter [Escherichia coli]
 gb|EHN90401.1| cation efflux system protein cusF [Escherichia coli B093]
Length=110

 Score = 81.6 bits (200),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/40 (98%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSL QDIKVSQ
Sbjct  71   MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ  110



>ref|WP_024243600.1| copper-binding protein [Escherichia coli]
 gb|KHH72995.1| copper-binding protein [Escherichia coli]
 gb|KIH06872.1| copper-binding protein [Escherichia coli]
Length=110

 Score = 81.6 bits (200),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/40 (98%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSL QDIKVSQ
Sbjct  71   MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ  110



>ref|WP_001487014.1| cation efflux system protein CusF [Escherichia coli]
 gb|ENA41381.1| cation efflux system protein CusF [Escherichia coli P0301867.4]
Length=110

 Score = 81.6 bits (200),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/40 (98%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSL QDIKVSQ
Sbjct  71   MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ  110



>gb|KFH90026.1| copper-binding protein [Escherichia coli]
Length=110

 Score = 81.6 bits (200),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/40 (98%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSL QDIKVSQ
Sbjct  71   MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ  110



>ref|WP_023156492.1| cation efflux system protein CusF [Escherichia coli]
 gb|ESA70753.1| cation efflux system protein CusF [Escherichia coli 907357]
Length=110

 Score = 81.6 bits (200),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/40 (98%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSL QDIKVSQ
Sbjct  71   MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ  110



>ref|WP_000753226.1| MULTISPECIES: cation transporter [Escherichia]
 gb|EIL45906.1| periplasmic copper-binding protein [Escherichia coli KD1]
 gb|ELC21999.1| cation efflux system protein CusF [Escherichia sp. KTE11]
 gb|EOV43227.1| cation efflux system protein CusF [Escherichia sp. KTE52]
 gb|EOV90880.1| cation efflux system protein CusF [Escherichia sp. KTE96]
 gb|EOW67279.1| cation efflux system protein CusF [Escherichia sp. KTE159]
 gb|EQN86687.1| cation efflux system protein CusF [Escherichia coli HVH 24 (4-5985145)]
Length=110

 Score = 81.6 bits (200),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/40 (98%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSL QDIKVSQ
Sbjct  71   MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ  110



>ref|WP_000709881.1| cation transporter [Escherichia coli]
 gb|EGI42419.1| cation efflux system protein CusF [Escherichia coli TA280]
Length=110

 Score = 81.6 bits (200),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/40 (98%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSL QDIKVSQ
Sbjct  71   MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ  110



>gb|EHU13917.1| periplasmic copper/silver-binding protein [Escherichia coli DEC1A]
Length=102

 Score = 81.3 bits (199),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/40 (98%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSL QDIKVSQ
Sbjct  63   MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ  102



>ref|WP_001597667.1| cation efflux system protein CusF [Escherichia coli]
 gb|ELG64798.1| cation efflux system protein CusF [Escherichia coli KTE135]
 emb|CDP67300.1| Cation efflux system protein [Escherichia coli D6-113.11]
 emb|CDU34491.1| Cation efflux system protein [Escherichia coli D6-113.11]
Length=110

 Score = 81.6 bits (200),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/40 (98%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSL QDIKVSQ
Sbjct  71   MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ  110



>ref|WP_001558773.1| cation efflux system protein CusF [Escherichia coli]
 gb|ELE45538.1| cation efflux system protein CusF [Escherichia coli KTE66]
Length=110

 Score = 81.6 bits (200),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/40 (98%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSL QDIKVSQ
Sbjct  71   MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ  110



>ref|WP_001522508.1| cation efflux system protein CusF [Escherichia coli]
 gb|ELC42948.1| cation efflux system protein CusF [Escherichia coli KTE21]
 gb|EOU72474.1| cation efflux system protein CusF [Escherichia coli KTE20]
 gb|EQO01970.1| cation efflux system protein CusF [Escherichia coli HVH 25 (4-5851939)]
 gb|EQP42753.1| cation efflux system protein CusF [Escherichia coli HVH 65 (4-2262045)]
 gb|EQW07384.1| cation efflux system protein CusF [Escherichia coli KOEGE 77 
(202a)]
 gb|ESA69358.1| cation efflux system protein CusF [Escherichia coli 110957]
 gb|ESD34094.1| cation efflux system protein CusF [Escherichia coli 907889]
 gb|ESK41430.1| cation efflux system protein CusF [Escherichia coli UMEA 3323-1]
 gb|ETY49969.1| cation efflux system protein CusF [Escherichia coli BWH 40]
 gb|KDG37085.1| cation efflux system protein CusF [Escherichia coli BIDMC 77]
Length=110

 Score = 81.6 bits (200),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/40 (98%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSL QDIKVSQ
Sbjct  71   MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ  110



>gb|EKI42802.1| cation efflux system protein CusF [Escherichia coli 3006]
Length=102

 Score = 81.3 bits (199),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/40 (98%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSL QDIKVSQ
Sbjct  63   MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ  102



>ref|WP_000709861.1| cation efflux system protein CusF [Escherichia coli]
 gb|EMW44952.1| cation efflux system protein CusF [Escherichia coli 2770900]
 gb|EMW79923.1| cation efflux system protein CusF [Escherichia coli 2747800]
 gb|EMZ87830.1| cation efflux system protein CusF [Escherichia coli p0305293.1]
 gb|ENA55747.1| cation efflux system protein CusF [Escherichia coli 2729250]
 gb|ENB10449.1| cation efflux system protein CusF [Escherichia coli 2866350]
 gb|END54697.1| cation efflux system protein CusF [Escherichia coli p0305293.13]
 gb|ENE14921.1| cation efflux system protein CusF [Escherichia coli p0305293.14]
 gb|ENG35444.1| cation efflux system protein CusF [Escherichia coli p0305293.10]
 gb|ENG46524.1| cation efflux system protein CusF [Escherichia coli p0305293.12]
 gb|ENG47439.1| cation efflux system protein CusF [Escherichia coli p0305293.11]
 gb|ENG55224.1| cation efflux system protein CusF [Escherichia coli p0305293.15]
 gb|ENG59893.1| cation efflux system protein CusF [Escherichia coli p0305293.2]
 gb|ENG65778.1| cation efflux system protein CusF [Escherichia coli p0305293.3]
 gb|ENG73367.1| cation efflux system protein CusF [Escherichia coli p0305293.8]
 gb|ENG79657.1| cation efflux system protein CusF [Escherichia coli p0305293.9]
 gb|ENH47569.1| cation efflux system protein CusF [Escherichia coli p0305293.5]
 gb|ENH54260.1| cation efflux system protein CusF [Escherichia coli p0305293.7]
 gb|ENH58316.1| cation efflux system protein CusF [Escherichia coli p0305293.6]
 gb|EPH48750.1| Cation efflux system protein CusF precursor [Escherichia coli 
E2265]
 gb|ESV03058.1| Cation efflux system protein CusF precursor [Escherichia coli 
E1777]
 gb|KEM16775.1| cation efflux system protein CusF [Escherichia coli 6-319-05_S1_C2]
 gb|KEM35066.1| cation efflux system protein CusF [Escherichia coli 6-319-05_S1_C3]
 gb|KEN09742.1| cation efflux system protein CusF [Escherichia coli 6-319-05_S1_C1]
Length=110

 Score = 81.3 bits (199),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/40 (98%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSL QDIKVSQ
Sbjct  71   MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ  110



>gb|ENG06681.1| cation efflux system protein CusF [Escherichia coli P0305260.3]
 gb|ENG22570.1| cation efflux system protein CusF [Escherichia coli P0305260.7]
Length=102

 Score = 81.3 bits (199),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/40 (98%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSL QDIKVSQ
Sbjct  63   MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ  102



>ref|WP_001462306.1| cation efflux system protein CusF [Escherichia coli]
 gb|EMV24113.1| cation efflux system protein CusF [Escherichia coli C-34666]
 gb|EMZ82720.1| cation efflux system protein CusF [Escherichia coli 199900.1]
 gb|ENC03236.1| cation efflux system protein CusF [Escherichia coli P0299438.3]
 gb|ENE50082.1| cation efflux system protein CusF [Escherichia coli P0304777.10]
 gb|ENE95971.1| cation efflux system protein CusF [Escherichia coli P0304777.4]
Length=110

 Score = 81.3 bits (199),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/40 (98%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSL QDIKVSQ
Sbjct  71   MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ  110



>ref|WP_033557456.1| copper-binding protein [Escherichia coli]
Length=110

 Score = 81.3 bits (199),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/40 (98%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSL QDIKVSQ
Sbjct  71   MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ  110



>ref|WP_032183576.1| copper-binding protein [Escherichia coli]
 gb|KDA59482.1| cation efflux system protein CusF [Escherichia coli 2-011-08_S1_C1]
 gb|KDW34068.1| cation efflux system protein CusF [Escherichia coli 2-156-04_S3_C2]
Length=110

 Score = 81.3 bits (199),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/40 (98%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSL QDIKVSQ
Sbjct  71   MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ  110



>ref|WP_000709880.1| MULTISPECIES: cation transporter [Escherichia]
 gb|EFK92614.1| cation efflux system protein CusF [Escherichia coli MS 146-1]
 gb|EFU97133.1| cation efflux system protein cusF [Escherichia coli 3431]
 gb|EGB67408.1| cusF protein [Escherichia coli TA007]
 gb|EGI10084.1| cation efflux system protein CusF [Escherichia coli H736]
 gb|AEJ55200.1| cation efflux system protein cusF [Escherichia coli UMNF18]
 gb|EGW98167.1| cation efflux system protein cusF [Escherichia coli STEC_EH250]
 gb|EGX20502.1| cation efflux system protein cusF [Escherichia coli STEC_S1191]
 gb|EHV62631.1| cation efflux system protein CusF [Escherichia coli DEC6A]
 gb|EHV64744.1| periplasmic copper/silver-binding protein [Escherichia coli DEC6B]
 gb|EHV66418.1| cation efflux system protein CusF [Escherichia coli DEC6C]
 gb|EHV76784.1| cation efflux system protein CusF [Escherichia coli DEC6D]
 gb|EHV79281.1| periplasmic copper/silver-binding protein [Escherichia coli DEC6E]
 gb|AFG39435.1| periplasmic copper-binding protein [Escherichia coli P12b]
 gb|EIF16414.1| periplasmic copper-binding protein [Escherichia coli O32:H37 
str. P4]
 gb|EIF86854.1| cation efflux system protein CusF [Escherichia coli M919]
 gb|EIG71905.1| cation efflux system protein CusF [Escherichia sp. 4_1_40B]
 gb|EII47889.1| cation efflux system protein CusF [Escherichia coli 2.3916]
 gb|EII69015.1| cation efflux system protein CusF [Escherichia coli 2.4168]
 gb|EII78904.1| cation efflux system protein CusF [Escherichia coli 3.2303]
 gb|EKI23756.1| cation efflux system protein CusF [Escherichia coli TW15901]
 gb|EKI30708.1| cation efflux system protein CusF [Escherichia coli TW00353]
 gb|EKK48724.1| cation efflux system protein CusF [Escherichia coli 8.0566]
 gb|EKK49286.1| cation efflux system protein CusF [Escherichia coli 8.0569]
 gb|ELC63977.1| cation efflux system protein CusF [Escherichia coli KTE44]
 gb|ELE74197.1| cation efflux system protein CusF [Escherichia coli KTE81]
 gb|ELF01846.1| cation efflux system protein CusF [Escherichia coli KTE111]
 gb|ELF22010.1| cation efflux system protein CusF [Escherichia coli KTE156]
 gb|ELF26728.1| cation efflux system protein CusF [Escherichia coli KTE161]
 gb|ELF41023.1| cation efflux system protein CusF [Escherichia coli KTE171]
 gb|ELH50123.1| cation efflux system protein CusF [Escherichia coli KTE197]
 gb|EMR96095.1| periplasmic copper-binding protein [Escherichia coli ONT:H33 
str. C48/93]
 gb|EMS10182.1| periplasmic copper-binding protein [Escherichia coli O127:H27 
str. C43/90]
 gb|EMZ88308.1| cation efflux system protein CusF [Escherichia coli 2722950]
 gb|ENA56878.1| cation efflux system protein CusF [Escherichia coli 2726950]
 gb|ENB24988.1| cation efflux system protein CusF [Escherichia coli BCE011_MS-01]
 gb|EOU70202.1| cation efflux system protein CusF [Escherichia coli KTE14]
 gb|EOV15288.1| cation efflux system protein CusF [Escherichia coli KTE40]
 gb|EOV54934.1| cation efflux system protein CusF [Escherichia coli KTE61]
 gb|EOV83282.1| cation efflux system protein CusF [Escherichia coli KTE71]
 gb|EOW62109.1| cation efflux system protein CusF [Escherichia coli KTE155]
 gb|EOX00525.1| cation efflux system protein CusF [Escherichia coli KTE41]
 gb|EQS85068.1| cation efflux system protein CusF [Escherichia coli HVH 164 (4-5953081)]
 gb|EQU64684.1| cation efflux system protein CusF [Escherichia coli HVH 209 (4-3062651)]
 gb|EQW98049.1| cation efflux system protein CusF [Escherichia coli UMEA 3139-1]
 gb|EQX69302.1| cation efflux system protein CusF [Escherichia coli UMEA 3180-1]
 gb|EQY83476.1| cation efflux system protein CusF [Escherichia coli UMEA 3317-1]
 gb|ERA22330.1| cation efflux system protein CusF [Escherichia coli UMEA 3889-1]
 gb|ERB15657.1| cation efflux system protein CusF [Escherichia coli UMEA 3150-1]
 gb|ERB32327.1| cation efflux system protein CusF [Escherichia coli UMEA 3271-1]
 gb|EYE05149.1| cation efflux system protein CusF [Escherichia coli 1-110-08_S4_C3]
 gb|EYE06164.1| cation efflux system protein CusF [Escherichia coli 1-110-08_S4_C2]
 gb|EYE28318.1| cation efflux system protein CusF [Escherichia coli 1-110-08_S1_C3]
 gb|EYE39817.1| cation efflux system protein CusF [Escherichia coli 1-110-08_S1_C1]
 gb|EZA71203.1| copper-binding protein [Escherichia coli O157:H16 str. 98-3133]
 gb|EZJ29425.1| cation efflux system protein CusF [Escherichia coli 1-176-05_S4_C3]
 gb|EZJ74378.1| cation efflux system protein CusF [Escherichia coli 1-176-05_S4_C1]
 gb|KDA81132.1| cation efflux system protein CusF [Escherichia coli 2-011-08_S3_C2]
 gb|KDA86222.1| cation efflux system protein CusF [Escherichia coli 2-011-08_S3_C3]
 gb|KDA91382.1| cation efflux system protein CusF [Escherichia coli 1-176-05_S4_C2]
 gb|KDT03498.1| cation efflux system protein CusF [Escherichia coli 2-011-08_S3_C1]
 gb|KDT40016.1| cation efflux system protein CusF [Escherichia coli 3-105-05_S3_C1]
 gb|KDT47789.1| cation efflux system protein CusF [Escherichia coli 3-105-05_S3_C2]
 gb|KDT59061.1| cation efflux system protein CusF [Escherichia coli 3-267-03_S3_C1]
 gb|KDT75539.1| cation efflux system protein CusF [Escherichia coli 3-373-03_S3_C3]
 gb|KDT83217.1| cation efflux system protein CusF [Escherichia coli 3-475-03_S4_C1]
 gb|KDT96983.1| cation efflux system protein CusF [Escherichia coli 3-105-05_S4_C1]
 gb|KDU12483.1| cation efflux system protein CusF [Escherichia coli 3-373-03_S3_C2]
 gb|KDU41283.1| cation efflux system protein CusF [Escherichia coli 3-073-06_S4_C1]
 gb|KDU65405.1| cation efflux system protein CusF [Escherichia coli 4-203-08_S4_C3]
 gb|KDW48870.1| cation efflux system protein CusF [Escherichia coli 2-210-07_S1_C3]
 gb|KDW74950.1| cation efflux system protein CusF [Escherichia coli 2-005-03_S4_C1]
 gb|KDW90548.1| cation efflux system protein CusF [Escherichia coli 2-210-07_S1_C2]
 gb|KDX18990.1| cation efflux system protein CusF [Escherichia coli 2-210-07_S3_C3]
 gb|KDY50755.1| cation efflux system protein CusF [Escherichia coli 2-460-02_S3_C1]
 gb|KDY58045.1| cation efflux system protein CusF [Escherichia coli 2-460-02_S3_C2]
 gb|KDY58851.1| cation efflux system protein CusF [Escherichia coli 2-460-02_S3_C3]
 gb|KDY66450.1| cation efflux system protein CusF [Escherichia coli 2-460-02_S4_C2]
 gb|KDY73498.1| cation efflux system protein CusF [Escherichia coli 2-460-02_S4_C3]
 gb|KDY78123.1| cation efflux system protein CusF [Escherichia coli 2-474-04_S1_C1]
 gb|KDY92693.1| cation efflux system protein CusF [Escherichia coli 2-474-04_S3_C1]
 gb|KDY96042.1| cation efflux system protein CusF [Escherichia coli 2-474-04_S3_C2]
 gb|KDZ17105.1| cation efflux system protein CusF [Escherichia coli 2-474-04_S3_C3]
 gb|KDZ36627.1| cation efflux system protein CusF [Escherichia coli 3-020-07_S3_C1]
 gb|KDZ63585.1| cation efflux system protein CusF [Escherichia coli 3-073-06_S3_C1]
 gb|KDZ64612.1| cation efflux system protein CusF [Escherichia coli 3-073-06_S3_C2]
 gb|KDZ81280.1| cation efflux system protein CusF [Escherichia coli 3-073-06_S4_C3]
 gb|KEJ53654.1| cation efflux system protein CusF [Escherichia coli 2-460-02_S4_C1]
 gb|KEJ70749.1| cation efflux system protein CusF [Escherichia coli 3-020-07_S3_C2]
 gb|KEL08720.1| cation efflux system protein CusF [Escherichia coli 4-203-08_S4_C2]
 gb|KEL13291.1| cation efflux system protein CusF [Escherichia coli 4-203-08_S3_C1]
 gb|KEL50836.1| cation efflux system protein CusF [Escherichia coli 5-172-05_S3_C1]
 gb|KEM66823.1| cation efflux system protein CusF [Escherichia coli 7-233-03_S1_C2]
 gb|KEM71037.1| cation efflux system protein CusF [Escherichia coli 7-233-03_S3_C1]
 gb|KEN04156.1| cation efflux system protein CusF [Escherichia coli 7-233-03_S1_C3]
 gb|KEN08417.1| cation efflux system protein CusF [Escherichia coli 7-233-03_S3_C3]
 gb|KEN29807.1| cation efflux system protein CusF [Escherichia coli 7-233-03_S3_C2]
 gb|KGM68444.1| Periplasmic copper-binding protein [Escherichia coli]
 gb|KGM77988.1| Periplasmic copper-binding protein [Escherichia coli]
 gb|KGM80697.1| Periplasmic copper-binding protein [Escherichia coli]
 gb|KHH71020.1| copper-binding protein [Escherichia coli]
 gb|KHH97040.1| copper-binding protein [Escherichia coli]
 gb|KIG44166.1| copper-binding protein [Escherichia coli]
 gb|KIH15961.1| copper-binding protein [Escherichia coli]
 gb|KJD86383.1| copper-binding protein [Escherichia coli]
Length=110

 Score = 81.3 bits (199),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/40 (98%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSL QDIKVSQ
Sbjct  71   MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ  110



>ref|WP_021540815.1| cation efflux system protein CusF [Escherichia coli]
 gb|EQT92971.1| cation efflux system protein CusF [Escherichia coli HVH 193 (4-3331423)]
Length=110

 Score = 81.3 bits (199),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/40 (98%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSL QDIKVSQ
Sbjct  71   MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ  110



>gb|KFI00403.1| copper-binding protein [Escherichia coli]
Length=110

 Score = 81.3 bits (199),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/40 (98%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSL QDIKVSQ
Sbjct  71   MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ  110



>ref|WP_000709879.1| MULTISPECIES: cation transporter [Enterobacteriaceae]
 gb|AAZ87293.1| conserved hypothetical protein [Shigella sonnei Ss046]
 gb|EDV83641.1| cation efflux system protein CusF [Escherichia coli E22]
 gb|EDX30294.1| cation efflux system protein CusF [Escherichia coli B171]
 dbj|BAI23974.1| periplasmic copper-binding protein CusF [Escherichia coli O26:H11 
str. 11368]
 dbj|BAI29442.1| periplasmic copper-binding protein CusF [Escherichia coli O103:H2 
str. 12009]
 dbj|BAI34572.1| periplasmic copper-binding protein CusF [Escherichia coli O111:H- 
str. 11128]
 gb|EFK43587.1| cation efflux system protein CusF [Escherichia coli MS 119-7]
 gb|EFK50678.1| cation efflux system protein CusF [Escherichia coli MS 107-1]
 gb|EFK70355.1| cation efflux system protein CusF [Escherichia coli MS 124-1]
 gb|EFU35101.1| cation efflux system protein CusF [Escherichia coli MS 85-1]
 gb|EFZ39964.1| cation efflux system protein cusF [Escherichia coli EPECa14]
 gb|EFZ44759.1| cation efflux system protein cusF [Escherichia coli E128010]
 gb|EFZ49818.1| cation efflux system protein cusF [Shigella sonnei 53G]
 gb|EFZ65516.1| cation efflux system protein cusF [Escherichia coli OK1180]
 gb|EGI38027.1| cation efflux system protein CusF [Escherichia coli TA271]
 gb|EGI47565.1| cation efflux system protein CusF [Escherichia coli H591]
 gb|EGJ07403.1| cation efflux system protein CusF [Escherichia coli D9]
 gb|EGU97248.1| cation efflux system protein CusF [Escherichia coli MS 79-10]
 gb|EGW85626.1| cation efflux system protein cusF [Escherichia coli STEC_94C]
 gb|EGW96782.1| cation efflux system protein cusF [Escherichia coli STEC_DG131-3]
 gb|EGX15426.1| cation efflux system protein cusF [Escherichia coli STEC_H.1.8]
 gb|EHW14617.1| cation efflux system protein CusF [Escherichia coli DEC8A]
 gb|EHW18756.1| periplasmic copper/silver-binding protein [Escherichia coli DEC8B]
 gb|EHW24318.1| periplasmic copper/silver-binding protein [Escherichia coli DEC8C]
 gb|EHW30204.1| periplasmic copper/silver-binding protein [Escherichia coli DEC8D]
 gb|EHW34938.1| periplasmic copper/silver-binding protein [Escherichia coli DEC8E]
 gb|EHW42832.1| periplasmic copper/silver-binding protein [Escherichia coli DEC9A]
 gb|EHW43987.1| periplasmic copper/silver-binding protein [Escherichia coli DEC9B]
 gb|EHW51521.1| periplasmic copper/silver-binding protein [Escherichia coli DEC9C]
 gb|EHW56096.1| periplasmic copper/silver-binding protein [Escherichia coli DEC9D]
 gb|EHW63058.1| periplasmic copper/silver-binding protein [Escherichia coli DEC9E]
 gb|EHW68536.1| periplasmic copper/silver-binding protein [Escherichia coli DEC10A]
 gb|EHW77143.1| periplasmic copper/silver-binding protein [Escherichia coli DEC10B]
 gb|EHW79904.1| periplasmic copper/silver-binding protein [Escherichia coli DEC10C]
 gb|EHW82722.1| periplasmic copper/silver-binding protein [Escherichia coli DEC10D]
 gb|EHW97299.1| periplasmic copper/silver-binding protein [Escherichia coli DEC11A]
 gb|EHX00091.1| periplasmic copper/silver-binding protein [Escherichia coli DEC10F]
 gb|EHX07419.1| periplasmic copper/silver-binding protein [Escherichia coli DEC11B]
 gb|EHX13658.1| cation efflux system protein CusF [Escherichia coli DEC11D]
 gb|EHX17417.1| cation efflux system protein CusF [Escherichia coli DEC11C]
 gb|EHX21786.1| cation efflux system protein CusF [Escherichia coli DEC11E]
 gb|EHX34988.1| periplasmic copper/silver-binding protein [Escherichia coli DEC12B]
 gb|EHX35471.1| cation efflux system protein CusF [Escherichia coli DEC12A]
 gb|EHX36887.1| cation efflux system protein CusF [Escherichia coli DEC12C]
 gb|EHX50725.1| periplasmic copper/silver-binding protein [Escherichia coli DEC12D]
 gb|EHX54070.1| periplasmic copper/silver-binding protein [Escherichia coli DEC12E]
 gb|EHY04711.1| periplasmic copper/silver-binding protein [Escherichia coli DEC15A]
 gb|EHY10523.1| periplasmic copper/silver-binding protein [Escherichia coli DEC15B]
 gb|EHY11447.1| periplasmic copper/silver-binding protein [Escherichia coli DEC15C]
 gb|EHY17235.1| periplasmic copper/silver-binding protein [Escherichia coli DEC15D]
 gb|EHY20874.1| periplasmic copper/silver-binding protein [Escherichia coli DEC15E]
 gb|EIG44871.1| cation efflux system protein CusF [Escherichia coli B799]
 gb|EIH56842.1| cation efflux system protein CusF [Escherichia coli 3.2608]
 gb|EIH68977.1| cation efflux system protein CusF [Escherichia coli 93.0624]
 gb|EIH79181.1| cation efflux system protein CusF [Escherichia coli 4.0522]
 gb|EIH90644.1| cation efflux system protein CusF [Escherichia coli JB1-95]
 gb|EIH99218.1| cation efflux system protein CusF [Escherichia coli 96.154]
 gb|EII10392.1| cation efflux system protein CusF [Escherichia coli 5.0959]
 gb|EII20196.1| cation efflux system protein CusF [Escherichia coli 9.0111]
 gb|EII33432.1| cation efflux system protein CusF [Escherichia coli 4.0967]
 gb|EII57033.1| cation efflux system protein CusF [Escherichia coli 3.3884]
 gb|EIJ17521.1| cation efflux system protein CusF [Escherichia coli 900105 (10e)]
 gb|EIK98783.1| periplasmic copper-binding protein [Escherichia coli O111:H11 
str. CVM9534]
 gb|EIL00968.1| periplasmic copper-binding protein [Escherichia coli O103:H2 
str. CVM9450]
 gb|EIL13057.1| periplasmic copper-binding protein [Escherichia coli O111:H11 
str. CVM9545]
 gb|EIL16843.1| periplasmic copper-binding protein [Escherichia coli O111:H8 
str. CVM9570]
 gb|EIL29868.1| periplasmic copper-binding protein [Escherichia coli O26:H11 
str. CVM9942]
 gb|EIL31459.1| periplasmic copper-binding protein [Escherichia coli O111:H8 
str. CVM9574]
 gb|EIL36696.1| periplasmic copper-binding protein CusF [Escherichia coli O26:H11 
str. CVM10026]
 gb|EIL51779.1| periplasmic copper-binding protein [Escherichia coli 541-15]
 gb|EIL64930.1| periplasmic copper-binding protein [Escherichia coli 541-1]
 gb|EIQ47411.1| cation efflux system protein CusF [Shigella sonnei 3226-85]
 gb|EIQ47888.1| cation efflux system protein CusF [Shigella sonnei 3233-85]
 gb|EIQ54609.1| periplasmic copper/silver-binding protein [Shigella sonnei 4822-66]
 gb|EIQ72254.1| periplasmic copper/silver-binding protein [Escherichia coli EPEC 
C342-62]
 gb|EJE58475.1| periplasmic copper-binding protein [Escherichia coli O26:H11 
str. CVM10224]
 gb|EJE60354.1| periplasmic copper-binding protein [Escherichia coli O111:H8 
str. CVM9634]
 gb|EJE68793.1| periplasmic copper-binding protein [Escherichia coli O111:H8 
str. CVM9602]
 gb|EJE77080.1| periplasmic copper-binding protein [Escherichia coli O26:H11 
str. CVM10021]
 gb|EJE84142.1| periplasmic copper-binding protein [Escherichia coli O111:H11 
str. CVM9455]
 gb|EJE91034.1| periplasmic copper-binding protein [Escherichia coli O111:H11 
str. CVM9553]
 gb|EJE93875.1| periplasmic copper-binding protein [Escherichia coli O26:H11 
str. CVM9952]
 gb|EJF03777.1| periplasmic copper-binding protein [Escherichia coli O26:H11 
str. CVM10030]
 gb|EJL19436.1| periplasmic copper/silver-binding protein [Shigella sonnei str. 
Moseley]
 gb|EKI55122.1| cation efflux system protein CusF [Escherichia coli N1]
 gb|EKJ26716.1| cation efflux system protein CusF [Escherichia coli EC1865]
 gb|EKT98432.1| periplasmic copper-binding protein [Escherichia coli O26:H11 
str. CFSAN001629]
 gb|EKU00699.1| periplasmic copper-binding protein [Escherichia coli O111:H8 
str. CFSAN001632]
 gb|EKU06343.1| periplasmic copper-binding protein [Escherichia coli O111:H11 
str. CFSAN001630]
 gb|ELC23047.1| cation efflux system protein CusF [Escherichia coli KTE12]
 gb|ELF89597.1| cation efflux system protein CusF [Escherichia coli KTE29]
 gb|ELG44659.1| cation efflux system protein CusF [Escherichia coli KTE91]
 gb|ELG71840.1| cation efflux system protein CusF [Escherichia coli KTE136]
 gb|ELH37292.1| cation efflux system protein CusF [Escherichia coli KTE184]
 gb|ELJ84929.1| cation efflux system protein CusF [Escherichia coli KTE90]
 gb|EMV94572.1| cation efflux system protein CusF [Escherichia coli 2865200]
 gb|EMW43623.1| cation efflux system protein CusF [Escherichia coli 2788150]
 gb|EMX17490.1| cation efflux system protein CusF [Escherichia coli P0302293.2]
 gb|ENB42674.1| cation efflux system protein CusF [Escherichia coli MP021561.3]
 gb|ENC42185.1| cation efflux system protein CusF [Escherichia coli P0299917.10]
 gb|ENC48902.1| cation efflux system protein CusF [Escherichia coli P0299917.2]
 gb|ENC59382.1| cation efflux system protein CusF [Escherichia coli P0299917.4]
 gb|ENC64350.1| cation efflux system protein CusF [Escherichia coli P0299917.3]
 gb|ENC75491.1| cation efflux system protein CusF [Escherichia coli P0299917.8]
 gb|ENC75721.1| cation efflux system protein CusF [Escherichia coli P0299917.6]
 gb|ENC82559.1| cation efflux system protein CusF [Escherichia coli P0299917.7]
 gb|ENC86035.1| cation efflux system protein CusF [Escherichia coli P0299917.9]
 gb|END72139.1| cation efflux system protein CusF [Escherichia coli P0299483.1]
 gb|END82652.1| cation efflux system protein CusF [Escherichia coli P0299483.2]
 gb|END85557.1| cation efflux system protein CusF [Escherichia coli P0299483.3]
 gb|ENE02113.1| cation efflux system protein CusF [Escherichia coli P0302293.7]
 gb|ENE16152.1| cation efflux system protein CusF [Escherichia coli P0304799.3]
 gb|ENE24789.1| cation efflux system protein CusF [Escherichia coli P0302293.3]
 gb|ENE28955.1| cation efflux system protein CusF [Escherichia coli P0302293.10]
 gb|ENE32167.1| cation efflux system protein CusF [Escherichia coli P0302293.4]
 gb|ENE38753.1| cation efflux system protein CusF [Escherichia coli P0302293.6]
 gb|ENE45210.1| cation efflux system protein CusF [Escherichia coli P0302293.8]
 gb|ENE54696.1| cation efflux system protein CusF [Escherichia coli P0302293.9]
 gb|ENO08598.1| periplasmic copper-binding protein [Escherichia coli O157:H43 
str. T22]
 gb|EOU36482.1| cation efflux system protein CusF [Escherichia coli KTE13]
 gb|EQO34978.1| cation efflux system protein CusF [Escherichia coli HVH 33 (4-2174936)]
 gb|EQR44878.1| cation efflux system protein CusF [Escherichia coli HVH 121 (4-6877826)]
 gb|EQS36881.1| cation efflux system protein CusF [Escherichia coli HVH 147 (4-5893887)]
 gb|EQU00764.1| cation efflux system protein CusF [Escherichia coli HVH 195 (3-7155360)]
 gb|EQU30521.1| cation efflux system protein CusF [Escherichia coli HVH 200 (4-4449924)]
 gb|EQV49548.1| cation efflux system protein CusF [Escherichia coli KOEGE 33 
(68a)]
 gb|EQW48218.1| cation efflux system protein CusF [Escherichia coli UMEA 3065-1]
 gb|EQX59454.1| cation efflux system protein CusF [Escherichia coli UMEA 3176-1]
 gb|ERA55994.1| cation transporter [Escherichia coli 95NR1]
 gb|ERB38980.1| cation efflux system protein CusF [Escherichia coli UMEA 3292-1]
 gb|ERE04428.1| cation transporter [Escherichia coli 95JB1]
 gb|ESA27711.1| Cation efflux system protein CusF precursor [Escherichia coli 
SCD1]
 gb|ESD17782.1| cation efflux system protein CusF [Escherichia coli 907710]
 gb|ESD71645.1| cation efflux system protein CusF [Escherichia coli 908541]
 gb|ESK09833.1| cation efflux system protein CusF [Escherichia coli HVH 98 (4-5799287)]
 gb|EST76278.1| periplasmic copper-binding protein [Escherichia coli ECC-1470]
 gb|ETD46924.1| cation transporter [Escherichia coli ATCC BAA-2215]
 gb|ETD64619.1| cation transporter [Escherichia coli ATCC BAA-2209]
 gb|ETI74237.1| cation transporter [Escherichia coli ATCC BAA-2196]
 gb|ETI74245.1| cation transporter [Escherichia coli ATCC BAA-2219]
 gb|ETJ56670.1| cation transporter [Escherichia coli ATCC BAA-2193]
 emb|CDK59659.1| Cation efflux system protein CusF precursor [Escherichia coli 
IS9]
 gb|EYE39834.1| cation efflux system protein CusF [Escherichia coli 1-110-08_S1_C2]
 gb|EYU77117.1| copper-binding protein [Escherichia coli O121:H19 str. 2010C-4254]
 gb|EYU77390.1| copper-binding protein [Escherichia coli O111:NM str. 2010C-4221]
 gb|EYU83871.1| copper-binding protein [Escherichia coli O26:NM str. 2010C-4347]
 gb|EYU91233.1| copper-binding protein [Escherichia coli O111:NM str. 2010C-4086]
 gb|EYU93749.1| copper-binding protein [Escherichia coli O45:H2 str. 2010C-3876]
 gb|EYU99129.1| copper-binding protein [Escherichia coli O111:NM str. 2010C-3977]
 gb|EYV00680.1| copper-binding protein [Escherichia coli O121:H19 str. 2010C-3840]
 gb|EYV01113.1| copper-binding protein [Escherichia coli O121:H19 str. 2010C-3840]
 gb|EYV11711.1| copper-binding protein [Escherichia coli O121:H19 str. 2010C-3609]
 gb|EYV63324.1| copper-binding protein [Escherichia coli O103:H11 str. 2010C-3214]
 gb|EYV75917.1| copper-binding protein [Escherichia coli O121:H19 str. 2009C-4659]
 gb|EYV77306.1| copper-binding protein [Escherichia coli O121:H19 str. 2009EL1412]
 gb|EYW91053.1| copper-binding protein [Escherichia coli O111:NM str. 08-4487]
 gb|EYX04676.1| copper-binding protein [Escherichia coli O118:H16 str. 08-3651]
 gb|EYX19329.1| copper-binding protein [Escherichia coli O69:H11 str. 07-4281]
 gb|EYX76710.1| copper-binding protein [Escherichia coli O111:NM str. 2011C-3679]
 gb|EYX78167.1| copper-binding protein [Escherichia coli O111:NM str. 2011C-3632]
 gb|EYX89434.1| copper-binding protein [Escherichia coli O103:H2 str. 2011C-3750]
 gb|EYX93004.1| copper-binding protein [Escherichia coli O111:NM str. 2011C-3573]
 gb|EYX96769.1| copper-binding protein [Escherichia coli O121:H19 str. 2011C-3537]
 gb|EYY02049.1| copper-binding protein [Escherichia coli O121:H19 str. 2011C-3500]
 gb|EYY07786.1| copper-binding protein [Escherichia coli O111:NM str. 2011C-3362]
 gb|EYY11897.1| copper-binding protein [Escherichia coli O111:NM str. 2011C-3170]
 gb|EYY14068.1| copper-binding protein [Escherichia coli O121:H19 str. 2011C-3216]
 gb|EYY22358.1| copper-binding protein [Escherichia coli O121:H19 str. 2011C-3108]
 gb|EYY30447.1| copper-binding protein [Escherichia coli O121:H19 str. 2011C-3072]
 gb|EYY31258.1| copper-binding protein [Escherichia coli O121:H19 str. 2010EL1058]
 gb|EYY36321.1| copper-binding protein [Escherichia coli O121:H19 str. 2010C-4989]
 gb|EYY42095.1| copper-binding protein [Escherichia coli O153:H2 str. 2010C-5034]
 gb|EYY52081.1| copper-binding protein [Escherichia coli O121:H19 str. 2010C-4966]
 gb|EYY59673.1| copper-binding protein [Escherichia coli O121:H19 str. 2010C-4824]
 gb|EYY64765.1| copper-binding protein [Escherichia coli O111:NM str. 2010C-4799]
 gb|EYY67188.1| copper-binding protein [Escherichia coli O111:NM str. 2010C-4818]
 gb|EYY74064.1| copper-binding protein [Escherichia coli O111:NM str. 2010C-4746]
 gb|EYY76364.1| copper-binding protein [Escherichia coli O26:NM str. 2010C-4788]
 gb|EYY86599.1| copper-binding protein [Escherichia coli O111:NM str. 2010C-4735]
 gb|EYY87203.1| copper-binding protein [Escherichia coli O121:H19 str. 2010C-4732]
 gb|EYY97333.1| copper-binding protein [Escherichia coli O111:NM str. 2010C-4715]
 gb|EYY99198.1| copper-binding protein [Escherichia coli O111:NM str. 2010C-4622]
 gb|EYZ04206.1| copper-binding protein [Escherichia coli O111:NM str. 2010C-4592]
 gb|EYZ18798.1| copper-binding protein [Escherichia coli O103:H2 str. 2010C-4433]
 gb|EYZ50711.1| copper-binding protein [Escherichia coli O121:H19 str. 06-3822]
 gb|EYZ67701.1| copper-binding protein [Escherichia coli O118:H16 str. 06-3612]
 gb|EYZ75213.1| copper-binding protein [Escherichia coli O69:H11 str. 06-3325]
 gb|EYZ87277.1| copper-binding protein [Escherichia coli O111:NM str. 04-3211]
 gb|EYZ89055.1| copper-binding protein [Escherichia coli O121:H19 str. 06-3003]
 gb|EYZ92222.1| copper-binding protein [Escherichia coli O118:H16 str. 06-3256]
 gb|EZA04629.1| copper-binding protein [Escherichia coli O111:NM str. 03-3484]
 gb|EZA09284.1| copper-binding protein [Escherichia coli O121:H19 str. 03-3227]
 gb|EZA19833.1| copper-binding protein [Escherichia coli O28ac:NM str. 02-3404]
 gb|EZA23594.1| copper-binding protein [Escherichia coli O113:H21 str. 07-4224]
 gb|EZA29173.1| copper-binding protein [Escherichia coli O45:H2 str. 01-3147]
 gb|EZA36971.1| copper-binding protein [Escherichia coli O174:H8 str. 04-3038]
 gb|EZA43301.1| copper-binding protein [Escherichia coli O26:H11 str. 05-3646]
 gb|EZA81389.1| copper-binding protein [Escherichia coli O111:H8 str. F6627]
 gb|EZA95564.1| copper-binding protein [Escherichia coli O121:H19 str. F6714]
 gb|EZC55018.1| copper-binding protein [Escherichia coli O121:H19 str. K5198]
 gb|EZC58240.1| copper-binding protein [Escherichia coli O121:H19 str. K5269]
 gb|EZD20931.1| copper-binding protein [Escherichia coli O111:NM str. K6723]
 gb|EZD23819.1| copper-binding protein [Escherichia coli O111:NM str. K6722]
 gb|EZD29344.1| copper-binding protein [Escherichia coli O111:NM str. K6728]
 gb|EZD43068.1| copper-binding protein [Escherichia coli O111:NM str. K6890]
 gb|EZD47738.1| copper-binding protein [Escherichia coli O111:NM str. K6895]
 gb|EZD54194.1| copper-binding protein [Escherichia coli O111:NM str. K6897]
 gb|EZD55205.1| copper-binding protein [Escherichia coli O111:NM str. K6898]
 gb|EZD61593.1| copper-binding protein [Escherichia coli O111:NM str. K6904]
 gb|EZD68306.1| copper-binding protein [Escherichia coli O111:NM str. K6915]
 gb|EZD68673.1| copper-binding protein [Escherichia coli O111:NM str. K6908]
 gb|EZE00577.1| copper-binding protein [Escherichia coli O103:H2 str. 2009C-3279]
 gb|EZE05551.1| copper-binding protein [Escherichia coli O69:H11 str. 08-4661]
 gb|EZE09521.1| copper-binding protein [Escherichia coli O121:H7 str. 2009C-3299]
 gb|EZE17213.1| copper-binding protein [Escherichia coli O123:H11 str. 2009C-3307]
 gb|EZE21037.1| copper-binding protein [Escherichia coli O45:H2 str. 2009C-3686]
 gb|EZE30553.1| copper-binding protein [Escherichia coli O69:H11 str. 2009C-3601]
 gb|EZE38473.1| copper-binding protein [Escherichia coli O111:NM str. 2009C-4006]
 gb|EZE40998.1| copper-binding protein [Escherichia coli O121:H19 str. 2009C-4050]
 gb|EZE48595.1| copper-binding protein [Escherichia coli O118:H16 str. 2009C-4446]
 gb|EZE50471.1| copper-binding protein [Escherichia coli O111:NM str. 2009C-4052]
 gb|EZE62897.1| copper-binding protein [Escherichia coli O45:H2 str. 2009C-4780]
 gb|EZE63103.1| copper-binding protein [Escherichia coli O45:H2 str. 2009C-4780]
 gb|EZE72519.1| copper-binding protein [Escherichia coli O121:H19 str. 2009C-4750]
 gb|EZE82838.1| copper-binding protein [Escherichia coli O121:H19 str. 2009EL1302]
 gb|EZE96097.1| copper-binding protein [Escherichia coli O121:H19 str. 2010C-3794]
 gb|EZG50744.1| copper-binding protein [Escherichia coli O26:H11 str. 03-3500]
 gb|EZG52245.1| copper-binding protein [Escherichia coli O26:H11 str. 06-3464]
 gb|EZG58258.1| copper-binding protein [Escherichia coli O26:H11 str. 2010C-4819]
 gb|EZG60716.1| copper-binding protein [Escherichia coli O26:H11 str. 2010C-4430]
 gb|EZG74076.1| copper-binding protein [Escherichia coli O26:H11 str. 2010C-4834]
 gb|EZG74196.1| copper-binding protein [Escherichia coli O26:H11 str. 2010C-5028]
 gb|EZG84317.1| copper-binding protein [Escherichia coli O26:H11 str. 2011C-3270]
 gb|EZG84327.1| copper-binding protein [Escherichia coli O26:H11 str. 2010EL-1699]
 gb|EZG91259.1| copper-binding protein [Escherichia coli O26:H11 str. 2011C-3387]
 gb|EZG93562.1| copper-binding protein [Escherichia coli O26:H11 str. 2011C-3506]
 gb|EZH04326.1| copper-binding protein [Escherichia coli O26:H11 str. 2011C-3282]
 gb|EZH08769.1| copper-binding protein [Escherichia coli O26:H11 str. 2009C-3689]
 gb|EZH10215.1| copper-binding protein [Escherichia coli O26:H11 str. 2009C-3612]
 gb|EZH15688.1| copper-binding protein [Escherichia coli O26:H11 str. 2011C-3655]
 gb|EZH24443.1| copper-binding protein [Escherichia coli O26:H11 str. 2009C-4826]
 gb|EZH24927.1| copper-binding protein [Escherichia coli O26:H11 str. 2009C-3996]
 gb|EZH27706.1| copper-binding protein [Escherichia coli O26:H11 str. 2009C-4760]
 gb|EZH38313.1| copper-binding protein [Escherichia coli O26:H11 str. 2010C-3051]
 gb|EZH43011.1| copper-binding protein [Escherichia coli O26:H11 str. 2010C-3472]
 gb|EZH43138.1| copper-binding protein [Escherichia coli O26:H11 str. 2010C-3871]
 gb|EZH55320.1| copper-binding protein [Escherichia coli O26:H11 str. 2010C-3902]
 gb|EZH55893.1| copper-binding protein [Escherichia coli O26:H11 str. 2010C-4244]
 gb|EZQ28811.1| copper-binding protein [Escherichia coli O111:NM str. 2010C-3053]
 gb|EZQ29711.1| copper-binding protein [Escherichia coli O111:H8 str. 2009EL-2169]
 gb|EZQ35201.1| copper-binding protein [Escherichia coli O26:H1 str. 2009C-4747]
 gb|EZQ37766.1| copper-binding protein [Escherichia coli O111:H8 str. 2009C-4126]
 gb|EZQ43032.1| copper-binding protein [Escherichia coli O111:H8 str. 2011C-3453]
 gb|KDH01778.1| cation efflux system protein CusF [Escherichia coli UCI 66]
 gb|KDM71222.1| copper-binding protein [Escherichia coli]
 gb|KDM86817.1| copper-binding protein [Escherichia coli]
 gb|KDT63575.1| cation efflux system protein CusF [Escherichia coli 3-267-03_S1_C3]
 gb|KDT97179.1| cation efflux system protein CusF [Escherichia coli 3-267-03_S3_C2]
 gb|KDU19721.1| cation efflux system protein CusF [Escherichia coli 3-267-03_S1_C1]
 gb|KDU24981.1| cation efflux system protein CusF [Escherichia coli 3-267-03_S4_C2]
 gb|KDV13975.1| copper-binding protein [Escherichia coli O111:NM str. 01-3076]
 gb|KDV35172.1| copper-binding protein [Escherichia coli O69:H11 str. 07-3763]
 gb|KDV39125.1| copper-binding protein [Escherichia coli O146:H21 str. 2010C-3325]
 gb|KDV55321.1| copper-binding protein [Escherichia coli O45:H2 str. 2010C-4211]
 gb|KDV56502.1| copper-binding protein [Escherichia coli O121:H19 str. 2011C-3609]
 gb|KDV61370.1| copper-binding protein [Escherichia coli O128:H2 str. 2011C-3317]
 gb|KDV72452.1| copper-binding protein [Escherichia coli O118:H16 str. 07-4255]
 gb|KDV75785.1| copper-binding protein [Escherichia coli O26:H11 str. 2011C-3274]
 gb|KDW05571.1| cation efflux system protein CusF [Escherichia coli 2-156-04_S3_C1]
 gb|KDW97906.1| cation efflux system protein CusF [Escherichia coli 2-210-07_S3_C2]
 gb|KDX36729.1| cation efflux system protein CusF [Escherichia coli 2-156-04_S4_C2]
 gb|KDX63272.1| cation efflux system protein CusF [Escherichia coli 2-222-05_S1_C1]
 gb|KDX74070.1| cation efflux system protein CusF [Escherichia coli 2-222-05_S1_C2]
 gb|KDX82705.1| cation efflux system protein CusF [Escherichia coli 2-222-05_S1_C3]
 gb|KDX96070.1| cation efflux system protein CusF [Escherichia coli 2-316-03_S3_C2]
 gb|KDX99835.1| cation efflux system protein CusF [Escherichia coli 2-316-03_S3_C3]
 gb|KDY22696.1| cation efflux system protein CusF [Escherichia coli 2-427-07_S1_C2]
 gb|KDY87401.1| cation efflux system protein CusF [Escherichia coli 2-427-07_S1_C3]
 gb|KDZ43366.1| cation efflux system protein CusF [Escherichia coli 3-020-07_S4_C2]
 gb|KDZ48784.1| cation efflux system protein CusF [Escherichia coli 3-020-07_S4_C3]
 gb|KDZ72479.1| cation efflux system protein CusF [Escherichia coli 3-073-06_S4_C2]
 gb|KDZ91454.1| cation efflux system protein CusF [Escherichia coli 2-427-07_S1_C1]
 gb|KEJ51435.1| cation efflux system protein CusF [Escherichia coli 2-427-07_S4_C3]
 gb|KEJ65082.1| cation efflux system protein CusF [Escherichia coli 3-267-03_S4_C1]
 gb|KEK76533.1| cation efflux system protein CusF [Escherichia coli 3-475-03_S1_C2]
 gb|KEK87216.1| cation efflux system protein CusF [Escherichia coli 3-475-03_S3_C2]
 gb|KEL84722.1| cation efflux system protein CusF [Escherichia coli 5-366-08_S3_C2]
 gb|KEM79950.1| cation efflux system protein CusF [Escherichia coli 6-537-08_S3_C1]
 gb|KEM85355.1| cation efflux system protein CusF [Escherichia coli 6-537-08_S3_C3]
 gb|KEN21096.1| cation efflux system protein CusF [Escherichia coli 6-537-08_S3_C2]
 gb|KEN73449.1| cation efflux system protein CusF [Escherichia coli 1-392-07_S4_C3]
 gb|KEO03513.1| cation efflux system protein CusF [Escherichia coli 1-392-07_S4_C1]
 gb|KEO34426.1| cation efflux system protein CusF [Escherichia coli 2-460-02_S1_C1]
 gb|KGY96084.1| copper-binding protein [Shigella sonnei]
 gb|KHG90897.1| copper-binding protein [Escherichia coli]
 gb|KHG91584.1| copper-binding protein [Escherichia coli]
 gb|KHH02866.1| copper-binding protein [Escherichia coli]
 gb|KHH16142.1| copper-binding protein [Escherichia coli]
 gb|KHH16747.1| copper-binding protein [Escherichia coli]
 gb|KHI33542.1| copper-binding protein [Escherichia coli]
 gb|KHI60513.1| copper-binding protein [Escherichia coli]
 gb|KHI77892.1| copper-binding protein [Escherichia coli]
 gb|KHI85405.1| copper-binding protein [Escherichia coli]
 gb|KHI99900.1| copper-binding protein [Escherichia coli]
 gb|KHJ07743.1| copper-binding protein [Escherichia coli]
 gb|KHJ16865.1| copper-binding protein [Escherichia coli]
 gb|KHJ28822.1| copper-binding protein [Escherichia coli]
 gb|KHO57590.1| copper-binding protein [Escherichia coli]
 emb|CEK03625.1| periplasmic copper-binding protein [Escherichia coli O26:H11]
 gb|KIG43492.1| copper-binding protein [Escherichia coli]
 gb|KIG63158.1| copper-binding protein [Escherichia coli]
 gb|KIG82491.1| copper-binding protein [Escherichia coli]
 gb|KIG92350.1| copper-binding protein [Escherichia coli]
 gb|KII10487.1| copper-binding protein [Escherichia coli]
 gb|AJG07599.1| periplasmic copper- and silver-binding protein [Escherichia coli 
ECC-1470]
 gb|KIO86968.1| cation efflux system protein CusF [Escherichia coli 97.0264]
Length=110

 Score = 81.3 bits (199),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/40 (98%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSL QDIKVSQ
Sbjct  71   MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ  110



>ref|WP_000709871.1| cation efflux system protein CusF [Escherichia sp. TW14182]
Length=110

 Score = 81.3 bits (199),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/40 (98%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSL QDIKVSQ
Sbjct  71   MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ  110



>ref|WP_000709885.1| cation transporter [Escherichia coli]
 gb|EGP26089.1| Cation efflux system protein CusF [Escherichia coli PCN033]
 gb|EIH13479.1| cation efflux system protein CusF [Escherichia coli 97.0259]
Length=110

 Score = 81.3 bits (199),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/40 (98%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSL QDIKVSQ
Sbjct  71   MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ  110



>gb|KFH78617.1| copper-binding protein [Escherichia coli]
Length=102

 Score = 81.3 bits (199),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/40 (98%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSL QDIKVSQ
Sbjct  63   MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ  102



>ref|WP_001479112.1| cation efflux system protein CusF [Escherichia coli]
 gb|ENC63988.1| cation efflux system protein CusF [Escherichia coli P0299917.5]
Length=110

 Score = 81.3 bits (199),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/40 (98%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSL QDIKVSQ
Sbjct  71   MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ  110



>ref|WP_000709878.1| cation transporter [Escherichia coli]
 gb|EFJ84092.1| cation efflux system protein CusF [Escherichia coli MS 84-1]
Length=110

 Score = 81.3 bits (199),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/40 (98%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSL QDIKVSQ
Sbjct  71   MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ  110



>gb|EGW77147.1| cation efflux system protein cusF [Escherichia coli 2534-86]
Length=102

 Score = 81.3 bits (199),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/40 (98%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSL QDIKVSQ
Sbjct  63   MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ  102



>ref|WP_000709882.1| MULTISPECIES: cation transporter [Shigella]
 gb|EDX35235.1| cation efflux system protein CusF [Shigella dysenteriae 1012]
 gb|EGI91165.1| cation efflux system protein cusF [Shigella dysenteriae 155-74]
 gb|EGI99287.1| cation efflux system protein cusF [Shigella boydii 5216-82]
 gb|EIQ35284.1| cation efflux system protein CusF [Shigella boydii 965-58]
Length=110

 Score = 81.3 bits (199),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/40 (98%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSL QDIKVSQ
Sbjct  71   MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ  110



>ref|WP_001398748.1| cation efflux system protein CusF [Escherichia coli]
 gb|EMV98121.1| cation efflux system protein CusF [Escherichia coli 2860050]
 gb|EMW71192.1| cation efflux system protein CusF [Escherichia coli 2749250]
 gb|ENB00296.1| cation efflux system protein CusF [Escherichia coli 2860650]
Length=110

 Score = 81.3 bits (199),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/40 (98%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSL QDIKVSQ
Sbjct  71   MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ  110



>ref|WP_021575043.1| cation efflux system protein CusF [Escherichia coli]
 gb|EQZ70279.1| cation efflux system protein CusF [Escherichia coli UMEA 3682-1]
Length=110

 Score = 81.3 bits (199),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/40 (98%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSL QDIKVSQ
Sbjct  71   MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ  110



>ref|WP_000709883.1| cation transporter [Shigella boydii]
 gb|EFW55043.1| Cation efflux system protein CusF precursor [Shigella boydii 
ATCC 9905]
Length=110

 Score = 81.3 bits (199),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/40 (98%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSL QDIKVSQ
Sbjct  71   MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ  110



>ref|WP_000753225.1| cation transporter [Escherichia sp. TW09308]
Length=110

 Score = 80.9 bits (198),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/40 (95%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSL QDIK+SQ
Sbjct  71   MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKISQ  110



>ref|WP_032256123.1| copper-binding protein [Escherichia coli]
 gb|KDT50860.1| cation efflux system protein CusF [Escherichia coli 3-105-05_S4_C3]
Length=110

 Score = 80.1 bits (196),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 38/40 (95%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKMSEIKTGDKVAFNFV+QGNLSL QDIKVSQ
Sbjct  71   MRFTITPQTKMSEIKTGDKVAFNFVRQGNLSLLQDIKVSQ  110



>gb|EHN99611.1| hypothetical protein ESPG_01722 [Escherichia coli H397]
Length=40

 Score = 78.2 bits (191),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 38/40 (95%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKMSEIKTGDKVAFNFVQQG+LSL QDIKVSQ
Sbjct  1    MRFTITPQTKMSEIKTGDKVAFNFVQQGSLSLLQDIKVSQ  40



>gb|KGM73041.1| Periplasmic copper-binding protein [Escherichia coli]
Length=110

 Score = 80.1 bits (196),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 38/40 (95%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKMSEIKTG+KVAFNFVQQGNLSL QDIKVSQ
Sbjct  71   MRFTITPQTKMSEIKTGEKVAFNFVQQGNLSLLQDIKVSQ  110



>ref|WP_001561598.1| cation efflux system protein CusF [Escherichia coli]
 gb|ELE57900.1| cation efflux system protein CusF [Escherichia coli KTE75]
Length=109

 Score = 79.7 bits (195),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 38/39 (97%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVS  127
            MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSL QDIKVS
Sbjct  71   MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVS  109



>ref|WP_000709862.1| cation efflux system protein CusF [Escherichia sp. TW15838]
Length=110

 Score = 79.7 bits (195),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 38/40 (95%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKM EIKTGDKVAFNFVQQGNLSL QDIKVSQ
Sbjct  71   MRFTITPQTKMGEIKTGDKVAFNFVQQGNLSLLQDIKVSQ  110



>ref|WP_000709872.1| MULTISPECIES: cation efflux system protein CusF [Escherichia]
 gb|EOU45173.1| cation efflux system protein CusF [Escherichia sp. KTE114]
Length=110

 Score = 79.7 bits (195),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 38/40 (95%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKM EIKTGDKVAFNFVQQGNLSL QDIKVSQ
Sbjct  71   MRFTITPQTKMGEIKTGDKVAFNFVQQGNLSLLQDIKVSQ  110



>ref|WP_001224008.1| cation transporter [Escherichia coli]
 gb|EFK18190.1| cation efflux system protein CusF [Escherichia coli MS 21-1]
 gb|ELF21871.1| cation efflux system protein CusF [Escherichia coli KTE143]
 gb|EOU74157.1| cation efflux system protein CusF [Escherichia coli KTE24]
 gb|EOU95099.1| cation efflux system protein CusF [Escherichia coli KTE36]
 gb|EOU97778.1| cation efflux system protein CusF [Escherichia coli KTE37]
 gb|EOV13309.1| cation efflux system protein CusF [Escherichia coli KTE38]
 gb|EOV67537.1| cation efflux system protein CusF [Escherichia coli KTE69]
 gb|EOV80453.1| cation efflux system protein CusF [Escherichia coli KTE70]
 gb|EOV97281.1| cation efflux system protein CusF [Escherichia coli KTE74]
 gb|EOV97636.1| cation efflux system protein CusF [Escherichia coli KTE98]
 gb|EQQ15436.1| cation efflux system protein CusF [Escherichia coli HVH 87 (4-5977630)]
 gb|EQX68414.1| cation efflux system protein CusF [Escherichia coli UMEA 3190-1]
 gb|EQY76164.1| cation efflux system protein CusF [Escherichia coli UMEA 3304-1]
Length=110

 Score = 79.7 bits (195),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 38/40 (95%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSL QDI VSQ
Sbjct  71   MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDINVSQ  110



>ref|WP_000709869.1| cation transporter [Escherichia coli]
 gb|EFF14357.1| cation efflux system protein cusF [Escherichia coli B354]
 gb|EFJ80331.1| cation efflux system protein CusF [Escherichia coli MS 69-1]
 gb|EIL56684.1| periplasmic copper-binding protein [Escherichia coli KD2]
 gb|ELF58172.1| cation efflux system protein CusF [Escherichia coli KTE9]
 gb|ELG54097.1| cation efflux system protein CusF [Escherichia coli KTE115]
 gb|EQW00145.1| cation efflux system protein CusF [Escherichia coli KOEGE 118 
(317a)]
 gb|ESD79840.1| cation efflux system protein CusF [Escherichia coli 908573]
 gb|AHM42772.1| copper-binding protein [Escherichia coli]
 gb|AHM47403.1| copper-binding protein [Escherichia coli]
 gb|AHM51946.1| copper-binding protein [Escherichia coli]
 gb|KDU03398.1| cation efflux system protein CusF [Escherichia coli 3-267-03_S1_C2]
Length=110

 Score = 79.7 bits (195),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 38/40 (95%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKM EIKTGDKVAFNFVQQGNLSL QDIKVSQ
Sbjct  71   MRFTITPQTKMGEIKTGDKVAFNFVQQGNLSLLQDIKVSQ  110



>ref|WP_001400041.1| cation efflux system protein CusF [Escherichia coli]
 gb|EMW37139.1| cation efflux system protein CusF [Escherichia coli 2845350]
 gb|ENA22445.1| cation efflux system protein CusF [Escherichia coli P0298942.1]
 gb|ENB02660.1| cation efflux system protein CusF [Escherichia coli 2862600]
 gb|ENB15683.1| cation efflux system protein CusF [Escherichia coli 2875150]
 gb|ENB45148.1| cation efflux system protein CusF [Escherichia coli P0298942.10]
 gb|ENB51211.1| cation efflux system protein CusF [Escherichia coli P0298942.11]
 gb|ENB66504.1| cation efflux system protein CusF [Escherichia coli P0298942.15]
 gb|ENB66982.1| cation efflux system protein CusF [Escherichia coli P0298942.6]
 gb|ENB70083.1| cation efflux system protein CusF [Escherichia coli P0298942.2]
 gb|ENB81590.1| cation efflux system protein CusF [Escherichia coli P0298942.7]
 gb|ENB83452.1| cation efflux system protein CusF [Escherichia coli P0298942.8]
 gb|ENB87484.1| cation efflux system protein CusF [Escherichia coli P0298942.9]
 gb|END46614.1| cation efflux system protein CusF [Escherichia coli 2733950]
 gb|END74663.1| cation efflux system protein CusF [Escherichia coli P0298942.4]
 gb|END74897.1| cation efflux system protein CusF [Escherichia coli P0298942.3]
 gb|ENG87770.1| cation efflux system protein CusF [Escherichia coli P0298942.12]
 gb|ENG91975.1| cation efflux system protein CusF [Escherichia coli P0298942.14]
Length=110

 Score = 79.7 bits (195),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 38/40 (95%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKMSEIKTGDKVAFNFVQQGN SL QDIKVSQ
Sbjct  71   MRFTITPQTKMSEIKTGDKVAFNFVQQGNFSLLQDIKVSQ  110



>ref|WP_032170876.1| copper-binding protein [Escherichia coli]
 gb|KDG88283.1| cation efflux system protein CusF [Escherichia coli UCI 57]
 gb|KDG91822.1| cation efflux system protein CusF [Escherichia coli UCI 58]
Length=110

 Score = 79.7 bits (195),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 38/40 (95%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSL QDI VSQ
Sbjct  71   MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDINVSQ  110



>ref|WP_034173308.1| copper-binding protein [Escherichia coli]
Length=110

 Score = 79.7 bits (195),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 38/40 (95%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSL QDI VSQ
Sbjct  71   MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDINVSQ  110



>ref|WP_029400252.1| copper-binding protein [Escherichia coli]
Length=110

 Score = 79.7 bits (195),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 38/40 (95%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKM EIKTGDKVAFNFVQQGNLSL QDIKVSQ
Sbjct  71   MRFTITPQTKMDEIKTGDKVAFNFVQQGNLSLLQDIKVSQ  110



>ref|WP_016159133.1| MULTISPECIES: cation efflux system protein CusF [Escherichia]
 gb|EOQ57042.1| cation efflux system protein CusF [Escherichia coli KTE33]
 gb|EOU83202.1| cation efflux system protein CusF [Escherichia sp. KTE31]
Length=110

 Score = 79.7 bits (195),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 38/40 (95%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKM EIKTGDKVAFNFVQQGNLSL QDIKVSQ
Sbjct  71   MRFTITPQTKMGEIKTGDKVAFNFVQQGNLSLLQDIKVSQ  110



>ref|WP_021550393.1| cation efflux system protein CusF [Escherichia coli]
 gb|EQV94730.1| cation efflux system protein CusF [Escherichia coli KOEGE 71 
(186a)]
Length=110

 Score = 79.7 bits (195),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 38/40 (95%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKM EIKTGDKVAFNFVQQGNLSL QDIKVSQ
Sbjct  71   MRFTITPQTKMGEIKTGDKVAFNFVQQGNLSLLQDIKVSQ  110



>ref|WP_001717824.1| cation efflux system protein CusF [Escherichia coli]
 gb|EMW24545.1| cation efflux system protein CusF [Escherichia coli 2845650]
Length=110

 Score = 79.7 bits (195),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 38/40 (95%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKM EIKTGDKVAFNFVQQGNLSL QDIKVSQ
Sbjct  71   MRFTITPQTKMREIKTGDKVAFNFVQQGNLSLLQDIKVSQ  110



>ref|WP_000753227.1| cation efflux system protein CusF [Escherichia sp. TW09231]
Length=110

 Score = 79.3 bits (194),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 38/40 (95%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKM EIKTGDKVAFNFVQQGNLSL QDIKVSQ
Sbjct  71   MRFTITPQTKMGEIKTGDKVAFNFVQQGNLSLLQDIKVSQ  110



>ref|WP_033554945.1| copper-binding protein [Escherichia coli]
Length=110

 Score = 79.3 bits (194),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 38/40 (95%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKMSEIKTGDKVAFNFVQQG+LSL QDIKVSQ
Sbjct  71   MRFTITPQTKMSEIKTGDKVAFNFVQQGSLSLLQDIKVSQ  110



>ref|WP_000709867.1| cation efflux system protein CusF [Escherichia albertii]
 gb|AHE58795.1| periplasmic copper-binding protein [Escherichia albertii KF1]
Length=110

 Score = 79.3 bits (194),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 38/40 (95%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKMSEIKTGDKVAF+FVQQGNLSL QDIKVSQ
Sbjct  71   MRFTITPQTKMSEIKTGDKVAFSFVQQGNLSLLQDIKVSQ  110



>ref|WP_000709874.1| MULTISPECIES: cation transporter [Escherichia]
 ref|YP_002390426.1| copper-binding protein [Escherichia coli S88]
 ref|YP_002396611.1| periplasmic copper-binding protein [Escherichia coli ED1a]
 ref|YP_008570513.1| Cation efflux system protein CusF precursor [Escherichia coli 
PMV-1]
 gb|ABE06073.1| conserved hypothetical protein [Escherichia coli UTI89]
 gb|ABI99994.1| conserved hypothetical protein [Escherichia coli APEC O1]
 emb|CAR01953.1| periplasmic copper-binding protein [Escherichia coli S88]
 emb|CAR06774.1| periplasmic copper-binding protein [Escherichia coli ED1a]
 gb|EEH84926.1| cation efflux system protein CusF [Escherichia sp. 3_2_53FAA]
 gb|ADE88964.1| cation efflux system protein CusF [Escherichia coli IHE3034]
 gb|EFM54197.1| periplasmic copper-binding protein [Escherichia coli NC101]
 gb|ADN72293.1| periplasmic copper-binding protein [Escherichia coli UM146]
 gb|EFU46418.1| cation efflux system protein CusF [Escherichia coli MS 110-3]
 gb|EFU58348.1| cation efflux system protein CusF [Escherichia coli MS 16-3]
 gb|EGB48717.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Escherichia 
coli H252]
 gb|EGB54037.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Escherichia 
coli H263]
 gb|EHG02086.1| periplasmic copper-binding protein [Escherichia coli cloneA_i1]
 gb|EIL75598.1| periplasmic copper-binding protein [Escherichia coli HM605]
 gb|ELC03026.1| cation efflux system protein CusF [Escherichia coli KTE4]
 gb|ELC12522.1| cation efflux system protein CusF [Escherichia coli KTE5]
 gb|ELC30866.1| cation efflux system protein CusF [Escherichia coli KTE16]
 gb|ELC32767.1| cation efflux system protein CusF [Escherichia coli KTE15]
 gb|ELD54626.1| cation efflux system protein CusF [Escherichia coli KTE224]
 gb|ELE14789.1| cation efflux system protein CusF [Escherichia coli KTE55]
 gb|ELE26772.1| cation efflux system protein CusF [Escherichia coli KTE58]
 gb|ELE35374.1| cation efflux system protein CusF [Escherichia coli KTE62]
 gb|ELE52124.1| cation efflux system protein CusF [Escherichia coli KTE72]
 gb|ELE83581.1| cation efflux system protein CusF [Escherichia coli KTE86]
 gb|ELE93486.1| cation efflux system protein CusF [Escherichia coli KTE93]
 gb|ELF40874.1| cation efflux system protein CusF [Escherichia coli KTE169]
 gb|ELF85170.1| cation efflux system protein CusF [Escherichia coli KTE43]
 gb|ELF94038.1| cation efflux system protein CusF [Escherichia coli KTE22]
 gb|ELG17359.1| cation efflux system protein CusF [Escherichia coli KTE59]
 gb|ELG28402.1| cation efflux system protein CusF [Escherichia coli KTE65]
 gb|ELG56653.1| cation efflux system protein CusF [Escherichia coli KTE118]
 gb|ELG59860.1| cation efflux system protein CusF [Escherichia coli KTE123]
 gb|ELG88552.1| cation efflux system protein CusF [Escherichia coli KTE147]
 gb|ELH11385.1| cation efflux system protein CusF [Escherichia coli KTE192]
 gb|ELH17977.1| cation efflux system protein CusF [Escherichia coli KTE194]
 gb|ELH33984.1| cation efflux system protein CusF [Escherichia coli KTE183]
 gb|ELH65507.1| cation efflux system protein CusF [Escherichia coli KTE207]
 gb|ELH84576.1| cation efflux system protein CusF [Escherichia coli KTE215]
 gb|ELH94909.1| cation efflux system protein CusF [Escherichia coli KTE227]
 gb|ELH96938.1| cation efflux system protein CusF [Escherichia coli KTE229]
 gb|ELI20298.1| cation efflux system protein CusF [Escherichia coli KTE109]
 gb|ELI28925.1| cation efflux system protein CusF [Escherichia coli KTE113]
 gb|ELI74708.1| cation efflux system protein CusF [Escherichia coli KTE133]
 gb|ELI91014.1| cation efflux system protein CusF [Escherichia coli KTE145]
 gb|ELJ32457.1| cation efflux system protein CusF [Escherichia coli KTE168]
 gb|ELJ44273.1| cation efflux system protein CusF [Escherichia coli KTE176]
 gb|ELJ57194.1| cation efflux system protein CusF [Escherichia coli KTE179]
 gb|ELJ58813.1| cation efflux system protein CusF [Escherichia coli KTE180]
 gb|ELJ73517.1| cation efflux system protein CusF [Escherichia coli KTE88]
 gb|EMZ47776.1| cation efflux system protein CusF [Escherichia coli SWW33]
 gb|EOU38159.1| cation efflux system protein CusF [Escherichia coli KTE7]
 gb|EOU40635.1| cation efflux system protein CusF [Escherichia coli KTE3]
 gb|EOU81741.1| cation efflux system protein CusF [Escherichia coli KTE27]
 gb|EOV97350.1| cation efflux system protein CusF [Escherichia coli KTE89]
 gb|EOX16367.1| cation efflux system protein CusF [Escherichia coli KTE240]
 gb|EOX25910.1| cation efflux system protein CusF [Escherichia coli KTE186]
 gb|EQN06572.1| cation efflux system protein CusF [Escherichia coli HVH 1 (4-6876161)]
 gb|EQN09867.1| cation efflux system protein CusF [Escherichia coli HVH 3 (4-7276001)]
 gb|EQN22200.1| cation efflux system protein CusF [Escherichia coli HVH 5 (4-7148410)]
 gb|EQN73675.1| cation efflux system protein CusF [Escherichia coli HVH 19 (4-7154984)]
 gb|EQO24121.1| cation efflux system protein CusF [Escherichia coli HVH 30 (4-2661829)]
 gb|EQO26856.1| cation efflux system protein CusF [Escherichia coli HVH 32 (4-3773988)]
 gb|EQO34650.1| cation efflux system protein CusF [Escherichia coli HVH 35 (4-2962667)]
 gb|EQO53690.1| cation efflux system protein CusF [Escherichia coli HVH 38 (4-2774682)]
 gb|EQO64256.1| cation efflux system protein CusF [Escherichia coli HVH 42 (4-2100061)]
 gb|EQO86960.1| cation efflux system protein CusF [Escherichia coli HVH 48 (4-2658593)]
 gb|EQP28358.1| cation efflux system protein CusF [Escherichia coli HVH 59 (4-1119338)]
 gb|EQP53517.1| cation efflux system protein CusF [Escherichia coli HVH 73 (4-2393174)]
 gb|EQP63147.1| cation efflux system protein CusF [Escherichia coli HVH 76 (4-2538717)]
 gb|EQP80838.1| cation efflux system protein CusF [Escherichia coli HVH 80 (4-2428830)]
 gb|EQQ43098.1| cation efflux system protein CusF [Escherichia coli HVH 102 (4-6906788)]
 gb|EQQ53553.1| cation efflux system protein CusF [Escherichia coli HVH 104 (4-6977960)]
 gb|EQR26695.1| cation efflux system protein CusF [Escherichia coli HVH 118 (4-7345399)]
 gb|EQR50435.1| cation efflux system protein CusF [Escherichia coli HVH 126 (4-6034225)]
 gb|EQR55463.1| cation efflux system protein CusF [Escherichia coli HVH 127 (4-7303629)]
 gb|EQR89892.1| cation efflux system protein CusF [Escherichia coli HVH 137 (4-2124971)]
 gb|EQT04939.1| cation efflux system protein CusF [Escherichia coli HVH 170 (4-3026949)]
 gb|EQT31388.1| cation efflux system protein CusF [Escherichia coli HVH 180 (4-3051617)]
 gb|EQT84795.1| cation efflux system protein CusF [Escherichia coli HVH 191 (3-9341900)]
 gb|EQT87129.1| cation efflux system protein CusF [Escherichia coli HVH 192 (4-3054470)]
 gb|EQU01033.1| cation efflux system protein CusF [Escherichia coli HVH 196 (4-4530470)]
 gb|EQU14629.1| cation efflux system protein CusF [Escherichia coli HVH 199 (4-5670322)]
 gb|EQU27281.1| cation efflux system protein CusF [Escherichia coli HVH 201 (4-4459431)]
 gb|EQU38690.1| cation efflux system protein CusF [Escherichia coli HVH 203 (4-3126218)]
 gb|EQU75089.1| cation efflux system protein CusF [Escherichia coli HVH 211 (4-3041891)]
 gb|EQU97636.1| cation efflux system protein CusF [Escherichia coli HVH 217 (4-1022806)]
 gb|EQV17013.1| cation efflux system protein CusF [Escherichia coli HVH 222 (4-2977443)]
 gb|EQV38752.1| cation efflux system protein CusF [Escherichia coli KOEGE 32 
(66a)]
 gb|EQW36033.1| cation efflux system protein CusF [Escherichia coli UMEA 3041-1]
 gb|EQW94523.1| cation efflux system protein CusF [Escherichia coli UMEA 3140-1]
 gb|EQX31668.1| cation efflux system protein CusF [Escherichia coli UMEA 3162-1]
 gb|EQY04706.1| cation efflux system protein CusF [Escherichia coli UMEA 3203-1]
 gb|EQY06318.1| cation efflux system protein CusF [Escherichia coli UMEA 3206-1]
 gb|EQZ22953.1| cation efflux system protein CusF [Escherichia coli UMEA 3391-1]
 gb|EQZ56667.1| cation efflux system protein CusF [Escherichia coli UMEA 3632-1]
 gb|EQZ61319.1| cation efflux system protein CusF [Escherichia coli UMEA 3662-1]
 gb|EQZ82956.1| cation efflux system protein CusF [Escherichia coli UMEA 3702-1]
 gb|ERA25283.1| cation efflux system protein CusF [Escherichia coli UMEA 3893-1]
 gb|ERA26408.1| cation efflux system protein CusF [Escherichia coli UMEA 3834-1]
 gb|ERA51528.1| cation efflux system protein CusF [Escherichia coli UMEA 4076-1]
 gb|ERA93237.1| cation efflux system protein CusF [Escherichia coli HVH 210 (4-3042480)]
 gb|ERB38341.1| cation efflux system protein CusF [Escherichia coli UMEA 3298-1]
 emb|CDH64099.1| Cation efflux system protein CusF precursor [Escherichia coli 
PMV-1]
 gb|ESE10170.1| cation efflux system protein CusF [Escherichia coli 908675]
 gb|ESP23811.1| cation efflux system protein CusF [Escherichia coli HVH 12 (4-7653042)]
 gb|ESP32589.1| cation efflux system protein CusF [Escherichia coli HVH 148 (4-3192490)]
 gb|ESP34165.1| cation efflux system protein CusF [Escherichia coli HVH 178 (4-3189163)]
 gb|ETF26197.1| cation efflux system protein CusF [Escherichia coli HVH 214 (4-3062198)]
 gb|ETY51846.1| cation efflux system protein CusF [Escherichia coli BIDMC 49b]
 gb|ETY53655.1| cation efflux system protein CusF [Escherichia coli BIDMC 49a]
 gb|EWC57053.1| periplasmic copper-binding protein [Escherichia coli EC096/10]
 gb|EWY55247.1| copper-binding protein [Escherichia coli MP1]
 gb|EYT11374.1| cation efflux system protein CusF [Escherichia coli K02]
 gb|EZA17267.1| copper-binding protein [Escherichia coli O81:NM str. 02-3012]
 gb|EZJ45909.1| cation efflux system protein CusF [Escherichia coli 2-005-03_S4_C3]
 gb|EZJ54559.1| cation efflux system protein CusF [Escherichia coli 2-005-03_S4_C2]
 gb|KDG07346.1| cation efflux system protein CusF [Escherichia coli BIDMC 65]
 gb|KDT29622.1| cation efflux system protein CusF [Escherichia coli 2-052-05_S4_C1]
 gb|KDZ54105.1| cation efflux system protein CusF [Escherichia coli 3-073-06_S1_C1]
 gb|KEJ79935.1| cation efflux system protein CusF [Escherichia coli 5-366-08_S1_C3]
 gb|KEL69287.1| cation efflux system protein CusF [Escherichia coli 5-366-08_S1_C1]
 gb|KFB92108.1| CusF family cation efflux system protein [Escherichia coli DSM 
30083 = JCM 1649 = ATCC 11775]
 gb|AJB38365.1| periplasmic copper-binding protein [Escherichia coli APEC IMT5155]
 gb|KIE68971.1| copper-binding protein [Escherichia coli]
 gb|KIE74645.1| copper-binding protein [Escherichia coli]
 gb|KIE83818.1| copper-binding protein [Escherichia coli RS218]
Length=110

 Score = 79.3 bits (194),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 38/40 (95%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKMSEIKTGDKVAFNFVQQG+LSL QDIKVSQ
Sbjct  71   MRFTITPQTKMSEIKTGDKVAFNFVQQGSLSLLQDIKVSQ  110



>gb|EKI45674.1| cation efflux system protein CusF [Escherichia coli 07798]
Length=102

 Score = 79.3 bits (194),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 38/40 (95%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKMSEIKTGDKVAFNFVQQG+LSL QDIKVSQ
Sbjct  63   MRFTITPQTKMSEIKTGDKVAFNFVQQGSLSLLQDIKVSQ  102



>ref|WP_044712089.1| copper-binding protein [Escherichia coli]
Length=110

 Score = 79.3 bits (194),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 38/40 (95%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKMSEIKTGDKVAF+FVQQGNLSL QDIKVSQ
Sbjct  71   MRFTITPQTKMSEIKTGDKVAFSFVQQGNLSLLQDIKVSQ  110



>ref|WP_001357854.1| cation transporter [Escherichia coli]
 gb|EFW68874.1| Cation efflux system protein CusF precursor [Escherichia coli 
WV_060327]
 gb|ELD13568.1| cation efflux system protein CusF [Escherichia coli KTE205]
 gb|ELE22663.1| cation efflux system protein CusF [Escherichia coli KTE57]
 gb|ELG37811.1| cation efflux system protein CusF [Escherichia coli KTE84]
 gb|ELI63491.1| cation efflux system protein CusF [Escherichia coli KTE129]
 gb|ELJ16196.1| cation efflux system protein CusF [Escherichia coli KTE157]
 gb|ELJ75764.1| cation efflux system protein CusF [Escherichia coli KTE85]
 gb|EOV41419.1| cation efflux system protein CusF [Escherichia coli KTE219]
 gb|EOX01682.1| cation efflux system protein CusF [Escherichia coli KTE182]
 gb|EQN98849.1| cation efflux system protein CusF [Escherichia coli HVH 26 (4-5703913)]
 gb|EQP03438.1| cation efflux system protein CusF [Escherichia coli HVH 55 (4-2646161)]
 gb|EQQ81173.1| cation efflux system protein CusF [Escherichia coli HVH 107 (4-5860571)]
 gb|EQR62937.1| cation efflux system protein CusF [Escherichia coli HVH 128 (4-7030436)]
 gb|EQU88963.1| cation efflux system protein CusF [Escherichia coli HVH 213 (4-3042928)]
 gb|EQV37076.1| cation efflux system protein CusF [Escherichia coli HVH 225 (4-1273116)]
 gb|EQW46412.1| cation efflux system protein CusF [Escherichia coli UMEA 3053-1]
 gb|EQW66932.1| cation efflux system protein CusF [Escherichia coli UMEA 3088-1]
 gb|EQW89799.1| cation efflux system protein CusF [Escherichia coli UMEA 3122-1]
 gb|EQX03727.1| cation efflux system protein CusF [Escherichia coli UMEA 3152-1]
 gb|EQY19194.1| cation efflux system protein CusF [Escherichia coli UMEA 3215-1]
 gb|ESE21664.1| cation efflux system protein CusF [Escherichia coli 910096-2]
 gb|KDG11381.1| cation efflux system protein CusF [Escherichia coli BIDMC 72]
 gb|KDG11874.1| cation efflux system protein CusF [Escherichia coli BIDMC 73]
 gb|KEL53437.1| cation efflux system protein CusF [Escherichia coli 6-175-07_S1_C1]
Length=110

 Score = 79.3 bits (194),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 38/40 (95%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKMSEIKTGDKVAFNFVQQG+LSL QDIKVSQ
Sbjct  71   MRFTITPQTKMSEIKTGDKVAFNFVQQGSLSLLQDIKVSQ  110



>ref|WP_042003289.1| copper-binding protein [Escherichia coli]
Length=110

 Score = 79.3 bits (194),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 38/40 (95%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKMSEIKTGDKVAFNFVQQG+LSL QDIKVSQ
Sbjct  71   MRFTITPQTKMSEIKTGDKVAFNFVQQGSLSLLQDIKVSQ  110



>ref|WP_021531109.1| cation efflux system protein CusF [Escherichia coli]
 gb|EQR46612.1| cation efflux system protein CusF [Escherichia coli HVH 125 (4-2634716)]
 gb|EQV73705.1| cation efflux system protein CusF [Escherichia coli KOEGE 56 
(169a)]
 gb|EQY47195.1| cation efflux system protein CusF [Escherichia coli UMEA 3221-1]
 gb|EQY48094.1| cation efflux system protein CusF [Escherichia coli UMEA 3230-1]
Length=110

 Score = 79.3 bits (194),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 38/40 (95%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKMSEIKTGDKVAFNFVQQG+LSL QDIKVSQ
Sbjct  71   MRFTITPQTKMSEIKTGDKVAFNFVQQGSLSLLQDIKVSQ  110



>ref|WP_001700488.1| cation efflux system protein CusF [Escherichia coli]
 gb|EMV35777.1| cation efflux system protein CusF [Escherichia coli BCE002_MS12]
Length=110

 Score = 79.3 bits (194),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 38/40 (95%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTI PQTKMSEIKTGDKVAFNFVQQGNLSL QDIKVSQ
Sbjct  71   MRFTIPPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ  110



>ref|WP_001668456.1| cation efflux system protein CusF [Escherichia coli]
 gb|ENG68933.1| cation efflux system protein CusF [Escherichia coli p0305293.4]
Length=110

 Score = 79.3 bits (194),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 38/40 (95%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTI PQTKMSEIKTGDKVAFNFVQQGNLSL QDIKVSQ
Sbjct  71   MRFTIPPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ  110



>ref|WP_044067106.1| copper-binding protein [Escherichia coli]
Length=110

 Score = 79.3 bits (194),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/40 (95%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKMSEIKT DKVAFNFVQQGNLSL QDIKVSQ
Sbjct  71   MRFTITPQTKMSEIKTSDKVAFNFVQQGNLSLLQDIKVSQ  110



>ref|WP_000709866.1| cation transporter [Escherichia coli]
 gb|EDV88031.1| cation efflux system protein CusF [Escherichia coli E110019]
Length=110

 Score = 78.6 bits (192),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/40 (95%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSL Q IKVSQ
Sbjct  71   MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQGIKVSQ  110



>ref|WP_032084404.1| copper-binding protein [Escherichia coli]
Length=110

 Score = 78.6 bits (192),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/40 (95%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKMSEIKT DKVAFNFVQQGNLSL QDIKVSQ
Sbjct  71   MRFTITPQTKMSEIKTDDKVAFNFVQQGNLSLLQDIKVSQ  110



>ref|WP_000709868.1| cation transporter [Escherichia coli]
 ref|NP_286298.1| copper-binding protein [Escherichia coli O157:H7 str. EDL933]
 ref|NP_308638.1| copper-binding protein [Escherichia coli O157:H7 str. Sakai]
 sp|Q8XBY2.1|CUSF_ECO57 RecName: Full=Cation efflux system protein CusF; Flags: Precursor 
[Escherichia coli O157:H7]
 gb|AAG54906.1|AE005237_2 orf, hypothetical protein [Escherichia coli O157:H7 str. EDL933]
 dbj|BAB34034.1| hypothetical protein [Escherichia coli O157:H7 str. Sakai]
 gb|EDU33571.1| cation efflux system protein CusF [Escherichia coli O157:H7 str. 
EC4196]
 gb|EDU55706.1| cation efflux system protein CusF [Escherichia coli O157:H7 str. 
EC4113]
 gb|EDU71805.1| cation efflux system protein CusF [Escherichia coli O157:H7 str. 
EC4076]
 gb|EDU76443.1| cation efflux system protein CusF [Escherichia coli O157:H7 str. 
EC4401]
 gb|EDU79271.1| cation efflux system protein CusF [Escherichia coli O157:H7 str. 
EC4486]
 gb|EDU87601.1| cation efflux system protein CusF [Escherichia coli O157:H7 str. 
EC4501]
 gb|EDU92152.1| cation efflux system protein CusF [Escherichia coli O157:H7 str. 
EC869]
 gb|EDU97773.1| cation efflux system protein CusF [Escherichia coli O157:H7 str. 
EC508]
 gb|EDZ78956.1| cation efflux system protein CusF [Escherichia coli O157:H7 str. 
EC4206]
 gb|EDZ80689.1| cation efflux system protein CusF [Escherichia coli O157:H7 str. 
EC4045]
 gb|EDZ85165.1| cation efflux system protein CusF [Escherichia coli O157:H7 str. 
EC4042]
 gb|ACI34892.1| cation efflux system protein CusF [Escherichia coli O157:H7 str. 
EC4115]
 gb|ACI87171.1| hypothetical protein ECs0611 [Escherichia coli]
 gb|ACI87172.1| hypothetical protein ECs0611 [Escherichia coli]
 gb|ACI87173.1| hypothetical protein ECs0611 [Escherichia coli]
 gb|ACI87174.1| hypothetical protein ECs0611 [Escherichia coli]
 gb|ACI87175.1| hypothetical protein ECs0611 [Escherichia coli]
 gb|EEC29477.1| cation efflux system protein CusF [Escherichia coli O157:H7 str. 
TW14588]
 gb|ACT70499.1| periplasmic copper-binding protein [Escherichia coli O157:H7 
str. TW14359]
 gb|ADD55357.1| Cation efflux system protein cusF precursor [Escherichia coli 
O55:H7 str. CB9615]
 gb|EFW67617.1| Cation efflux system protein CusF precursor [Escherichia coli 
O157:H7 str. EC1212]
 gb|EFX07784.1| periplasmic copper-binding protein [Escherichia coli O157:H7 
str. G5101]
 gb|EFX12596.1| periplasmic copper-binding protein [Escherichia coli O157:H- 
str. 493-89]
 gb|EFX17388.1| periplasmic copper-binding protein [Escherichia coli O157:H- 
str. H 2687]
 gb|EFX22394.1| periplasmic copper-binding protein [Escherichia coli O55:H7 str. 
3256-97 TW 07815]
 gb|EFX27662.1| periplasmic copper-binding protein [Escherichia coli O55:H7 str. 
USDA 5905]
 gb|EFX31959.1| periplasmic copper-binding protein [Escherichia coli O157:H7 
str. LSU-61]
 gb|EGD65116.1| Cation efflux system protein CusF precursor [Escherichia coli 
O157:H7 str. 1044]
 gb|EGD69638.1| Cation efflux system protein CusF precursor [Escherichia coli 
O157:H7 str. 1125]
 gb|AEZ39333.1| periplasmic copper-binding protein [Escherichia coli O55:H7 str. 
RM12579]
 gb|EHU64393.1| periplasmic copper/silver-binding protein [Escherichia coli DEC3A]
 gb|EHU66305.1| periplasmic copper/silver-binding protein [Escherichia coli DEC3B]
 gb|EHU77856.1| periplasmic copper/silver-binding protein [Escherichia coli DEC3C]
 gb|EHU82006.1| periplasmic copper/silver-binding protein [Escherichia coli DEC3D]
 gb|EHU84398.1| periplasmic copper/silver-binding protein [Escherichia coli DEC3E]
 gb|EHU95496.1| periplasmic copper/silver-binding protein [Escherichia coli DEC3F]
 gb|EHU97846.1| periplasmic copper/silver-binding protein [Escherichia coli DEC4A]
 gb|EHV03005.1| periplasmic copper/silver-binding protein [Escherichia coli DEC4B]
 gb|EHV13295.1| periplasmic copper/silver-binding protein [Escherichia coli DEC4C]
 gb|EHV14954.1| periplasmic copper/silver-binding protein [Escherichia coli DEC4D]
 gb|EHV17683.1| periplasmic copper/silver-binding protein [Escherichia coli DEC4E]
 gb|EHV28864.1| periplasmic copper/silver-binding protein [Escherichia coli DEC5A]
 gb|EHV30932.1| periplasmic copper/silver-binding protein [Escherichia coli DEC4F]
 gb|EHV35817.1| periplasmic copper/silver-binding protein [Escherichia coli DEC5B]
 gb|EHV43650.1| periplasmic copper/silver-binding protein [Escherichia coli DEC5C]
 gb|EHV43731.1| periplasmic copper/silver-binding protein [Escherichia coli DEC5D]
 gb|EHV50541.1| cation efflux system protein CusF [Escherichia coli DEC5E]
 gb|AFJ27641.1| periplasmic copper-binding protein [Escherichia coli Xuzhou21]
 gb|EIN29107.1| cation efflux system protein CusF [Escherichia coli FRIK1996]
 gb|EIN30754.1| cation efflux system protein CusF [Escherichia coli FDA517]
 gb|EIN31185.1| cation efflux system protein CusF [Escherichia coli FDA505]
 gb|EIN46170.1| cation efflux system protein CusF [Escherichia coli 93-001]
 gb|EIN48908.1| cation efflux system protein CusF [Escherichia coli FRIK1990]
 gb|EIN49797.1| cation efflux system protein CusF [Escherichia coli FRIK1985]
 gb|EIN63496.1| cation efflux system protein CusF [Escherichia coli PA3]
 gb|EIN66570.1| cation efflux system protein CusF [Escherichia coli PA9]
 gb|EIN67420.1| cation efflux system protein CusF [Escherichia coli PA5]
 gb|EIN81428.1| cation efflux system protein CusF [Escherichia coli PA10]
 gb|EIN83072.1| cation efflux system protein CusF [Escherichia coli PA15]
 gb|EIN84741.1| cation efflux system protein CusF [Escherichia coli PA14]
 gb|EIN93219.1| cation efflux system protein CusF [Escherichia coli PA22]
 gb|EIO04796.1| cation efflux system protein CusF [Escherichia coli PA25]
 gb|EIO04955.1| cation efflux system protein CusF [Escherichia coli PA24]
 gb|EIO07803.1| cation efflux system protein CusF [Escherichia coli PA28]
 gb|EIO21745.1| cation efflux system protein CusF [Escherichia coli PA31]
 gb|EIO22051.1| cation efflux system protein CusF [Escherichia coli PA32]
 gb|EIO24183.1| cation efflux system protein CusF [Escherichia coli PA33]
 gb|EIO31805.1| cation efflux system protein CusF [Escherichia coli PA40]
 gb|EIO43887.1| cation efflux system protein CusF [Escherichia coli PA41]
 gb|EIO45560.1| cation efflux system protein CusF [Escherichia coli PA42]
 gb|EIO51145.1| cation efflux system protein CusF [Escherichia coli PA39]
 gb|EIO53354.1| cation efflux system protein CusF [Escherichia coli TW06591]
 gb|EIO59191.1| cation efflux system protein CusF [Escherichia coli TW10246]
 gb|EIO68983.1| cation efflux system protein CusF [Escherichia coli TW11039]
 gb|EIO76191.1| cation efflux system protein CusF [Escherichia coli TW07945]
 gb|EIO78211.1| cation efflux system protein CusF [Escherichia coli TW09109]
 gb|EIO85436.1| cation efflux system protein CusF [Escherichia coli TW10119]
 gb|EIO88898.1| cation efflux system protein CusF [Escherichia coli TW09098]
 gb|EIP01485.1| cation efflux system protein CusF [Escherichia coli EC4203]
 gb|EIP03953.1| cation efflux system protein CusF [Escherichia coli EC4196]
 gb|EIP05571.1| cation efflux system protein CusF [Escherichia coli TW09195]
 gb|EIP18166.1| cation efflux system protein CusF [Escherichia coli TW14301]
 gb|EIP21680.1| cation efflux system protein CusF [Escherichia coli EC4421]
 gb|EIP22101.1| cation efflux system protein CusF [Escherichia coli TW14313]
 gb|EIP32787.1| cation efflux system protein CusF [Escherichia coli EC4422]
 gb|EIP46133.1| cation efflux system protein CusF [Escherichia coli EC4402]
 gb|EIP47798.1| cation efflux system protein CusF [Escherichia coli EC4439]
 gb|EIP53876.1| cation efflux system protein CusF [Escherichia coli EC4436]
 gb|EIP56516.1| cation efflux system protein CusF [Escherichia coli EC1738]
 gb|EIP68352.1| cation efflux system protein CusF [Escherichia coli EC1734]
 gb|EIP68955.1| cation efflux system protein CusF [Escherichia coli EC4437]
 gb|EIP73446.1| cation efflux system protein CusF [Escherichia coli EC4448]
 gb|EIP82421.1| cation efflux system protein CusF [Escherichia coli EC1863]
 gb|EIP83584.1| cation efflux system protein CusF [Escherichia coli EC1845]
 gb|EKH06331.1| cation efflux system protein CusF [Escherichia coli PA7]
 gb|EKH09684.1| cation efflux system protein CusF [Escherichia coli FRIK920]
 gb|EKH19384.1| cation efflux system protein CusF [Escherichia coli PA34]
 gb|EKH23326.1| cation efflux system protein CusF [Escherichia coli FDA506]
 gb|EKH28293.1| cation efflux system protein CusF [Escherichia coli FDA507]
 gb|EKH34572.1| cation efflux system protein CusF [Escherichia coli FDA504]
 gb|EKH41682.1| cation efflux system protein CusF [Escherichia coli FRIK1999]
 gb|EKH47719.1| cation efflux system protein CusF [Escherichia coli FRIK1997]
 gb|EKH52709.1| cation efflux system protein CusF [Escherichia coli NE1487]
 gb|EKH60332.1| cation efflux system protein CusF [Escherichia coli NE037]
 gb|EKH62115.1| cation efflux system protein CusF [Escherichia coli FRIK2001]
 gb|EKH70704.1| cation efflux system protein CusF [Escherichia coli PA4]
 gb|EKH78719.1| cation efflux system protein CusF [Escherichia coli PA23]
 gb|EKH81124.1| cation efflux system protein CusF [Escherichia coli PA49]
 gb|EKH85734.1| cation efflux system protein CusF [Escherichia coli PA45]
 gb|EKH94161.1| cation efflux system protein CusF [Escherichia coli TT12B]
 gb|EKH98988.1| cation efflux system protein CusF [Escherichia coli MA6]
 gb|EKI01403.1| cation efflux system protein CusF [Escherichia coli 5905]
 gb|EKI12803.1| cation efflux system protein CusF [Escherichia coli CB7326]
 gb|EKI17151.1| cation efflux system protein CusF [Escherichia coli EC96038]
 gb|EKI17368.1| cation efflux system protein CusF [Escherichia coli 5412]
 gb|EKI55943.1| cation efflux system protein CusF [Escherichia coli PA38]
 gb|EKI61642.1| cation efflux system protein CusF [Escherichia coli EC1735]
 gb|EKI70868.1| cation efflux system protein CusF [Escherichia coli EC1736]
 gb|EKI74283.1| cation efflux system protein CusF [Escherichia coli EC1737]
 gb|EKI80216.1| cation efflux system protein CusF [Escherichia coli EC1846]
 gb|EKI88584.1| cation efflux system protein CusF [Escherichia coli EC1847]
 gb|EKI90043.1| cation efflux system protein CusF [Escherichia coli EC1848]
 gb|EKI98412.1| cation efflux system protein CusF [Escherichia coli EC1849]
 gb|EKJ04023.1| cation efflux system protein CusF [Escherichia coli EC1850]
 gb|EKJ06327.1| cation efflux system protein CusF [Escherichia coli EC1856]
 gb|EKJ18064.1| cation efflux system protein CusF [Escherichia coli EC1862]
 gb|EKJ18383.1| cation efflux system protein CusF [Escherichia coli EC1864]
 gb|EKJ33540.1| cation efflux system protein CusF [Escherichia coli EC1868]
 gb|EKJ33712.1| cation efflux system protein CusF [Escherichia coli EC1866]
 gb|EKJ46401.1| cation efflux system protein CusF [Escherichia coli EC1869]
 gb|EKJ51331.1| cation efflux system protein CusF [Escherichia coli NE098]
 gb|EKJ52611.1| cation efflux system protein CusF [Escherichia coli EC1870]
 gb|EKJ64280.1| cation efflux system protein CusF [Escherichia coli FRIK523]
 gb|EKJ66469.1| cation efflux system protein CusF [Escherichia coli 0.1304]
 gb|EKK34771.1| cation efflux system protein CusF [Escherichia coli 5.2239]
 gb|EKK35183.1| cation efflux system protein CusF [Escherichia coli 3.4870]
 gb|EKK36182.1| cation efflux system protein CusF [Escherichia coli 6.0172]
 gb|EKK59967.1| cation efflux system protein CusF [Escherichia coli 8.0586]
 gb|EKK64518.1| cation efflux system protein CusF [Escherichia coli 8.2524]
 gb|EKK66174.1| cation efflux system protein CusF [Escherichia coli 10.0833]
 gb|EKK77554.1| cation efflux system protein CusF [Escherichia coli 10.0869]
 gb|EKK79043.1| cation efflux system protein CusF [Escherichia coli 8.0416]
 gb|EKK83395.1| cation efflux system protein CusF [Escherichia coli 88.0221]
 gb|EKK89990.1| cation efflux system protein CusF [Escherichia coli 10.0821]
 gb|EKV83590.1| cation efflux system protein CusF [Escherichia coli 88.1042]
 gb|EKV85446.1| cation efflux system protein CusF [Escherichia coli 89.0511]
 gb|EKV85901.1| cation efflux system protein CusF [Escherichia coli 88.1467]
 gb|EKW01332.1| cation efflux system protein CusF [Escherichia coli 90.2281]
 gb|EKW01538.1| cation efflux system protein CusF [Escherichia coli 90.0039]
 gb|EKW03486.1| cation efflux system protein CusF [Escherichia coli 90.0091]
 gb|EKW17814.1| cation efflux system protein CusF [Escherichia coli 93.0056]
 gb|EKW19217.1| cation efflux system protein CusF [Escherichia coli 93.0055]
 gb|EKW20262.1| cation efflux system protein CusF [Escherichia coli 94.0618]
 gb|EKW34975.1| cation efflux system protein CusF [Escherichia coli 95.0943]
 gb|EKW35191.1| cation efflux system protein CusF [Escherichia coli 95.0183]
 gb|EKW40290.1| cation efflux system protein CusF [Escherichia coli 95.1288]
 gb|EKW50084.1| cation efflux system protein CusF [Escherichia coli 96.0428]
 gb|EKW55151.1| cation efflux system protein CusF [Escherichia coli 96.0427]
 gb|EKW56755.1| cation efflux system protein CusF [Escherichia coli 96.0939]
 gb|EKW67276.1| cation efflux system protein CusF [Escherichia coli 97.0003]
 gb|EKW68615.1| cation efflux system protein CusF [Escherichia coli 96.0932]
 gb|EKW72745.1| cation efflux system protein CusF [Escherichia coli 96.0107]
 gb|EKW83023.1| cation efflux system protein CusF [Escherichia coli 97.1742]
 gb|EKW83804.1| cation efflux system protein CusF [Escherichia coli 97.0007]
 gb|EKW94905.1| cation efflux system protein CusF [Escherichia coli 99.0713]
 gb|EKW95199.1| cation efflux system protein CusF [Escherichia coli 99.0678]
 gb|EKW97552.1| cation efflux system protein CusF [Escherichia coli 99.0672]
 gb|EKY43473.1| cation efflux system protein CusF [Escherichia coli 96.0109]
 gb|EKY45131.1| cation efflux system protein CusF [Escherichia coli 97.0010]
 gb|ELV21703.1| cation efflux system protein CusF [Escherichia coli 99.0814]
 gb|ELV28374.1| cation efflux system protein CusF [Escherichia coli 09BKT078844]
 gb|ELV29563.1| cation efflux system protein CusF [Escherichia coli 99.0815]
 gb|ELV41675.1| cation efflux system protein CusF [Escherichia coli 99.0839]
 gb|ELV43686.1| cation efflux system protein CusF [Escherichia coli 99.0816]
 gb|ELV47479.1| cation efflux system protein CusF [Escherichia coli 99.0848]
 gb|ELV57933.1| cation efflux system protein CusF [Escherichia coli 99.1753]
 gb|ELV60572.1| cation efflux system protein CusF [Escherichia coli 99.1775]
 gb|ELV61310.1| cation efflux system protein CusF [Escherichia coli 99.1793]
 gb|ELV74379.1| cation efflux system protein CusF [Escherichia coli ATCC 700728]
 gb|ELV74564.1| cation efflux system protein CusF [Escherichia coli PA11]
 gb|ELV82651.1| cation efflux system protein CusF [Escherichia coli 99.1805]
 gb|ELV88350.1| cation efflux system protein CusF [Escherichia coli PA13]
 gb|ELV88547.1| cation efflux system protein CusF [Escherichia coli PA19]
 gb|ELV96990.1| cation efflux system protein CusF [Escherichia coli PA2]
 gb|ELW05610.1| cation efflux system protein CusF [Escherichia coli PA48]
 gb|ELW05905.1| cation efflux system protein CusF [Escherichia coli PA47]
 gb|ELW10194.1| cation efflux system protein CusF [Escherichia coli PA8]
 gb|ELW20153.1| cation efflux system protein CusF [Escherichia coli 7.1982]
 gb|ELW22719.1| cation efflux system protein CusF [Escherichia coli 99.1781]
 gb|ELW25977.1| cation efflux system protein CusF [Escherichia coli 99.1762]
 gb|ELW34520.1| cation efflux system protein CusF [Escherichia coli PA35]
 gb|ELW38779.1| cation efflux system protein CusF [Escherichia coli 3.4880]
 gb|ELW44300.1| cation efflux system protein CusF [Escherichia coli 95.0083]
 gb|ELW45915.1| cation efflux system protein CusF [Escherichia coli 99.0670]
 gb|EQW37851.1| cation efflux system protein CusF [Escherichia coli UMEA 3052-1]
 gb|ERB78251.1| cation efflux system protein CusF [Escherichia coli B107]
 gb|ERB88034.1| cation efflux system protein CusF [Escherichia coli B102]
 gb|ERB91433.1| cation efflux system protein CusF [Escherichia coli B26-1]
 gb|ERB94821.1| cation efflux system protein CusF [Escherichia coli B26-2]
 gb|ERC05609.1| cation efflux system protein CusF [Escherichia coli B28-2]
 gb|ERC06873.1| cation efflux system protein CusF [Escherichia coli B28-1]
 gb|ERC13349.1| cation efflux system protein CusF [Escherichia coli B29-1]
 gb|ERC22158.1| cation efflux system protein CusF [Escherichia coli B29-2]
 gb|ERC25653.1| cation efflux system protein CusF [Escherichia coli B36-1]
 gb|ERC28773.1| cation efflux system protein CusF [Escherichia coli B36-2]
 gb|ERC36903.1| cation efflux system protein CusF [Escherichia coli B7-1]
 gb|ERC45502.1| cation efflux system protein CusF [Escherichia coli B7-2]
 gb|ERC46816.1| cation efflux system protein CusF [Escherichia coli B93]
 gb|ERC52274.1| cation efflux system protein CusF [Escherichia coli B94]
 gb|ERC60064.1| cation efflux system protein CusF [Escherichia coli B95]
 gb|ERC71141.1| cation efflux system protein CusF [Escherichia coli 08BKT055439]
 gb|ERC73207.1| cation efflux system protein CusF [Escherichia coli Bd5610_99]
 gb|ERC73614.1| cation efflux system protein CusF [Escherichia coli T234_00]
 gb|ERC76643.1| cation efflux system protein CusF [Escherichia coli T1840_97]
 gb|ERC89618.1| cation efflux system protein CusF [Escherichia coli T924_01]
 gb|ERC91046.1| cation efflux system protein CusF [Escherichia coli 14A]
 gb|ERD04158.1| cation efflux system protein CusF [Escherichia coli B104]
 gb|ERD06073.1| cation efflux system protein CusF [Escherichia coli B103]
 gb|ERD07037.1| cation efflux system protein CusF [Escherichia coli 2886-75]
 gb|ERD19569.1| cation efflux system protein CusF [Escherichia coli B105]
 gb|ERD21138.1| cation efflux system protein CusF [Escherichia coli B106]
 gb|ERD22034.1| cation efflux system protein CusF [Escherichia coli B108]
 gb|ERD33785.1| cation efflux system protein CusF [Escherichia coli B109]
 gb|ERD35788.1| cation efflux system protein CusF [Escherichia coli B112]
 gb|ERD43164.1| cation efflux system protein CusF [Escherichia coli B113]
 gb|ERD50687.1| cation efflux system protein CusF [Escherichia coli B114]
 gb|ERD53253.1| cation efflux system protein CusF [Escherichia coli B15]
 gb|ERD54641.1| cation efflux system protein CusF [Escherichia coli B17]
 gb|ERD67569.1| cation efflux system protein CusF [Escherichia coli B40-2]
 gb|ERD71290.1| cation efflux system protein CusF [Escherichia coli B49-2]
 gb|ERD71674.1| cation efflux system protein CusF [Escherichia coli B40-1]
 gb|ERD81758.1| cation efflux system protein CusF [Escherichia coli B5-2]
 gb|ERD84919.1| cation efflux system protein CusF [Escherichia coli B83]
 gb|ERD89672.1| cation efflux system protein CusF [Escherichia coli B84]
 gb|ERD96193.1| cation efflux system protein CusF [Escherichia coli B86]
 gb|ERD96439.1| cation efflux system protein CusF [Escherichia coli B85]
 gb|ERE10631.1| cation efflux system protein CusF [Escherichia coli 08BKT77219]
 gb|ERE20684.1| cation efflux system protein CusF [Escherichia coli 09BKT024447]
 gb|ERE26248.1| cation efflux system protein CusF [Escherichia coli T1282_01]
 gb|ERE34845.1| cation efflux system protein CusF [Escherichia coli B89]
 gb|ERE37686.1| cation efflux system protein CusF [Escherichia coli B90]
 gb|ERE40865.1| cation efflux system protein CusF [Escherichia coli Tx1686]
 gb|ERE44682.1| cation efflux system protein CusF [Escherichia coli Tx3800]
 gb|ETJ80822.1| cation transporter [Escherichia coli ATCC BAA-2192]
 gb|EYV53211.1| copper-binding protein [Escherichia coli O157:H7 str. 2009EL2109]
 gb|EYV66260.1| copper-binding protein [Escherichia coli O157:H7 str. 2009EL1705]
 gb|EYV83978.1| copper-binding protein [Escherichia coli O157:H7 str. K5806]
 gb|EYV91652.1| copper-binding protein [Escherichia coli O157:H7 str. F7350]
 gb|EYW02648.1| copper-binding protein [Escherichia coli O157:H7 str. 2011EL-2312]
 gb|EYW10352.1| copper-binding protein [Escherichia coli O157:H7 str. 2011EL-2288]
 gb|EYW12462.1| copper-binding protein [Escherichia coli O157:H7 str. 2011EL-2289]
 gb|EYW19348.1| copper-binding protein [Escherichia coli O157:H7 str. 2011EL-2287]
 gb|EYW20353.1| copper-binding protein [Escherichia coli O157:H7 str. 2011EL-2114]
 gb|EYW23552.1| copper-binding protein [Escherichia coli O157:H7 str. 2011EL-2286]
 gb|EYW37829.1| copper-binding protein [Escherichia coli O157:H7 str. 2011EL-2113]
 gb|EYW39525.1| copper-binding protein [Escherichia coli O157:H7 str. 2011EL-2112]
 gb|EYW40960.1| copper-binding protein [Escherichia coli O157:H7 str. 2011EL-2111]
 gb|EYW47490.1| copper-binding protein [Escherichia coli O157:H7 str. 2011EL-2109]
 gb|EYW51024.1| copper-binding protein [Escherichia coli O157:H7 str. 2011EL-2107]
 gb|EYW52311.1| copper-binding protein [Escherichia coli O157:H7 str. 2011EL-2108]
 gb|EYW58116.1| copper-binding protein [Escherichia coli O157:H7 str. 2011EL-2106]
 gb|EYW62460.1| copper-binding protein [Escherichia coli O157:H7 str. 2011EL-2105]
 gb|EYW69709.1| copper-binding protein [Escherichia coli O157:H7 str. 2011EL-2104]
 gb|EYW74144.1| copper-binding protein [Escherichia coli O157:H7 str. 2011EL-2103]
 gb|EYW79896.1| copper-binding protein [Escherichia coli O157:H7 str. 2011EL-2101]
 gb|EYW82357.1| copper-binding protein [Escherichia coli O157:H7 str. 2011EL-2099]
 gb|EYW95217.1| copper-binding protein [Escherichia coli O157:H7 str. 08-4169]
 gb|EYX12632.1| copper-binding protein [Escherichia coli O157:H7 str. 08-3037]
 gb|EYX13440.1| copper-binding protein [Escherichia coli O157:H7 str. 08-3527]
 gb|EYX26370.1| copper-binding protein [Escherichia coli O157:H7 str. 2011EL-2098]
 gb|EYX29315.1| copper-binding protein [Escherichia coli O157:H7 str. 2011EL-2097]
 gb|EYX32161.1| copper-binding protein [Escherichia coli O157:H7 str. 2011EL-2096]
 gb|EYX37601.1| copper-binding protein [Escherichia coli O157:H7 str. 2011EL-2093]
 gb|EYX40138.1| copper-binding protein [Escherichia coli O157:H7 str. 2011EL-2094]
 gb|EYX47289.1| copper-binding protein [Escherichia coli O157:H7 str. 2011EL-2092]
 gb|EYX51630.1| copper-binding protein [Escherichia coli O157:H7 str. 2011EL-2091]
 gb|EYX59671.1| copper-binding protein [Escherichia coli O157:H7 str. 2011EL-2090]
 gb|EYX66582.1| copper-binding protein [Escherichia coli O157:H7 str. 2011EL-1107]
 gb|EYY50977.1| copper-binding protein [Escherichia coli O157:H7 str. 2010C-4979C1]
 gb|EYZ29628.1| copper-binding protein [Escherichia coli O157:H7 str. 07-3391]
 gb|EYZ35726.1| copper-binding protein [Escherichia coli O157:H7 str. 07-3091]
 gb|EYZ39085.1| copper-binding protein [Escherichia coli O157:H7 str. 06-4039]
 gb|EYZ51872.1| copper-binding protein [Escherichia coli O157:H7 str. 06-3745]
 gb|EYZ52925.1| copper-binding protein [Escherichia coli O55:H7 str. 06-3555]
 gb|EZA86278.1| copper-binding protein [Escherichia coli O157:H7 str. F6142]
 gb|EZB03237.1| copper-binding protein [Escherichia coli O157:H7 str. F6749]
 gb|EZB04659.1| copper-binding protein [Escherichia coli O157:H7 str. F6750]
 gb|EZB08603.1| copper-binding protein [Escherichia coli O157:H7 str. F6751]
 gb|EZB14028.1| copper-binding protein [Escherichia coli O157:H7 str. F7377]
 gb|EZB16083.1| copper-binding protein [Escherichia coli O157:H7 str. F7384]
 gb|EZB22932.1| copper-binding protein [Escherichia coli O157:H7 str. F7410]
 gb|EZB31573.1| copper-binding protein [Escherichia coli O157:H7 str. G5303]
 gb|EZB35774.1| copper-binding protein [Escherichia coli O157:H7 str. H2495]
 gb|EZB40452.1| copper-binding protein [Escherichia coli O157:H7 str. H2498]
 gb|EZB43768.1| copper-binding protein [Escherichia coli O157:H7 str. K1420]
 gb|EZB56860.1| copper-binding protein [Escherichia coli O157:H7 str. K1793]
 gb|EZB60701.1| copper-binding protein [Escherichia coli O157:H7 str. K1792]
 gb|EZB68342.1| copper-binding protein [Escherichia coli O157:H7 str. K1845]
 gb|EZB72626.1| copper-binding protein [Escherichia coli O157:H7 str. K1795]
 gb|EZB76249.1| copper-binding protein [Escherichia coli O157:H7 str. K1796]
 gb|EZB86297.1| copper-binding protein [Escherichia coli O157:H7 str. K1927]
 gb|EZB86900.1| copper-binding protein [Escherichia coli O157:H7 str. K1921]
 gb|EZB91601.1| copper-binding protein [Escherichia coli O157:H7 str. K2188]
 gb|EZC01374.1| copper-binding protein [Escherichia coli O157:H7 str. K2191]
 gb|EZC04801.1| copper-binding protein [Escherichia coli O157:H7 str. K2324]
 gb|EZC07804.1| copper-binding protein [Escherichia coli O157:H7 str. K2192]
 gb|EZC15094.1| copper-binding protein [Escherichia coli O157:H7 str. K2581]
 gb|EZC16964.1| copper-binding protein [Escherichia coli O157:H7 str. K2622]
 gb|EZC23875.1| copper-binding protein [Escherichia coli O157:H7 str. K2845]
 gb|EZC30474.1| copper-binding protein [Escherichia coli O157:H7 str. K2854]
 gb|EZC35280.1| copper-binding protein [Escherichia coli O157:H7 str. K4396]
 gb|EZC38710.1| copper-binding protein [Escherichia coli O157:H7 str. K4405]
 gb|EZC41612.1| copper-binding protein [Escherichia coli O157:H7 str. K4406]
 gb|EZC46044.1| copper-binding protein [Escherichia coli O157:H7 str. K4527]
 gb|EZC57595.1| copper-binding protein [Escherichia coli O157:H7 str. K5418]
 gb|EZC67331.1| copper-binding protein [Escherichia coli O157:H7 str. K5448]
 gb|EZC72033.1| copper-binding protein [Escherichia coli O157:H7 str. K5453]
 gb|EZC73187.1| copper-binding protein [Escherichia coli O157:H7 str. K5449]
 gb|EZC80763.1| copper-binding protein [Escherichia coli O157:H7 str. K5460]
 gb|EZC88387.1| copper-binding protein [Escherichia coli O157:H7 str. K5467]
 gb|EZC92070.1| copper-binding protein [Escherichia coli O157:H7 str. K5602]
 gb|EZC94349.1| copper-binding protein [Escherichia coli O157:H7 str. K5609]
 gb|EZC95527.1| copper-binding protein [Escherichia coli O157:H7 str. K5607]
 gb|EZD05195.1| copper-binding protein [Escherichia coli O157:H7 str. K5852]
 gb|EZD06395.1| copper-binding protein [Escherichia coli O157:H7 str. K6590]
 gb|EZD11579.1| copper-binding protein [Escherichia coli O157:H7 str. K6676]
 gb|EZD18199.1| copper-binding protein [Escherichia coli O157:H7 str. K6687]
 gb|EZD74634.1| copper-binding protein [Escherichia coli O157:H7 str. K7140]
 gb|EZD84962.1| copper-binding protein [Escherichia coli O157:H7 str. 08-4529]
 gb|EZD91138.1| copper-binding protein [Escherichia coli O157:NM str. 08-4540]
 gb|EZE58753.1| copper-binding protein [Escherichia coli O157:H7 str. 2009C-4258]
 gb|EZE83406.1| copper-binding protein [Escherichia coli O157:H7 str. 2009EL1913]
 gb|EZE85673.1| copper-binding protein [Escherichia coli O157:H7 str. 2009EL1449]
 gb|EZF02522.1| copper-binding protein [Escherichia coli O157:H7 str. 2011EL-2313]
 gb|EZF07584.1| copper-binding protein [Escherichia coli O157:H7 str. 2011EL-2290]
 gb|EZQ38525.1| copper-binding protein [Escherichia coli O157: str. 2010EL-2045]
 gb|EZQ54124.1| copper-binding protein [Escherichia coli O157: str. 2010EL-2044]
 gb|AIF92202.1| Cation efflux system protein CusF precursor [Escherichia coli 
O157:H7 str. SS17]
 gb|AIG66839.1| Cation efflux system protein CusF precursor [Escherichia coli 
O157:H7 str. EDL933]
 gb|AJA24554.1| Cation efflux system protein CusF precursor [Escherichia coli 
O157:H7 str. SS52]
 gb|KIY29519.1| copper-binding protein [Escherichia coli]
 gb|KIZ08266.1| copper-binding protein [Escherichia coli]
Length=110

 Score = 78.2 bits (191),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/40 (95%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKMS IKTGDKVAFNFVQQGNLSL QDIKVSQ
Sbjct  71   MRFTITPQTKMSGIKTGDKVAFNFVQQGNLSLLQDIKVSQ  110



>gb|EIP36888.1| cation efflux system protein CusF [Escherichia coli EC4013]
 gb|ERB83621.1| cation efflux system protein CusF [Escherichia coli 09BKT076207]
Length=102

 Score = 78.2 bits (191),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/40 (95%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKMS IKTGDKVAFNFVQQGNLSL QDIKVSQ
Sbjct  63   MRFTITPQTKMSGIKTGDKVAFNFVQQGNLSLLQDIKVSQ  102



>ref|WP_000709875.1| cation transporter [Escherichia coli]
 gb|EDV60438.1| cation efflux system protein CusF [Escherichia coli B7A]
 gb|EFK00010.1| cation efflux system protein CusF [Escherichia coli MS 182-1]
 gb|EFK72343.1| cation efflux system protein CusF [Escherichia coli MS 78-1]
 gb|EFO55592.1| cation efflux system protein CusF [Escherichia coli MS 145-7]
 gb|EGW92903.1| cation efflux system protein cusF [Escherichia coli 3030-1]
 gb|EHN82575.1| cation efflux system protein CusF [Escherichia coli H494]
 gb|EID66312.1| putative cation efflux system protein CusF [Escherichia coli 
W26]
 gb|ELD24415.1| cation efflux system protein CusF [Escherichia coli KTE210]
 gb|EMD12555.1| periplasmic copper-binding protein [Escherichia coli O08]
 gb|EMV26222.1| cation efflux system protein CusF [Escherichia coli BCE034_MS-14]
 gb|EMV48764.1| cation efflux system protein CusF [Escherichia coli 2872800]
 gb|EMV62730.1| cation efflux system protein CusF [Escherichia coli 2867750]
 gb|EMV78536.1| cation efflux system protein CusF [Escherichia coli 2866450]
 gb|EMV80316.1| cation efflux system protein CusF [Escherichia coli 2866750]
 gb|EMW07960.1| cation efflux system protein CusF [Escherichia coli 2853500]
 gb|EMW08156.1| cation efflux system protein CusF [Escherichia coli 2851500]
 gb|EMW11325.1| cation efflux system protein CusF [Escherichia coli 2850750]
 gb|EMW24062.1| cation efflux system protein CusF [Escherichia coli 2850400]
 gb|EMW28342.1| cation efflux system protein CusF [Escherichia coli 2848050]
 gb|EMW52562.1| cation efflux system protein CusF [Escherichia coli 2780750]
 gb|EMW64225.1| cation efflux system protein CusF [Escherichia coli 2756500]
 gb|EMX55153.1| cation efflux system protein CusF [Escherichia coli MP020980.2]
 gb|EMX56091.1| cation efflux system protein CusF [Escherichia coli Jurua 20/10]
 gb|EMX96243.1| cation efflux system protein CusF [Escherichia coli 2720900]
 gb|EMZ71846.1| cation efflux system protein CusF [Escherichia coli 2735000]
 gb|ENA69712.1| cation efflux system protein CusF [Escherichia coli 179550]
 gb|ENA71465.1| cation efflux system protein CusF [Escherichia coli 180200]
 gb|ENA99469.1| cation efflux system protein CusF [Escherichia coli 2864350]
 gb|END55913.1| cation efflux system protein CusF [Escherichia coli MP020980.1]
 gb|EQR04809.1| cation efflux system protein CusF [Escherichia coli HVH 115 (4-4465989)]
 gb|EQR09576.1| cation efflux system protein CusF [Escherichia coli HVH 115 (4-4465997)]
 gb|ESA63623.1| cation efflux system protein CusF [Escherichia coli 113303]
 gb|ESS95189.1| Cation efflux system protein CusF precursor [Escherichia coli 
CE516]
 gb|EST00333.1| Cation efflux system protein CusF precursor [Escherichia coli 
CE418]
 gb|EZG31211.1| copper-binding protein [Escherichia coli E1728]
 gb|EZJ24469.1| cation efflux system protein CusF [Escherichia coli 1-182-04_S4_C3]
 gb|EZJ46503.1| cation efflux system protein CusF [Escherichia coli 1-182-04_S4_C2]
 gb|EZJ63114.1| cation efflux system protein CusF [Escherichia coli 1-182-04_S4_C1]
 gb|KDF71024.1| cation efflux system protein CusF [Escherichia coli BIDMC 59]
 gb|KDG15450.1| cation efflux system protein CusF [Escherichia coli BIDMC 74]
 gb|KDG60058.1| cation efflux system protein CusF [Escherichia coli CHS 77]
 gb|KDV12636.1| copper-binding protein [Escherichia coli O78:H12 str. 00-3279]
 gb|KDV88440.1| cation efflux system protein CusF [Escherichia coli 2-052-05_S4_C2]
 gb|KDW19339.1| cation efflux system protein CusF [Escherichia coli 2-177-06_S3_C1]
 gb|KEP83749.1| copper-binding protein [Escherichia coli E1140]
 gb|AIF61599.1| cation efflux system protein CusF [Escherichia coli B7A]
 gb|KFV31928.1| copper-binding protein [Escherichia coli]
 gb|AIT33769.1| copper-binding protein [Escherichia coli FAP1]
 gb|KHI96469.1| copper-binding protein [Escherichia coli]
 gb|AIZ81605.1| copper-binding protein [Escherichia coli]
 gb|KIG29348.1| copper-binding protein [Escherichia coli]
 gb|KIG65087.1| copper-binding protein [Escherichia coli]
 gb|KIH07966.1| copper-binding protein [Escherichia coli]
 gb|KIH14242.1| copper-binding protein [Escherichia coli]
 gb|KIH25461.1| copper-binding protein [Escherichia coli]
 gb|KIZ75992.1| copper-binding protein [Escherichia coli]
Length=110

 Score = 78.2 bits (191),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/40 (95%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTIT QTKMSEIKTGDKVAFNFVQQGNLSL QDIKVSQ
Sbjct  71   MRFTITSQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ  110



>gb|EMV42379.1| cation efflux system protein CusF [Escherichia coli 2875000]
Length=102

 Score = 77.8 bits (190),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/40 (95%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTIT QTKMSEIKTGDKVAFNFVQQGNLSL QDIKVSQ
Sbjct  63   MRFTITSQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ  102



>ref|WP_001708729.1| cation efflux system protein CusF [Escherichia coli]
 gb|EMV78103.1| cation efflux system protein CusF [Escherichia coli 2866550]
Length=110

 Score = 77.8 bits (190),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/40 (95%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTIT QTKMSEIKTGDKVAFNFVQQGNLSL QDIKVSQ
Sbjct  71   MRFTITSQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ  110



>gb|ETJ27596.1| Cation efflux system protein CusF, partial [Escherichia coli 
DORA_A_5_14_21]
Length=100

 Score = 77.8 bits (190),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 37/40 (93%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKM EIKTGDKVAFNFVQQG+LSL QDIKVSQ
Sbjct  61   MRFTITPQTKMGEIKTGDKVAFNFVQQGSLSLLQDIKVSQ  100



>ref|WP_024216681.1| copper-binding protein [Escherichia coli]
Length=110

 Score = 77.8 bits (190),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/40 (93%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTITPQTKM EIKTGDKVAFNFVQQG+LSL QDIKVSQ
Sbjct  71   MRFTITPQTKMGEIKTGDKVAFNFVQQGSLSLLQDIKVSQ  110



>ref|WP_038355225.1| copper-binding protein [Escherichia sp. HT073016]
Length=110

 Score = 77.4 bits (189),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/40 (93%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            M FTITPQTKMSEIKTGDKVAFNFVQQGNLSL QDIK+SQ
Sbjct  71   MCFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKISQ  110



>gb|KHH47113.1| copper-binding protein [Escherichia coli]
Length=110

 Score = 77.4 bits (189),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 38/40 (95%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTIT QTKMSEIKTGDKVAFNFVQQGNLSL QDIKVSQ
Sbjct  71   MRFTITLQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ  110



>gb|AAW63704.1| unknown, partial [Citrobacter sp. MY-5]
Length=106

 Score = 74.3 bits (181),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 35/36 (97%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDI  136
            MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSL QDI
Sbjct  71   MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDI  106



>ref|WP_012133441.1| copper-binding protein [Citrobacter koseri]
 ref|YP_001454158.1| periplasmic copper-binding protein [Citrobacter koseri ATCC BAA-895]
 gb|ABV13722.1| hypothetical protein CKO_02613 [Citrobacter koseri ATCC BAA-895]
 emb|CDZ84299.1| periplasmic copper-binding protein [Citrobacter koseri]
Length=116

 Score = 64.7 bits (156),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFT+TP+T+  +IK GDKVAF FVQQGNLSL +DI+VSQ
Sbjct  77   MRFTLTPETRSGDIKPGDKVAFTFVQQGNLSLLRDIQVSQ  116



>gb|KGY20539.1| copper-binding protein [Citrobacter koseri]
Length=115

 Score = 64.7 bits (156),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFT+TP+T+  +IK GDKVAF FVQQGNLSL +DI+VSQ
Sbjct  76   MRFTLTPETRSGDIKPGDKVAFTFVQQGNLSLLRDIQVSQ  115



>ref|WP_041143858.1| copper-binding protein [Raoultella ornithinolytica]
 gb|AJF71489.1| copper-binding protein [Raoultella ornithinolytica]
Length=115

 Score = 64.3 bits (155),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVS  127
            MRFTITPQT++  +K GDKVAF F+QQGNLSL QDI V+
Sbjct  77   MRFTITPQTQLGAVKPGDKVAFTFIQQGNLSLLQDIHVN  115



>ref|WP_043001508.1| copper-binding protein [Citrobacter sp. MGH 55]
 gb|KDF04675.1| hypothetical protein AF41_04639 [Citrobacter sp. MGH 55]
Length=114

 Score = 63.5 bits (153),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIK  133
            MRFTITPQT++++IK GD VAF F+QQGNLSL QDIK
Sbjct  76   MRFTITPQTQLNDIKPGDNVAFTFIQQGNLSLLQDIK  112



>ref|WP_044256696.1| MULTISPECIES: copper-binding protein [Citrobacter]
 gb|KEY44822.1| copper-binding protein [Citrobacter amalonaticus]
Length=114

 Score = 63.5 bits (153),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIK  133
            MRFTITPQT++++IK GD VAF F+QQGNLSL QDIK
Sbjct  76   MRFTITPQTQLNDIKPGDNVAFTFIQQGNLSLLQDIK  112



>ref|WP_042320897.1| copper-binding protein [Citrobacter farmeri]
 dbj|GAL49531.1| cation efflux system protein CusF [Citrobacter farmeri GTC 1319]
Length=114

 Score = 62.8 bits (151),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIK  133
            MRFTITPQT+++ IK GD VAF F+QQGNLSL QDIK
Sbjct  76   MRFTITPQTQLNGIKAGDNVAFTFIQQGNLSLLQDIK  112



>ref|WP_032698007.1| copper-binding protein [Raoultella planticola]
 gb|KGZ19206.1| copper-binding protein [Klebsiella pneumoniae]
Length=115

 Score = 62.4 bits (150),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFT TPQT +++IK G KVAF F+QQGNLSL QDI ++Q
Sbjct  76   MRFTFTPQTPLNDIKAGSKVAFTFIQQGNLSLLQDIHLAQ  115



>gb|KFD13643.1| CusF family cation efflux system protein [Raoultella planticola 
ATCC 33531]
Length=116

 Score = 62.4 bits (150),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFT TPQT +++IK G KVAF F+QQGNLSL QDI ++Q
Sbjct  77   MRFTFTPQTPLNDIKAGSKVAFTFIQQGNLSLLQDIHLAQ  116



>ref|WP_044348423.1| copper-binding protein [Raoultella ornithinolytica]
 gb|KIZ44419.1| copper-binding protein [Raoultella ornithinolytica]
Length=115

 Score = 62.4 bits (150),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFT TPQT +++IK G KVAF F+QQGNLSL QDI ++Q
Sbjct  76   MRFTFTPQTPLNDIKAGSKVAFTFIQQGNLSLLQDIHLAQ  115



>ref|WP_015585239.1| MULTISPECIES: periplasmic copper-binding protein [Enterobacteriaceae]
 gb|AGJ87852.1| periplasmic copper-binding protein [Raoultella ornithinolytica 
B6]
 gb|KDV97091.1| cation efflux system protein CusF [Escherichia coli 2-156-04_S1_C1]
 gb|KDX08521.1| cation efflux system protein CusF [Escherichia coli 2-156-04_S1_C2]
Length=115

 Score = 62.0 bits (149),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFT TPQT +++IK G KVAF F+QQGNLSL QDI ++Q
Sbjct  76   MRFTFTPQTPLNDIKAGSKVAFTFIQQGNLSLLQDIHLAQ  115



>ref|WP_023565969.1| periplasmic copper-binding protein [Escherichia coli]
 gb|EST75864.1| periplasmic copper-binding protein [Escherichia coli ECA-727]
Length=30

 Score = 59.7 bits (143),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 29/30 (97%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -3

Query  213  MSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MSEIKTGDKVAFNFVQQGNLSL QDIKVSQ
Sbjct  1    MSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ  30



>ref|WP_032689703.1| copper-binding protein [Raoultella ornithinolytica]
 gb|KAJ94429.1| copper-binding protein [Raoultella ornithinolytica]
Length=115

 Score = 60.8 bits (146),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFT TPQT +++IK G KVAF F+QQGNLSL QDI + Q
Sbjct  76   MRFTFTPQTPLNDIKAGSKVAFTFIQQGNLSLLQDIHLVQ  115



>ref|WP_023296988.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae]
 gb|ESL92131.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae UCICRE 10]
 gb|KDL52974.1| hypothetical protein AD94_05043 [Klebsiella pneumoniae MGH 68]
Length=114

 Score = 60.1 bits (144),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVS  127
            MRFTITPQT+++ +K GD V F FVQQGNLSL QDI+ +
Sbjct  76   MRFTITPQTQLNNVKNGDSVDFTFVQQGNLSLLQDIRAN  114



>ref|WP_025714123.1| copper-binding protein [Klebsiella sp. 10982]
Length=114

 Score = 60.1 bits (144),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVS  127
            MRFTITPQT+++ +K GD V F FVQQGNLSL QDI+ +
Sbjct  76   MRFTITPQTQLNNVKNGDSVDFTFVQQGNLSLLQDIRAN  114



>ref|WP_012543002.1| copper-binding protein [Klebsiella pneumoniae]
 gb|ACI11427.1| cation efflux system protein CusF [Klebsiella pneumoniae 342]
Length=114

 Score = 60.1 bits (144),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVS  127
            MRFTITPQT+++ +K GD V F FVQQGNLSL QDI+ +
Sbjct  76   MRFTITPQTQLNNVKNGDSVDFTFVQQGNLSLLQDIRAN  114



>gb|AIE01540.1| copper-binding protein [Klebsiella pneumoniae subsp. pneumoniae 
KP5-1]
Length=114

 Score = 59.7 bits (143),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKV  130
            MRFTITPQT+++ +K GD V F FVQQGNLSL QDI+ 
Sbjct  76   MRFTITPQTQLNNVKNGDSVDFTFVQQGNLSLLQDIRA  113



>ref|WP_008807070.1| copper-binding protein [Klebsiella sp. 1_1_55]
 gb|EFD83111.1| cation efflux system protein CusF [Klebsiella sp. 1_1_55]
Length=114

 Score = 59.7 bits (143),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKV  130
            MRFTITPQT+++ +K GD V F FVQQGNLSL QDI+ 
Sbjct  76   MRFTITPQTQLNNVKNGDSVDFTFVQQGNLSLLQDIRA  113



>ref|WP_023323569.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae]
 gb|ESM66441.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae MGH 40]
 gb|KDH20728.1| hypothetical protein AE36_05028 [Klebsiella pneumoniae BIDMC 
61]
Length=114

 Score = 59.7 bits (143),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVS  127
            MRFTITPQT+++ +K GD V F FVQQGNLSL QDI+ +
Sbjct  76   MRFTITPQTQLNNVKDGDSVDFTFVQQGNLSLLQDIRAN  114



>ref|WP_004206718.1| periplasmic copper-binding protein [Klebsiella pneumoniae]
 gb|EMR15681.1| periplasmic copper-binding protein [Klebsiella pneumoniae 700603]
Length=114

 Score = 59.7 bits (143),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKV  130
            MRFTITPQT+++ +K GD V F FVQQGNLSL QDI+ 
Sbjct  76   MRFTITPQTQLNNVKNGDSVDFTFVQQGNLSLLQDIRA  113



>ref|WP_032418103.1| copper-binding protein [Klebsiella pneumoniae]
 gb|EWD04472.1| periplasmic copper-binding protein [Klebsiella pneumoniae NB60]
 gb|EWF49409.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae BWH 2]
Length=114

 Score = 59.7 bits (143),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVS  127
            MRFTITPQT+++ +K GD V F FVQQGNLSL QDI+ +
Sbjct  76   MRFTITPQTQLNNVKDGDSVDFTFVQQGNLSLLQDIRAN  114



>ref|WP_022064527.1| cation efflux system protein CusF [Klebsiella variicola CAG:634]
 emb|CDA03989.1| cation efflux system protein CusF [Klebsiella variicola CAG:634]
Length=115

 Score = 59.7 bits (143),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVS  127
            MRFTITPQT+++ +K GD V F FVQQGNLSL QDI+ +
Sbjct  77   MRFTITPQTQLNNVKDGDSVDFTFVQQGNLSLLQDIRAN  115



>ref|WP_032731860.1| MULTISPECIES: copper-binding protein [Klebsiella]
 gb|EWD74907.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae UCI 18]
 gb|KFJ96975.1| copper-binding protein [Klebsiella variicola]
Length=114

 Score = 59.7 bits (143),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVS  127
            MRFTITPQT+++ +K GD V F FVQQGNLSL QDI+ +
Sbjct  76   MRFTITPQTQLNNVKDGDSVDFTFVQQGNLSLLQDIRAN  114



>emb|CDL61891.1| Cation efflux system protein CusF precursor [Klebsiella pneumoniae 
IS39]
Length=61

 Score = 58.5 bits (140),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKV  130
            MRFTITPQT+++ +K GD V F FVQQGNLSL QDI+ 
Sbjct  23   MRFTITPQTQLNNVKDGDSVDFTFVQQGNLSLLQDIRA  60



>ref|WP_040245722.1| copper-binding protein [Klebsiella pneumoniae]
Length=114

 Score = 59.3 bits (142),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVS  127
            MRFTITPQT+++ +K GD V F FVQQGNLSL QDI+ +
Sbjct  76   MRFTITPQTQLNNVKDGDSVDFTFVQQGNLSLLQDIRAN  114



>ref|WP_012969046.1| copper-binding protein [Klebsiella variicola]
 gb|ADC60412.1| periplasmic copper-binding protein [Klebsiella variicola At-22]
Length=114

 Score = 59.3 bits (142),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKV  130
            MRFTITPQT+++ +K GD V F FVQQGNLSL QDI+ 
Sbjct  76   MRFTITPQTQLNNVKDGDSVDFTFVQQGNLSLLQDIRA  113



>ref|WP_016160208.1| hypothetical protein [Klebsiella sp. KTE92]
 gb|EOQ56400.1| hypothetical protein A1WC_00452 [Klebsiella sp. KTE92]
 gb|KHE28095.1| copper-binding protein [Klebsiella pneumoniae]
 emb|CEP32410.1| periplasmic copper-binding protein [Klebsiella variicola]
Length=114

 Score = 59.3 bits (142),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIK  133
            MRFTITPQT+++ +K GD V F FVQQGNLSL QDI+
Sbjct  76   MRFTITPQTQLNNVKNGDSVDFTFVQQGNLSLLQDIR  112



>ref|WP_032736753.1| MULTISPECIES: copper-binding protein [Klebsiella]
 gb|KDM00600.1| hypothetical protein AE06_04990 [Klebsiella pneumoniae MGH 80]
 emb|CEL87346.1| periplasmic copper-binding protein [Klebsiella variicola]
 gb|AJE91009.1| copper-binding protein [Klebsiella variicola]
Length=114

 Score = 59.3 bits (142),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVS  127
            MRFTITPQT+++ +K GD V F FVQQGNLSL QDI+ +
Sbjct  76   MRFTITPQTQLNNVKDGDSVDFTFVQQGNLSLLQDIRAN  114



>ref|WP_042894147.1| copper-binding protein [Enterobacter aerogenes]
 gb|KHM32849.1| copper-binding protein [Enterobacter aerogenes]
Length=114

 Score = 59.3 bits (142),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKV  130
            MRFTITPQT+++ +K GD V F FVQQGNLSL QDI+ 
Sbjct  76   MRFTITPQTQLNNVKNGDSVDFTFVQQGNLSLLQDIRA  113



>ref|WP_023342515.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae]
 gb|ESN32036.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae MGH 19]
Length=114

 Score = 59.3 bits (142),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKV  130
            MRFTITPQT+++ +K GD V F FVQQGNLSL QDI+ 
Sbjct  76   MRFTITPQTQLNNVKNGDSVDFTFVQQGNLSLLQDIRA  113



>emb|CDL50139.1| Cation efflux system protein CusF precursor [Klebsiella pneumoniae 
ISC21]
Length=86

 Score = 58.9 bits (141),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKV  130
            MRFTITPQT+++ +K GD V F FVQQGNLSL QDI+ 
Sbjct  48   MRFTITPQTQLNNVKDGDSVDFTFVQQGNLSLLQDIRA  85



>ref|WP_032740383.1| MULTISPECIES: copper-binding protein [Klebsiella]
 gb|AJA95380.1| copper-binding protein [Klebsiella variicola]
Length=114

 Score = 59.3 bits (142),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKV  130
            MRFTITPQT+++ +K GD V F FVQQGNLSL QDI+ 
Sbjct  76   MRFTITPQTQLNNVKDGDSVDFTFVQQGNLSLLQDIRA  113



>gb|EJK92704.1| periplasmic copper-binding protein [Klebsiella pneumoniae subsp. 
pneumoniae DSM 30104]
Length=84

 Score = 58.9 bits (141),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKV  130
            MRFTITPQT+++ +K GD V F FVQQGNLSL QDI+ 
Sbjct  46   MRFTITPQTQLNNVKDGDSVDFTFVQQGNLSLLQDIRA  83



>ref|WP_023291814.1| MULTISPECIES: Cu(I)/Ag(I) efflux system periplasmic protein CusF 
[Klebsiella]
 gb|ESL72485.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae UCICRE 14]
 emb|CDN03613.1| periplasmic copper-binding protein [Klebsiella sp. 18A069]
 emb|CDQ17608.1| periplasmic copper-binding protein [Klebsiella sp.]
Length=114

 Score = 59.3 bits (142),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKV  130
            MRFTITPQT+++ +K GD V F FVQQGNLSL QDI+ 
Sbjct  76   MRFTITPQTQLNNVKDGDSVDFTFVQQGNLSLLQDIRA  113



>emb|CDL09419.1| Cation efflux system protein CusF precursor [Klebsiella pneumoniae 
IS43]
Length=86

 Score = 58.9 bits (141),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIK  133
            MRFTITPQT+++ +K GD V F FVQQGNLSL QDI+
Sbjct  48   MRFTITPQTQLNNVKDGDSVDFTFVQQGNLSLLQDIR  84



>gb|ESN46144.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae MGH 20]
 gb|KDM28269.1| hypothetical protein AE02_02628 [Klebsiella pneumoniae MGH 76]
Length=115

 Score = 59.3 bits (142),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKV  130
            MRFTITPQT+++ +K GD V F FVQQGNLSL QDI+ 
Sbjct  77   MRFTITPQTQLNNVKDGDSVDFTFVQQGNLSLLQDIRA  114



>ref|WP_021441118.1| cation efflux system protein CusF precursor [Klebsiella pneumoniae]
 gb|ERI56223.1| cation efflux system protein CusF precursor [Klebsiella pneumoniae 
KP-1]
 gb|ESL18135.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae BIDMC 40]
 gb|ESL45419.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae BIDMC 25]
 gb|EWD36846.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae UCI 34]
 gb|KDH37921.1| hypothetical protein AE09_04483 [Klebsiella pneumoniae BWH 46]
 gb|KDM24280.1| hypothetical protein AE21_04742 [Klebsiella pneumoniae UCI 62]
 gb|AIA40302.1| copper-binding protein [Klebsiella pneumoniae subsp. pneumoniae 
KPNIH27]
 gb|AIX67614.1| copper-binding protein [Klebsiella pneumoniae subsp. pneumoniae]
Length=114

 Score = 59.3 bits (142),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKV  130
            MRFTITPQT+++ +K GD V F FVQQGNLSL QDI+ 
Sbjct  76   MRFTITPQTQLNNVKDGDSVDFTFVQQGNLSLLQDIRA  113



>ref|WP_004894569.1| periplasmic copper-binding protein [Klebsiella pneumoniae]
 gb|EMH99718.1| periplasmic copper-binding protein [Klebsiella pneumoniae RYC492]
 gb|ESM82956.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae MGH 36]
 emb|CDK76227.1| Cation efflux system protein CusF precursor [Klebsiella pneumoniae 
IS22]
 gb|EWD41995.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae UCI 26]
 gb|EWD87672.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae BIDMC 52]
 gb|EWF38289.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae BWH 15]
 gb|EWF61252.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae MGH 43]
 gb|KDL30275.1| hypothetical protein AF50_04687 [Klebsiella pneumoniae MGH 64]
 gb|KDL89337.1| hypothetical protein AE00_04360 [Klebsiella pneumoniae MGH 74]
Length=114

 Score = 59.3 bits (142),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKV  130
            MRFTITPQT+++ +K GD V F FVQQGNLSL QDI+ 
Sbjct  76   MRFTITPQTQLNNVKDGDSVDFTFVQQGNLSLLQDIRA  113



>ref|WP_044245279.1| copper-binding protein [Klebsiella pneumoniae]
 emb|CDQ54859.1| cusF [Klebsiella pneumoniae]
Length=114

 Score = 59.3 bits (142),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKV  130
            MRFTITPQT+++ +K GD V F FVQQGNLSL QDI+ 
Sbjct  76   MRFTITPQTQLNNVKDGDSVDFTFVQQGNLSLLQDIRA  113



>ref|WP_032433444.1| copper-binding protein [Klebsiella pneumoniae]
 gb|EWD53453.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae UCI 25]
Length=114

 Score = 59.3 bits (142),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKV  130
            MRFTITPQT+++ +K GD V F FVQQGNLSL QDI+ 
Sbjct  76   MRFTITPQTQLNNVKDGDSVDFTFVQQGNLSLLQDIRA  113



>ref|WP_017900885.1| copper-binding protein [Klebsiella pneumoniae]
 gb|ESM60183.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae MGH 44]
 gb|KII55355.1| copper-binding protein [Klebsiella pneumoniae]
Length=114

 Score = 59.3 bits (142),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKV  130
            MRFTITPQT+++ +K GD V F FVQQGNLSL QDI+ 
Sbjct  76   MRFTITPQTQLNNVKDGDSVDFTFVQQGNLSLLQDIRA  113



>ref|WP_004186842.1| copper-binding protein [Klebsiella pneumoniae]
 gb|EKB82667.1| hypothetical protein HMPREF1308_04814 [Klebsiella pneumoniae 
subsp. pneumoniae WGLW5]
 gb|ESN49537.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae MGH 17]
Length=114

 Score = 59.3 bits (142),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKV  130
            MRFTITPQT+++ +K GD V F FVQQGNLSL QDI+ 
Sbjct  76   MRFTITPQTQLNNVKDGDSVDFTFVQQGNLSLLQDIRA  113



>ref|WP_016529489.1| periplasmic copper-binding protein, partial [Klebsiella pneumoniae]
 gb|EPF44402.1| periplasmic copper-binding protein, partial [Klebsiella pneumoniae 
subsp. pneumoniae B5055]
Length=104

 Score = 58.9 bits (141),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKV  130
            MRFTITPQT+++ +K GD V F FVQQGNLSL QDI+ 
Sbjct  66   MRFTITPQTQLNNVKDGDSVDFTFVQQGNLSLLQDIRA  103



>ref|WP_040148409.1| copper-binding protein [Klebsiella pneumoniae]
 emb|CDL21849.1| Cation efflux system protein CusF precursor [Klebsiella pneumoniae 
IS53]
Length=114

 Score = 59.3 bits (142),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKV  130
            MRFTITPQT+++ +K GD V F FVQQGNLSL QDI+ 
Sbjct  76   MRFTITPQTQLNNVKDGDSVDFTFVQQGNLSLLQDIRA  113



>ref|WP_021462623.1| copper-binding protein [Klebsiella pneumoniae]
 gb|ERE64737.1| copper-binding protein [Enterococcus gallinarum EGD-AAK12]
 gb|ESL33212.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae BIDMC 36]
 gb|KDH07105.1| hypothetical protein AE29_04566 [Klebsiella pneumoniae BIDMC 
55]
 gb|KEG33179.1| copper-binding protein [Klebsiella pneumoniae]
 gb|KFC45103.1| copper-binding protein [Klebsiella pneumoniae]
 emb|CEN64972.1| cation efflux system protein CusF [Klebsiella pneumoniae]
Length=114

 Score = 59.3 bits (142),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKV  130
            MRFTITPQT+++ +K GD V F FVQQGNLSL QDI+ 
Sbjct  76   MRFTITPQTQLNNVKDGDSVDFTFVQQGNLSLLQDIRA  113



>ref|WP_032105401.1| copper-binding protein [Klebsiella pneumoniae]
Length=114

 Score = 59.3 bits (142),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKV  130
            MRFTITPQT+++ +K GD V F FVQQGNLSL QDI+ 
Sbjct  76   MRFTITPQTQLNNVKDGDSVDFTFVQQGNLSLLQDIRA  113



>ref|WP_015368490.1| Cation efflux system protein CusF precursor [Enterobacter aerogenes]
 emb|CCG31996.1| Cation efflux system protein CusF precursor [Enterobacter aerogenes 
EA1509E]
 gb|EUL43470.1| hypothetical protein P851_00333 [Enterobacter aerogenes UCI 48]
 gb|EUL46351.1| hypothetical protein P849_04783 [Enterobacter aerogenes UCI 46]
 gb|EUL53127.1| hypothetical protein P850_00335 [Enterobacter aerogenes UCI 47]
 gb|EUL95082.1| hypothetical protein P817_04599 [Enterobacter aerogenes UCI 15]
 gb|EUL95438.1| hypothetical protein P819_03621 [Enterobacter aerogenes UCI 16]
 gb|KDF25050.1| hypothetical protein AE03_04764 [Enterobacter aerogenes MGH 77]
 gb|KDF28749.1| hypothetical protein AE04_04627 [Enterobacter aerogenes MGH 78]
Length=114

 Score = 59.3 bits (142),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKV  130
            MRFTITPQT+++ +K GD V F FVQQGNLSL QDI+ 
Sbjct  76   MRFTITPQTQLNNVKDGDSVDFTFVQQGNLSLLQDIRA  113



>ref|WP_040175037.1| copper-binding protein [Klebsiella pneumoniae]
Length=114

 Score = 59.3 bits (142),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKV  130
            MRFTITPQT+++ +K GD V F FVQQGNLSL QDI+ 
Sbjct  76   MRFTITPQTQLNNVKDGDSVDFTFVQQGNLSLLQDIRA  113



>ref|WP_023313901.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae]
 gb|ESM33344.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae BWH 30]
Length=114

 Score = 59.3 bits (142),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKV  130
            MRFTITPQT+++ +K GD V F FVQQGNLSL QDI+ 
Sbjct  76   MRFTITPQTQLNNVKDGDSVDFTFVQQGNLSLLQDIRA  113



>gb|EKB81124.1| hypothetical protein HMPREF1306_00373 [Klebsiella pneumoniae 
subsp. pneumoniae WGLW2]
 gb|EPA92466.1| cation efflux system protein CusF [Klebsiella pneumoniae UHKPC57]
 gb|EPO91756.1| cation efflux system protein CusF [Klebsiella pneumoniae UHKPC179]
 gb|ERN59173.1| copper-binding protein [Klebsiella pneumoniae 303K]
 gb|ESM10138.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae UCICRE 4]
 gb|ESM58126.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae MGH 46]
 gb|EWE85157.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae BIDMC 11]
 gb|EZQ75399.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae MGH 63]
 gb|EZR20557.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae MGH 75]
 gb|KDK59922.1| hypothetical protein AF22_04340 [Klebsiella pneumoniae CHS 66]
 gb|KDL42700.1| hypothetical protein AF51_04860 [Klebsiella pneumoniae MGH 65]
 gb|KEF23035.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae BIDMC 33B]
 gb|AIG83820.1| copper-binding protein [Klebsiella pneumoniae subsp. pneumoniae 
PittNDM01]
 gb|AIT01662.1| Cation efflux system protein CusF precursor [Klebsiella pneumoniae]
 gb|KGY61682.1| copper-binding protein [Escherichia coli]
 gb|KHF54638.1| copper-binding protein [Klebsiella pneumoniae]
 emb|CEO85363.1| cation efflux system protein CusF [Klebsiella pneumoniae]
Length=115

 Score = 59.3 bits (142),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKV  130
            MRFTITPQT+++ +K GD V F FVQQGNLSL QDI+ 
Sbjct  77   MRFTITPQTQLNNVKDGDSVDFTFVQQGNLSLLQDIRA  114



>ref|WP_032420886.1| copper-binding protein [Klebsiella pneumoniae]
 gb|AIK81296.1| periplasmic copper/silver-binding protein [Klebsiella pneumoniae 
subsp. pneumoniae]
 gb|KGB19970.1| copper-binding protein [Klebsiella pneumoniae]
Length=114

 Score = 59.3 bits (142),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKV  130
            MRFTITPQT+++ +K GD V F FVQQGNLSL QDI+ 
Sbjct  76   MRFTITPQTQLNNVKDGDSVDFTFVQQGNLSLLQDIRA  113



>ref|WP_025983237.1| copper-binding protein [Klebsiella pneumoniae]
Length=114

 Score = 59.3 bits (142),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKV  130
            MRFTITPQT+++ +K GD V F FVQQGNLSL QDI+ 
Sbjct  76   MRFTITPQTQLNNVKDGDSVDFTFVQQGNLSLLQDIRA  113



>ref|WP_023287080.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae]
 gb|ESL51068.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae BIDMC 23]
 gb|ESM90956.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae MGH 32]
 gb|ESN31425.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae MGH 21]
 gb|EZR03373.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae UCI 60]
 gb|KDM12267.1| hypothetical protein AE15_04796 [Klebsiella pneumoniae UCI 56]
 emb|CED78059.1| periplasmic copper-binding protein [Klebsiella pneumoniae]
Length=114

 Score = 59.3 bits (142),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKV  130
            MRFTITPQT+++ +K GD V F FVQQGNLSL QDI+ 
Sbjct  76   MRFTITPQTQLNNVKDGDSVDFTFVQQGNLSLLQDIRA  113



>ref|WP_004197273.1| cation efflux system protein CusF [Klebsiella pneumoniae]
 gb|EMH90831.1| cation efflux system protein CusF [Klebsiella pneumoniae JHCK1]
 gb|KGK50972.1| copper-binding protein [Klebsiella pneumoniae]
Length=114

 Score = 59.3 bits (142),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKV  130
            MRFTITPQT+++ +K GD V F FVQQGNLSL QDI+ 
Sbjct  76   MRFTITPQTQLNNVKDGDSVDFTFVQQGNLSLLQDIRA  113



>ref|WP_015959364.1| copper-binding protein [Klebsiella pneumoniae]
 gb|ABR80088.1| putative periplasmic copper-binding protein [Klebsiella pneumoniae 
subsp. pneumoniae MGH 78578]
 gb|KDM45922.1| hypothetical protein AE27_04443 [Klebsiella pneumoniae UCI 68]
Length=114

 Score = 59.3 bits (142),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKV  130
            MRFTITPQT+++ +K GD V F FVQQGNLSL QDI+ 
Sbjct  76   MRFTITPQTQLNNVKDGDSVDFTFVQQGNLSLLQDIRA  113



>ref|WP_025368487.1| copper-binding protein [Klebsiella pneumoniae]
 gb|AHE46554.1| Cation efflux system protein cusF [Klebsiella pneumoniae subsp. 
pneumoniae Kp13]
 gb|ETX35867.1| hypothetical protein L467_04828 [Klebsiella pneumoniae BIDMC 
31]
Length=110

 Score = 58.9 bits (141),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKV  130
            MRFTITPQT+++ +K GD V F FVQQGNLSL QDI+ 
Sbjct  72   MRFTITPQTQLNNVKDGDSVDFTFVQQGNLSLLQDIRA  109



>ref|WP_025862174.1| copper-binding protein [Klebsiella pneumoniae]
 gb|KFJ73618.1| cation efflux system protein CusF [Klebsiella pneumoniae]
Length=114

 Score = 58.9 bits (141),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKV  130
            MRFTITPQT+++ +K GD V F FVQQGNLSL QDI+ 
Sbjct  76   MRFTITPQTQLNNVKDGDSVDFTFVQQGNLSLLQDIRA  113



>gb|EKB63352.1| hypothetical protein HMPREF1305_04523 [Klebsiella pneumoniae 
subsp. pneumoniae WGLW1]
 gb|EKB72832.1| hypothetical protein HMPREF1307_04694 [Klebsiella pneumoniae 
subsp. pneumoniae WGLW3]
Length=115

 Score = 59.3 bits (142),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKV  130
            MRFTITPQT+++ +K GD V F FVQQGNLSL QDI+ 
Sbjct  77   MRFTITPQTQLNNVKDGDSVDFTFVQQGNLSLLQDIRA  114



>gb|KDL12233.1| hypothetical protein AF38_05168 [Klebsiella pneumoniae MGH 52]
Length=115

 Score = 58.9 bits (141),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKV  130
            MRFTITPQT+++ +K GD V F FVQQGNLSL QDI+ 
Sbjct  77   MRFTITPQTQLNNVKDGDSVDFTFVQQGNLSLLQDIRA  114



>ref|WP_015704246.1| copper-binding protein [Enterobacter aerogenes]
 ref|YP_004592191.1| copper-binding protein [Enterobacter aerogenes KCTC 2190]
 gb|AEG96912.1| periplasmic copper-binding protein [Enterobacter aerogenes KCTC 
2190]
Length=114

 Score = 58.9 bits (141),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKV  130
            MRFTITPQT+++ +K GD V F FVQQGNLSL QDI+ 
Sbjct  76   MRFTITPQTQLNNVKDGDSVDFTFVQQGNLSLLQDIRA  113



>ref|WP_038808522.1| copper-binding protein [Klebsiella pneumoniae]
Length=110

 Score = 58.9 bits (141),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKV  130
            MRFTITPQT+++ +K GD V F FVQQGNLSL QDI+ 
Sbjct  72   MRFTITPQTQLNNVKDGDSVDFTFVQQGNLSLLQDIRA  109



>gb|EWE05867.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae BIDMC 47]
Length=115

 Score = 58.9 bits (141),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKV  130
            MRFTITPQT+++ +K GD V F FVQQGNLSL QDI+ 
Sbjct  77   MRFTITPQTQLNNVKDGDSVDFTFVQQGNLSLLQDIRA  114



>ref|WP_044650381.1| copper-binding protein [Klebsiella variicola]
Length=114

 Score = 58.9 bits (141),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIK  133
            MRFTITPQT+++ +K GD V F FVQQGNLSL QDI+
Sbjct  76   MRFTITPQTQLNNVKDGDSVDFTFVQQGNLSLLQDIR  112



>ref|WP_004192220.1| MULTISPECIES: copper-binding protein [Klebsiella]
 gb|EHL86675.1| hypothetical protein HMPREF1024_04962 [Klebsiella sp. 4_1_44FAA]
 gb|EKF80722.1| Periplasmic copper-binding protein [Klebsiella pneumoniae subsp. 
pneumoniae KpQ3]
 gb|EOY81572.1| cation efflux system protein CusF [Klebsiella pneumoniae UHKPC81]
 gb|ESL17507.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae BIDMC 41]
 gb|ESL61659.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae BIDMC 21]
 gb|ESL91514.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae UCICRE 8]
 gb|ESM24303.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae UCICRE 2]
 gb|ESM45650.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae BWH 28]
 gb|ESM93291.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae MGH 30]
 gb|ESN46799.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae MGH 18]
 gb|EWD90854.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae BIDMC 53]
 gb|EWE02851.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae BIDMC 48]
 gb|EWE20425.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae BIDMC 46a]
 gb|EWE53360.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae BIDMC 18D]
 gb|EWF47975.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae MGH 47]
 emb|CDO16434.1| cusF [Klebsiella pneumoniae]
 gb|KDH24933.1| hypothetical protein AE44_04815 [Klebsiella pneumoniae BIDMC 
69]
 gb|KDH49567.1| hypothetical protein AE56_04459 [Klebsiella pneumoniae BWH 48]
 gb|KDL31288.1| hypothetical protein AF46_04487 [Klebsiella pneumoniae MGH 60]
 gb|KDL65484.1| hypothetical protein AD96_04513 [Klebsiella pneumoniae MGH 70]
 gb|KDL80282.1| hypothetical protein AD98_04618 [Klebsiella pneumoniae MGH 72]
Length=114

 Score = 58.9 bits (141),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKV  130
            MRFTITPQT+++ +K GD V F FVQQGNLSL QDI+ 
Sbjct  76   MRFTITPQTQLNNVKDGDSVDFTFVQQGNLSLLQDIRA  113



>gb|KHF68784.1| copper-binding protein [Klebsiella pneumoniae]
Length=115

 Score = 58.9 bits (141),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKV  130
            MRFTITPQT+++ +K GD V F FVQQGNLSL QDI+ 
Sbjct  77   MRFTITPQTQLNNVKDGDSVDFTFVQQGNLSLLQDIRA  114



>gb|EGF63421.1| cation efflux system protein CusF [Klebsiella sp. MS 92-3]
 gb|EPO20634.1| cation efflux system protein CusF [Klebsiella pneumoniae DMC0799]
 gb|AGX40621.1| copper-binding protein [Klebsiella pneumoniae CG43]
 gb|ESL58424.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae BIDMC 22]
 gb|ESL95889.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae UCICRE 7]
 gb|ESL97597.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae UCICRE 6]
 emb|CDI25669.1| periplasmic copper-binding protein [Klebsiella pneumoniae subsp. 
pneumoniae SA1]
 gb|EWD06230.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae UCI 42]
 gb|EWE35916.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae BIDMC 35]
 gb|EZQ91058.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae CHS 21]
 gb|EZR09843.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae UCI 64]
 gb|AJB34369.1| Cation efflux system protein CusF precursor [Klebsiella pneumoniae 
HK787]
Length=115

 Score = 58.9 bits (141),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKV  130
            MRFTITPQT+++ +K GD V F FVQQGNLSL QDI+ 
Sbjct  77   MRFTITPQTQLNNVKDGDSVDFTFVQQGNLSLLQDIRA  114



>ref|WP_004214146.1| MULTISPECIES: periplasmic copper-binding protein [Klebsiella]
 gb|EMB08913.1| periplasmic copper-binding protein [Klebsiella pneumoniae hvKP1]
 gb|AIX01584.1| copper-binding protein [Klebsiella pneumoniae]
 gb|KII01112.1| copper-binding protein [Klebsiella pneumoniae]
Length=114

 Score = 58.9 bits (141),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKV  130
            MRFTITPQT+++ +K GD V F FVQQGNLSL QDI+ 
Sbjct  76   MRFTITPQTQLNNVKDGDSVDFTFVQQGNLSLLQDIRA  113



>ref|WP_023317482.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae]
 gb|ESM47576.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae MGH 48]
Length=114

 Score = 58.9 bits (141),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKV  130
            MRFTITPQT+++ +K GD V F FVQQGNLSL QDI+ 
Sbjct  76   MRFTITPQTQLNNVKDGDSVDFTFVQQGNLSLLQDIRA  113



>ref|WP_020079739.1| copper-binding protein [Enterobacter aerogenes]
 gb|KGB01873.1| cation efflux system protein CusF [Enterobacter aerogenes]
Length=114

 Score = 58.9 bits (141),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKV  130
            MRFTITPQT+++ +K GD V F FVQQGNLSL QDI+ 
Sbjct  76   MRFTITPQTQLNNVKDGDSVDFTFVQQGNLSLLQDIRA  113



>ref|WP_004222368.1| copper-binding protein [Klebsiella pneumoniae]
 gb|AEJ96288.1| periplasmic copper-binding protein [Klebsiella pneumoniae KCTC 
2242]
 emb|CCN27858.1| cation efflux system protein CusF [Klebsiella pneumoniae subsp. 
pneumoniae Ecl8]
 gb|ESA99106.1| cation efflux system protein CusF [Klebsiella pneumoniae 909957]
 emb|CDI15044.1| periplasmic copper-binding protein [Klebsiella pneumoniae subsp. 
pneumoniae T69]
 gb|KDJ46966.1| hypothetical protein AE99_04517 [Klebsiella pneumoniae CHS 43]
 gb|KDJ64585.1| hypothetical protein AF04_04912 [Klebsiella pneumoniae CHS 48]
 gb|KGY32362.1| copper-binding protein [Klebsiella pneumoniae]
 gb|AJC06495.1| Cation efflux system protein CusF precursor [Klebsiella pneumoniae 
subsp. pneumoniae 1158]
Length=114

 Score = 58.9 bits (141),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKV  130
            MRFTITPQT+++ +K GD V F FVQQGNLSL QDI+ 
Sbjct  76   MRFTITPQTQLNNVKDGDSVDFTFVQQGNLSLLQDIRA  113



>ref|WP_032715529.1| copper-binding protein [Enterobacter aerogenes]
 gb|KDF16731.1| hypothetical protein AF48_03830 [Enterobacter aerogenes MGH 62]
Length=114

 Score = 58.9 bits (141),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKV  130
            MRFTITPQT+++ +K GD V F FVQQGNLSL QDI+ 
Sbjct  76   MRFTITPQTQLNNVKDGDSVDFTFVQQGNLSLLQDIRA  113



>gb|KHF54506.1| copper-binding protein [Klebsiella pneumoniae]
Length=115

 Score = 58.9 bits (141),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKV  130
            MRFTITPQT+++ +K GD V F FVQQGNLSL QDI+ 
Sbjct  77   MRFTITPQTQLNNVKDGDSVDFTFVQQGNLSLLQDIRA  114



>gb|KGT63428.1| cation efflux system protein CusF [Klebsiella pneumoniae MRSN 
1319]
Length=114

 Score = 58.9 bits (141),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKV  130
            MRFTITPQT+++ +K GD V F FVQQGNLSL QDI+ 
Sbjct  76   MRFTITPQTQLNNVKDGDSVDFTFVQQGNLSLLQDIRA  113



>ref|WP_025987660.1| copper-binding protein [Klebsiella pneumoniae]
 emb|CDI26193.1| periplasmic copper-binding protein [Klebsiella pneumoniae subsp. 
pneumoniae BJ1-GA]
 gb|AIJ42950.1| copper-binding protein [Klebsiella pneumoniae]
Length=114

 Score = 58.9 bits (141),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKV  130
            MRFTITPQT+++ +K GD V F FVQQGNLSL QDI+ 
Sbjct  76   MRFTITPQTQLNNVKDGDSVDFTFVQQGNLSLLQDIRA  113



>ref|WP_021314307.1| copper-binding protein [Klebsiella pneumoniae]
 gb|EXF42246.1| copper-binding protein [Klebsiella pneumoniae EGD-HP19-C]
Length=114

 Score = 58.9 bits (141),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKV  130
            MRFTITPQT+++ +K GD V F FVQQGNLSL QDI+ 
Sbjct  76   MRFTITPQTQLNNVKDGDSVDFTFVQQGNLSLLQDIRA  113



>ref|WP_002887266.1| copper-binding protein [Klebsiella pneumoniae]
 ref|YP_005224883.1| copper-binding protein [Klebsiella pneumoniae subsp. pneumoniae 
HS11286]
 gb|AEW59281.1| periplasmic copper-binding protein [Klebsiella pneumoniae subsp. 
pneumoniae HS11286]
 gb|EJJ34327.1| periplasmic copper-binding protein [Klebsiella pneumoniae subsp. 
pneumoniae KPNIH4]
 gb|EJJ34751.1| periplasmic copper-binding protein [Klebsiella pneumoniae subsp. 
pneumoniae KPNIH2]
 gb|EJJ49764.1| periplasmic copper-binding protein [Klebsiella pneumoniae subsp. 
pneumoniae KPNIH5]
 gb|EJJ51014.1| periplasmic copper-binding protein [Klebsiella pneumoniae subsp. 
pneumoniae KPNIH6]
 gb|EJJ53132.1| periplasmic copper-binding protein [Klebsiella pneumoniae subsp. 
pneumoniae KPNIH7]
 gb|EJJ66536.1| periplasmic copper-binding protein [Klebsiella pneumoniae subsp. 
pneumoniae KPNIH9]
 gb|EJJ67944.1| periplasmic copper-binding protein [Klebsiella pneumoniae subsp. 
pneumoniae KPNIH8]
 gb|EJJ83143.1| periplasmic copper-binding protein [Klebsiella pneumoniae subsp. 
pneumoniae KPNIH11]
 gb|EJJ84695.1| periplasmic copper-binding protein [Klebsiella pneumoniae subsp. 
pneumoniae KPNIH12]
 gb|EJJ91364.1| periplasmic copper-binding protein [Klebsiella pneumoniae subsp. 
pneumoniae KPNIH14]
 gb|EJJ99820.1| periplasmic copper-binding protein [Klebsiella pneumoniae subsp. 
pneumoniae KPNIH17]
 gb|EJJ99998.1| periplasmic copper-binding protein [Klebsiella pneumoniae subsp. 
pneumoniae KPNIH16]
 gb|EJK10650.1| periplasmic copper-binding protein [Klebsiella pneumoniae subsp. 
pneumoniae KPNIH18]
 gb|EJK16853.1| periplasmic copper-binding protein [Klebsiella pneumoniae subsp. 
pneumoniae KPNIH20]
 gb|EJK28191.1| periplasmic copper-binding protein [Klebsiella pneumoniae subsp. 
pneumoniae KPNIH21]
 gb|EJK33941.1| periplasmic copper-binding protein [Klebsiella pneumoniae subsp. 
pneumoniae KPNIH22]
 gb|EJK39223.1| periplasmic copper-binding protein [Klebsiella pneumoniae subsp. 
pneumoniae KPNIH23]
 emb|CCM85389.1| Cation efflux system protein CusF precursor [Klebsiella pneumoniae 
subsp. pneumoniae ST258-K26BO]
 emb|CCM89733.1| Cation efflux system protein CusF precursor [Klebsiella pneumoniae 
subsp. pneumoniae ST258-K28BO]
 emb|CCM95122.1| Cation efflux system protein CusF precursor [Klebsiella pneumoniae 
subsp. pneumoniae ST512-K30BO]
 dbj|BAM74477.1| periplasmic copper-binding protein Cus F [Klebsiella pneumoniae]
 gb|EMI36039.1| cation efflux system protein CusF [Klebsiella pneumoniae VA360]
 gb|EMR15524.1| periplasmic copper-binding protein [Klebsiella pneumoniae ATCC 
BAA-1705]
 gb|EMR15995.1| periplasmic copper-binding protein [Klebsiella pneumoniae ATCC 
BAA-2146]
 gb|ENY59197.1| periplasmic copper-binding protein [Klebsiella pneumoniae subsp. 
pneumoniae KpMDU1]
 gb|EOR18357.1| cation efflux system protein CusF [Klebsiella pneumoniae UHKPC23]
 gb|EOY64588.1| cation efflux system protein CusF [Klebsiella pneumoniae KP-7]
 gb|EOY69557.1| cation efflux system protein CusF [Klebsiella pneumoniae UHKPC40]
 gb|EOY82145.1| cation efflux system protein CusF [Klebsiella pneumoniae UHKPC09]
 gb|EOY86089.1| cation efflux system protein CusF [Klebsiella pneumoniae UHKPC01]
 gb|EOY92392.1| cation efflux system protein CusF [Klebsiella pneumoniae UHKPC26]
 gb|EOY97140.1| cation efflux system protein CusF [Klebsiella pneumoniae UHKPC24]
 gb|EOZ03245.1| cation efflux system protein CusF [Klebsiella pneumoniae UHKPC27]
 gb|EOZ09678.1| cation efflux system protein CusF [Klebsiella pneumoniae UHKPC04]
 gb|EOZ17436.1| cation efflux system protein CusF [Klebsiella pneumoniae UHKPC22]
 gb|EOZ23036.1| cation efflux system protein CusF [Klebsiella pneumoniae VAKPC252]
 gb|EOZ28351.1| cation efflux system protein CusF [Klebsiella pneumoniae VAKPC269]
 gb|EOZ33446.1| cation efflux system protein CusF [Klebsiella pneumoniae VAKPC254]
 gb|EOZ38782.1| cation efflux system protein CusF [Klebsiella pneumoniae VAKPC280]
 gb|EOZ42873.1| cation efflux system protein CusF [Klebsiella pneumoniae VAKPC270]
 gb|EOZ44189.1| cation efflux system protein CusF [Klebsiella pneumoniae VAKPC297]
 gb|EOZ54713.1| cation efflux system protein CusF [Klebsiella pneumoniae VAKPC276]
 gb|EOZ54733.1| cation efflux system protein CusF [Klebsiella pneumoniae VAKPC309]
 gb|EOZ60219.1| cation efflux system protein CusF [Klebsiella pneumoniae 361_1301]
 gb|EOZ68504.1| cation efflux system protein CusF [Klebsiella pneumoniae KP-11]
 gb|EOZ77181.1| cation efflux system protein CusF [Klebsiella pneumoniae 500_1420]
 gb|EOZ84145.1| cation efflux system protein CusF [Klebsiella pneumoniae 540_1460]
 gb|EOZ87024.1| cation efflux system protein CusF [Klebsiella pneumoniae 440_1540]
 gb|EPA04230.1| cation efflux system protein CusF [Klebsiella pneumoniae 646_1568]
 gb|EPB07544.1| cation efflux system protein CusF [Klebsiella pneumoniae UHKPC 
52]
 gb|EPB08111.1| cation efflux system protein CusF [Klebsiella pneumoniae UHKPC05]
 gb|EPB10545.1| cation efflux system protein CusF [Klebsiella pneumoniae UHKPC45]
 gb|EPB19008.1| cation efflux system protein CusF [Klebsiella pneumoniae VAKPC278]
 gb|EPB26516.1| cation efflux system protein CusF [Klebsiella pneumoniae UHKPC29]
 gb|EPB28650.1| cation efflux system protein CusF [Klebsiella pneumoniae UHKPC48]
 gb|EPB34118.1| cation efflux system protein CusF [Klebsiella pneumoniae DMC0526]
 gb|EPB36676.1| cation efflux system protein CusF [Klebsiella pneumoniae UHKPC32]
 gb|EPN91592.1| cation efflux system protein CusF [Klebsiella pneumoniae UHKPC28]
 gb|EPN93550.1| cation efflux system protein CusF [Klebsiella pneumoniae UHKPC47]
 gb|EPO04350.1| cation efflux system protein CusF [Klebsiella pneumoniae UHKPC69]
 gb|EPO09395.1| cation efflux system protein CusF [Klebsiella pneumoniae UHKPC96]
 gb|EPO12687.1| cation efflux system protein CusF [Klebsiella pneumoniae UHKPC77]
 gb|EPO22225.1| cation efflux system protein CusF [Klebsiella pneumoniae DMC1097]
 gb|EPO27830.1| cation efflux system protein CusF [Klebsiella pneumoniae DMC1316]
 gb|EPO37792.1| cation efflux system protein CusF [Klebsiella pneumoniae UHKPC61]
 gb|EPO38793.1| cation efflux system protein CusF [Klebsiella pneumoniae UHKPC33]
 gb|EPO45881.1| cation efflux system protein CusF [Klebsiella pneumoniae UHKPC07]
 gb|EPO48822.1| cation efflux system protein CusF [Klebsiella pneumoniae UHKPC59]
 gb|EPO59732.1| cation efflux system protein CusF [Klebsiella pneumoniae UHKPC17]
 gb|EPO63408.1| cation efflux system protein CusF [Klebsiella pneumoniae UHKPC18]
 gb|EPO68674.1| cation efflux system protein CusF [Klebsiella pneumoniae UHKPC06]
 gb|EPO70734.1| cation efflux system protein CusF [Klebsiella pneumoniae UHKPC31]
 gb|EPO82698.1| cation efflux system protein CusF [Klebsiella pneumoniae UHKPC67]
 gb|EPO85901.1| cation efflux system protein CusF [Klebsiella pneumoniae UHKPC02]
 gb|EPO94170.1| cation efflux system protein CusF [Klebsiella pneumoniae 160_1080]
 gb|EPP05797.1| cation efflux system protein CusF [Klebsiella pneumoniae 140_1040]
 gb|EPP07025.1| cation efflux system protein CusF [Klebsiella pneumoniae 120_1020]
 gb|EPP12701.1| cation efflux system protein CusF [Klebsiella pneumoniae 280_1220]
 gb|EPS14359.1| copper-binding protein [Klebsiella pneumoniae subsp. pneumoniae 
UKKV901664]
 gb|EPS14726.1| copper-binding protein [Klebsiella pneumoniae subsp. pneumoniae 
MP14]
 gb|AGT26162.1| periplasmic copper-binding protein [Klebsiella pneumoniae JM45]
 gb|ERO77826.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae BIDMC 16]
 gb|ERO82856.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae BIDMC 18C]
 gb|ERO88792.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae BIDMC 12C]
 emb|CDK93552.1| Cation efflux system protein CusF precursor [Klebsiella pneumoniae 
IS33]
 gb|AHI34092.1| Cation efflux system protein CusF precursor [Klebsiella pneumoniae 
ATCC BAA-2146]
 gb|EWD06665.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae UCI 43]
 gb|EWD14816.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae UCI 44]
 gb|EWD21479.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae UCI 41]
 gb|EWD24331.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae UCI 38]
 gb|EWD25825.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae UCI 37]
 gb|EWD41645.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae UCI 33]
 gb|EWD56498.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae UCI 22]
 gb|EWD57065.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae UCI 21]
 gb|EWD69326.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae UCI 20]
 gb|EWD75711.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae UCI 19]
 gb|EWD82334.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae BIDMC 45]
 gb|EWD99296.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae BIDMC 51]
 gb|EWE11774.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae BIDMC 46b]
 gb|EWE21943.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae BIDMC 42a]
 gb|EWE26047.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae BIDMC 42b]
 gb|EWE39341.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae BIDMC 34]
 gb|EWE40453.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae BIDMC 32]
 gb|EWE50047.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae BIDMC 18A]
 gb|EWE64670.1| hypothetical protein L443_04956 [Klebsiella pneumoniae BIDMC 
14]
 gb|EWE67473.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae BIDMC 13]
 gb|EWE71497.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae BIDMC 12B]
 gb|EWE76743.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae BIDMC 12A]
 gb|EWE89305.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae BIDMC 7B]
 gb|EWF00041.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae BIDMC 5]
 gb|EWF00995.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae BIDMC 4]
 gb|EWF02536.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae BIDMC 2A]
 gb|EWF07547.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae BIDMC 1]
 gb|EWF20897.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae UCICRE 1]
 gb|EWF26695.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae BWH 36]
 gb|EWF27294.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae BWH 22]
 gb|EWF33074.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae BWH 41]
 gb|EWF53870.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae MGH 45]
 gb|EWF80635.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae MGH 31]
 gb|EWF82580.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae MGH 29]
 gb|EWF98911.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae UCICRE 13]
 gb|EWG04221.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae BIDMC 7A]
 gb|AHM81599.1| Putative membrane spanning protein [Klebsiella pneumoniae 30684/NJST258_2]
 gb|AHM87278.1| Putative membrane spanning protein [Klebsiella pneumoniae 30660/NJST258_1]
 gb|EYB72468.1| cation efflux system protein CusF [Klebsiella pneumoniae Kb677]
 gb|EYB79069.1| cation efflux system protein CusF [Klebsiella pneumoniae Kb140]
 gb|EZQ75613.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae CHS 60]
 gb|EZQ79955.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae CHS 47]
 gb|EZQ92378.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae CHS 42]
 gb|EZQ99564.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae CHS 16]
 gb|KAI86056.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae CHS 08]
 gb|KDG97603.1| hypothetical protein L449_05040 [Klebsiella pneumoniae BIDMC 
18B]
 gb|KDH07612.1| hypothetical protein AE28_04549 [Klebsiella pneumoniae BIDMC 
54]
 gb|KDH17392.1| hypothetical protein AE35_03623 [Klebsiella pneumoniae BIDMC 
60]
 gb|KDH25620.1| hypothetical protein AE43_04835 [Klebsiella pneumoniae BIDMC 
68]
 gb|KDH38426.1| hypothetical protein AE08_05139 [Klebsiella pneumoniae BWH 45]
 gb|KDH49083.1| hypothetical protein AE55_05123 [Klebsiella pneumoniae BWH 47]
 gb|KDH57074.1| hypothetical protein AE58_05204 [Klebsiella pneumoniae CHS 02]
 gb|KDH62566.1| hypothetical protein AE59_05193 [Klebsiella pneumoniae CHS 03]
 gb|KDH64750.1| hypothetical protein AE61_04978 [Klebsiella pneumoniae CHS 05]
 gb|KDH74834.1| hypothetical protein AE62_04982 [Klebsiella pneumoniae CHS 06]
 gb|KDH80262.1| hypothetical protein AE63_04943 [Klebsiella pneumoniae CHS 07]
 gb|KDH83248.1| hypothetical protein AE65_05180 [Klebsiella pneumoniae CHS 09]
 gb|KDH92123.1| hypothetical protein AE67_03670 [Klebsiella pneumoniae CHS 11]
 gb|KDH95062.1| hypothetical protein AE68_05159 [Klebsiella pneumoniae CHS 12]
 gb|KDI02607.1| hypothetical protein AE69_04977 [Klebsiella pneumoniae CHS 13]
 gb|KDI04897.1| hypothetical protein AE70_04760 [Klebsiella pneumoniae CHS 14]
 gb|KDI13196.1| hypothetical protein AE73_05136 [Klebsiella pneumoniae CHS 17]
 gb|KDI15601.1| hypothetical protein AE74_05161 [Klebsiella pneumoniae CHS 18]
 gb|KDI24146.1| hypothetical protein AE75_04974 [Klebsiella pneumoniae CHS 19]
 gb|KDI29700.1| hypothetical protein AE76_04449 [Klebsiella pneumoniae CHS 20]
 gb|KDI34448.1| hypothetical protein AE78_04748 [Klebsiella pneumoniae CHS 22]
 gb|KDI39093.1| hypothetical protein AE79_03687 [Klebsiella pneumoniae CHS 23]
 gb|KDI47396.1| hypothetical protein AE80_04732 [Klebsiella pneumoniae CHS 24]
 gb|KDI48625.1| hypothetical protein AE81_04896 [Klebsiella pneumoniae CHS 25]
 gb|KDI55024.1| hypothetical protein AE82_03627 [Klebsiella pneumoniae CHS 26]
 gb|KDI66078.1| hypothetical protein AE84_05199 [Klebsiella pneumoniae CHS 28]
 gb|KDI67639.1| hypothetical protein AE83_03627 [Klebsiella pneumoniae CHS 27]
 gb|KDI68312.1| hypothetical protein AE85_03876 [Klebsiella pneumoniae CHS 29]
 gb|KDI81021.1| hypothetical protein AE87_04880 [Klebsiella pneumoniae CHS 31]
 gb|KDI89640.1| hypothetical protein AE88_03523 [Klebsiella pneumoniae CHS 32]
 gb|KDI95026.1| hypothetical protein AE86_00404 [Klebsiella pneumoniae CHS 30]
 gb|KDI96707.1| hypothetical protein AE89_04884 [Klebsiella pneumoniae CHS 33]
 gb|KDI97848.1| hypothetical protein AE90_05187 [Klebsiella pneumoniae CHS 34]
 gb|KDI99053.1| hypothetical protein AE91_05134 [Klebsiella pneumoniae CHS 35]
 gb|KDJ13624.1| hypothetical protein AE92_05197 [Klebsiella pneumoniae CHS 36]
 gb|KDJ15604.1| hypothetical protein AE93_05077 [Klebsiella pneumoniae CHS 37]
 gb|KDJ19519.1| hypothetical protein AE94_05097 [Klebsiella pneumoniae CHS 38]
 gb|KDJ31680.1| hypothetical protein AE96_04981 [Klebsiella pneumoniae CHS 40]
 gb|KDJ32420.1| hypothetical protein AE95_03708 [Klebsiella pneumoniae CHS 39]
 gb|KDJ38439.1| hypothetical protein AE97_03712 [Klebsiella pneumoniae CHS 41]
 gb|KDJ49693.1| hypothetical protein AF01_04926 [Klebsiella pneumoniae CHS 45]
 gb|KDJ57287.1| hypothetical protein AF00_03132 [Klebsiella pneumoniae CHS 44]
 gb|KDJ65115.1| hypothetical protein AF02_03650 [Klebsiella pneumoniae CHS 46]
 gb|KDJ68053.1| hypothetical protein AF05_04946 [Klebsiella pneumoniae CHS 49]
 gb|KDJ79961.1| hypothetical protein AF06_03750 [Klebsiella pneumoniae CHS 50]
 gb|KDJ84716.1| hypothetical protein AF07_04647 [Klebsiella pneumoniae CHS 51]
 gb|KDJ88591.1| hypothetical protein AF08_03680 [Klebsiella pneumoniae CHS 52]
 gb|KDJ96089.1| hypothetical protein AF10_05162 [Klebsiella pneumoniae CHS 54]
 gb|KDJ98192.1| hypothetical protein AF09_04040 [Klebsiella pneumoniae CHS 53]
 gb|KDK03336.1| hypothetical protein AF11_05191 [Klebsiella pneumoniae CHS 55]
 gb|KDK11706.1| hypothetical protein AF12_04895 [Klebsiella pneumoniae CHS 56]
 gb|KDK17034.1| hypothetical protein AF13_04263 [Klebsiella pneumoniae CHS 57]
 gb|KDK21122.1| hypothetical protein AF14_05039 [Klebsiella pneumoniae CHS 58]
 gb|KDK25200.1| hypothetical protein AF15_05046 [Klebsiella pneumoniae CHS 59]
 gb|KDK32560.1| hypothetical protein AF17_04977 [Klebsiella pneumoniae CHS 61]
 gb|KDK40932.1| hypothetical protein AF19_05310 [Klebsiella pneumoniae CHS 63]
 gb|KDK41385.1| hypothetical protein AF18_03708 [Klebsiella pneumoniae CHS 62]
 gb|KDK53887.1| hypothetical protein AF20_03701 [Klebsiella pneumoniae CHS 64]
 gb|KDK54408.1| hypothetical protein AF21_04755 [Klebsiella pneumoniae CHS 65]
 gb|KDK63922.1| hypothetical protein AF23_05112 [Klebsiella pneumoniae CHS 67]
 gb|KDK72189.1| hypothetical protein AF26_03240 [Klebsiella pneumoniae CHS 70]
 gb|KDK77682.1| hypothetical protein AF28_05194 [Klebsiella pneumoniae CHS 72]
 gb|KDK81640.1| hypothetical protein AF27_03221 [Klebsiella pneumoniae CHS 71]
 gb|KDK90255.1| hypothetical protein AF29_03220 [Klebsiella pneumoniae CHS 73]
 gb|KDK94466.1| hypothetical protein AF31_05191 [Klebsiella pneumoniae CHS 75]
 gb|KDK95349.1| hypothetical protein AF30_04737 [Klebsiella pneumoniae CHS 74]
 gb|KDL02721.1| hypothetical protein AF32_03222 [Klebsiella pneumoniae CHS 76]
 gb|KDL10584.1| hypothetical protein AF36_05191 [Klebsiella pneumoniae CHS 80]
 gb|KDL14765.1| hypothetical protein AF37_05045 [Klebsiella pneumoniae MGH 51]
 gb|KDL26367.1| hypothetical protein AF45_04465 [Klebsiella pneumoniae MGH 59]
 gb|KDL50663.1| hypothetical protein AD93_04204 [Klebsiella pneumoniae MGH 67]
 gb|KDL64578.1| hypothetical protein AD95_03515 [Klebsiella pneumoniae MGH 69]
 gb|KDL74503.1| hypothetical protein AD97_03118 [Klebsiella pneumoniae MGH 71]
 gb|KDL78614.1| hypothetical protein AD99_04886 [Klebsiella pneumoniae MGH 73]
 gb|KDL95636.1| hypothetical protein AE05_04157 [Klebsiella pneumoniae MGH 79]
 gb|KDM03068.1| hypothetical protein AE14_05059 [Klebsiella pneumoniae UCI 55]
 gb|KDM13368.1| hypothetical protein AE18_04853 [Klebsiella pneumoniae UCI 59]
 gb|KDM22365.1| hypothetical protein AE20_05174 [Klebsiella pneumoniae UCI 61]
 gb|KDM35032.1| hypothetical protein AE22_04698 [Klebsiella pneumoniae UCI 63]
 gb|KDM37467.1| hypothetical protein AE26_05011 [Klebsiella pneumoniae UCI 67]
 gb|AIA34927.1| copper-binding protein [Klebsiella pneumoniae subsp. pneumoniae 
KPNIH10]
 gb|KEC96355.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae UCI 17]
 gb|KED00050.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae BIDMC 10]
 gb|KEF66372.1| copper-binding protein [Klebsiella pneumoniae 160_1080]
 gb|KEF73138.1| copper-binding protein [Klebsiella pneumoniae UHKPC 52]
 gb|KEF77640.1| copper-binding protein [Klebsiella pneumoniae UHKPC45]
 gb|KEF83486.1| copper-binding protein [Klebsiella pneumoniae UHKPC05]
 gb|KEF88337.1| copper-binding protein [Klebsiella pneumoniae VAKPC278]
 gb|AID94217.1| copper-binding protein [Klebsiella pneumoniae subsp. pneumoniae 
KPNIH24]
 gb|AIE21240.1| copper-binding protein [Klebsiella pneumoniae subsp. pneumoniae 
KPNIH1]
 gb|AIE26637.1| copper-binding protein [Klebsiella pneumoniae subsp. pneumoniae 
KPR0928]
 gb|KEP95083.1| copper-binding protein [Klebsiella pneumoniae]
 gb|KFG15078.1| copper-binding protein [Klebsiella pneumoniae]
 gb|KFG15983.1| copper-binding protein [Klebsiella pneumoniae]
 gb|AIW69197.1| copper-binding protein [Klebsiella pneumoniae subsp. pneumoniae]
 gb|AIW74742.1| copper-binding protein [Klebsiella pneumoniae subsp. pneumoniae]
 gb|AIX77265.1| copper-binding protein [Klebsiella pneumoniae subsp. pneumoniae]
 gb|KHF62285.1| Cation efflux system protein CusF precursor [Klebsiella pneumoniae 
subsp. pneumoniae]
 gb|KHQ36583.1| copper-binding protein [Klebsiella pneumoniae]
 gb|KHQ39769.1| copper-binding protein [Klebsiella pneumoniae]
 gb|AJB78068.1| copper-binding protein [Klebsiella pneumoniae]
 gb|AJB59617.1| copper-binding protein [Klebsiella pneumoniae]
Length=114

 Score = 58.5 bits (140),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKV  130
            MRFTITPQT+++ +K GD V F FVQQGNLSL QDI+ 
Sbjct  76   MRFTITPQTQLNNVKDGDSVDFTFVQQGNLSLLQDIRA  113



>gb|EWF66303.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae MGH 35]
 gb|EWF78231.1| Cu(I)/Ag(I) efflux system periplasmic protein CusF [Klebsiella 
pneumoniae MGH 39]
Length=102

 Score = 58.5 bits (140),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIK  133
            MRFTITPQT+++ +K GD V F FVQQGNLSL QDI+
Sbjct  64   MRFTITPQTQLNNVKDGDSVDFTFVQQGNLSLLQDIR  100



>ref|WP_032432083.1| copper-binding protein [Klebsiella pneumoniae]
 gb|AIX86938.1| copper-binding protein [Klebsiella pneumoniae subsp. pneumoniae]
 gb|KHQ24960.1| copper-binding protein [Klebsiella pneumoniae]
Length=101

 Score = 58.5 bits (140),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIK  133
            MRFTITPQT+++ +K GD V F FVQQGNLSL QDI+
Sbjct  63   MRFTITPQTQLNNVKDGDSVDFTFVQQGNLSLLQDIR  99



>ref|WP_040183256.1| copper-binding protein [Klebsiella pneumoniae]
Length=101

 Score = 58.5 bits (140),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIK  133
            MRFTITPQT+++ +K GD V F FVQQGNLSL QDI+
Sbjct  63   MRFTITPQTQLNNVKDGDSVDFTFVQQGNLSLLQDIR  99



>ref|WP_032456949.1| copper-binding protein [Klebsiella sp. 07A044]
 emb|CDN09562.1| periplasmic copper-binding protein [Klebsiella sp. 07A044]
Length=114

 Score = 58.5 bits (140),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKV  130
            MRFTITPQT+++ +K GD V F F+QQGNLSL QDI+ 
Sbjct  76   MRFTITPQTQLNNVKDGDSVDFTFIQQGNLSLLQDIRA  113



>ref|WP_040903073.1| copper-binding protein [Yokenella regensburgei]
Length=115

 Score = 58.5 bits (140),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 36/41 (88%), Gaps = 1/41 (2%)
 Frame = -3

Query  243  MRFTIT-PQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTIT P+T+  +IK GDKVAF+FVQQG+LSL +DI++SQ
Sbjct  75   MRFTITDPKTQPGDIKVGDKVAFDFVQQGSLSLLRDIRISQ  115



>gb|EHM50332.1| cation efflux system protein CusF [Yokenella regensburgei ATCC 
43003]
Length=116

 Score = 58.5 bits (140),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 36/41 (88%), Gaps = 1/41 (2%)
 Frame = -3

Query  243  MRFTIT-PQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTIT P+T+  +IK GDKVAF+FVQQG+LSL +DI++SQ
Sbjct  76   MRFTITDPKTQPGDIKVGDKVAFDFVQQGSLSLLRDIRISQ  116



>ref|WP_012737331.1| copper-binding protein [Klebsiella pneumoniae]
 dbj|BAH61536.1| putative periplasmic copper-binding protein [Klebsiella pneumoniae 
subsp. pneumoniae NTUH-K2044]
 gb|AFQ67632.1| Cation efflux system protein CusF precursor [Klebsiella pneumoniae 
subsp. pneumoniae 1084]
Length=114

 Score = 57.0 bits (136),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKV  130
            MRFTI PQT+++ +K GD V F FVQQGNLSL QDI+ 
Sbjct  76   MRFTIIPQTQLNNVKDGDSVDFTFVQQGNLSLLQDIRA  113



>ref|WP_004872501.1| copper-binding protein [Klebsiella pneumoniae]
 ref|YP_007989782.1| cusF [Klebsiella pneumoniae]
 gb|EEW38761.1| cation efflux system protein CusF [Klebsiella pneumoniae subsp. 
rhinoscleromatis ATCC 13884]
 emb|CCI75031.1| cusF [Klebsiella pneumoniae]
Length=114

 Score = 57.0 bits (136),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKV  130
            MRFTITPQT+++ +K GD V   FVQQGNLSL QDI+ 
Sbjct  76   MRFTITPQTQLNNVKDGDSVDLTFVQQGNLSLLQDIRA  113



>ref|WP_032713604.1| copper-binding protein [Enterobacter aerogenes]
 gb|KDF14646.1| hypothetical protein AF47_04707 [Enterobacter aerogenes MGH 61]
Length=114

 Score = 57.0 bits (136),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKV  130
            MRFTITPQT+++ +K  D V F FVQQGNLSL QDI+ 
Sbjct  76   MRFTITPQTQLNNVKDADSVDFTFVQQGNLSLLQDIRA  113



>ref|WP_023177625.1| periplasmic copper-binding protein [Salmonella enterica]
 gb|ESE66765.1| periplasmic copper-binding protein [Salmonella enterica subsp. 
salamae serovar 58:l,z13,z28:z6 str. 00-0163]
Length=114

 Score = 57.0 bits (136),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFT TP T+ + +K GDKVAF+FVQQGNLSL +DI   Q
Sbjct  75   MRFTRTPDTQFTTVKPGDKVAFSFVQQGNLSLLRDIHTRQ  114



>ref|WP_000559535.1| hypothetical protein [Salmonella enterica]
Length=114

 Score = 56.6 bits (135),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFT TP T+ + +K GDKVAF+FVQQGNLSL +DI   Q
Sbjct  75   MRFTRTPDTQFTTVKPGDKVAFSFVQQGNLSLLRDIHTRQ  114



>ref|WP_038253833.1| copper-binding protein [Yokenella regensburgei]
Length=114

 Score = 56.6 bits (135),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTIT   +  +IK GDKVAF+FVQQG+LSL +DI++SQ
Sbjct  75   MRFTITDPNQPGDIKVGDKVAFDFVQQGSLSLLRDIRISQ  114



>gb|KFD24617.1| CusF family cation efflux system protein [Yokenella regensburgei 
ATCC 49455]
Length=115

 Score = 56.6 bits (135),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFTIT   +  +IK GDKVAF+FVQQG+LSL +DI++SQ
Sbjct  76   MRFTITDPNQPGDIKVGDKVAFDFVQQGSLSLLRDIRISQ  115



>ref|WP_043015501.1| copper-binding protein [Citrobacter freundii]
 gb|KDF20937.1| hypothetical protein AF42_00370 [Citrobacter freundii MGH 56]
 gb|KGZ33060.1| copper-binding protein [Citrobacter freundii]
Length=115

 Score = 55.8 bits (133),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFT+   TK  +IK GDKVAF FVQQGNLS+ +DI +S+
Sbjct  76   MRFTLVADTKADDIKPGDKVAFTFVQQGNLSVLRDIHISK  115



>ref|WP_003021945.1| MULTISPECIES: copper-binding protein [Citrobacter]
 gb|EJF24218.1| periplasmic copper-binding protein [Citrobacter sp. A1]
 gb|EKU36679.1| periplasmic copper-binding protein [Citrobacter sp. L17]
 gb|EOD61867.1| periplasmic copper-binding protein [Citrobacter freundii GTC 
09629]
Length=115

 Score = 55.8 bits (133),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFT+   TK  +IK GDKVAF FVQQGNLS+ +DI +S+
Sbjct  76   MRFTLVADTKADDIKPGDKVAFTFVQQGNLSVLRDIHISK  115



>ref|WP_016149747.1| MULTISPECIES: periplasmic copper-binding protein [Enterobacteriaceae]
 gb|EOQ25339.1| periplasmic copper-binding protein [Citrobacter sp. KTE30]
 emb|CDL37915.1| Cation efflux system protein CusF precursor [Escherichia coli 
ISC11]
 gb|ETX72631.1| periplasmic copper-binding protein [Citrobacter freundii UCI 
31]
 gb|KEL80326.1| cation efflux system protein CusF [Escherichia coli 5-172-05_S1_C1]
 gb|KGY84582.1| copper-binding protein [Citrobacter freundii]
 gb|KJC13294.1| copper-binding protein [Citrobacter freundii]
Length=115

 Score = 55.8 bits (133),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFT+   TK  +IK GDKVAF FVQQGNLS+ +DI +S+
Sbjct  76   MRFTLVADTKADDIKPGDKVAFTFVQQGNLSVLRDIHISK  115



>ref|WP_003831139.1| copper-binding protein [Citrobacter freundii]
 gb|EHL83323.1| hypothetical protein HMPREF9428_00339 [Citrobacter freundii 4_7_47CFAA]
Length=115

 Score = 55.8 bits (133),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFT+   TK  +IK GDKVAF FVQQGNLS+ +DI +S+
Sbjct  76   MRFTLVADTKADDIKPGDKVAFTFVQQGNLSVLRDIHISK  115



>ref|WP_008784023.1| copper-binding protein [Citrobacter sp. 30_2]
 gb|EEH91982.1| hypothetical protein CSAG_00336 [Citrobacter sp. 30_2]
Length=115

 Score = 55.8 bits (133),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFT+   TK  +IK GDKVAF FVQQGNLS+ +DI +S+
Sbjct  76   MRFTLVADTKADDIKPGDKVAFTFVQQGNLSVLRDIHISK  115



>ref|WP_032942611.1| copper-binding protein [Citrobacter freundii]
 gb|ETX65062.1| periplasmic copper-binding protein [Citrobacter freundii UCI 
32]
Length=115

 Score = 55.8 bits (133),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFT+   TK  +IK GDKVAF FVQQGNLS+ +DI +S+
Sbjct  76   MRFTLVADTKADDIKPGDKVAFTFVQQGNLSVLRDIHISK  115



>ref|WP_032709759.1| copper-binding protein [Enterobacter aerogenes]
 gb|EUL47515.1| hypothetical protein P848_04990 [Enterobacter aerogenes UCI 45]
 gb|EUL77733.1| hypothetical protein P830_04718 [Enterobacter aerogenes UCI 27]
 gb|EUL80908.1| hypothetical protein P831_01661 [Enterobacter aerogenes UCI 28]
Length=114

 Score = 55.5 bits (132),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKV  130
            MRFTIT QT+++ +K GD V F FVQQGNLSL QDI+ 
Sbjct  76   MRFTITSQTQLNNVKDGDSVDFTFVQQGNLSLLQDIRA  113



>ref|WP_042285728.1| copper-binding protein [Citrobacter sedlakii]
Length=110

 Score = 55.1 bits (131),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIK  133
            MRFT+T QT+++ I  GD V F+FVQQGNLSL QDIK
Sbjct  72   MRFTLTSQTQLNGITPGDSVTFHFVQQGNLSLLQDIK  108



>ref|WP_023182882.1| periplasmic copper-binding protein [Salmonella enterica]
 gb|ESE87717.1| periplasmic copper-binding protein [Salmonella enterica subsp. 
indica serovar 6,14,25:z10:1,(2),7 str. 1121]
Length=115

 Score = 55.1 bits (131),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFT TP T+ + +K GDKVAF+FVQQGNLS  +DI   Q
Sbjct  76   MRFTRTPDTQFTTVKPGDKVAFSFVQQGNLSFLRDIHTRQ  115



>ref|WP_006685618.1| copper-binding protein [Citrobacter youngae]
 gb|EFE08406.1| cation efflux system protein CusF [Citrobacter youngae ATCC 29220]
Length=115

 Score = 54.7 bits (130),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFT+   TK  +IK GDKVAF FVQQGNLS+ +DI  S+
Sbjct  76   MRFTLVADTKADDIKPGDKVAFTFVQQGNLSVLRDIHTSK  115



>ref|WP_038638538.1| copper-binding protein [Citrobacter freundii]
 gb|AHY12380.1| copper-binding protein [Citrobacter freundii CFNIH1]
Length=115

 Score = 54.7 bits (130),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFT+   T+  +IK GDKVAF FVQQGNLS+ +DI +S+
Sbjct  76   MRFTLGADTRADDIKPGDKVAFTFVQQGNLSVLRDIHISK  115



>ref|WP_042309919.1| copper-binding protein [Citrobacter werkmanii]
 dbj|GAL45007.1| cation efflux system protein CusF [Citrobacter werkmanii NBRC 
105721]
Length=115

 Score = 54.3 bits (129),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFT+   T+  +IK GDKVAF FVQQGN+S+ +DI +S+
Sbjct  76   MRFTLVADTRADDIKPGDKVAFTFVQQGNISVLRDIHISK  115



>ref|WP_016155925.1| periplasmic copper-binding protein [Citrobacter sp. KTE32]
 gb|EOQ32465.1| periplasmic copper-binding protein [Citrobacter sp. KTE32]
Length=115

 Score = 53.9 bits (128),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFT    TK  +IK GDKVAF FVQQGNLS+ +DI +S+
Sbjct  76   MRFTRVADTKADDIKPGDKVAFTFVQQGNLSVLRDIHISK  115



>ref|WP_003835715.1| periplasmic copper-binding protein [Citrobacter freundii]
 gb|EKS58722.1| periplasmic copper-binding protein [Citrobacter freundii ATCC 
8090 = MTCC 1658]
 gb|EXF29564.1| copper-binding protein [Citrobacter freundii RLS1]
 gb|KFC00780.1| CusF family cation efflux system protein [Citrobacter freundii 
ATCC 8090 = MTCC 1658]
 dbj|GAL39033.1| cation efflux system protein CusF [Citrobacter freundii NBRC 
12681]
Length=115

 Score = 53.9 bits (128),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFT    TK  +IK GDKVAF FVQQGNLS+ +DI +S+
Sbjct  76   MRFTRVADTKADDIKPGDKVAFTFVQQGNLSVLRDIHISK  115



>ref|WP_003847477.1| periplasmic copper-binding protein [Citrobacter freundii]
 gb|EMF20856.1| periplasmic copper-binding protein [Citrobacter freundii GTC 
09479]
Length=115

 Score = 53.5 bits (127),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFT    TK  +IK GDKVAF FVQQGNLS+ +DI +S+
Sbjct  76   MRFTRVADTKTDDIKPGDKVAFTFVQQGNLSVLRDIHISK  115



>gb|EIQ79192.1| cation efflux system protein CusF [Shigella flexneri 1235-66]
Length=99

 Score = 53.1 bits (126),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFT+   T+  +I+ GDKVAF FVQQGNLS+ +DI +S+
Sbjct  60   MRFTLVSDTRADDIQPGDKVAFTFVQQGNLSVLRDIHISK  99



>ref|WP_040232621.1| copper-binding protein [Citrobacter sp. CIP 55.13]
 emb|CEJ66098.1| Cation efflux system protein CusF precursor [Citrobacter sp. 
CIP 55.13]
Length=115

 Score = 53.5 bits (127),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFT+   T+  +I+ GDKVAF FVQQGNLS+ +DI +S+
Sbjct  76   MRFTLVSDTRADDIQPGDKVAFTFVQQGNLSVLRDIHISK  115



>gb|KHE09672.1| copper-binding protein [Citrobacter braakii]
Length=115

 Score = 52.8 bits (125),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFT    TK  +IK GDKVAF FVQQGN+S+ +DI +S+
Sbjct  76   MRFTRVADTKADDIKPGDKVAFTFVQQGNISVLRDIHISK  115



>ref|WP_016152151.1| MULTISPECIES: periplasmic copper-binding protein [Citrobacter]
 gb|EOQ50186.1| periplasmic copper-binding protein [Citrobacter sp. KTE151]
 gb|KHE06624.1| copper-binding protein [Citrobacter braakii]
Length=115

 Score = 52.8 bits (125),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFT    TK  +IK GDKVAF FVQQGN+S+ +DI +S+
Sbjct  76   MRFTRVADTKADDIKPGDKVAFTFVQQGNISVLRDIHISK  115



>ref|WP_015062723.1| Cation efflux system protein CusF precursor [Salmonella sp. 14]
 ref|YP_006964416.1| Cation efflux system protein CusF precursor [Salmonella sp. 14]
 gb|AFK90139.1| Cation efflux system protein CusF precursor [Salmonella sp. 14]
Length=118

 Score = 48.5 bits (114),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 33/41 (80%), Gaps = 1/41 (2%)
 Frame = -3

Query  243  MRFTITPQ-TKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFT T Q   ++ +K+G+KV F+FVQQGN+SL QDI+V+Q
Sbjct  77   MRFTFTTQDNGINALKSGNKVNFSFVQQGNISLLQDIQVTQ  117



>emb|CDL28814.1| Cation efflux system protein CusF precursor [Escherichia coli 
ISC7]
Length=92

 Score = 48.1 bits (113),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/22 (100%), Positives = 22/22 (100%), Gaps = 0/22 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAF  178
            MRFTITPQTKMSEIKTGDKVAF
Sbjct  71   MRFTITPQTKMSEIKTGDKVAF  92



>ref|WP_035891064.1| hypothetical protein [Kluyvera ascorbata]
 gb|KFD09153.1| CusF family cation efflux system protein [Kluyvera ascorbata 
ATCC 33433]
Length=114

 Score = 46.2 bits (108),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 28/38 (74%), Gaps = 1/38 (3%)
 Frame = -3

Query  243  MRFTIT-PQTKMSEIKTGDKVAFNFVQQGNLSLXQDIK  133
            MRFT T P   ++++K G  V F+F+QQGNLSL QDIK
Sbjct  75   MRFTYTEPTEAINQLKAGSHVNFSFIQQGNLSLLQDIK  112



>ref|WP_039031776.1| copper-binding protein [Leclercia adecarboxylata]
Length=113

 Score = 46.2 bits (108),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIK  133
            MRFT T  +++  I  GD+V F F+QQGN+SL QDI+
Sbjct  74   MRFTFTQASQIQGITVGDQVEFTFIQQGNISLLQDIR  110



>ref|WP_035600913.1| copper ABC transporter substrate-binding protein [Edwardsiella 
tarda]
Length=116

 Score = 44.3 bits (103),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 31/40 (78%), Gaps = 1/40 (3%)
 Frame = -3

Query  243  MRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLXQDIKVSQ  124
            MRFT +    ++ +K G+KV F+F+QQGNLSL QDI+V+Q
Sbjct  77   MRFT-SQDDGITALKPGNKVNFSFIQQGNLSLLQDIQVTQ  115



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 559512047520