BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002C08

Length=560
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009613542.1|  PREDICTED: uncharacterized protein LOC104106659    126   1e-32   Nicotiana tomentosiformis
ref|XP_009759556.1|  PREDICTED: uncharacterized protein LOC104212073    125   3e-32   Nicotiana sylvestris
gb|KJB17803.1|  hypothetical protein B456_003G015900                    120   2e-30   Gossypium raimondii
gb|KHG24772.1|  Aldehyde dehydrogenase                                  120   3e-30   Gossypium arboreum [tree cotton]
ref|XP_006341924.1|  PREDICTED: uncharacterized protein LOC102585551    120   6e-30   Solanum tuberosum [potatoes]
ref|XP_010254892.1|  PREDICTED: uncharacterized protein LOC104595729    118   1e-29   Nelumbo nucifera [Indian lotus]
ref|XP_004238248.1|  PREDICTED: uncharacterized protein LOC101256584    117   6e-29   Solanum lycopersicum
gb|KJB17802.1|  hypothetical protein B456_003G015900                    116   7e-29   Gossypium raimondii
ref|XP_007156925.1|  hypothetical protein PHAVU_002G028800g             108   7e-26   Phaseolus vulgaris [French bean]
gb|KFK30286.1|  hypothetical protein AALP_AA7G241900                    107   1e-25   Arabis alpina [alpine rockcress]
ref|XP_006282502.1|  hypothetical protein CARUB_v10006860mg             107   2e-25   Capsella rubella
emb|CAB16809.1|  hypothetical protein                                   106   3e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002867000.1|  At4g36660                                          107   3e-25   
dbj|BAH30560.1|  hypothetical protein                                   106   4e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006411975.1|  hypothetical protein EUTSA_v10026362mg             106   4e-25   Eutrema salsugineum [saltwater cress]
ref|NP_195384.5|  uncharacterized protein                               106   4e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006466773.1|  PREDICTED: uncharacterized protein LOC102620...    103   2e-24   
ref|XP_009625643.1|  PREDICTED: uncharacterized protein LOC104116484    105   2e-24   Nicotiana tomentosiformis
ref|XP_010432152.1|  PREDICTED: uncharacterized protein LOC104716471    104   3e-24   Camelina sativa [gold-of-pleasure]
ref|XP_009791325.1|  PREDICTED: uncharacterized protein LOC104238615    103   5e-24   Nicotiana sylvestris
emb|CDX75587.1|  BnaA01g01150D                                          103   5e-24   
ref|XP_009142898.1|  PREDICTED: uncharacterized protein LOC103866654    103   5e-24   Brassica rapa
ref|XP_006466772.1|  PREDICTED: uncharacterized protein LOC102620...    103   6e-24   Citrus sinensis [apfelsine]
gb|KHN41992.1|  hypothetical protein glysoja_003732                     103   7e-24   Glycine soja [wild soybean]
ref|XP_006590683.1|  PREDICTED: uncharacterized protein LOC100787922    103   7e-24   Glycine max [soybeans]
gb|ACU23828.1|  unknown                                                 103   7e-24   Glycine max [soybeans]
gb|KDP38489.1|  hypothetical protein JCGZ_04414                         103   7e-24   Jatropha curcas
gb|KDO79509.1|  hypothetical protein CISIN_1g0391382mg                  102   8e-24   Citrus sinensis [apfelsine]
ref|XP_004512021.1|  PREDICTED: uncharacterized protein LOC101494863    102   1e-23   Cicer arietinum [garbanzo]
ref|XP_010446762.1|  PREDICTED: uncharacterized protein LOC104729514    102   2e-23   
gb|ABU45202.1|  unknown                                                 102   2e-23   Solanum bulbocastanum [ornamental nightshade]
ref|XP_009402023.1|  PREDICTED: uncharacterized protein LOC103985884    102   3e-23   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006573579.1|  PREDICTED: uncharacterized protein LOC100800366    100   4e-23   Glycine max [soybeans]
ref|XP_006340593.1|  PREDICTED: uncharacterized protein LOC102599104    101   4e-23   Solanum tuberosum [potatoes]
ref|XP_007017505.1|  Sugar transporter, putative isoform 2              101   4e-23   
gb|ABU45182.1|  unknown                                                 101   5e-23   Capsicum frutescens [bird pepper]
emb|CDY67099.1|  BnaCnng53540D                                        99.8    5e-23   Brassica napus [oilseed rape]
ref|XP_010095271.1|  hypothetical protein L484_014612                   100   6e-23   Morus notabilis
ref|XP_007017504.1|  Sugar transporter, putative isoform 1              100   6e-23   
ref|XP_009356685.1|  PREDICTED: uncharacterized protein LOC103947497    100   6e-23   Pyrus x bretschneideri [bai li]
ref|XP_008241652.1|  PREDICTED: uncharacterized protein LOC103340064    100   7e-23   Prunus mume [ume]
ref|XP_006856090.1|  hypothetical protein AMTR_s00059p00127380          100   8e-23   Amborella trichopoda
ref|XP_004300622.1|  PREDICTED: uncharacterized protein LOC101302363    100   1e-22   Fragaria vesca subsp. vesca
ref|XP_003611971.1|  hypothetical protein MTR_5g019900                99.4    2e-22   Medicago truncatula
gb|AFK42567.1|  unknown                                               99.4    2e-22   Lotus japonicus
emb|CBI17540.3|  unnamed protein product                              99.4    2e-22   Vitis vinifera
ref|XP_010550395.1|  PREDICTED: uncharacterized protein LOC104821281  99.4    3e-22   Tarenaya hassleriana [spider flower]
gb|KGN48820.1|  hypothetical protein Csa_6G502580                     98.6    4e-22   Cucumis sativus [cucumbers]
ref|XP_008440698.1|  PREDICTED: uncharacterized protein LOC103485038  98.6    4e-22   Cucumis melo [Oriental melon]
ref|XP_010444944.1|  PREDICTED: probable polyol transporter 6           103   5e-22   
ref|XP_007202654.1|  hypothetical protein PRUPE_ppa012270mg           98.2    6e-22   Prunus persica
ref|XP_010244287.1|  PREDICTED: uncharacterized protein LOC104588164  98.2    6e-22   Nelumbo nucifera [Indian lotus]
ref|XP_007046980.1|  Sugar transporter, putative                      97.8    1e-21   Theobroma cacao [chocolate]
ref|XP_009371570.1|  PREDICTED: uncharacterized protein LOC103960807  95.9    1e-21   
ref|XP_010558208.1|  PREDICTED: uncharacterized protein LOC104826929  97.1    2e-21   Tarenaya hassleriana [spider flower]
ref|XP_010936292.1|  PREDICTED: uncharacterized protein LOC105055...  95.9    4e-21   Elaeis guineensis
ref|XP_008790343.1|  PREDICTED: uncharacterized protein LOC103707...  95.9    5e-21   
ref|XP_004232390.1|  PREDICTED: uncharacterized protein LOC101253740  95.9    5e-21   Solanum lycopersicum
ref|XP_008352460.1|  PREDICTED: uncharacterized protein LOC103415959  95.5    5e-21   
gb|KCW67829.1|  hypothetical protein EUGRSUZ_F01557                   95.9    5e-21   Eucalyptus grandis [rose gum]
ref|XP_010936293.1|  PREDICTED: uncharacterized protein LOC105055...  95.9    5e-21   Elaeis guineensis
ref|XP_007156030.1|  hypothetical protein PHAVU_003G252600g           95.1    5e-21   Phaseolus vulgaris [French bean]
gb|AAG01119.1|AF273333_4  BAC19.4                                     95.9    5e-21   Solanum lycopersicum
ref|XP_010060934.1|  PREDICTED: uncharacterized protein LOC104448744  95.9    5e-21   Eucalyptus grandis [rose gum]
ref|XP_008790342.1|  PREDICTED: uncharacterized protein LOC103707...  95.5    6e-21   Phoenix dactylifera
ref|XP_004143580.1|  PREDICTED: probable polyol transporter 3-like    98.2    6e-21   
gb|KCW67828.1|  hypothetical protein EUGRSUZ_F01557                   95.9    6e-21   Eucalyptus grandis [rose gum]
ref|XP_010936399.1|  PREDICTED: uncharacterized protein LOC105056...  95.5    8e-21   Elaeis guineensis
ref|XP_008338119.1|  PREDICTED: uncharacterized protein LOC103401176  95.1    8e-21   Malus domestica [apple tree]
ref|XP_010649162.1|  PREDICTED: probable polyol transporter 6 iso...  97.8    8e-21   Vitis vinifera
ref|XP_010936400.1|  PREDICTED: uncharacterized protein LOC105056...  95.1    8e-21   Elaeis guineensis
ref|XP_009622062.1|  PREDICTED: uncharacterized protein LOC104113...  94.4    9e-21   
ref|XP_007156031.1|  hypothetical protein PHAVU_003G252600g           94.7    1e-20   Phaseolus vulgaris [French bean]
ref|XP_008362114.1|  PREDICTED: uncharacterized protein LOC103425793  94.7    1e-20   Malus domestica [apple tree]
ref|XP_009622061.1|  PREDICTED: uncharacterized protein LOC104113...  94.0    2e-20   Nicotiana tomentosiformis
ref|XP_007206057.1|  hypothetical protein PRUPE_ppa012645mg           93.6    2e-20   Prunus persica
ref|XP_002310215.2|  hypothetical protein POPTR_0007s12630g           93.6    2e-20   Populus trichocarpa [western balsam poplar]
gb|KJB43530.1|  hypothetical protein B456_007G204600                  93.6    3e-20   Gossypium raimondii
ref|XP_006383226.1|  hypothetical protein POPTR_0005s12660g           93.6    3e-20   
gb|KJB43531.1|  hypothetical protein B456_007G204600                  93.2    3e-20   Gossypium raimondii
ref|XP_010939259.1|  PREDICTED: uncharacterized protein LOC105058...  92.8    3e-20   Elaeis guineensis
ref|XP_010999974.1|  PREDICTED: uncharacterized protein LOC105107660  93.6    3e-20   Populus euphratica
ref|XP_010939258.1|  PREDICTED: uncharacterized protein LOC105058...  93.2    3e-20   
ref|XP_010106008.1|  hypothetical protein L484_021185                 92.8    4e-20   
ref|XP_010939257.1|  PREDICTED: uncharacterized protein LOC105058...  93.2    4e-20   Elaeis guineensis
gb|KJB43529.1|  hypothetical protein B456_007G204600                  92.8    4e-20   Gossypium raimondii
gb|KHN47872.1|  hypothetical protein glysoja_036616                   92.8    4e-20   Glycine soja [wild soybean]
gb|KHG25088.1|  Protein FAM75A4                                       93.2    5e-20   Gossypium arboreum [tree cotton]
ref|XP_008220784.1|  PREDICTED: uncharacterized protein LOC103320...  93.6    5e-20   Prunus mume [ume]
gb|KJB43527.1|  hypothetical protein B456_007G204600                  92.8    6e-20   Gossypium raimondii
gb|KJB43528.1|  hypothetical protein B456_007G204600                  92.8    6e-20   Gossypium raimondii
ref|XP_008220785.1|  PREDICTED: uncharacterized protein LOC103320...  92.8    7e-20   Prunus mume [ume]
ref|XP_007227275.1|  hypothetical protein PRUPE_ppa017694mg           91.3    7e-20   
ref|XP_010939255.1|  PREDICTED: uncharacterized protein LOC105058...  92.8    9e-20   Elaeis guineensis
ref|XP_010070047.1|  PREDICTED: uncharacterized protein LOC104456867  91.7    2e-19   Eucalyptus grandis [rose gum]
ref|XP_010680806.1|  PREDICTED: uncharacterized protein LOC104895866  91.7    2e-19   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB58298.1|  hypothetical protein B456_009G203200                  91.3    2e-19   Gossypium raimondii
ref|XP_010531025.1|  PREDICTED: uncharacterized protein LOC104807...  90.5    3e-19   Tarenaya hassleriana [spider flower]
dbj|BAA98184.1|  unnamed protein product                              90.5    3e-19   Arabidopsis thaliana [mouse-ear cress]
gb|ABC69762.1|  unknown                                               90.9    4e-19   Vitis pseudoreticulata
gb|KHF97827.1|  Serine--tRNA ligase                                   90.9    4e-19   Gossypium arboreum [tree cotton]
emb|CDP07532.1|  unnamed protein product                              90.9    4e-19   Coffea canephora [robusta coffee]
gb|KJB63685.1|  hypothetical protein B456_010G010700                  90.5    4e-19   Gossypium raimondii
ref|XP_002521583.1|  sugar transporter, putative                      92.8    5e-19   
ref|XP_009787249.1|  PREDICTED: uncharacterized protein LOC104235226  90.5    5e-19   Nicotiana sylvestris
ref|XP_010531023.1|  PREDICTED: uncharacterized protein LOC104807...  90.1    6e-19   Tarenaya hassleriana [spider flower]
gb|KDP27567.1|  hypothetical protein JCGZ_20030                       90.1    7e-19   Jatropha curcas
ref|XP_006593126.1|  PREDICTED: uncharacterized protein LOC100783879  93.6    7e-19   
ref|NP_569015.1|  uncharacterized protein                             90.1    8e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006393868.1|  hypothetical protein EUTSA_v10004972mg           90.1    8e-19   Eutrema salsugineum [saltwater cress]
ref|XP_008785651.1|  PREDICTED: uncharacterized protein LOC103704228  89.7    8e-19   Phoenix dactylifera
gb|KJB63684.1|  hypothetical protein B456_010G010700                  89.7    1e-18   Gossypium raimondii
ref|XP_011025752.1|  PREDICTED: uncharacterized protein LOC105126554  89.0    2e-18   Populus euphratica
ref|XP_002282877.1|  PREDICTED: uncharacterized protein LOC100264357  89.0    2e-18   Vitis vinifera
ref|XP_004234561.1|  PREDICTED: uncharacterized protein LOC101254...  89.0    2e-18   Solanum lycopersicum
ref|XP_002510368.1|  conserved hypothetical protein                   89.0    2e-18   Ricinus communis
gb|KFK28355.1|  hypothetical protein AALP_AA8G505100                  88.6    2e-18   Arabis alpina [alpine rockcress]
gb|EYU45139.1|  hypothetical protein MIMGU_mgv1a014622mg              88.6    2e-18   Erythranthe guttata [common monkey flower]
ref|XP_010464966.1|  PREDICTED: uncharacterized protein LOC104745426  88.6    3e-18   Camelina sativa [gold-of-pleasure]
emb|CDP02042.1|  unnamed protein product                              88.6    3e-18   Coffea canephora [robusta coffee]
gb|KHG00293.1|  Gamma-aminobutyric acid receptor alpha-like protein   88.6    4e-18   Gossypium arboreum [tree cotton]
ref|XP_009103491.1|  PREDICTED: uncharacterized protein LOC103829572  88.2    4e-18   Brassica rapa
gb|KHN00553.1|  hypothetical protein glysoja_000221                   87.8    5e-18   Glycine soja [wild soybean]
ref|XP_002864968.1|  hypothetical protein ARALYDRAFT_919901           87.8    5e-18   Arabidopsis lyrata subsp. lyrata
ref|XP_010444743.1|  PREDICTED: uncharacterized protein LOC104727358  87.4    7e-18   Camelina sativa [gold-of-pleasure]
ref|XP_011074529.1|  PREDICTED: uncharacterized protein LOC105159234  87.0    9e-18   Sesamum indicum [beniseed]
ref|XP_004291885.1|  PREDICTED: uncharacterized protein LOC101301938  87.4    9e-18   Fragaria vesca subsp. vesca
emb|CDY30757.1|  BnaC07g16570D                                        87.0    1e-17   Brassica napus [oilseed rape]
ref|XP_008357183.1|  PREDICTED: uncharacterized protein LOC103420925  84.7    6e-17   Malus domestica [apple tree]
emb|CDX72594.1|  BnaC07g46160D                                        88.6    6e-17   
ref|XP_009364539.1|  PREDICTED: uncharacterized protein LOC103954431  84.7    8e-17   Pyrus x bretschneideri [bai li]
ref|XP_006595581.1|  PREDICTED: uncharacterized protein LOC100803...  83.6    1e-16   
gb|AEI98625.1|  hypothetical protein 111O18.12                        84.3    1e-16   Coffea canephora [robusta coffee]
gb|KHN20989.1|  hypothetical protein glysoja_009297                   83.6    1e-16   Glycine soja [wild soybean]
ref|XP_010484713.1|  PREDICTED: uncharacterized protein LOC104762987  83.2    2e-16   Camelina sativa [gold-of-pleasure]
ref|XP_010484594.1|  PREDICTED: uncharacterized protein LOC104762894  83.6    2e-16   Camelina sativa [gold-of-pleasure]
ref|XP_009138437.1|  PREDICTED: uncharacterized protein LOC103862481  83.2    2e-16   Brassica rapa
ref|XP_002320589.2|  hypothetical protein POPTR_0014s17990g           82.4    4e-16   Populus trichocarpa [western balsam poplar]
ref|XP_004160032.1|  PREDICTED: uncharacterized protein LOC101224396  80.5    2e-15   
ref|XP_011012938.1|  PREDICTED: uncharacterized protein LOC105117091  80.5    2e-15   Populus euphratica
gb|KFK44072.1|  hypothetical protein AALP_AA1G212500                  79.0    5e-15   Arabis alpina [alpine rockcress]
ref|XP_008667655.1|  PREDICTED: uncharacterized protein LOC100276...  77.8    1e-14   
gb|ACG40814.1|  hypothetical protein                                  77.8    2e-14   Zea mays [maize]
ref|XP_002463166.1|  hypothetical protein SORBIDRAFT_02g038920        76.3    6e-14   Sorghum bicolor [broomcorn]
ref|XP_009627619.1|  PREDICTED: uncharacterized protein LOC104118...  75.9    1e-13   Nicotiana tomentosiformis
ref|XP_009627627.1|  PREDICTED: uncharacterized protein LOC104118...  75.5    1e-13   Nicotiana tomentosiformis
ref|XP_009627612.1|  PREDICTED: uncharacterized protein LOC104118...  75.9    1e-13   Nicotiana tomentosiformis
ref|XP_004152705.1|  PREDICTED: uncharacterized protein LOC101218892  75.1    2e-13   
ref|XP_009627606.1|  PREDICTED: uncharacterized protein LOC104118...  75.9    2e-13   Nicotiana tomentosiformis
ref|NP_173371.1|  uncharacterized protein                             74.3    2e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009396443.1|  PREDICTED: uncharacterized protein LOC103981440  74.3    3e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011083699.1|  PREDICTED: uncharacterized protein LOC105166154  73.9    5e-13   Sesamum indicum [beniseed]
ref|XP_006425705.1|  hypothetical protein CICLE_v10027139mg           72.8    7e-13   
gb|ABK27045.1|  unknown                                               72.8    9e-13   Picea sitchensis
gb|KEH36150.1|  transmembrane protein, putative                       72.0    2e-12   Medicago truncatula
ref|XP_007136586.1|  hypothetical protein PHAVU_009G057300g           71.6    2e-12   Phaseolus vulgaris [French bean]
gb|KEH36149.1|  transmembrane protein, putative                       71.6    3e-12   Medicago truncatula
ref|XP_009365595.1|  PREDICTED: uncharacterized protein LOC103955427  68.9    2e-11   Pyrus x bretschneideri [bai li]
gb|ACG31735.1|  hypothetical protein                                  68.2    6e-11   Zea mays [maize]
gb|EPS67837.1|  hypothetical protein M569_06941                       67.0    1e-10   Genlisea aurea
ref|NP_001237413.1|  uncharacterized protein LOC100500653             65.5    3e-10   Glycine max [soybeans]
gb|KHN45844.1|  hypothetical protein glysoja_023067                   64.7    5e-10   Glycine soja [wild soybean]
emb|CAN75408.1|  hypothetical protein VITISV_042285                   54.3    6e-10   Vitis vinifera
ref|XP_008444700.1|  PREDICTED: uncharacterized protein LOC103487960  64.7    6e-10   Cucumis melo [Oriental melon]
ref|XP_011097125.1|  PREDICTED: uncharacterized protein LOC105176117  64.3    9e-10   
ref|XP_009394309.1|  PREDICTED: uncharacterized protein LOC103979819  62.8    3e-09   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004958258.1|  PREDICTED: uncharacterized protein LOC101780353  61.6    7e-09   
ref|NP_001144135.1|  uncharacterized protein LOC100276984             61.6    7e-09   Zea mays [maize]
ref|NP_001143565.1|  uncharacterized protein LOC100276262             61.2    9e-09   
ref|XP_010529511.1|  PREDICTED: uncharacterized protein LOC104806349  60.8    1e-08   Tarenaya hassleriana [spider flower]
ref|XP_010498354.1|  PREDICTED: uncharacterized protein LOC104776052  60.5    1e-08   Camelina sativa [gold-of-pleasure]
gb|EYU40147.1|  hypothetical protein MIMGU_mgv1a015364mg              60.1    2e-08   Erythranthe guttata [common monkey flower]
ref|XP_004501128.1|  PREDICTED: uncharacterized protein LOC101512645  60.1    2e-08   Cicer arietinum [garbanzo]
dbj|BAK05463.1|  predicted protein                                    60.1    2e-08   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010477152.1|  PREDICTED: uncharacterized protein LOC104756282  59.7    3e-08   Camelina sativa [gold-of-pleasure]
gb|EMT24196.1|  hypothetical protein F775_30518                       60.1    3e-08   
ref|XP_006650190.1|  PREDICTED: uncharacterized protein LOC102720218  60.1    3e-08   Oryza brachyantha
ref|XP_006416510.1|  hypothetical protein EUTSA_v10008999mg           58.9    5e-08   Eutrema salsugineum [saltwater cress]
emb|CAN60001.1|  hypothetical protein VITISV_043637                   54.3    5e-08   Vitis vinifera
ref|XP_003570023.1|  PREDICTED: uncharacterized protein LOC100822234  58.9    7e-08   Brachypodium distachyon [annual false brome]
ref|NP_001281179.1|  uncharacterized protein LOC100276045             57.4    8e-08   
ref|XP_010459607.1|  PREDICTED: uncharacterized protein LOC104740635  57.0    3e-07   Camelina sativa [gold-of-pleasure]
ref|XP_002467700.1|  hypothetical protein SORBIDRAFT_01g032680        56.6    4e-07   Sorghum bicolor [broomcorn]
ref|XP_002890331.1|  hypothetical protein ARALYDRAFT_472165           55.8    6e-07   
ref|XP_006657943.1|  PREDICTED: uncharacterized protein LOC102708073  55.8    6e-07   Oryza brachyantha
ref|XP_006305739.1|  hypothetical protein CARUB_v10010542mg           53.9    3e-06   Capsella rubella
gb|KCW45824.1|  hypothetical protein EUGRSUZ_L00342                   52.4    3e-06   Eucalyptus grandis [rose gum]
ref|XP_010039660.1|  PREDICTED: uncharacterized protein LOC104428358  52.4    6e-06   Eucalyptus grandis [rose gum]
gb|EAZ04660.1|  hypothetical protein OsI_26812                        53.1    7e-06   Oryza sativa Indica Group [Indian rice]
ref|NP_001241923.1|  uncharacterized protein LOC100803339             52.0    9e-06   
gb|ACG48314.1|  hypothetical protein                                  50.8    1e-05   Zea mays [maize]
ref|NP_001060236.1|  Os07g0607500                                     52.0    2e-05   
ref|NP_001050350.1|  Os03g0411600                                     52.0    2e-05   
emb|CDX96663.1|  BnaA08g22060D                                        51.2    3e-05   
emb|CDX83766.1|  BnaC08g18790D                                        50.4    5e-05   
ref|XP_009110276.1|  PREDICTED: uncharacterized protein LOC103835844  50.1    6e-05   Brassica rapa
ref|XP_010317714.1|  PREDICTED: uncharacterized protein LOC101254...  50.4    6e-05   Solanum lycopersicum
gb|EPS71215.1|  hypothetical protein M569_03548                       48.1    2e-04   Genlisea aurea
ref|XP_004984041.1|  PREDICTED: uncharacterized protein LOC101766...  48.5    4e-04   Setaria italica
gb|EMT26061.1|  hypothetical protein F775_27408                       47.4    5e-04   



>ref|XP_009613542.1| PREDICTED: uncharacterized protein LOC104106659 [Nicotiana tomentosiformis]
Length=198

 Score =   126 bits (317),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 84/143 (59%), Positives = 102/143 (71%), Gaps = 30/143 (21%)
 Frame = +2

Query  173  YEEMKDEEAQV--ITS-----------------AGKKEHGSDGGHGLFGRGKYKLWVILA  295
            Y+EMKDEEA+   IT+                 +GKKE    G +GL G+GKYKLWV+ A
Sbjct  4    YQEMKDEEARTRSITTNTVTPAAVSVVVAPAAASGKKE----GCNGLLGKGKYKLWVLAA  59

Query  296  ILLLAFWSMFTGSLTLSLN-------RVSDSSGFPLHddldvleveekekvvRQMWDVYT  454
            ILLLAFWSMFTGSLTLSLN       R+SD+S F +HDDLD+LE+EEKE++V+ MWDVYT
Sbjct  60   ILLLAFWSMFTGSLTLSLNWSAANLSRLSDASDFSIHDDLDILELEEKERMVKHMWDVYT  119

Query  455  QSRSSRLPKFWQEAFEAAYEEMT  523
            QS   RLPKFWQEAF+AAY ++T
Sbjct  120  QSSRIRLPKFWQEAFQAAYLDLT  142



>ref|XP_009759556.1| PREDICTED: uncharacterized protein LOC104212073 [Nicotiana sylvestris]
Length=199

 Score =   125 bits (315),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 84/144 (58%), Positives = 102/144 (71%), Gaps = 31/144 (22%)
 Frame = +2

Query  173  YEEMKDEEAQV--ITS------------------AGKKEHGSDGGHGLFGRGKYKLWVIL  292
            Y+EMK+EEAQ   IT+                  +GKKE    G +GL G+GKYKLWV+ 
Sbjct  4    YQEMKEEEAQTRSITTYTVTPTAASVAVAAAAAASGKKE----GCNGLLGKGKYKLWVLA  59

Query  293  AILLLAFWSMFTGSLTLSLN-------RVSDSSGFPLHddldvleveekekvvRQMWDVY  451
            AILLLAFWSMFTGSLTLSLN       R+SD+S F +HDDLD+LE+EEKE++V+ MWDVY
Sbjct  60   AILLLAFWSMFTGSLTLSLNWSAANLSRLSDASDFSIHDDLDILELEEKERMVKHMWDVY  119

Query  452  TQSRSSRLPKFWQEAFEAAYEEMT  523
            TQS   RLPKFWQEAF+AAY ++T
Sbjct  120  TQSSRIRLPKFWQEAFQAAYLDLT  143



>gb|KJB17803.1| hypothetical protein B456_003G015900 [Gossypium raimondii]
 gb|KJB17804.1| hypothetical protein B456_003G015900 [Gossypium raimondii]
Length=171

 Score =   120 bits (301),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 87/119 (73%), Gaps = 5/119 (4%)
 Frame = +2

Query  182  MKDEEAQVITSAGKKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL-----S  346
            MKD++    T+A            LFGRG+YK W   AILLLAFWSMFTG++TL     +
Sbjct  1    MKDDDTLPTTTATANLKKESSDSCLFGRGRYKFWAFAAILLLAFWSMFTGTVTLRWSAGN  60

Query  347  LNRVSDSSGFPLHddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
            LNR+SD  G P+HDDLDVLE+EE+EKVV+ MWDVYT SR  RLP+FWQEAFEAAYEE+T
Sbjct  61   LNRLSDDIGSPIHDDLDVLEMEEREKVVKHMWDVYTNSRRIRLPRFWQEAFEAAYEELT  119



>gb|KHG24772.1| Aldehyde dehydrogenase [Gossypium arboreum]
Length=171

 Score =   120 bits (300),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 87/119 (73%), Gaps = 5/119 (4%)
 Frame = +2

Query  182  MKDEEAQVITSAGKKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL-----S  346
            MKD++    T+A            LFGRG+YK W   AILLLAFWSMFTG++TL     +
Sbjct  1    MKDDDTLPTTTATANLKKESSDSCLFGRGRYKFWAFAAILLLAFWSMFTGTVTLRWSAGN  60

Query  347  LNRVSDSSGFPLHddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
            LNR+SD  G P+HDDLDVLE+EE+EKVV+ MWDVYT SR  RLP+FWQEAFEAAYEE+T
Sbjct  61   LNRLSDDIGSPVHDDLDVLEMEEREKVVKHMWDVYTNSRRIRLPRFWQEAFEAAYEELT  119



>ref|XP_006341924.1| PREDICTED: uncharacterized protein LOC102585551 [Solanum tuberosum]
Length=202

 Score =   120 bits (300),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 78/145 (54%), Positives = 97/145 (67%), Gaps = 31/145 (21%)
 Frame = +2

Query  173  YEEMKDEEAQ---------------------VITSAGKKEHGSDGGHGLFGRGKYKLWVI  289
            Y+EMKDEEAQ                       TS  KK+ G     G+FG+GKYKLWV+
Sbjct  4    YQEMKDEEAQSRISTNTVTTVSSVSVVATPAAATSTVKKDQG---FSGVFGKGKYKLWVL  60

Query  290  LAILLLAFWSMFTGSLTLSLN-------RVSDSSGFPLHddldvleveekekvvRQMWDV  448
             AILLLAFWSMFTGSLTLSLN       R+S +S F +H+DLD+L +EE+EK+V+ MWDV
Sbjct  61   AAILLLAFWSMFTGSLTLSLNWSTSNLSRLSHASDFTIHEDLDILVLEEREKMVKHMWDV  120

Query  449  YTQSRSSRLPKFWQEAFEAAYEEMT  523
            YTQ+   RLPKFWQ+AF+AAY ++T
Sbjct  121  YTQNSRIRLPKFWQDAFQAAYLDLT  145



>ref|XP_010254892.1| PREDICTED: uncharacterized protein LOC104595729 [Nelumbo nucifera]
 ref|XP_010254893.1| PREDICTED: uncharacterized protein LOC104595729 [Nelumbo nucifera]
Length=174

 Score =   118 bits (296),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 91/119 (76%), Gaps = 8/119 (7%)
 Frame = +2

Query  182  MKDEEAQVITSAGKKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL-----S  346
            MKD+ A   T + KKE  S G   LFG+G+YK W + AI+LLAFWSMFTG++TL     +
Sbjct  1    MKDDVAP--TPSSKKESSS-GDGSLFGKGRYKFWALAAIILLAFWSMFTGTVTLKWSAGN  57

Query  347  LNRVSDSSGFPLHddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
            LNR+SD    P+HDDLDVLE+EE+EKVVR MWDVYT SR  RLP+FWQEAFEAAYE++T
Sbjct  58   LNRLSDDLDTPIHDDLDVLEIEEREKVVRHMWDVYTHSRRIRLPRFWQEAFEAAYEDLT  116



>ref|XP_004238248.1| PREDICTED: uncharacterized protein LOC101256584 [Solanum lycopersicum]
Length=204

 Score =   117 bits (293),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 75/144 (52%), Positives = 93/144 (65%), Gaps = 27/144 (19%)
 Frame = +2

Query  173  YEEMKDEEAQVITSAG--------------------KKEHGSDGGHGLFGRGKYKLWVIL  292
            Y+EMKDEEAQ   S                             G  G+FG+GKYKLWV+ 
Sbjct  4    YQEMKDEEAQSRISTNTVTTVSSVSAVATPAAAAATSTVKKDQGFSGVFGKGKYKLWVLA  63

Query  293  AILLLAFWSMFTGSLTLSLN-------RVSDSSGFPLHddldvleveekekvvRQMWDVY  451
            AILLLAFWSMFTGSLTLSLN       R+S +S F +H+DLD+L +EE+EK+V+ MWDVY
Sbjct  64   AILLLAFWSMFTGSLTLSLNWSTSNLSRLSHASDFTIHEDLDILVLEEREKMVKHMWDVY  123

Query  452  TQSRSSRLPKFWQEAFEAAYEEMT  523
            TQ+   RLPKFWQ+AF+AAY ++T
Sbjct  124  TQNSRIRLPKFWQDAFQAAYLDLT  147



>gb|KJB17802.1| hypothetical protein B456_003G015900 [Gossypium raimondii]
Length=168

 Score =   116 bits (290),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 82/119 (69%), Gaps = 8/119 (7%)
 Frame = +2

Query  182  MKDEEAQVITSAGKKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL-----S  346
            MKD++    T+A            LFGRG+YK W   AILLLAFWSMFTG++TL     +
Sbjct  1    MKDDDTLPTTTATANLKKESSDSCLFGRGRYKFWAFAAILLLAFWSMFTGTVTLRWSAGN  60

Query  347  LNRVSDSSGFPLHddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
            LNR+SD  G P+H   D L+V E+EKVV+ MWDVYT SR  RLP+FWQEAFEAAYEE+T
Sbjct  61   LNRLSDDIGSPIH---DDLDVLEREKVVKHMWDVYTNSRRIRLPRFWQEAFEAAYEELT  116



>ref|XP_007156925.1| hypothetical protein PHAVU_002G028800g [Phaseolus vulgaris]
 gb|ESW28919.1| hypothetical protein PHAVU_002G028800g [Phaseolus vulgaris]
Length=172

 Score =   108 bits (270),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 91/118 (77%), Gaps = 6/118 (5%)
 Frame = +2

Query  182  MKDEEAQVITSAGKKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL----SL  349
            MKDEE    T+AG K+   D G  LFG+GKYK W + AILLLAFWSMFTG+++L    +L
Sbjct  1    MKDEEGLPTTTAGAKKEPLDSG--LFGKGKYKFWALAAILLLAFWSMFTGTVSLRWSGTL  58

Query  350  NRVSDSSGFPLHddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
            N +S+    P+HDDLDVLE+EE+EKVVR MWDVYT SR  RLPKFWQEAFEAAYE++T
Sbjct  59   NSLSNDMDSPIHDDLDVLEMEEREKVVRHMWDVYTNSRRIRLPKFWQEAFEAAYEDLT  116



>gb|KFK30286.1| hypothetical protein AALP_AA7G241900 [Arabis alpina]
Length=180

 Score =   107 bits (268),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 66/112 (59%), Positives = 85/112 (76%), Gaps = 8/112 (7%)
 Frame = +2

Query  203  VITSAGKKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL-----SLNRVSDS  367
             +T+  KKE+ SD    LFGRG+YK W   AILLLAFWSMFTG++TL     +LNR+++ 
Sbjct  20   TVTANSKKEN-SDSS--LFGRGRYKFWAFAAILLLAFWSMFTGTVTLRLSDGNLNRLAED  76

Query  368  SGFPLHddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
             G P +++LD LE+EE+EKVV+ MWDVYT +R  +LPKFWQEAF AAYEE+T
Sbjct  77   LGIPNYENLDALEMEEREKVVKHMWDVYTNTRRIKLPKFWQEAFVAAYEELT  128



>ref|XP_006282502.1| hypothetical protein CARUB_v10006860mg [Capsella rubella]
 gb|EOA15400.1| hypothetical protein CARUB_v10006860mg [Capsella rubella]
Length=177

 Score =   107 bits (267),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 82/108 (76%), Gaps = 7/108 (6%)
 Frame = +2

Query  215  AGKKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL-----SLNRVSDSSGFP  379
            A  K+  SD    LFGRG+YK W   AILLLAFWSMFTG++TL     +LNR S+  G P
Sbjct  21   ANSKKDSSDSI--LFGRGRYKFWAFAAILLLAFWSMFTGTVTLRLSTGNLNRFSEDLGIP  78

Query  380  LHddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
            ++D+LDVLE+EE+EKVV+ MWDVYT SR  +LP+FWQEAF AAYEE+T
Sbjct  79   IYDNLDVLEMEEREKVVKHMWDVYTNSRRIKLPRFWQEAFVAAYEELT  126



>emb|CAB16809.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB80332.1| hypothetical protein [Arabidopsis thaliana]
Length=159

 Score =   106 bits (265),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 82/108 (76%), Gaps = 7/108 (6%)
 Frame = +2

Query  215  AGKKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL-----SLNRVSDSSGFP  379
            A  K+  SD    LFGRG+YK W   AILLLAFWSMFTG++TL     +LNR+S+  G P
Sbjct  22   ANSKKESSDSV--LFGRGRYKFWAFAAILLLAFWSMFTGTVTLRLSTGNLNRLSEDLGIP  79

Query  380  LHddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
             +D+LDVLE+EE+EKVV+ MWDVYT SR  +LP+FWQEAF AAYEE+T
Sbjct  80   NYDNLDVLEMEEREKVVKHMWDVYTNSRRIKLPRFWQEAFVAAYEELT  127



>ref|XP_002867000.1| At4g36660 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43259.1| At4g36660 [Arabidopsis lyrata subsp. lyrata]
Length=178

 Score =   107 bits (266),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 66/108 (61%), Positives = 81/108 (75%), Gaps = 7/108 (6%)
 Frame = +2

Query  215  AGKKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL-----SLNRVSDSSGFP  379
            A  K+  SD    LFGRG+YK W   AILLLAFWSMFTG++TL     +LNR+S+  G P
Sbjct  21   ANSKKENSDSV--LFGRGRYKFWAFAAILLLAFWSMFTGTVTLRLSTGNLNRLSEDLGIP  78

Query  380  LHddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
             + +LDVLE+EE+EKVV+ MWDVYT SR  +LP+FWQEAF AAYEE+T
Sbjct  79   NYANLDVLEMEEREKVVKHMWDVYTSSRRIKLPRFWQEAFVAAYEELT  126



>dbj|BAH30560.1| hypothetical protein [Arabidopsis thaliana]
Length=167

 Score =   106 bits (264),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 82/108 (76%), Gaps = 7/108 (6%)
 Frame = +2

Query  215  AGKKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL-----SLNRVSDSSGFP  379
            A  K+  SD    LFGRG+YK W   AILLLAFWSMFTG++TL     +LNR+S+  G P
Sbjct  22   ANSKKESSDSV--LFGRGRYKFWAFAAILLLAFWSMFTGTVTLRLSTGNLNRLSEDLGIP  79

Query  380  LHddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
             +D+LDVLE+EE+EKVV+ MWDVYT SR  +LP+FWQEAF AAYEE+T
Sbjct  80   NYDNLDVLEMEEREKVVKHMWDVYTNSRRIKLPRFWQEAFVAAYEELT  127



>ref|XP_006411975.1| hypothetical protein EUTSA_v10026362mg [Eutrema salsugineum]
 gb|ESQ53428.1| hypothetical protein EUTSA_v10026362mg [Eutrema salsugineum]
Length=179

 Score =   106 bits (265),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 66/108 (61%), Positives = 81/108 (75%), Gaps = 7/108 (6%)
 Frame = +2

Query  215  AGKKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL-----SLNRVSDSSGFP  379
            A  K+  SD    LFGRG+YK W   AILLLAFWSMFTG++TL     +LNR+SD  GF 
Sbjct  22   ANSKKDNSDSA--LFGRGRYKFWAFAAILLLAFWSMFTGTVTLRLSTGNLNRLSDDRGFT  79

Query  380  LHddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
             +++LDVLE+EE+EKVV+ MWDVYT S   +LP+FWQEAF AAYEE+T
Sbjct  80   NYENLDVLEMEEREKVVKHMWDVYTNSHRIKLPRFWQEAFVAAYEELT  127



>ref|NP_195384.5| uncharacterized protein [Arabidopsis thaliana]
 gb|AAS76222.1| At4g36660 [Arabidopsis thaliana]
 gb|AAS76688.1| At4g36660 [Arabidopsis thaliana]
 gb|AEE86684.1| uncharacterized protein AT4G36660 [Arabidopsis thaliana]
Length=179

 Score =   106 bits (265),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 82/108 (76%), Gaps = 7/108 (6%)
 Frame = +2

Query  215  AGKKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL-----SLNRVSDSSGFP  379
            A  K+  SD    LFGRG+YK W   AILLLAFWSMFTG++TL     +LNR+S+  G P
Sbjct  22   ANSKKESSDSV--LFGRGRYKFWAFAAILLLAFWSMFTGTVTLRLSTGNLNRLSEDLGIP  79

Query  380  LHddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
             +D+LDVLE+EE+EKVV+ MWDVYT SR  +LP+FWQEAF AAYEE+T
Sbjct  80   NYDNLDVLEMEEREKVVKHMWDVYTNSRRIKLPRFWQEAFVAAYEELT  127



>ref|XP_006466773.1| PREDICTED: uncharacterized protein LOC102620496 isoform X2 [Citrus 
sinensis]
Length=144

 Score =   103 bits (258),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 88/119 (74%), Gaps = 5/119 (4%)
 Frame = +2

Query  182  MKDEEAQVITSAGKKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL-----S  346
            MKD+E+   T+             +FG+G+YK W + AILLLAFWSMFTG++TL     +
Sbjct  1    MKDDESVPTTTTLNVTKKESSDSSIFGKGRYKFWALAAILLLAFWSMFTGTVTLRWSAGN  60

Query  347  LNRVSDSSGFPLHddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
            LNR+SD  G P+HDDLDVLE+EE+EKVV+ MWDVYT SR  RLP+FWQEAFEAAYEE++
Sbjct  61   LNRLSDDLGSPIHDDLDVLEMEEREKVVKHMWDVYTNSRRIRLPRFWQEAFEAAYEELS  119



>ref|XP_009625643.1| PREDICTED: uncharacterized protein LOC104116484 [Nicotiana tomentosiformis]
Length=182

 Score =   105 bits (261),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 76/96 (79%), Gaps = 5/96 (5%)
 Frame = +2

Query  251  GLFGRGKYKLWVILAILLLAFWSMFTGSLTL-----SLNRVSDSSGFPLHddldvlevee  415
             +FGRG+YK W   AILLLAFWSM TG++TL     +LN +SD+   PL +DLDVLE+EE
Sbjct  33   AIFGRGRYKFWAFAAILLLAFWSMLTGTVTLRWSAGNLNAISDNIDIPLPEDLDVLEMEE  92

Query  416  kekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
            +EK+V+ MWDVYT SR  ++PKFWQEAFEAAYEE+T
Sbjct  93   REKLVKHMWDVYTNSRGIKMPKFWQEAFEAAYEELT  128



>ref|XP_010432152.1| PREDICTED: uncharacterized protein LOC104716471 [Camelina sativa]
Length=179

 Score =   104 bits (259),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 81/108 (75%), Gaps = 7/108 (6%)
 Frame = +2

Query  215  AGKKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL-----SLNRVSDSSGFP  379
            A  K+  SD    LFGRG+YK W   AILLLAFWSMFTG++TL     +LNR S+  G P
Sbjct  22   ANSKKENSDSI--LFGRGRYKFWAFGAILLLAFWSMFTGTVTLRLTTGNLNRFSEDLGIP  79

Query  380  LHddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
             +D+LDVLE+EE+EKVV+ MWDVYT SR  +LP+FWQEAF AAYEE+T
Sbjct  80   NYDNLDVLEMEEREKVVKHMWDVYTSSRRIKLPRFWQEAFVAAYEELT  127



>ref|XP_009791325.1| PREDICTED: uncharacterized protein LOC104238615 [Nicotiana sylvestris]
Length=182

 Score =   103 bits (258),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 60/96 (63%), Positives = 74/96 (77%), Gaps = 5/96 (5%)
 Frame = +2

Query  251  GLFGRGKYKLWVILAILLLAFWSMFTGSLTL-----SLNRVSDSSGFPLHddldvlevee  415
             +FGRG YK W   AILLLAFWSM TG++TL     +LN +SD+   PL +DLDVL +EE
Sbjct  33   AIFGRGSYKFWAFAAILLLAFWSMLTGTVTLRWSAGNLNAISDNIDIPLPEDLDVLAMEE  92

Query  416  kekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
            +EK+V+ MWDVYT SR  ++PKFWQEAFEAAYEE+T
Sbjct  93   REKLVKHMWDVYTNSRGIKMPKFWQEAFEAAYEELT  128



>emb|CDX75587.1| BnaA01g01150D [Brassica napus]
Length=169

 Score =   103 bits (257),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 64/120 (53%), Positives = 87/120 (73%), Gaps = 8/120 (7%)
 Frame = +2

Query  182  MKDEEAQVITSAGKKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL-----S  346
            MK+++     +A +K+  SD    LFGRG+YK +   A++LLAFWSMFTG++TL      
Sbjct  1    MKEDDVLPAATANQKKDSSDSV--LFGRGRYKFFAFAALMLLAFWSMFTGTVTLRLSTED  58

Query  347  LNRVSDSSGFPL-HddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
            LNR+S+  G P  H+ LDVLE+EE+E+VV+ MWDVYT SR  +LP+FWQ+AF AAYEE+T
Sbjct  59   LNRLSEDIGIPTNHESLDVLEMEERERVVKHMWDVYTNSRRIKLPQFWQQAFVAAYEELT  118



>ref|XP_009142898.1| PREDICTED: uncharacterized protein LOC103866654 [Brassica rapa]
Length=172

 Score =   103 bits (257),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 87/120 (73%), Gaps = 8/120 (7%)
 Frame = +2

Query  182  MKDEEAQVITSAGKKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL-----S  346
            MK+++     +A +K+  SD    LFGRG+YK +   A++LLAFWSMFTG++TL      
Sbjct  1    MKEDDVLPAATANQKKDSSDSV--LFGRGRYKFFAFAALMLLAFWSMFTGTVTLRLSTED  58

Query  347  LNRVSDSSGFPL-HddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
            LNR+S+  G P  H+ LDVLE+EE+EKVV+ MWDVYT SR  +LP+FWQ+AF AAYEE+T
Sbjct  59   LNRLSEDIGIPTNHESLDVLEMEEREKVVKHMWDVYTNSRRIKLPQFWQQAFVAAYEELT  118



>ref|XP_006466772.1| PREDICTED: uncharacterized protein LOC102620496 isoform X1 [Citrus 
sinensis]
Length=177

 Score =   103 bits (257),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 88/119 (74%), Gaps = 5/119 (4%)
 Frame = +2

Query  182  MKDEEAQVITSAGKKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL-----S  346
            MKD+E+   T+             +FG+G+YK W + AILLLAFWSMFTG++TL     +
Sbjct  1    MKDDESVPTTTTLNVTKKESSDSSIFGKGRYKFWALAAILLLAFWSMFTGTVTLRWSAGN  60

Query  347  LNRVSDSSGFPLHddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
            LNR+SD  G P+HDDLDVLE+EE+EKVV+ MWDVYT SR  RLP+FWQEAFEAAYEE++
Sbjct  61   LNRLSDDLGSPIHDDLDVLEMEEREKVVKHMWDVYTNSRRIRLPRFWQEAFEAAYEELS  119



>gb|KHN41992.1| hypothetical protein glysoja_003732 [Glycine soja]
Length=172

 Score =   103 bits (256),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 90/118 (76%), Gaps = 6/118 (5%)
 Frame = +2

Query  182  MKDEEAQVITSAGKKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL----SL  349
            MKDE+    T+A  K+   D    LFG+G+YK W + AILLLAFWSMFTG+++L    +L
Sbjct  1    MKDEDGLPTTTAVTKKENLDSS--LFGKGRYKFWALAAILLLAFWSMFTGTVSLRWSGTL  58

Query  350  NRVSDSSGFPLHddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
            N +S+    P+HDDLDVLE+EE+EKVVR MWDVYT SRS RLP+FWQEAFEAAYE++T
Sbjct  59   NSLSNDIDTPIHDDLDVLEMEEREKVVRHMWDVYTNSRSVRLPRFWQEAFEAAYEDLT  116



>ref|XP_006590683.1| PREDICTED: uncharacterized protein LOC100787922 [Glycine max]
Length=172

 Score =   103 bits (256),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 90/118 (76%), Gaps = 6/118 (5%)
 Frame = +2

Query  182  MKDEEAQVITSAGKKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL----SL  349
            MKDE+    T+A  K+   D    LFG+G+YK W + AILLLAFWSMFTG+++L    +L
Sbjct  1    MKDEDGLPTTTAVTKKENLDSS--LFGKGRYKFWALAAILLLAFWSMFTGTVSLRWSGTL  58

Query  350  NRVSDSSGFPLHddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
            N +S+    P+HDDLDVLE+EE+EKVVR MWDVYT SRS RLP+FWQEAFEAAYE++T
Sbjct  59   NSLSNDIDTPIHDDLDVLEMEEREKVVRHMWDVYTNSRSVRLPRFWQEAFEAAYEDLT  116



>gb|ACU23828.1| unknown [Glycine max]
Length=168

 Score =   103 bits (256),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 90/118 (76%), Gaps = 6/118 (5%)
 Frame = +2

Query  182  MKDEEAQVITSAGKKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL----SL  349
            MKDE+    T+A  K+   D    LFG+G+YK W + AILLLAFWSMFTG+++L    +L
Sbjct  1    MKDEDGLPTTTAVTKKENLDSS--LFGKGRYKFWALAAILLLAFWSMFTGTVSLRWSGTL  58

Query  350  NRVSDSSGFPLHddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
            N +S+    P+HDDLDVLE+EE+EKVVR MWDVYT SRS RLP+FWQEAFEAAYE++T
Sbjct  59   NSLSNDIDTPIHDDLDVLEMEEREKVVRHMWDVYTNSRSVRLPRFWQEAFEAAYEDLT  116



>gb|KDP38489.1| hypothetical protein JCGZ_04414 [Jatropha curcas]
Length=181

 Score =   103 bits (257),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 85/107 (79%), Gaps = 9/107 (8%)
 Frame = +2

Query  218  GKKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL-----SLNRVSDSSGFPL  382
            GKK+ GSDGG  LFG+ +YK WV+ AILLLAFWSMFTGS+TL     + +R++D    P+
Sbjct  24   GKKD-GSDGG--LFGKVRYKFWVLAAILLLAFWSMFTGSVTLKWSTGNFSRLADDLDLPI  80

Query  383  Hddl-dvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEM  520
            HDD  D+LEVEEKEKVVRQMW++YT   +++LP+FWQEAFEAAYE +
Sbjct  81   HDDDLDILEVEEKEKVVRQMWNIYTHGSTTKLPRFWQEAFEAAYEAL  127



>gb|KDO79509.1| hypothetical protein CISIN_1g0391382mg, partial [Citrus sinensis]
Length=152

 Score =   102 bits (254),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 87/119 (73%), Gaps = 5/119 (4%)
 Frame = +2

Query  182  MKDEEAQVITSAGKKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL-----S  346
            MKD+E+   T+              FG+G+YK W + AILLLAFWSMFTG++TL     +
Sbjct  1    MKDDESLPTTTTLNVTKKESSDSSAFGKGRYKFWALAAILLLAFWSMFTGTVTLRWSAGN  60

Query  347  LNRVSDSSGFPLHddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
            LNR+SD  G P+HDDLDVLE+EE+EKVV+ MWDVYT SR  RLP+FWQEAFEAAYEE++
Sbjct  61   LNRLSDDLGSPIHDDLDVLEMEEREKVVKHMWDVYTNSRRIRLPRFWQEAFEAAYEELS  119



>ref|XP_004512021.1| PREDICTED: uncharacterized protein LOC101494863 [Cicer arietinum]
Length=172

 Score =   102 bits (255),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 89/118 (75%), Gaps = 6/118 (5%)
 Frame = +2

Query  182  MKDEEAQVITSAGKKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL----SL  349
            MKD++A   T+   K+   D    LFG+G+YK W + AILLLAFWSMFTG+++L    +L
Sbjct  1    MKDDDALPTTATSNKKENMDSS--LFGKGRYKFWALAAILLLAFWSMFTGTVSLRWSGNL  58

Query  350  NRVSDSSGFPLHddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
            N +S+    P+HDDLDVLE+EE+EKVVR MWDVYT SR  RLP+FWQEAFEAAYEE+T
Sbjct  59   NSLSNDLDTPIHDDLDVLEMEEREKVVRHMWDVYTNSRRIRLPRFWQEAFEAAYEELT  116



>ref|XP_010446762.1| PREDICTED: uncharacterized protein LOC104729514 [Camelina sativa]
Length=180

 Score =   102 bits (254),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 66/108 (61%), Positives = 80/108 (74%), Gaps = 7/108 (6%)
 Frame = +2

Query  215  AGKKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL-----SLNRVSDSSGFP  379
            A  K+  SD    LFGRG+YK W   AILLLAFWSMFTG++TL     +LNR S+  G P
Sbjct  23   ANSKKENSDSI--LFGRGRYKFWAFGAILLLAFWSMFTGTVTLRLTTGNLNRFSEDLGIP  80

Query  380  LHddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
             +D+LDVLE+EE+EKVV+ MWD YT SR  +LP+FWQEAF AAYEE+T
Sbjct  81   NYDNLDVLEMEEREKVVKHMWDAYTSSRRIKLPRFWQEAFVAAYEELT  128



>gb|ABU45202.1| unknown [Solanum bulbocastanum]
Length=186

 Score =   102 bits (253),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 82/124 (66%), Gaps = 10/124 (8%)
 Frame = +2

Query  182  MKDEEAQVITSAGKKEHGSDGGH-----GLFGRGKYKLWVILAILLLAFWSMFTGSLTL-  343
            MKD++  + T        +          +FGRG+YK W   AILLLAFWSM TG++TL 
Sbjct  1    MKDDDLPISTPTAPSSSFTTSKKETSYSAIFGRGRYKFWAFTAILLLAFWSMLTGTVTLR  60

Query  344  ----SLNRVSDSSGFPLHddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAY  511
                +LN +SD    PL +DLDVLE+EE+EK+V+ MWDVYT SR  +L KFWQEAFEAAY
Sbjct  61   WSAGNLNAISDDIDIPLPEDLDVLEMEEREKLVKHMWDVYTNSRGIKLRKFWQEAFEAAY  120

Query  512  EEMT  523
            EE+T
Sbjct  121  EELT  124



>ref|XP_009402023.1| PREDICTED: uncharacterized protein LOC103985884 [Musa acuminata 
subsp. malaccensis]
Length=185

 Score =   102 bits (253),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 77/111 (69%), Gaps = 7/111 (6%)
 Frame = +2

Query  206  ITSAGKKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL-----SLNRVSDSS  370
            + SA +    +D G  LFG+G+YK W + AILLLAFWSM TG++TL      LNR+    
Sbjct  17   VASAIRVSSAADAG--LFGKGRYKFWALTAILLLAFWSMVTGTVTLRWSAGDLNRLDRDL  74

Query  371  GFPLHddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
              P+H DLD LE+EE+EKVVR MWDVY  +   RLP+FWQEAFEAAYEE+ 
Sbjct  75   NAPIHSDLDALEMEEREKVVRHMWDVYAHNHRIRLPRFWQEAFEAAYEELA  125



>ref|XP_006573579.1| PREDICTED: uncharacterized protein LOC100800366 [Glycine max]
 gb|KHN36115.1| hypothetical protein glysoja_003238 [Glycine soja]
Length=167

 Score =   100 bits (250),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 88/118 (75%), Gaps = 7/118 (6%)
 Frame = +2

Query  182  MKDEEAQVITSAGKKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL----SL  349
            MKDE+    T+A KKE        LFG+G+YK W + AILLLAFWSMFTG+++L    +L
Sbjct  1    MKDEDGLPTTAATKKESM---DSSLFGKGRYKFWALAAILLLAFWSMFTGTVSLRWSGTL  57

Query  350  NRVSDSSGFPLHddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
            N +S     P+HDDLDVLE+EE+EKVVR MWDVYT SR  RLP+FWQEAFEAAYE++T
Sbjct  58   NSLSSDIDTPIHDDLDVLEMEEREKVVRHMWDVYTNSRRVRLPRFWQEAFEAAYEDLT  115



>ref|XP_006340593.1| PREDICTED: uncharacterized protein LOC102599104 [Solanum tuberosum]
Length=178

 Score =   101 bits (251),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 82/124 (66%), Gaps = 10/124 (8%)
 Frame = +2

Query  182  MKDEEAQVITSAGKKEHGSDGGH-----GLFGRGKYKLWVILAILLLAFWSMFTGSLTL-  343
            MKD++  + T        +          +FGRG+YK W   AILLLAFWSM TG++TL 
Sbjct  1    MKDDDLPISTPTAPSSSFTTSKKETSYSAIFGRGRYKFWAFTAILLLAFWSMLTGTVTLR  60

Query  344  ----SLNRVSDSSGFPLHddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAY  511
                +LN +SD    PL +DLDVLE+EE+EK+V+ MWDVYT SR  +L KFWQEAFEAAY
Sbjct  61   WSAGNLNAISDDIDIPLPEDLDVLEMEEREKLVKHMWDVYTNSRGIKLLKFWQEAFEAAY  120

Query  512  EEMT  523
            EE+T
Sbjct  121  EELT  124



>ref|XP_007017505.1| Sugar transporter, putative isoform 2, partial [Theobroma cacao]
 gb|EOY14730.1| Sugar transporter, putative isoform 2, partial [Theobroma cacao]
Length=170

 Score =   101 bits (251),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 69/113 (61%), Positives = 82/113 (73%), Gaps = 7/113 (6%)
 Frame = +2

Query  200  QVITSAGKKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL-----SLNRVSD  364
            Q  T+   K+H S  G   FG+  YK WV+ AILLLAFWSMFTGS++L      L R SD
Sbjct  17   QQQTTGSAKKHSSVAG--FFGKSGYKFWVLAAILLLAFWSMFTGSVSLKWSSGDLTRFSD  74

Query  365  SSGFPLHddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
             S F +HDDLDVLE+EE+EKVVR+MW+VYT S S RLPKFW EAFEAAYE ++
Sbjct  75   DSEFSVHDDLDVLELEEREKVVRKMWNVYTHSASLRLPKFWLEAFEAAYEYLS  127



>gb|ABU45182.1| unknown [Capsicum frutescens]
Length=195

 Score =   101 bits (252),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 60/96 (63%), Positives = 74/96 (77%), Gaps = 5/96 (5%)
 Frame = +2

Query  251  GLFGRGKYKLWVILAILLLAFWSMFTGSLTL-----SLNRVSDSSGFPLHddldvlevee  415
             +FGR +YK W   AILLLAFWSM TG++TL     +LN +SD    PL +DLDVLE+EE
Sbjct  38   AIFGRDRYKFWAFAAILLLAFWSMLTGTVTLRWSAGNLNAISDDIDIPLPEDLDVLEMEE  97

Query  416  kekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
            +EK+V+ MWDVYT SR  +LPKFWQ+AFEAAYEE+T
Sbjct  98   REKLVKHMWDVYTNSRGIKLPKFWQDAFEAAYEELT  133



>emb|CDY67099.1| BnaCnng53540D, partial [Brassica napus]
Length=120

 Score = 99.8 bits (247),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 64/120 (53%), Positives = 86/120 (72%), Gaps = 11/120 (9%)
 Frame = +2

Query  182  MKDEEAQVITSAGKKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL-----S  346
            MK+++   +    +K+  SD    LFGRG+YK +   A++LLAFWSMFTG++TL      
Sbjct  1    MKEDD---VLPTNQKKDSSDSV--LFGRGRYKFFAFAALMLLAFWSMFTGTVTLRLSTED  55

Query  347  LNRVSDSSGFPL-HddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
            LNR+S+  G P  H+ LDVLE+EE+E+VV+ MWDVYT SR  +LPKFWQ+AF AAYEE+T
Sbjct  56   LNRLSEDIGIPTNHESLDVLEMEERERVVKHMWDVYTNSRRIKLPKFWQQAFVAAYEELT  115



>ref|XP_010095271.1| hypothetical protein L484_014612 [Morus notabilis]
 gb|EXB59117.1| hypothetical protein L484_014612 [Morus notabilis]
Length=176

 Score =   100 bits (250),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 88/119 (74%), Gaps = 6/119 (5%)
 Frame = +2

Query  182  MKDEEAQVITSAGKKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL-----S  346
            MKDE+    T+A  K+  SD G   FG+G+YK W + AILLLA WSMFTG++TL     +
Sbjct  1    MKDEDGLPTTTATAKKESSDSGLA-FGKGRYKFWALGAILLLALWSMFTGTVTLRWSAGN  59

Query  347  LNRVSDSSGFPLHddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
            LNR+SD    P+HDDLDVLE+EE+EKVV  MWDVYT SR  RL +FWQEAFEAAYE++T
Sbjct  60   LNRISDDFDAPIHDDLDVLEMEEREKVVNHMWDVYTNSRRIRLTRFWQEAFEAAYEDLT  118



>ref|XP_007017504.1| Sugar transporter, putative isoform 1 [Theobroma cacao]
 gb|EOY14729.1| Sugar transporter, putative isoform 1 [Theobroma cacao]
Length=173

 Score =   100 bits (250),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 82/114 (72%), Gaps = 7/114 (6%)
 Frame = +2

Query  197  AQVITSAGKKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL-----SLNRVS  361
             Q  T+   K+H S  G   FG+  YK WV+ AILLLAFWSMFTGS++L      L R S
Sbjct  16   VQQQTTGSAKKHSSVAG--FFGKSGYKFWVLAAILLLAFWSMFTGSVSLKWSSGDLTRFS  73

Query  362  DSSGFPLHddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
            D S F +HDDLDVLE+EE+EKVVR+MW+VYT S S RLPKFW EAFEAAYE ++
Sbjct  74   DDSEFSVHDDLDVLELEEREKVVRKMWNVYTHSASLRLPKFWLEAFEAAYEYLS  127



>ref|XP_009356685.1| PREDICTED: uncharacterized protein LOC103947497 [Pyrus x bretschneideri]
Length=178

 Score =   100 bits (250),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 76/122 (62%), Positives = 92/122 (75%), Gaps = 10/122 (8%)
 Frame = +2

Query  182  MKDEEAQVITSA---GKKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL---  343
            MKD++    T+A   GKKE  SD G  + G+G+YK W + AILLLAFWSMFTG++TL   
Sbjct  1    MKDDDGLPTTTAASSGKKE-SSDSGL-ILGKGRYKFWALAAILLLAFWSMFTGTVTLRWS  58

Query  344  --SLNRVSDSSGFPLHddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEE  517
              +LNR+SD    P+HDDLDVLE+EE+EKVV  MWDVYT SR  RLP+FWQEAFEAAYEE
Sbjct  59   AGNLNRLSDDFDSPIHDDLDVLEMEEREKVVEHMWDVYTNSRRIRLPRFWQEAFEAAYEE  118

Query  518  MT  523
            +T
Sbjct  119  LT  120



>ref|XP_008241652.1| PREDICTED: uncharacterized protein LOC103340064 [Prunus mume]
Length=177

 Score =   100 bits (250),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 90/120 (75%), Gaps = 7/120 (6%)
 Frame = +2

Query  182  MKDEEA-QVITSAGKKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL-----  343
            MKDE+     T+A  K+  SD    + G+G+YK W + AILLLAFWSMFTG++TL     
Sbjct  1    MKDEDGLPTSTTASAKKESSDSSV-VLGKGRYKFWALAAILLLAFWSMFTGTVTLRWSAG  59

Query  344  SLNRVSDSSGFPLHddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
            +LNR+SD    P+HDDLDVLE+EE+EKVV+ MWDVYT SR  RLP+FWQEAFEAAYEE+T
Sbjct  60   NLNRLSDDLDSPIHDDLDVLEMEEREKVVKHMWDVYTNSRRIRLPRFWQEAFEAAYEELT  119



>ref|XP_006856090.1| hypothetical protein AMTR_s00059p00127380 [Amborella trichopoda]
 gb|ERN17557.1| hypothetical protein AMTR_s00059p00127380 [Amborella trichopoda]
Length=159

 Score =   100 bits (248),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 82/106 (77%), Gaps = 8/106 (8%)
 Frame = +2

Query  218  GKKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL-----SLNRVSDSSGFPL  382
            GKKE   DGG  + G+ +YK W + AI+LLAFWS+FTGS+TL     +L R+SD    P+
Sbjct  7    GKKE--GDGG-AVMGKTRYKFWALGAIILLAFWSIFTGSVTLKWSDGNLMRLSDDMDSPI  63

Query  383  HddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEM  520
            H+DLDVLE+EE+EKVVR MWDVYT ++  +LP+FWQEAFEAAYEE+
Sbjct  64   HEDLDVLELEEREKVVRHMWDVYTHNKRVKLPRFWQEAFEAAYEEL  109



>ref|XP_004300622.1| PREDICTED: uncharacterized protein LOC101302363 [Fragaria vesca 
subsp. vesca]
Length=174

 Score =   100 bits (248),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 87/119 (73%), Gaps = 8/119 (7%)
 Frame = +2

Query  182  MKDEEAQVITSAGKKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL-----S  346
            MKD++    T+A  K+  SD      G+G+YK W + AILLLAFWSMFTG++TL     +
Sbjct  1    MKDDDGLPTTTAAAKKDSSDSS---LGKGRYKFWALAAILLLAFWSMFTGTVTLRWSAGN  57

Query  347  LNRVSDSSGFPLHddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
            LNR SD    P+HDDLDVLE+EE+EKVV  MWDVYT SR  RLP+FWQEAFEAAYE++T
Sbjct  58   LNRFSDEFDSPIHDDLDVLEMEEREKVVEHMWDVYTNSRRIRLPRFWQEAFEAAYEDLT  116



>ref|XP_003611971.1| hypothetical protein MTR_5g019900 [Medicago truncatula]
 ref|XP_003636273.1| hypothetical protein MTR_036s0057 [Medicago truncatula]
 gb|AES94929.1| polyol transporter-like protein, putative [Medicago truncatula]
 gb|AFK44303.1| unknown [Medicago truncatula]
Length=171

 Score = 99.4 bits (246),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 90/120 (75%), Gaps = 9/120 (8%)
 Frame = +2

Query  182  MKDEEAQVITSA--GKKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL----  343
            MKD++    T+A   KKE+      GLFG+G+YK W + AILLLAFWSMFTG+++L    
Sbjct  1    MKDDDGLPTTTAAINKKENMD---SGLFGKGRYKFWALAAILLLAFWSMFTGTVSLRWSG  57

Query  344  SLNRVSDSSGFPLHddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
            +LN +S     P+HDDLDVLE+EE+EKVVR MWDVYT SR  RLP+FWQEAFEAAYEE+T
Sbjct  58   NLNTLSSDLDTPIHDDLDVLEMEEREKVVRHMWDVYTNSRRIRLPRFWQEAFEAAYEELT  117



>gb|AFK42567.1| unknown [Lotus japonicus]
Length=176

 Score = 99.4 bits (246),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 89/118 (75%), Gaps = 5/118 (4%)
 Frame = +2

Query  182  MKDEEAQVITSAGKKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL----SL  349
            MKD++    T+A   +   +   GLFG+G+YK W + AILLLAFWSMFTG+++L    +L
Sbjct  1    MKDDDGLPTTTAPTAKK-DNLDSGLFGKGRYKFWALAAILLLAFWSMFTGTVSLRWSGNL  59

Query  350  NRVSDSSGFPLHddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
            N +S+    P+HDDLDVLE+EE+EKVVR MWDVYT SR  RLP+FWQEAFEAAYEE+T
Sbjct  60   NSLSNDLDTPIHDDLDVLEMEEREKVVRHMWDVYTNSRRIRLPRFWQEAFEAAYEELT  117



>emb|CBI17540.3| unnamed protein product [Vitis vinifera]
Length=178

 Score = 99.4 bits (246),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 86/119 (72%), Gaps = 5/119 (4%)
 Frame = +2

Query  182  MKDEEAQVITSAGKKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL-----S  346
            MKD+++   T+             +FGRG+YK W + AILLLAFWSMFTG++TL     +
Sbjct  1    MKDDDSLPTTAPTTNAKKDSSDASVFGRGRYKFWALAAILLLAFWSMFTGTVTLRWSAGN  60

Query  347  LNRVSDSSGFPLHddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
            LN +SD     +HDDLDVLE+EE+EKVV+ MWDVYT SR SRLP+FWQEAFEAAYE++T
Sbjct  61   LNHISDDLDSHIHDDLDVLEMEEREKVVKHMWDVYTNSRRSRLPRFWQEAFEAAYEDLT  119



>ref|XP_010550395.1| PREDICTED: uncharacterized protein LOC104821281 [Tarenaya hassleriana]
Length=184

 Score = 99.4 bits (246),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 69/121 (57%), Positives = 87/121 (72%), Gaps = 7/121 (6%)
 Frame = +2

Query  182  MKDEEAQVITSAGKKEHGSD--GGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL----  343
            MKD +A  I++A    +     G   LFG+G+YK W + AILLLAFWSMFTG++TL    
Sbjct  1    MKDGDAIPISTAATTANAKKDAGDSALFGKGRYKFWALAAILLLAFWSMFTGTVTLRWSA  60

Query  344  -SLNRVSDSSGFPLHddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEM  520
             +LNR +D    P+H+DLDVLE+EE+EKVV+ MWDVY   R  RLP+FWQEAFEAAYEE+
Sbjct  61   GNLNRFTDDLDSPIHEDLDVLEMEEREKVVKHMWDVYNNGRRIRLPRFWQEAFEAAYEEL  120

Query  521  T  523
            T
Sbjct  121  T  121



>gb|KGN48820.1| hypothetical protein Csa_6G502580 [Cucumis sativus]
Length=176

 Score = 98.6 bits (244),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 71/121 (59%), Positives = 90/121 (74%), Gaps = 10/121 (8%)
 Frame = +2

Query  182  MKDEEA--QVITSAGKKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL----  343
            MKD++     I SAGKKE        LFG+G+YK W + AILLLAFWSMFTG+++L    
Sbjct  1    MKDDDVLPTTIASAGKKESSV---SSLFGKGRYKFWALAAILLLAFWSMFTGTVSLRWSA  57

Query  344  -SLNRVSDSSGFPLHddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEM  520
             +LN +SD   F +HDDLDVLE+EE+EK+V+ MWDVYT +R  RLP+FWQEAFEAAYE++
Sbjct  58   GNLNGLSDDIDFSIHDDLDVLEMEEREKIVKHMWDVYTNNRRIRLPRFWQEAFEAAYEDL  117

Query  521  T  523
            T
Sbjct  118  T  118



>ref|XP_008440698.1| PREDICTED: uncharacterized protein LOC103485038 [Cucumis melo]
Length=176

 Score = 98.6 bits (244),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 71/121 (59%), Positives = 90/121 (74%), Gaps = 10/121 (8%)
 Frame = +2

Query  182  MKDEEA--QVITSAGKKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL----  343
            MKD++     I SAGKKE        LFG+G+YK W + AILLLAFWSMFTG+++L    
Sbjct  1    MKDDDVLPTTIASAGKKESSV---SSLFGKGRYKFWALAAILLLAFWSMFTGTVSLRWSA  57

Query  344  -SLNRVSDSSGFPLHddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEM  520
             +LN +SD   F +HDDLDVLE+EE+EK+V+ MWDVYT +R  RLP+FWQEAFEAAYE++
Sbjct  58   GNLNGLSDDIDFNIHDDLDVLEMEEREKIVKHMWDVYTNNRRIRLPRFWQEAFEAAYEDL  117

Query  521  T  523
            T
Sbjct  118  T  118



>ref|XP_010444944.1| PREDICTED: probable polyol transporter 6 [Camelina sativa]
Length=677

 Score =   103 bits (257),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 81/108 (75%), Gaps = 7/108 (6%)
 Frame = +2

Query  215  AGKKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL-----SLNRVSDSSGFP  379
            A  K+  SD    LFGRG+YK W   AILLLAFWSMFTG++TL     +LNR S+  G P
Sbjct  520  ANSKKENSD--SILFGRGRYKFWAFGAILLLAFWSMFTGTVTLRLTTGNLNRFSEDLGIP  577

Query  380  LHddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
             +D+LDVLE+EE+EKVV+ MWDVYT SR  +LP+FWQEAF AAYEE+T
Sbjct  578  NYDNLDVLEMEEREKVVKHMWDVYTSSRRIKLPRFWQEAFVAAYEELT  625



>ref|XP_007202654.1| hypothetical protein PRUPE_ppa012270mg [Prunus persica]
 gb|EMJ03853.1| hypothetical protein PRUPE_ppa012270mg [Prunus persica]
Length=177

 Score = 98.2 bits (243),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 89/120 (74%), Gaps = 7/120 (6%)
 Frame = +2

Query  182  MKDEEA-QVITSAGKKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL-----  343
            MKDE+     T+A  K+  SD    + G+G+YK W + AILLLAFWSMFTG++TL     
Sbjct  1    MKDEDGLPTSTTASAKKESSDSSV-VLGKGRYKFWALAAILLLAFWSMFTGTVTLRWSAG  59

Query  344  SLNRVSDSSGFPLHddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
            +LNR+SD    P+ DDLDVLE+EE+EKVV+ MWDVYT SR  RLP+FWQEAFEAAYEE+T
Sbjct  60   NLNRLSDDLDSPIRDDLDVLEMEEREKVVKHMWDVYTNSRRIRLPRFWQEAFEAAYEELT  119



>ref|XP_010244287.1| PREDICTED: uncharacterized protein LOC104588164 [Nelumbo nucifera]
Length=176

 Score = 98.2 bits (243),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 89/118 (75%), Gaps = 8/118 (7%)
 Frame = +2

Query  182  MKDEEAQVITSAGKKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL-----S  346
            MKD++A   T+   K+  S G   LFG+G+YK W + AILLLAFWSMFTG++TL     +
Sbjct  1    MKDDDAPSPTT---KKDNSSGDASLFGKGRYKFWALAAILLLAFWSMFTGTVTLKWSASN  57

Query  347  LNRVSDSSGFPLHddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEM  520
            LNR+SD    P+ DDLDVLEVEE+EKVV+ MWDVYT SR  +LP+FWQEAFEAAYE++
Sbjct  58   LNRLSDHLNTPILDDLDVLEVEEREKVVKHMWDVYTHSRRIQLPRFWQEAFEAAYEDL  115



>ref|XP_007046980.1| Sugar transporter, putative [Theobroma cacao]
 gb|EOX91137.1| Sugar transporter, putative [Theobroma cacao]
Length=180

 Score = 97.8 bits (242),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 83/105 (79%), Gaps = 7/105 (7%)
 Frame = +2

Query  224  KEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL-----SLNRVSDSSGFPLHd  388
            K+  SD    LFG+G+YK W + AILLLAFWSMFTG++TL     +LNR+SD    P+HD
Sbjct  20   KKESSDSS--LFGKGRYKFWALAAILLLAFWSMFTGTVTLRWSAGNLNRLSDDLDSPIHD  77

Query  389  dldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
            DLDVLE+EE+EKVV+ MWDVYT SR  RLP+FWQEAFEAAYEE+T
Sbjct  78   DLDVLEMEEREKVVKHMWDVYTNSRRIRLPRFWQEAFEAAYEELT  122



>ref|XP_009371570.1| PREDICTED: uncharacterized protein LOC103960807, partial [Pyrus 
x bretschneideri]
Length=134

 Score = 95.9 bits (237),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 71/109 (65%), Positives = 86/109 (79%), Gaps = 7/109 (6%)
 Frame = +2

Query  212  SAGKKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL-----SLNRVSDSSGF  376
            S+GKKE  SD G  + G+G+YK W + AILLLAFWSMFTG++TL     +LNR+SD    
Sbjct  14   SSGKKE-SSDSGL-ILGKGRYKFWALAAILLLAFWSMFTGTVTLRWSAGNLNRLSDDLDS  71

Query  377  PLHddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
            P+HDDLDVLE+EE+EKVV+ MWDVYT S   RLP+FWQEAFEAAYEE+T
Sbjct  72   PIHDDLDVLEMEEREKVVKHMWDVYTNSHRIRLPRFWQEAFEAAYEELT  120



>ref|XP_010558208.1| PREDICTED: uncharacterized protein LOC104826929 [Tarenaya hassleriana]
Length=185

 Score = 97.1 bits (240),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 69/122 (57%), Positives = 87/122 (71%), Gaps = 8/122 (7%)
 Frame = +2

Query  182  MKDEEAQVITSAGKKEHGSD---GGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL---  343
            MKD +   I++A      +    G   LFG+G+YK W + AILLLAFWSMFTG++TL   
Sbjct  1    MKDGDTLPISNAASTAGNAKKDAGDSALFGKGRYKFWALAAILLLAFWSMFTGTVTLRWS  60

Query  344  --SLNRVSDSSGFPLHddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEE  517
              +LNR SD    P+H+DLDVLE+EE+EKVV+ MWDVYT  R  RLP+FWQEAFEAAYEE
Sbjct  61   AGNLNRFSDDFDSPIHEDLDVLEMEEREKVVKHMWDVYTNGRRIRLPRFWQEAFEAAYEE  120

Query  518  MT  523
            ++
Sbjct  121  LS  122



>ref|XP_010936292.1| PREDICTED: uncharacterized protein LOC105055949 isoform X1 [Elaeis 
guineensis]
Length=181

 Score = 95.9 bits (237),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 64/115 (56%), Positives = 78/115 (68%), Gaps = 7/115 (6%)
 Frame = +2

Query  200  QVITSAGKKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL-----SLNRVSD  364
            Q+ TSA            LFG+G+YK W + AI+LLAFWSM TG++TL     +LNR+SD
Sbjct  6    QLPTSAKPSSAAGAAETALFGKGRYKFWALAAIILLAFWSMLTGTVTLKGSAGNLNRISD  65

Query  365  S-SGFPLH-ddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
                 PL   DLDVLE+EE+EKVVR MWD+Y  S   RLP+FWQEAFEAAYEE+ 
Sbjct  66   DLLDAPLRDADLDVLEMEEREKVVRHMWDIYAHSLRIRLPRFWQEAFEAAYEELA  120



>ref|XP_008790343.1| PREDICTED: uncharacterized protein LOC103707584 isoform X2 [Phoenix 
dactylifera]
Length=172

 Score = 95.9 bits (237),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 80/118 (68%), Gaps = 9/118 (8%)
 Frame = +2

Query  191  EEAQVITSAGKKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL-----SLNR  355
            +E   +T+A K    ++    LFG+G+YK W + AI+LLAFWSM TG++TL     +LNR
Sbjct  2    KEGDQLTTAAKPSSAAEAA--LFGKGRYKFWALAAIILLAFWSMLTGTVTLKWSAGNLNR  59

Query  356  VSDSS-GFPLHddld-vleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
            +SD   G P  D    VLE+EE+EKVVR MWD+Y  S   RLP+FWQEAFEAAYEE+ 
Sbjct  60   LSDDLLGAPFRDADLDVLEMEEREKVVRHMWDIYAHSLRIRLPRFWQEAFEAAYEELA  117



>ref|XP_004232390.1| PREDICTED: uncharacterized protein LOC101253740 [Solanum lycopersicum]
Length=178

 Score = 95.9 bits (237),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 72/95 (76%), Gaps = 5/95 (5%)
 Frame = +2

Query  251  GLFGRGKYKLWVILAILLLAFWSMFTGSLTL-----SLNRVSDSSGFPLHddldvlevee  415
             +FGRG+YK W   AI LLA WSMFTG++TL     +LN +SD    PL +DLDVLE+EE
Sbjct  29   AIFGRGRYKFWAFAAISLLALWSMFTGTVTLRWSAGNLNAISDDIDIPLPEDLDVLEMEE  88

Query  416  kekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEM  520
            +EK+V+ MWDVYT SR  +L KFWQEAFEAAYEE+
Sbjct  89   REKLVKHMWDVYTNSRGIKLLKFWQEAFEAAYEEL  123



>ref|XP_008352460.1| PREDICTED: uncharacterized protein LOC103415959 [Malus domestica]
Length=173

 Score = 95.5 bits (236),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 75/122 (61%), Positives = 91/122 (75%), Gaps = 10/122 (8%)
 Frame = +2

Query  182  MKDEEAQVITSA---GKKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL---  343
            MKD +    T+A   GKKE  SD G  + G+G+YK W + AILLLAFWSMFTG++TL   
Sbjct  1    MKDGDGFPTTTAASSGKKE-SSDSGL-ILGKGRYKFWALAAILLLAFWSMFTGTVTLRWS  58

Query  344  --SLNRVSDSSGFPLHddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEE  517
              +LNR+SD     +HDDLDVLE+EE+EKVV+ MWDVYT SR  RLP+FWQEAFEAAYEE
Sbjct  59   AGNLNRLSDDLDSRIHDDLDVLEMEEREKVVKHMWDVYTNSRRIRLPRFWQEAFEAAYEE  118

Query  518  MT  523
            +T
Sbjct  119  LT  120



>gb|KCW67829.1| hypothetical protein EUGRSUZ_F01557 [Eucalyptus grandis]
Length=181

 Score = 95.9 bits (237),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 82/111 (74%), Gaps = 8/111 (7%)
 Frame = +2

Query  209  TSAGKKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL-----SLNRVS-DSS  370
            ++  K+E  ++    LFGR  YK WV+ AILLLAFWSM TGS+TL     +L R S D  
Sbjct  22   SNGSKRERPAESR--LFGRSAYKFWVLAAILLLAFWSMLTGSVTLKWSAGNLARFSSDLL  79

Query  371  GFPLHddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
              P ++DLD+LEVEE+EKVVR MWDVYTQS+SSRLPKFWQ+AF+A YE +T
Sbjct  80   DLPSYEDLDILEVEEREKVVRHMWDVYTQSKSSRLPKFWQDAFQAGYEFLT  130



>ref|XP_010936293.1| PREDICTED: uncharacterized protein LOC105055949 isoform X2 [Elaeis 
guineensis]
Length=180

 Score = 95.9 bits (237),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 63/115 (55%), Positives = 77/115 (67%), Gaps = 7/115 (6%)
 Frame = +2

Query  200  QVITSAGKKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL-----SLNRVSD  364
            Q+ TSA            LFG+G+YK W + AI+LLAFWSM TG++TL     +LNR+SD
Sbjct  6    QLPTSAKPSSAAGAAETALFGKGRYKFWALAAIILLAFWSMLTGTVTLKGSAGNLNRISD  65

Query  365  S-SGFPLHddl-dvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
                 PL D   DVLE+EE+EKVVR MWD+Y  S   RLP+FWQEAFEAAYEE+ 
Sbjct  66   DLLDAPLRDADLDVLEMEEREKVVRHMWDIYAHSLRIRLPRFWQEAFEAAYEELA  120



>ref|XP_007156030.1| hypothetical protein PHAVU_003G252600g [Phaseolus vulgaris]
 gb|ESW28024.1| hypothetical protein PHAVU_003G252600g [Phaseolus vulgaris]
Length=155

 Score = 95.1 bits (235),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 85/118 (72%), Gaps = 8/118 (7%)
 Frame = +2

Query  182  MKDEEAQVITSAGKKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL----SL  349
            MKDEE   I  A K+   SD G  LFGRG YK W + AILLLA WSMFTG+++L    +L
Sbjct  1    MKDEETLPI--AKKETLASDSG--LFGRGSYKFWALAAILLLALWSMFTGTVSLRWSGTL  56

Query  350  NRVSDSSGFPLHddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
            N  S     PLHD LDVLE+EE+EKVVR MWDVYT +R  RLP+FWQEAFEAAYE+++
Sbjct  57   NTFSHDLHVPLHDHLDVLEMEEREKVVRHMWDVYTNNRRIRLPRFWQEAFEAAYEDLS  114



>gb|AAG01119.1|AF273333_4 BAC19.4 [Solanum lycopersicum]
Length=182

 Score = 95.9 bits (237),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 62/123 (50%), Positives = 80/123 (65%), Gaps = 10/123 (8%)
 Frame = +2

Query  182  MKDEEAQVITSAGKKEHGSDGGH-----GLFGRGKYKLWVILAILLLAFWSMFTGSLTL-  343
            M+D++  + T        +          +FGRG+YK W   AI LLA WSMFTG++TL 
Sbjct  1    MRDDDLPISTPTAPSSSFTTSKKETSYFAIFGRGRYKFWAFAAISLLALWSMFTGTVTLR  60

Query  344  ----SLNRVSDSSGFPLHddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAY  511
                +LN +SD    PL +DLDVLE+EE+EK+V+ MWDVYT SR  +L KFWQEAFEAAY
Sbjct  61   WSAGNLNAISDDIDIPLPEDLDVLEMEEREKLVKHMWDVYTNSRGIKLLKFWQEAFEAAY  120

Query  512  EEM  520
            EE+
Sbjct  121  EEL  123



>ref|XP_010060934.1| PREDICTED: uncharacterized protein LOC104448744 [Eucalyptus grandis]
 gb|KCW67827.1| hypothetical protein EUGRSUZ_F01557 [Eucalyptus grandis]
Length=190

 Score = 95.9 bits (237),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 82/111 (74%), Gaps = 8/111 (7%)
 Frame = +2

Query  209  TSAGKKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL-----SLNRVS-DSS  370
            ++  K+E  ++    LFGR  YK WV+ AILLLAFWSM TGS+TL     +L R S D  
Sbjct  22   SNGSKRERPAESR--LFGRSAYKFWVLAAILLLAFWSMLTGSVTLKWSAGNLARFSSDLL  79

Query  371  GFPLHddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
              P ++DLD+LEVEE+EKVVR MWDVYTQS+SSRLPKFWQ+AF+A YE +T
Sbjct  80   DLPSYEDLDILEVEEREKVVRHMWDVYTQSKSSRLPKFWQDAFQAGYEFLT  130



>ref|XP_008790342.1| PREDICTED: uncharacterized protein LOC103707584 isoform X1 [Phoenix 
dactylifera]
Length=177

 Score = 95.5 bits (236),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 60/118 (51%), Positives = 79/118 (67%), Gaps = 9/118 (8%)
 Frame = +2

Query  191  EEAQVITSAGKKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL-----SLNR  355
            +E   +T+A K    ++    LFG+G+YK W + AI+LLAFWSM TG++TL     +LNR
Sbjct  2    KEGDQLTTAAKPSSAAEAA--LFGKGRYKFWALAAIILLAFWSMLTGTVTLKWSAGNLNR  59

Query  356  VSDSS-GFPLHddldvl-eveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
            +SD   G P  D    + E+EE+EKVVR MWD+Y  S   RLP+FWQEAFEAAYEE+ 
Sbjct  60   LSDDLLGAPFRDADLDVLEMEEREKVVRHMWDIYAHSLRIRLPRFWQEAFEAAYEELA  117



>ref|XP_004143580.1| PREDICTED: probable polyol transporter 3-like [Cucumis sativus]
 ref|XP_004162330.1| PREDICTED: probable polyol transporter 3-like [Cucumis sativus]
Length=378

 Score = 98.2 bits (243),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 72/128 (56%), Positives = 91/128 (71%), Gaps = 10/128 (8%)
 Frame = +2

Query  155  PPSVDWYEEMKDEEAQVITSAGKKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGS  334
            P S  W ++  D     I SAGKKE        LFG+G+YK W + AILLLAFWSMFTG+
Sbjct  198  PESPRWLDD--DVLPTTIASAGKKESSV---SSLFGKGRYKFWALAAILLLAFWSMFTGT  252

Query  335  LTL-----SLNRVSDSSGFPLHddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAF  499
            ++L     +LN +SD   F +HDDLDVLE+EE+EK+V+ MWDVYT +R  RLP+FWQEAF
Sbjct  253  VSLRWSAGNLNGLSDDIDFSIHDDLDVLEMEEREKIVKHMWDVYTNNRRIRLPRFWQEAF  312

Query  500  EAAYEEMT  523
            EAAYE++T
Sbjct  313  EAAYEDLT  320



>gb|KCW67828.1| hypothetical protein EUGRSUZ_F01557 [Eucalyptus grandis]
Length=189

 Score = 95.9 bits (237),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 82/111 (74%), Gaps = 8/111 (7%)
 Frame = +2

Query  209  TSAGKKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL-----SLNRVS-DSS  370
            ++  K+E  ++    LFGR  YK WV+ AILLLAFWSM TGS+TL     +L R S D  
Sbjct  22   SNGSKRERPAESR--LFGRSAYKFWVLAAILLLAFWSMLTGSVTLKWSAGNLARFSSDLL  79

Query  371  GFPLHddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
              P ++DLD+LEVEE+EKVVR MWDVYTQS+SSRLPKFWQ+AF+A YE +T
Sbjct  80   DLPSYEDLDILEVEEREKVVRHMWDVYTQSKSSRLPKFWQDAFQAGYEFLT  130



>ref|XP_010936399.1| PREDICTED: uncharacterized protein LOC105056036 isoform X1 [Elaeis 
guineensis]
Length=180

 Score = 95.5 bits (236),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 63/115 (55%), Positives = 77/115 (67%), Gaps = 7/115 (6%)
 Frame = +2

Query  200  QVITSAGKKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL-----SLNRVSD  364
            Q+ TSA            LFG+G+YK W + AI+LLAFWSM TG++TL     +LNR+SD
Sbjct  6    QLPTSAKPSSAAGAAETSLFGKGRYKFWALAAIILLAFWSMLTGTVTLKGSAGNLNRISD  65

Query  365  S-SGFPLHddl-dvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
                 PL D   DVLE+EE+EKVVR MWD+Y  S   RLP+FWQEAFEAAYEE+ 
Sbjct  66   DFLDAPLRDADLDVLEMEEREKVVRHMWDIYAHSLRIRLPRFWQEAFEAAYEELA  120



>ref|XP_008338119.1| PREDICTED: uncharacterized protein LOC103401176 [Malus domestica]
Length=178

 Score = 95.1 bits (235),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 75/122 (61%), Positives = 91/122 (75%), Gaps = 10/122 (8%)
 Frame = +2

Query  182  MKDEEAQVITSA---GKKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL---  343
            MKD +    T+A   GKKE  SD G  + G+G+YK W + AILLLAFWSMFTG++TL   
Sbjct  1    MKDGDGFPTTTAASSGKKE-SSDSGL-ILGKGRYKFWALAAILLLAFWSMFTGTVTLRWS  58

Query  344  --SLNRVSDSSGFPLHddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEE  517
              +LNR+SD     +HDDLDVLE+EE+EKVV+ MWDVYT SR  RLP+FWQEAFEAAYEE
Sbjct  59   AGNLNRLSDDLDSRIHDDLDVLEMEEREKVVKHMWDVYTNSRRIRLPRFWQEAFEAAYEE  118

Query  518  MT  523
            +T
Sbjct  119  LT  120



>ref|XP_010649162.1| PREDICTED: probable polyol transporter 6 isoform X2 [Vitis vinifera]
Length=378

 Score = 97.8 bits (242),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 86/119 (72%), Gaps = 5/119 (4%)
 Frame = +2

Query  182  MKDEEAQVITSAGKKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL-----S  346
            MKD+++   T+             +FGRG+YK W + AILLLAFWSMFTG++TL     +
Sbjct  201  MKDDDSLPTTAPTTNAKKDSSDASVFGRGRYKFWALAAILLLAFWSMFTGTVTLRWSAGN  260

Query  347  LNRVSDSSGFPLHddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
            LN +SD     +HDDLDVLE+EE+EKVV+ MWDVYT SR SRLP+FWQEAFEAAYE++T
Sbjct  261  LNHISDDLDSHIHDDLDVLEMEEREKVVKHMWDVYTNSRRSRLPRFWQEAFEAAYEDLT  319



>ref|XP_010936400.1| PREDICTED: uncharacterized protein LOC105056036 isoform X2 [Elaeis 
guineensis]
Length=179

 Score = 95.1 bits (235),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 64/115 (56%), Positives = 78/115 (68%), Gaps = 7/115 (6%)
 Frame = +2

Query  200  QVITSAGKKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL-----SLNRVSD  364
            Q+ TSA            LFG+G+YK W + AI+LLAFWSM TG++TL     +LNR+SD
Sbjct  6    QLPTSAKPSSAAGAAETSLFGKGRYKFWALAAIILLAFWSMLTGTVTLKGSAGNLNRISD  65

Query  365  S-SGFPLH-ddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
                 PL   DLDVLE+EE+EKVVR MWD+Y  S   RLP+FWQEAFEAAYEE+ 
Sbjct  66   DFLDAPLRDADLDVLEMEEREKVVRHMWDIYAHSLRIRLPRFWQEAFEAAYEELA  120



>ref|XP_009622062.1| PREDICTED: uncharacterized protein LOC104113563 isoform X2 [Nicotiana 
tomentosiformis]
Length=152

 Score = 94.4 bits (233),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 85/119 (71%), Gaps = 5/119 (4%)
 Frame = +2

Query  182  MKDEEAQVITSAGKKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL-----S  346
            MKD+E+  +++       S     +FGR +YK W + AILLLAFWSMFTG++TL     +
Sbjct  1    MKDDESIPVSTPTTHSKISTSDASIFGRRRYKFWALAAILLLAFWSMFTGTVTLRWSAGN  60

Query  347  LNRVSDSSGFPLHddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
            LN +SD    PL DDLDV+E+EE+EK+V+ MWDVYT +   RLPKFWQEAFEAAYEE+T
Sbjct  61   LNGLSDYFNLPLSDDLDVIEMEEREKLVKHMWDVYTNTPRIRLPKFWQEAFEAAYEELT  119



>ref|XP_007156031.1| hypothetical protein PHAVU_003G252600g [Phaseolus vulgaris]
 gb|ESW28025.1| hypothetical protein PHAVU_003G252600g [Phaseolus vulgaris]
Length=170

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 85/118 (72%), Gaps = 8/118 (7%)
 Frame = +2

Query  182  MKDEEAQVITSAGKKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL----SL  349
            MKDEE   I  A K+   SD G  LFGRG YK W + AILLLA WSMFTG+++L    +L
Sbjct  1    MKDEETLPI--AKKETLASDSG--LFGRGSYKFWALAAILLLALWSMFTGTVSLRWSGTL  56

Query  350  NRVSDSSGFPLHddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
            N  S     PLHD LDVLE+EE+EKVVR MWDVYT +R  RLP+FWQEAFEAAYE+++
Sbjct  57   NTFSHDLHVPLHDHLDVLEMEEREKVVRHMWDVYTNNRRIRLPRFWQEAFEAAYEDLS  114



>ref|XP_008362114.1| PREDICTED: uncharacterized protein LOC103425793 [Malus domestica]
Length=178

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 71/120 (59%), Positives = 86/120 (72%), Gaps = 6/120 (5%)
 Frame = +2

Query  182  MKDEEAQVITSAGKKEHGSDGGHGL-FGRGKYKLWVILAILLLAFWSMFTGSLTL-----  343
            MKD++    T+A           GL  G+G+YK W + AILLLAFWSMFTG++TL     
Sbjct  1    MKDDDGLPTTTAASSGKKDSSDSGLILGKGRYKFWALAAILLLAFWSMFTGTVTLRWSAG  60

Query  344  SLNRVSDSSGFPLHddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
            +LNR+SD    P+HDDLDVLE+EE+EKVV  MWDVYT SR  RLP+FWQEAFEAAYEE+T
Sbjct  61   NLNRLSDDFDSPIHDDLDVLEMEEREKVVEHMWDVYTNSRRIRLPRFWQEAFEAAYEELT  120



>ref|XP_009622061.1| PREDICTED: uncharacterized protein LOC104113563 isoform X1 [Nicotiana 
tomentosiformis]
Length=173

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 85/119 (71%), Gaps = 5/119 (4%)
 Frame = +2

Query  182  MKDEEAQVITSAGKKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL-----S  346
            MKD+E+  +++       S     +FGR +YK W + AILLLAFWSMFTG++TL     +
Sbjct  1    MKDDESIPVSTPTTHSKISTSDASIFGRRRYKFWALAAILLLAFWSMFTGTVTLRWSAGN  60

Query  347  LNRVSDSSGFPLHddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
            LN +SD    PL DDLDV+E+EE+EK+V+ MWDVYT +   RLPKFWQEAFEAAYEE+T
Sbjct  61   LNGLSDYFNLPLSDDLDVIEMEEREKLVKHMWDVYTNTPRIRLPKFWQEAFEAAYEELT  119



>ref|XP_007206057.1| hypothetical protein PRUPE_ppa012645mg [Prunus persica]
 gb|EMJ07256.1| hypothetical protein PRUPE_ppa012645mg [Prunus persica]
Length=160

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 75/101 (74%), Gaps = 8/101 (8%)
 Frame = +2

Query  245  GHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL-----SLNRVSDSSGFPLHddldvlev  409
            G     + +YK WV+ AILLLAFWSMFTGS+TL     +L R+SD    P  DDLD+LEV
Sbjct  38   GRSFLDKTRYKFWVLAAILLLAFWSMFTGSVTLKWSAGNLTRLSDDLDLPSFDDLDILEV  97

Query  410  eekekvvRQMWDVYTQ---SRSSRLPKFWQEAFEAAYEEMT  523
            EE+EKVVR MWD+YTQ   S S+RLP+FWQEAFEAAYE ++
Sbjct  98   EEREKVVRHMWDLYTQSSRSSSNRLPRFWQEAFEAAYEHLS  138



>ref|XP_002310215.2| hypothetical protein POPTR_0007s12630g [Populus trichocarpa]
 gb|ABK93535.1| unknown [Populus trichocarpa]
 gb|EEE90665.2| hypothetical protein POPTR_0007s12630g [Populus trichocarpa]
Length=171

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 69/120 (58%), Positives = 88/120 (73%), Gaps = 8/120 (7%)
 Frame = +2

Query  182  MKDEEAQVITSAGK-KEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL-----  343
            MKD+++   T+A   K+  SD    LFG+G+YK W + AILLLAFWSM TG++TL     
Sbjct  1    MKDDDSLPTTTAPSVKKETSDSV--LFGKGRYKFWALAAILLLAFWSMLTGTVTLRWSAG  58

Query  344  SLNRVSDSSGFPLHddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
            +LN + D    P+ DDLDVLE+E++EKVV+ MWD+YT SR  RLPKFWQEAFEAAYEE+T
Sbjct  59   NLNSLVDDIDTPIRDDLDVLEMEDREKVVKHMWDIYTNSRRIRLPKFWQEAFEAAYEELT  118



>gb|KJB43530.1| hypothetical protein B456_007G204600 [Gossypium raimondii]
Length=163

 Score = 93.6 bits (231),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 81/105 (77%), Gaps = 7/105 (7%)
 Frame = +2

Query  224  KEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL-----SLNRVSDSSGFPLHd  388
            K+  SD    LFG+G+YK W + AILLLAFWSMFTG++TL     +LNR SD     +HD
Sbjct  22   KKESSDSS--LFGKGRYKFWALAAILLLAFWSMFTGTVTLRWSAGNLNRFSDDFDSHIHD  79

Query  389  dldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
            DLDVLE+EE+EKVV+ MWDVYT SR  RLP+FWQEAFEAAYEE+T
Sbjct  80   DLDVLEMEEREKVVKHMWDVYTNSRRIRLPRFWQEAFEAAYEELT  124



>ref|XP_006383226.1| hypothetical protein POPTR_0005s12660g [Populus trichocarpa]
 gb|ERP61023.1| hypothetical protein POPTR_0005s12660g [Populus trichocarpa]
Length=164

 Score = 93.6 bits (231),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 82/117 (70%), Gaps = 7/117 (6%)
 Frame = +2

Query  188  DEEAQVITSAGKKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL-----SLN  352
            D      T+   K+  SD G  LFG+ +YK W + AILLLAFWSMFTG++TL     +LN
Sbjct  4    DVSLPTTTAPTVKKETSDSG--LFGKVRYKFWALAAILLLAFWSMFTGTVTLRWSAGNLN  61

Query  353  RVSDSSGFPLHddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
             ++D    P+ DD DVLE+EE+EK V+ MWD+YT SR  RLPKFWQEAFEAAYEE+T
Sbjct  62   SLADDIDTPIRDDRDVLEMEEREKAVKHMWDIYTNSRRIRLPKFWQEAFEAAYEELT  118



>gb|KJB43531.1| hypothetical protein B456_007G204600 [Gossypium raimondii]
Length=159

 Score = 93.2 bits (230),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 81/105 (77%), Gaps = 7/105 (7%)
 Frame = +2

Query  224  KEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL-----SLNRVSDSSGFPLHd  388
            K+  SD    LFG+G+YK W + AILLLAFWSMFTG++TL     +LNR SD     +HD
Sbjct  22   KKESSDSS--LFGKGRYKFWALAAILLLAFWSMFTGTVTLRWSAGNLNRFSDDFDSHIHD  79

Query  389  dldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
            DLDVLE+EE+EKVV+ MWDVYT SR  RLP+FWQEAFEAAYEE+T
Sbjct  80   DLDVLEMEEREKVVKHMWDVYTNSRRIRLPRFWQEAFEAAYEELT  124



>ref|XP_010939259.1| PREDICTED: uncharacterized protein LOC105058138 isoform X4 [Elaeis 
guineensis]
Length=151

 Score = 92.8 bits (229),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 72/97 (74%), Gaps = 7/97 (7%)
 Frame = +2

Query  254  LFGRGKYKLWVILAILLLAFWSMFTGSLTL-----SLNRVSDSSGFPL--Hddldvleve  412
            LFG+G+YK W + AI+LLAFWSMFTG++TL     +LNR+SD    P      LDVLE+E
Sbjct  21   LFGKGRYKFWALAAIILLAFWSMFTGTVTLKWSAGNLNRLSDDLLDPPLRDAALDVLEME  80

Query  413  ekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
            E+EKVVR MWD+Y  S   RLP+FWQEAFEAAYEE+ 
Sbjct  81   EREKVVRHMWDIYAHSLRIRLPRFWQEAFEAAYEELA  117



>ref|XP_010999974.1| PREDICTED: uncharacterized protein LOC105107660 [Populus euphratica]
Length=171

 Score = 93.6 bits (231),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 81/110 (74%), Gaps = 7/110 (6%)
 Frame = +2

Query  209  TSAGKKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL-----SLNRVSDSSG  373
            T+   K+  SD G  LFG+ +YK W + AILLLAFWSMFTG++TL     +LN ++D   
Sbjct  11   TAPTVKKETSDSG--LFGKVRYKFWALAAILLLAFWSMFTGTVTLRWSAGNLNSLADDID  68

Query  374  FPLHddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
             P+ DD DVLE+EE+EK V+ MWD+YT SR  RLPKFWQEAFEAAYEE+T
Sbjct  69   TPIRDDRDVLEMEEREKAVKHMWDIYTNSRRIRLPKFWQEAFEAAYEELT  118



>ref|XP_010939258.1| PREDICTED: uncharacterized protein LOC105058138 isoform X3 [Elaeis 
guineensis]
Length=164

 Score = 93.2 bits (230),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 72/97 (74%), Gaps = 7/97 (7%)
 Frame = +2

Query  254  LFGRGKYKLWVILAILLLAFWSMFTGSLTL-----SLNRVSDSSGFPL--Hddldvleve  412
            LFG+G+YK W + AI+LLAFWSMFTG++TL     +LNR+SD    P      LDVLE+E
Sbjct  21   LFGKGRYKFWALAAIILLAFWSMFTGTVTLKWSAGNLNRLSDDLLDPPLRDAALDVLEME  80

Query  413  ekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
            E+EKVVR MWD+Y  S   RLP+FWQEAFEAAYEE+ 
Sbjct  81   EREKVVRHMWDIYAHSLRIRLPRFWQEAFEAAYEELA  117



>ref|XP_010106008.1| hypothetical protein L484_021185 [Morus notabilis]
 gb|EXC07278.1| hypothetical protein L484_021185 [Morus notabilis]
Length=155

 Score = 92.8 bits (229),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 69/121 (57%), Positives = 87/121 (72%), Gaps = 12/121 (10%)
 Frame = +2

Query  182  MKDEEAQVITSAGKKEHGSDGGHGLFGRG-KYKLWVILAILLLAFWSMFTGSLTL-----  343
            MK+ +  V+    +KE  S    GL G+   YK WV+ A+LLLAFWSMFTGS+TL     
Sbjct  1    MKENDLPVLV---RKE--SSRSAGLPGKSFSYKFWVLFAVLLLAFWSMFTGSVTLKWSAG  55

Query  344  SLNRVSDSSGFPLHddldvleveekekvvRQMWDVYTQSRSSR-LPKFWQEAFEAAYEEM  520
            +L+R SD    P +DDLD+LEVEE+EKVVR MWDVYTQSR+ R +P+FWQEAFEAAYE++
Sbjct  56   NLSRFSDDFSSPNYDDLDILEVEEREKVVRLMWDVYTQSRNGRVVPRFWQEAFEAAYEDL  115

Query  521  T  523
             
Sbjct  116  V  116



>ref|XP_010939257.1| PREDICTED: uncharacterized protein LOC105058138 isoform X2 [Elaeis 
guineensis]
Length=177

 Score = 93.2 bits (230),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 72/97 (74%), Gaps = 7/97 (7%)
 Frame = +2

Query  254  LFGRGKYKLWVILAILLLAFWSMFTGSLTL-----SLNRVSDSSGFPL--Hddldvleve  412
            LFG+G+YK W + AI+LLAFWSMFTG++TL     +LNR+SD    P      LDVLE+E
Sbjct  21   LFGKGRYKFWALAAIILLAFWSMFTGTVTLKWSAGNLNRLSDDLLDPPLRDAALDVLEME  80

Query  413  ekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
            E+EKVVR MWD+Y  S   RLP+FWQEAFEAAYEE+ 
Sbjct  81   EREKVVRHMWDIYAHSLRIRLPRFWQEAFEAAYEELA  117



>gb|KJB43529.1| hypothetical protein B456_007G204600 [Gossypium raimondii]
Length=164

 Score = 92.8 bits (229),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 81/105 (77%), Gaps = 7/105 (7%)
 Frame = +2

Query  224  KEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL-----SLNRVSDSSGFPLHd  388
            K+  SD    LFG+G+YK W + AILLLAFWSMFTG++TL     +LNR SD     +HD
Sbjct  22   KKESSDSS--LFGKGRYKFWALAAILLLAFWSMFTGTVTLRWSAGNLNRFSDDFDSHIHD  79

Query  389  dldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
            DLDVLE+EE+EKVV+ MWDVYT SR  RLP+FWQEAFEAAYEE+T
Sbjct  80   DLDVLEMEEREKVVKHMWDVYTNSRRIRLPRFWQEAFEAAYEELT  124



>gb|KHN47872.1| hypothetical protein glysoja_036616 [Glycine soja]
Length=162

 Score = 92.8 bits (229),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 83/119 (70%), Gaps = 8/119 (7%)
 Frame = +2

Query  182  MKDEEA--QVITSAGKKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL----  343
            MKDE+    + T+A  K+   D    LFG+G+YK WV+ A+LL  FWSM+ G+++L    
Sbjct  1    MKDEDGLQMMTTTAATKKESMDSS--LFGKGRYKFWVLAAMLLQVFWSMYNGTVSLHWFG  58

Query  344  SLNRVSDSSGFPLHddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEM  520
            +LN +S     P+HDDLDVLE+EE+EKVVR MWDV T +   RLP+FWQE F+AAY+++
Sbjct  59   TLNSLSSDINTPIHDDLDVLEMEEREKVVRNMWDVCTNNHRVRLPRFWQEVFKAAYKDL  117



>gb|KHG25088.1| Protein FAM75A4 [Gossypium arboreum]
Length=176

 Score = 93.2 bits (230),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 81/105 (77%), Gaps = 7/105 (7%)
 Frame = +2

Query  224  KEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL-----SLNRVSDSSGFPLHd  388
            K+  SD    LFG+G+YK W + AILLLAFWSMFTG++TL     +LNR SD     +HD
Sbjct  22   KKESSDSS--LFGKGRYKFWALAAILLLAFWSMFTGTVTLRWSAGNLNRFSDDFDSHIHD  79

Query  389  dldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
            DLDVLE+EE+EKVV+ MWDVYT SR  RLP+FWQEAFEAAYEE+T
Sbjct  80   DLDVLEMEEREKVVKHMWDVYTNSRRIRLPRFWQEAFEAAYEELT  124



>ref|XP_008220784.1| PREDICTED: uncharacterized protein LOC103320830 isoform X1 [Prunus 
mume]
Length=198

 Score = 93.6 bits (231),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 75/101 (74%), Gaps = 8/101 (8%)
 Frame = +2

Query  245  GHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL-----SLNRVSDSSGFPLHddldvlev  409
            G     + +YK WV+ AILLLAFWSMFTGS+TL     +L R+SD    P  DDLD+LEV
Sbjct  39   GRSFLDKTRYKFWVLAAILLLAFWSMFTGSVTLRWSAGNLTRLSDDWDLPSFDDLDILEV  98

Query  410  eekekvvRQMWDVYTQ---SRSSRLPKFWQEAFEAAYEEMT  523
            EE+EKVVR MWD+YTQ   S S+RLP+FWQEAFEAAYE ++
Sbjct  99   EEREKVVRHMWDLYTQSSRSSSNRLPRFWQEAFEAAYEHLS  139



>gb|KJB43527.1| hypothetical protein B456_007G204600 [Gossypium raimondii]
Length=175

 Score = 92.8 bits (229),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 81/105 (77%), Gaps = 7/105 (7%)
 Frame = +2

Query  224  KEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL-----SLNRVSDSSGFPLHd  388
            K+  SD    LFG+G+YK W + AILLLAFWSMFTG++TL     +LNR SD     +HD
Sbjct  22   KKESSDSS--LFGKGRYKFWALAAILLLAFWSMFTGTVTLRWSAGNLNRFSDDFDSHIHD  79

Query  389  dldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
            DLDVLE+EE+EKVV+ MWDVYT SR  RLP+FWQEAFEAAYEE+T
Sbjct  80   DLDVLEMEEREKVVKHMWDVYTNSRRIRLPRFWQEAFEAAYEELT  124



>gb|KJB43528.1| hypothetical protein B456_007G204600 [Gossypium raimondii]
Length=176

 Score = 92.8 bits (229),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 81/105 (77%), Gaps = 7/105 (7%)
 Frame = +2

Query  224  KEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL-----SLNRVSDSSGFPLHd  388
            K+  SD    LFG+G+YK W + AILLLAFWSMFTG++TL     +LNR SD     +HD
Sbjct  22   KKESSDSS--LFGKGRYKFWALAAILLLAFWSMFTGTVTLRWSAGNLNRFSDDFDSHIHD  79

Query  389  dldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
            DLDVLE+EE+EKVV+ MWDVYT SR  RLP+FWQEAFEAAYEE+T
Sbjct  80   DLDVLEMEEREKVVKHMWDVYTNSRRIRLPRFWQEAFEAAYEELT  124



>ref|XP_008220785.1| PREDICTED: uncharacterized protein LOC103320830 isoform X2 [Prunus 
mume]
Length=182

 Score = 92.8 bits (229),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 75/101 (74%), Gaps = 8/101 (8%)
 Frame = +2

Query  245  GHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL-----SLNRVSDSSGFPLHddldvlev  409
            G     + +YK WV+ AILLLAFWSMFTGS+TL     +L R+SD    P  DDLD+LEV
Sbjct  39   GRSFLDKTRYKFWVLAAILLLAFWSMFTGSVTLRWSAGNLTRLSDDWDLPSFDDLDILEV  98

Query  410  eekekvvRQMWDVYTQ---SRSSRLPKFWQEAFEAAYEEMT  523
            EE+EKVVR MWD+YTQ   S S+RLP+FWQEAFEAAYE ++
Sbjct  99   EEREKVVRHMWDLYTQSSRSSSNRLPRFWQEAFEAAYEHLS  139



>ref|XP_007227275.1| hypothetical protein PRUPE_ppa017694mg, partial [Prunus persica]
 gb|EMJ28474.1| hypothetical protein PRUPE_ppa017694mg, partial [Prunus persica]
Length=117

 Score = 91.3 bits (225),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 61/100 (61%), Positives = 74/100 (74%), Gaps = 8/100 (8%)
 Frame = +2

Query  248  HGLFGRGKYKLWVILAILLLAFWSMFTGSLTL-----SLNRVSDSSGFPLHddldvleve  412
                 + +YK WV+ AILLLAFWSMFTGS+TL     +L R+SD    P  DDLD+LEVE
Sbjct  1    RSFLDKTRYKFWVLAAILLLAFWSMFTGSVTLKWSAGNLTRLSDDLDLPSFDDLDILEVE  60

Query  413  ekekvvRQMWDVYTQ---SRSSRLPKFWQEAFEAAYEEMT  523
            E+EKVVR MWD+YTQ   S S+RLP+FWQEAFEAAYE ++
Sbjct  61   EREKVVRHMWDLYTQSSRSSSNRLPRFWQEAFEAAYEHLS  100



>ref|XP_010939255.1| PREDICTED: uncharacterized protein LOC105058138 isoform X1 [Elaeis 
guineensis]
 ref|XP_010939256.1| PREDICTED: uncharacterized protein LOC105058138 isoform X1 [Elaeis 
guineensis]
Length=192

 Score = 92.8 bits (229),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 72/97 (74%), Gaps = 7/97 (7%)
 Frame = +2

Query  254  LFGRGKYKLWVILAILLLAFWSMFTGSLTL-----SLNRVSDSSGFP--LHddldvleve  412
            LFG+G+YK W + AI+LLAFWSMFTG++TL     +LNR+SD    P      LDVLE+E
Sbjct  21   LFGKGRYKFWALAAIILLAFWSMFTGTVTLKWSAGNLNRLSDDLLDPPLRDAALDVLEME  80

Query  413  ekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
            E+EKVVR MWD+Y  S   RLP+FWQEAFEAAYEE+ 
Sbjct  81   EREKVVRHMWDIYAHSLRIRLPRFWQEAFEAAYEELA  117



>ref|XP_010070047.1| PREDICTED: uncharacterized protein LOC104456867 [Eucalyptus grandis]
 gb|KCW58604.1| hypothetical protein EUGRSUZ_H01264 [Eucalyptus grandis]
Length=174

 Score = 91.7 bits (226),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 67/125 (54%), Positives = 91/125 (73%), Gaps = 13/125 (10%)
 Frame = +2

Query  182  MKDEEAQVITSAGK------KEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL  343
            MKD+++  ++++        K  G D G  +FGRG+YK+W + AILLLAFWSMFTG++TL
Sbjct  1    MKDDDSLPLSTSSAAAAANAKREGPDSG--VFGRGRYKIWALAAILLLAFWSMFTGTVTL  58

Query  344  -----SLNRVSDSSGFPLHddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAA  508
                 +LNR SD    P+ DDLDVLE+EE+EK+V+ MWDVYT SR  R+ KFWQEAFEAA
Sbjct  59   RWSAGNLNRFSDDLDAPIRDDLDVLEMEEREKLVKHMWDVYTNSRRMRMHKFWQEAFEAA  118

Query  509  YEEMT  523
            +E+++
Sbjct  119  FEDLS  123



>ref|XP_010680806.1| PREDICTED: uncharacterized protein LOC104895866 [Beta vulgaris 
subsp. vulgaris]
Length=183

 Score = 91.7 bits (226),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 64/96 (67%), Positives = 77/96 (80%), Gaps = 5/96 (5%)
 Frame = +2

Query  251  GLFGRGKYKLWVILAILLLAFWSMFTGSLTL-----SLNRVSDSSGFPLHddldvlevee  415
             LFG+G+YK W + AILLLAFWSMFTG++TL     +LNR+SD    PL DDLDVLE+EE
Sbjct  34   SLFGKGRYKFWALAAILLLAFWSMFTGTVTLRWSAGNLNRLSDDLDTPLRDDLDVLEMEE  93

Query  416  kekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
            +EKVV+ MWDVYT S   RLP+FWQ+AFEAAYE+MT
Sbjct  94   REKVVKYMWDVYTNSHRMRLPRFWQQAFEAAYEDMT  129



>gb|KJB58298.1| hypothetical protein B456_009G203200 [Gossypium raimondii]
Length=174

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 78/114 (68%), Gaps = 5/114 (4%)
 Frame = +2

Query  197  AQVITSAGKKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTLS-----LNRVS  361
            +Q + +    +  S    G  G+  YK WV+ AILLLAFWSMFTGS++L      L   S
Sbjct  16   SQQLATPSVVKKDSSVTAGFLGKSGYKFWVLAAILLLAFWSMFTGSVSLKWSSGHLTAFS  75

Query  362  DSSGFPLHddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
            D   F ++DDLDVLE+EE+EKVVR+MWDVYT S S RLP+FW EAFEAAYE ++
Sbjct  76   DDIDFSVYDDLDVLELEEREKVVRKMWDVYTHSASVRLPRFWLEAFEAAYEYLS  129



>ref|XP_010531025.1| PREDICTED: uncharacterized protein LOC104807445 isoform X2 [Tarenaya 
hassleriana]
Length=156

 Score = 90.5 bits (223),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 76/96 (79%), Gaps = 5/96 (5%)
 Frame = +2

Query  251  GLFGRGKYKLWVILAILLLAFWSMFTGSLTL-----SLNRVSDSSGFPLHddldvlevee  415
             LFG+G+YK W + AILLLAFWSMF G++TL     +LNR+SD  GF  +D+LDVLE+EE
Sbjct  27   ALFGKGRYKFWALAAILLLAFWSMFAGTVTLRLSDGNLNRISDDLGFQSYDNLDVLEMEE  86

Query  416  kekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
            +EKVV+ MWDVYT     RLP+FWQEAFEAAYEE+T
Sbjct  87   REKVVKHMWDVYTNGHRIRLPRFWQEAFEAAYEELT  122



>dbj|BAA98184.1| unnamed protein product [Arabidopsis thaliana]
Length=159

 Score = 90.5 bits (223),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 79/110 (72%), Gaps = 8/110 (7%)
 Frame = +2

Query  209  TSAGKKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL-----SLNRVSDSSG  373
            T  GKKE G      LF +G+YK W + AILLLAFWSM TG++ L     ++N  +D   
Sbjct  18   TVTGKKETGYSA---LFSKGRYKFWALAAILLLAFWSMLTGTVNLRWSAGNINHFTDDLV  74

Query  374  FPLHddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
            FP+H+DLDVLE+EE+EKVV+ MWDVY   R  RLP+FWQEAFEAAYEE+T
Sbjct  75   FPIHEDLDVLEMEEREKVVKHMWDVYNNGRRIRLPRFWQEAFEAAYEELT  124



>gb|ABC69762.1| unknown [Vitis pseudoreticulata]
Length=173

 Score = 90.9 bits (224),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 66/114 (58%), Positives = 82/114 (72%), Gaps = 5/114 (4%)
 Frame = +2

Query  194  EAQVITSAGKKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL-----SLNRV  358
            E    T++  K H SD G+   G+G YK W + AILLLAFWSMFTGS+TL     +L+R 
Sbjct  2    EGNPATTSSMKMHSSDSGNSFGGKGGYKFWALAAILLLAFWSMFTGSVTLKWSASNLSRF  61

Query  359  SDSSGFPLHddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEM  520
             D    P HDDLDVLEVEE+EK+VR MWD+YT + +SRLP+FW+EAFEAAY E+
Sbjct  62   PDDIDSPTHDDLDVLEVEEREKLVRYMWDLYTHTTTSRLPRFWEEAFEAAYMEL  115



>gb|KHF97827.1| Serine--tRNA ligase [Gossypium arboreum]
 gb|KJB58297.1| hypothetical protein B456_009G203200 [Gossypium raimondii]
Length=182

 Score = 90.9 bits (224),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 78/114 (68%), Gaps = 5/114 (4%)
 Frame = +2

Query  197  AQVITSAGKKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTLS-----LNRVS  361
            +Q + +    +  S    G  G+  YK WV+ AILLLAFWSMFTGS++L      L   S
Sbjct  16   SQQLATPSVVKKDSSVTAGFLGKSGYKFWVLAAILLLAFWSMFTGSVSLKWSSGHLTAFS  75

Query  362  DSSGFPLHddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
            D   F ++DDLDVLE+EE+EKVVR+MWDVYT S S RLP+FW EAFEAAYE ++
Sbjct  76   DDIDFSVYDDLDVLELEEREKVVRKMWDVYTHSASVRLPRFWLEAFEAAYEYLS  129



>emb|CDP07532.1| unnamed protein product [Coffea canephora]
Length=188

 Score = 90.9 bits (224),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 81/106 (76%), Gaps = 8/106 (8%)
 Frame = +2

Query  221  KKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTLS-----LNRVSDSS-GFPL  382
            KKE  S+GG    GR KYK W + AILLLAFWSMFTGS+TL      LN VSD     PL
Sbjct  25   KKEGSSEGG--FLGRSKYKFWALAAILLLAFWSMFTGSVTLKWSSVHLNHVSDDLFDSPL  82

Query  383  HddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEM  520
            H DLD+LEVEE+EK+VR++WDVYTQS++ +LP FWQEAFEAAYE++
Sbjct  83   HHDLDILEVEEREKMVRRLWDVYTQSKTVKLPIFWQEAFEAAYEDL  128



>gb|KJB63685.1| hypothetical protein B456_010G010700 [Gossypium raimondii]
Length=179

 Score = 90.5 bits (223),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 59/116 (51%), Positives = 78/116 (67%), Gaps = 5/116 (4%)
 Frame = +2

Query  191  EEAQVITSAGKKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL-----SLNR  355
            ++A  +    K    +    G FG+  YK WV+ AI+LLAFWSMFTGS++L     +L  
Sbjct  18   QQATALAPLKKYSSSTSAIAGFFGKNGYKFWVLTAIILLAFWSMFTGSVSLKWSSGNLTS  77

Query  356  VSDSSGFPLHddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
             S    F + +DLDVLE+EE+EKVVR+MWDVYT S S RLP+FW +AFEAAYE ++
Sbjct  78   FSYDFDFSIREDLDVLELEEREKVVRKMWDVYTHSTSIRLPRFWLDAFEAAYENLS  133



>ref|XP_002521583.1| sugar transporter, putative [Ricinus communis]
 gb|EEF40854.1| sugar transporter, putative [Ricinus communis]
Length=382

 Score = 92.8 bits (229),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 65/105 (62%), Positives = 82/105 (78%), Gaps = 7/105 (7%)
 Frame = +2

Query  224  KEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL-----SLNRVSDSSGFPLHd  388
            K+  SD    +FG+G+YK W + AILLLAFWSMFTG++TL     +LNR+SD    P+HD
Sbjct  222  KKESSD--SSVFGKGRYKFWALAAILLLAFWSMFTGTVTLRWSAGNLNRLSDDIDAPIHD  279

Query  389  dldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
            DLDVLE+EE+E+VV+ MWDVYT S   RLP+FWQEAFEAAYE++T
Sbjct  280  DLDVLEMEERERVVKHMWDVYTNSHRIRLPRFWQEAFEAAYEDLT  324



>ref|XP_009787249.1| PREDICTED: uncharacterized protein LOC104235226 [Nicotiana sylvestris]
Length=182

 Score = 90.5 bits (223),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 66/128 (52%), Positives = 86/128 (67%), Gaps = 14/128 (11%)
 Frame = +2

Query  182  MKDEEAQVITSAGKKE---------HGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGS  334
            MKD+E+  +++                S     +FGRG+YK W + AILLLAFWSMFTG+
Sbjct  1    MKDDESIPVSTPTTHSSSNTISTYSKNSTSDATIFGRGRYKFWALAAILLLAFWSMFTGT  60

Query  335  LTL-----SLNRVSDSSGFPLHddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAF  499
            +TL     +LN +SD    PL D+LDV+E+EE+EK+V+ MWDVYT +   RLPKFWQEAF
Sbjct  61   VTLRWSAGNLNGLSDYFNVPLSDNLDVIEMEEREKLVKHMWDVYTNTPRIRLPKFWQEAF  120

Query  500  EAAYEEMT  523
            EAAYEE+T
Sbjct  121  EAAYEELT  128



>ref|XP_010531023.1| PREDICTED: uncharacterized protein LOC104807445 isoform X1 [Tarenaya 
hassleriana]
Length=176

 Score = 90.1 bits (222),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 76/96 (79%), Gaps = 5/96 (5%)
 Frame = +2

Query  251  GLFGRGKYKLWVILAILLLAFWSMFTGSLTL-----SLNRVSDSSGFPLHddldvlevee  415
             LFG+G+YK W + AILLLAFWSMF G++TL     +LNR+SD  GF  +D+LDVLE+EE
Sbjct  27   ALFGKGRYKFWALAAILLLAFWSMFAGTVTLRLSDGNLNRISDDLGFQSYDNLDVLEMEE  86

Query  416  kekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
            +EKVV+ MWDVYT     RLP+FWQEAFEAAYEE+T
Sbjct  87   REKVVKHMWDVYTNGHRIRLPRFWQEAFEAAYEELT  122



>gb|KDP27567.1| hypothetical protein JCGZ_20030 [Jatropha curcas]
Length=187

 Score = 90.1 bits (222),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 81/108 (75%), Gaps = 7/108 (6%)
 Frame = +2

Query  215  AGKKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL-----SLNRVSDSSGFP  379
            A  K+  SD    LFG+G+YK W + AILLLAFWSMFTG++TL     +LN + D    P
Sbjct  24   ANAKKDSSDSI--LFGKGRYKFWALAAILLLAFWSMFTGTVTLRWSSGNLNSLYDDIDAP  81

Query  380  LHddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
            +HDDLDVLE+EE+EKVV+ MWDVYT SR  RLP+FW EAFEAAYEE+T
Sbjct  82   IHDDLDVLEMEEREKVVKHMWDVYTNSRRIRLPRFWLEAFEAAYEELT  129



>ref|XP_006593126.1| PREDICTED: uncharacterized protein LOC100783879 [Glycine max]
Length=488

 Score = 93.6 bits (231),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 83/119 (70%), Gaps = 8/119 (7%)
 Frame = +2

Query  182  MKDEEA--QVITSAGKKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL----  343
            MKDE+    + T+A  K+   D    LFG+G+YK WV+ A+LL  FWSM+ G+++L    
Sbjct  1    MKDEDGLQMMTTTAATKKESMDSS--LFGKGRYKFWVLAAMLLQVFWSMYNGTVSLHWFG  58

Query  344  SLNRVSDSSGFPLHddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEM  520
            +LN +S     P+HDDLDVLE+EE+EKVVR MWDV T +   RLP+FWQE F+AAY+++
Sbjct  59   TLNSLSSDINTPIHDDLDVLEMEEREKVVRNMWDVCTNNHRVRLPRFWQEVFKAAYKDL  117



>ref|NP_569015.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAM61360.1| unknown [Arabidopsis thaliana]
 gb|AAO22636.1| unknown protein [Arabidopsis thaliana]
 gb|AAO42441.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43048.1| putative protein [Arabidopsis thaliana]
 dbj|BAD44480.1| putative protein [Arabidopsis thaliana]
 gb|AED98082.1| uncharacterized protein AT5G65650 [Arabidopsis thaliana]
Length=185

 Score = 90.1 bits (222),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 79/110 (72%), Gaps = 8/110 (7%)
 Frame = +2

Query  209  TSAGKKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL-----SLNRVSDSSG  373
            T  GKKE G      LF +G+YK W + AILLLAFWSM TG++ L     ++N  +D   
Sbjct  18   TVTGKKETGYSA---LFSKGRYKFWALAAILLLAFWSMLTGTVNLRWSAGNINHFTDDLV  74

Query  374  FPLHddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
            FP+H+DLDVLE+EE+EKVV+ MWDVY   R  RLP+FWQEAFEAAYEE+T
Sbjct  75   FPIHEDLDVLEMEEREKVVKHMWDVYNNGRRIRLPRFWQEAFEAAYEELT  124



>ref|XP_006393868.1| hypothetical protein EUTSA_v10004972mg [Eutrema salsugineum]
 gb|ESQ31154.1| hypothetical protein EUTSA_v10004972mg [Eutrema salsugineum]
Length=188

 Score = 90.1 bits (222),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 63/111 (57%), Positives = 80/111 (72%), Gaps = 8/111 (7%)
 Frame = +2

Query  206  ITSAGKKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL-----SLNRVSDSS  370
            ++S  KKE G      LF +G+YK W + AILLLAFWSM TG++ L     ++N  +D  
Sbjct  20   VSSNAKKESGYSA---LFAKGRYKFWALAAILLLAFWSMLTGTVNLRWSAGNINHFTDDL  76

Query  371  GFPLHddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
             FP+H+DLDVLE+EE+EKVV+ MWDVY   R  RLP+FWQEAFEAAYEE+T
Sbjct  77   VFPIHEDLDVLEMEEREKVVKHMWDVYNNGRRIRLPRFWQEAFEAAYEELT  127



>ref|XP_008785651.1| PREDICTED: uncharacterized protein LOC103704228 [Phoenix dactylifera]
Length=177

 Score = 89.7 bits (221),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 71/97 (73%), Gaps = 7/97 (7%)
 Frame = +2

Query  254  LFGRGKYKLWVILAILLLAFWSMFTGSLTL-----SLNRVSDSSGFPL--Hddldvleve  412
            LFG+G+YK W + AI+LLAFWSM TG++TL     SLNR SD    P     DLDVLE+E
Sbjct  21   LFGKGRYKFWALAAIILLAFWSMLTGTVTLKWSAGSLNRFSDDLLDPPLRDADLDVLEME  80

Query  413  ekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
            E+EKVVR MWD+Y  S   RLP+FWQ+AFEAAYEE+ 
Sbjct  81   EREKVVRHMWDIYAHSLRIRLPRFWQQAFEAAYEELA  117



>gb|KJB63684.1| hypothetical protein B456_010G010700 [Gossypium raimondii]
 gb|KJB63686.1| hypothetical protein B456_010G010700 [Gossypium raimondii]
 gb|KJB63687.1| hypothetical protein B456_010G010700 [Gossypium raimondii]
Length=194

 Score = 89.7 bits (221),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 59/116 (51%), Positives = 78/116 (67%), Gaps = 5/116 (4%)
 Frame = +2

Query  191  EEAQVITSAGKKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL-----SLNR  355
            ++A  +    K    +    G FG+  YK WV+ AI+LLAFWSMFTGS++L     +L  
Sbjct  18   QQATALAPLKKYSSSTSAIAGFFGKNGYKFWVLTAIILLAFWSMFTGSVSLKWSSGNLTS  77

Query  356  VSDSSGFPLHddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
             S    F + +DLDVLE+EE+EKVVR+MWDVYT S S RLP+FW +AFEAAYE ++
Sbjct  78   FSYDFDFSIREDLDVLELEEREKVVRKMWDVYTHSTSIRLPRFWLDAFEAAYENLS  133



>ref|XP_011025752.1| PREDICTED: uncharacterized protein LOC105126554 [Populus euphratica]
Length=171

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 87/120 (73%), Gaps = 8/120 (7%)
 Frame = +2

Query  182  MKDEEAQVITSA-GKKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL-----  343
            MK++++   T+A   K+  SD    LFG+G+YK W + AILLLAFWSM TG++TL     
Sbjct  1    MKEDDSLPTTTALSVKKETSDSV--LFGKGRYKFWALAAILLLAFWSMLTGTVTLRWSAG  58

Query  344  SLNRVSDSSGFPLHddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
            +LN + D    P+ DDLDVLE+E++EKVV+ MWD+YT S   RLPKFWQEAFEAAYEE+T
Sbjct  59   NLNSLVDDIDTPIRDDLDVLEMEDREKVVKHMWDIYTNSHRIRLPKFWQEAFEAAYEELT  118



>ref|XP_002282877.1| PREDICTED: uncharacterized protein LOC100264357 [Vitis vinifera]
 emb|CBI19682.3| unnamed protein product [Vitis vinifera]
Length=173

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 82/114 (72%), Gaps = 5/114 (4%)
 Frame = +2

Query  194  EAQVITSAGKKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL-----SLNRV  358
            E    T++  K H S+ G+   G+G YK W + AILLLAFWSMFTGS+TL     +L+R 
Sbjct  2    EGNPATTSSMKMHSSESGNSFGGKGGYKFWALAAILLLAFWSMFTGSVTLKWSASNLSRF  61

Query  359  SDSSGFPLHddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEM  520
             D    P HDDLDVLEVEE+EK+VR MWD+YT + +SRLP+FW+EAFEAAY E+
Sbjct  62   PDDIDSPTHDDLDVLEVEEREKLVRYMWDLYTHTTTSRLPRFWEEAFEAAYMEL  115



>ref|XP_004234561.1| PREDICTED: uncharacterized protein LOC101254457 isoform X1 [Solanum 
lycopersicum]
Length=182

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 70/95 (74%), Gaps = 5/95 (5%)
 Frame = +2

Query  254  LFGRGKYKLWVILAILLLAFWSMFTGSLTL-----SLNRVSDSSGFPLHddldvleveek  418
            LFGRG+YK W + AIL LAFWSM TG+++L     +LN +SD    P  DDLDVLE+E++
Sbjct  34   LFGRGRYKFWALAAILFLAFWSMCTGTVSLRWSAGNLNSLSDLFDIPKSDDLDVLEMEDR  93

Query  419  ekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
            EK+V  MWDVYT S   R+ KFWQEAFEAAYEE+ 
Sbjct  94   EKLVNHMWDVYTNSPRIRILKFWQEAFEAAYEELN  128



>ref|XP_002510368.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF52555.1| conserved hypothetical protein [Ricinus communis]
Length=184

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 59/96 (61%), Positives = 72/96 (75%), Gaps = 6/96 (6%)
 Frame = +2

Query  251  GLFGRGKYKLWVILAILLLAFWSMFTGSLTL-----SLNRVSDSSGFP-LHddldvleve  412
            G  G+ +YK WV+ AILLLAFWSMFTGS+TL      L   S+  GF  L DDLD+LE+E
Sbjct  35   GFSGKTRYKFWVLAAILLLAFWSMFTGSVTLEWSAGKLTHPSEDLGFATLDDDLDILEIE  94

Query  413  ekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEM  520
            EKEK+V+ MWD+YT S S++LP FWQEAFEAAYE +
Sbjct  95   EKEKLVKHMWDIYTHSTSTKLPHFWQEAFEAAYESL  130



>gb|KFK28355.1| hypothetical protein AALP_AA8G505100 [Arabis alpina]
Length=184

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 79/108 (73%), Gaps = 8/108 (7%)
 Frame = +2

Query  215  AGKKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL-----SLNRVSDSSGFP  379
            + KKE+G      LF +G+YK W + AILLLAFWSM TG++ L     ++N  +D   FP
Sbjct  21   SAKKENGYSA---LFAKGRYKFWALAAILLLAFWSMLTGTVNLRWSAGNINHFTDDLVFP  77

Query  380  LHddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
            +H+DLDVLE+EE+EKVV+ MWDVY   R  RLP+FWQEAFEAAYEE+T
Sbjct  78   IHEDLDVLEMEEREKVVKHMWDVYNNGRRIRLPRFWQEAFEAAYEELT  125



>gb|EYU45139.1| hypothetical protein MIMGU_mgv1a014622mg [Erythranthe guttata]
Length=184

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 63/129 (49%), Positives = 81/129 (63%), Gaps = 16/129 (12%)
 Frame = +2

Query  182  MKDEEAQV-------ITSAG----KKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFT  328
            M+DEE Q           AG    KK+ G  G  GLFG+GKYKLW +  I+LLA WSMFT
Sbjct  1    MRDEETQTNPSSSSSTNLAGSFSIKKDGGGSGFEGLFGKGKYKLWALTVIILLAVWSMFT  60

Query  329  GSLTLS-----LNRVSDSSGFPLHddldvleveekekvvRQMWDVYTQSRSSRLPKFWQE  493
            GS+TL      L   S      +H DLDVL+V+E+EK+VRQMW+VY  +   RLP FW++
Sbjct  61   GSVTLKWSSVYLKHSSLDLDQSIHGDLDVLDVDEREKMVRQMWNVYKHNSIVRLPSFWRD  120

Query  494  AFEAAYEEM  520
            AF AAY+++
Sbjct  121  AFGAAYQDL  129



>ref|XP_010464966.1| PREDICTED: uncharacterized protein LOC104745426 [Camelina sativa]
Length=186

 Score = 88.6 bits (218),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 78/106 (74%), Gaps = 7/106 (7%)
 Frame = +2

Query  221  KKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL-----SLNRVSDSSGFPLH  385
            KKE G  G   LF +G+YK W + AILLLAFWSM TG++ L     ++N  +D   FP+H
Sbjct  22   KKETG--GYSALFSKGRYKFWALAAILLLAFWSMLTGTVNLRWSAGNINHFTDDLIFPIH  79

Query  386  ddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
            +DLDVLE+EE+EKVV+ MWDVY   R  RLP+FWQEAFEAAYEE+T
Sbjct  80   EDLDVLEMEEREKVVKHMWDVYNNGRRIRLPRFWQEAFEAAYEELT  125



>emb|CDP02042.1| unnamed protein product [Coffea canephora]
Length=191

 Score = 88.6 bits (218),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 61/103 (59%), Positives = 78/103 (76%), Gaps = 8/103 (8%)
 Frame = +2

Query  239  DGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL-----SLNRVS--DSSGFPLHddld  397
            D  + +FGRG+YK W + AI+LLAFWS+ TG++TL     +LN++S  DS  FPL DDLD
Sbjct  35   DHSYLIFGRGRYKFWALAAIILLAFWSILTGTVTLRWSAANLNQLSNRDSLDFPLPDDLD  94

Query  398  vleveekekvvRQMWDVYTQS-RSSRLPKFWQEAFEAAYEEMT  523
            VLE+EE+EKVVR MWDVYT S R  RL KFW++AF++AYE M 
Sbjct  95   VLEMEEREKVVRHMWDVYTSSNRRIRLAKFWEDAFKSAYEYMN  137



>gb|KHG00293.1| Gamma-aminobutyric acid receptor alpha-like protein [Gossypium 
arboreum]
Length=194

 Score = 88.6 bits (218),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 72/96 (75%), Gaps = 5/96 (5%)
 Frame = +2

Query  251  GLFGRGKYKLWVILAILLLAFWSMFTGSLTL-----SLNRVSDSSGFPLHddldvlevee  415
            G FG+  YK WV+ AI+LLAFWSMFTGS++L     +L   S  S F + +DLDVLE+EE
Sbjct  38   GFFGKNGYKFWVLTAIILLAFWSMFTGSVSLKWSSGNLTSFSYDSDFSIREDLDVLELEE  97

Query  416  kekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
            +EKVVR+MW VYT S S RLP+FW +AFEAAYE ++
Sbjct  98   REKVVRKMWHVYTHSTSIRLPRFWLDAFEAAYENLS  133



>ref|XP_009103491.1| PREDICTED: uncharacterized protein LOC103829572 [Brassica rapa]
 emb|CDY53850.1| BnaA07g37450D [Brassica napus]
Length=182

 Score = 88.2 bits (217),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 83/121 (69%), Gaps = 7/121 (6%)
 Frame = +2

Query  182  MKDEEAQVIT--SAGKKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL----  343
            MKD +   ++  SA       +G   LF +G+YK W + AILLLAFWSM TG++ L    
Sbjct  1    MKDADTLPLSTSSAAANAKKENGYSALFSKGRYKFWALAAILLLAFWSMLTGTVNLRWSA  60

Query  344  -SLNRVSDSSGFPLHddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEM  520
             +++  +D   FP+H+DLDVLE+EE+EKVV+ MWDVY   R  RLP+FWQEAFEAAYEE+
Sbjct  61   GNISHFTDDLVFPIHEDLDVLEMEEREKVVKHMWDVYNNGRRIRLPRFWQEAFEAAYEEL  120

Query  521  T  523
            T
Sbjct  121  T  121



>gb|KHN00553.1| hypothetical protein glysoja_000221 [Glycine soja]
Length=173

 Score = 87.8 bits (216),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 86/118 (73%), Gaps = 13/118 (11%)
 Frame = +2

Query  182  MKDEEAQVITSAGKKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL----SL  349
            MKD+E   I     K+  SD G  LFGRG YK W + A+LLLAFWSMFTG+++L    +L
Sbjct  1    MKDKETFPIA----KKEASDSG--LFGRGSYKFWALAAMLLLAFWSMFTGTVSLRWSGTL  54

Query  350  NRVSDSSGFPLHddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
            N  S +S   LHD LDVLE+EE+EK+VR MWDVYT +R  RLP+FW++AFEAAYE++T
Sbjct  55   NTFSHAS---LHDHLDVLEIEEREKLVRHMWDVYTNNRRIRLPRFWEKAFEAAYEDLT  109



>ref|XP_002864968.1| hypothetical protein ARALYDRAFT_919901 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41227.1| hypothetical protein ARALYDRAFT_919901 [Arabidopsis lyrata subsp. 
lyrata]
Length=185

 Score = 87.8 bits (216),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 78/110 (71%), Gaps = 8/110 (7%)
 Frame = +2

Query  209  TSAGKKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL-----SLNRVSDSSG  373
            T   KKE G      LF +G+YK W + AILLLAFWSM TG++ L     ++N  +D   
Sbjct  18   TVNAKKETGYSA---LFSKGRYKFWALAAILLLAFWSMLTGTVNLRWSAGNINHFTDDLV  74

Query  374  FPLHddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
            FP+H+DLDVLE+EE+EKVV+ MWDVY   R  RLP+FWQEAFEAAYEE+T
Sbjct  75   FPIHEDLDVLEMEEREKVVKHMWDVYNNGRRIRLPRFWQEAFEAAYEELT  124



>ref|XP_010444743.1| PREDICTED: uncharacterized protein LOC104727358 [Camelina sativa]
Length=186

 Score = 87.4 bits (215),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 78/106 (74%), Gaps = 7/106 (7%)
 Frame = +2

Query  221  KKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL-----SLNRVSDSSGFPLH  385
            KKE  + G   LF +G+YK W + AILLLAFWSM TG++ L     ++N  +D   FP+H
Sbjct  22   KKE--TSGYSALFSKGRYKFWALAAILLLAFWSMLTGTVNLRWSAGNINHFTDDLVFPIH  79

Query  386  ddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
            +DLDVLE+EE+EKVV+ MWDVY   R  RLP+FWQEAFEAAYEE+T
Sbjct  80   EDLDVLEMEEREKVVKHMWDVYNNGRRIRLPRFWQEAFEAAYEELT  125



>ref|XP_011074529.1| PREDICTED: uncharacterized protein LOC105159234 [Sesamum indicum]
Length=170

 Score = 87.0 bits (214),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 61/127 (48%), Positives = 80/127 (63%), Gaps = 13/127 (10%)
 Frame = +2

Query  182  MKDEEAQ------VITSAGKKEHGSDGG--HGLFGRGKYKLWVILAILLLAFWSMFTGSL  337
            M+DEEAQ        + A       DG    G+ GRG+YKLW + AI LLA WSMFTGS+
Sbjct  1    MRDEEAQKPWTSPTSSPAASFSTKKDGSVLEGVCGRGRYKLWALGAIFLLAIWSMFTGSV  60

Query  338  TLSLNRV-----SDSSGFPLHddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFE  502
            TL  + V     S   G  +H DLD+L+V+E+EK+VRQMWD Y  S +  LP FW++AF 
Sbjct  61   TLKSSDVIIKHPSQDLGSSIHGDLDILDVDEREKMVRQMWDAYKHSSTISLPSFWRDAFG  120

Query  503  AAYEEMT  523
            AAY+++T
Sbjct  121  AAYQDLT  127



>ref|XP_004291885.1| PREDICTED: uncharacterized protein LOC101301938 [Fragaria vesca 
subsp. vesca]
Length=196

 Score = 87.4 bits (215),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 75/99 (76%), Gaps = 12/99 (12%)
 Frame = +2

Query  263  RGKYKLWVILAILLLAFWSMFTGSLTL-----SLNRVSDSSGFPLHddldvleveekekv  427
            + +YKLWV+ AILLLAFWSMFTGS+TL     +L  +SD    P +DDLD+LEVE++EKV
Sbjct  42   KNRYKLWVLAAILLLAFWSMFTGSVTLRWSAGNLTGLSDDLNIPTYDDLDILEVEDREKV  101

Query  428  vRQMWDVYTQSRS-------SRLPKFWQEAFEAAYEEMT  523
            VR +WD+YTQ +S       +RLP+FWQEAFEAAY+ ++
Sbjct  102  VRHLWDLYTQRQSGSGRKSTTRLPRFWQEAFEAAYDPLS  140



>emb|CDY30757.1| BnaC07g16570D [Brassica napus]
Length=185

 Score = 87.0 bits (214),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 80/114 (70%), Gaps = 8/114 (7%)
 Frame = +2

Query  197  AQVITSAGKKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL-----SLNRVS  361
            A   T   KKE+G      LF +G+YK W + AILLLAFWSM TG++ L     +++  +
Sbjct  14   AAASTGNAKKENGYSA---LFAKGRYKFWALAAILLLAFWSMLTGTVNLRWSAGNISHFT  70

Query  362  DSSGFPLHddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
            D   FP+H+DLDVLE+EE+EKVV+ MWDVY   R  RLP+FWQEAFEAAYEE+T
Sbjct  71   DDLVFPIHEDLDVLEMEEREKVVKHMWDVYNNGRRIRLPRFWQEAFEAAYEELT  124



>ref|XP_008357183.1| PREDICTED: uncharacterized protein LOC103420925 [Malus domestica]
 ref|XP_008364977.1| PREDICTED: uncharacterized protein LOC103428637 [Malus domestica]
Length=188

 Score = 84.7 bits (208),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 74/100 (74%), Gaps = 9/100 (9%)
 Frame = +2

Query  251  GLF-GRGKYKLWVILAILLLAFWSMFTGSLTL-----SLNRVSDSSGFPLHddldvleve  412
            G+F  + +YK  V+ AILLLAFWS+FTG +TL     +L+ VSD    P  DDLD+LEVE
Sbjct  31   GVFLDKNRYKFSVLAAILLLAFWSIFTGCVTLKWSAGNLSHVSDDLDIPTFDDLDILEVE  90

Query  413  ekekvvRQMWDVYTQS---RSSRLPKFWQEAFEAAYEEMT  523
            E+E VVR MWD+YTQS    +SRLP+FWQEAFEAA+E ++
Sbjct  91   ERETVVRHMWDLYTQSSRTSTSRLPRFWQEAFEAAFEHLS  130



>emb|CDX72594.1| BnaC07g46160D [Brassica napus]
Length=681

 Score = 88.6 bits (218),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 65/119 (55%), Positives = 86/119 (72%), Gaps = 8/119 (7%)
 Frame = +2

Query  182  MKDEEAQVITSAGKKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL-----S  346
            MK+ +A   T+  KKEH       LFGRG+YK +   A+LLLAFWSMFTG++TL     +
Sbjct  514  MKEGDALPTTANSKKEHSETV---LFGRGRYKFYAFAALLLLAFWSMFTGTVTLRLSTGN  570

Query  347  LNRVSDSSGFPLHddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
            LNR+S+  G   +D LD LE+E++E+VV++MWDVYT SR  +LP+FWQEAF AAYEE+T
Sbjct  571  LNRLSEDLGVRNYDHLDALEMEKRERVVKRMWDVYTNSRRIKLPQFWQEAFVAAYEELT  629



>ref|XP_009364539.1| PREDICTED: uncharacterized protein LOC103954431 [Pyrus x bretschneideri]
Length=183

 Score = 84.7 bits (208),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 61/104 (59%), Positives = 74/104 (71%), Gaps = 8/104 (8%)
 Frame = +2

Query  236  SDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL-----SLNRVSDSSGFPLHddldv  400
            S    G   + +YK  V+ AILLLAFWSMFTG +TL     +L+ +SD    P  DDLD+
Sbjct  27   SSKAGGFLDKNRYKFSVLAAILLLAFWSMFTGCVTLKWSAGNLSHLSDDLDIPTFDDLDI  86

Query  401  leveekekvvRQMWDVYTQ---SRSSRLPKFWQEAFEAAYEEMT  523
            LEVEE+EKVVRQMWD+YTQ   S +SRLP FWQEAFEAAYE ++
Sbjct  87   LEVEEREKVVRQMWDLYTQSSSSSTSRLPLFWQEAFEAAYEHLS  130



>ref|XP_006595581.1| PREDICTED: uncharacterized protein LOC100803339 isoform X1 [Glycine 
max]
Length=158

 Score = 83.6 bits (205),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 74/103 (72%), Gaps = 11/103 (11%)
 Frame = +2

Query  239  DGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL-----SLNRVSDSSGFPLHddldvl  403
            DG     G+G+YKLWV+ AI+LLA WSMFT SLTL     +LNR  DS+     +D DVL
Sbjct  5    DGTPQSAGKGQYKLWVLGAIILLALWSMFTASLTLKWSAGNLNRDFDSATL---NDFDVL  61

Query  404  eveekekvvRQMWDVYTQSRSSR---LPKFWQEAFEAAYEEMT  523
            EVEE+EKVVR+MWDVYTQS+S R   LP+FW +AF AAY+ + 
Sbjct  62   EVEEREKVVRRMWDVYTQSKSGRGSGLPRFWSDAFHAAYDHLV  104



>gb|AEI98625.1| hypothetical protein 111O18.12 [Coffea canephora]
Length=203

 Score = 84.3 bits (207),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 74/103 (72%), Gaps = 9/103 (9%)
 Frame = +2

Query  239  DGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL-----SLNRVS--DSSGFPLHddld  397
            D  + +FGRG+YK W + AI+LLAFWS+ TG++TL     +LN++S  DS  FPL  D  
Sbjct  35   DHSYLIFGRGRYKFWALAAIILLAFWSILTGTVTLRWSAANLNQLSKRDSLDFPL-PDDL  93

Query  398  vleveekekvvRQMWDVYTQS-RSSRLPKFWQEAFEAAYEEMT  523
             +E+EE+EKVVR MWDVYT S R  RL KFW++AF++AYE M 
Sbjct  94   DVEMEEREKVVRHMWDVYTSSNRRIRLAKFWEDAFKSAYEYMN  136



>gb|KHN20989.1| hypothetical protein glysoja_009297 [Glycine soja]
Length=161

 Score = 83.6 bits (205),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 74/103 (72%), Gaps = 11/103 (11%)
 Frame = +2

Query  239  DGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL-----SLNRVSDSSGFPLHddldvl  403
            DG     G+G+YKLWV+ AI+LLA WSMFT SLTL     +LNR  DS+     +D DVL
Sbjct  5    DGTPQSAGKGQYKLWVLGAIILLALWSMFTASLTLKWSAGNLNRDFDSATL---NDFDVL  61

Query  404  eveekekvvRQMWDVYTQSRSSR---LPKFWQEAFEAAYEEMT  523
            EVEE+EKVVR+MWDVYTQS+S R   LP+FW +AF AAY+ + 
Sbjct  62   EVEEREKVVRRMWDVYTQSKSGRGSGLPRFWSDAFHAAYDHLV  104



>ref|XP_010484713.1| PREDICTED: uncharacterized protein LOC104762987 [Camelina sativa]
Length=171

 Score = 83.2 bits (204),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 77/106 (73%), Gaps = 7/106 (7%)
 Frame = +2

Query  221  KKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL-----SLNRVSDSSGFPLH  385
            KKE G  G   LF +G+YK W + AILLLAFWSM TG++ L     ++N  ++   FP+ 
Sbjct  22   KKETG--GYSALFSKGRYKFWALAAILLLAFWSMLTGTVNLRWSAGNINHFTEDLVFPIP  79

Query  386  ddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
            +DLDVLE+EE+EKVV+ MWDVY   R  RLP+FWQEAFEAAYEE+T
Sbjct  80   EDLDVLEMEEREKVVKHMWDVYNNGRRIRLPRFWQEAFEAAYEELT  125



>ref|XP_010484594.1| PREDICTED: uncharacterized protein LOC104762894 [Camelina sativa]
Length=186

 Score = 83.6 bits (205),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 77/106 (73%), Gaps = 7/106 (7%)
 Frame = +2

Query  221  KKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL-----SLNRVSDSSGFPLH  385
            KKE G  G   LF +G+YK W + AILLLAFWSM TG++ L     ++N  ++   FP+ 
Sbjct  22   KKETG--GYSALFSKGRYKFWALAAILLLAFWSMLTGTVNLRWSAGNINHFTEDLVFPIP  79

Query  386  ddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
            +DLDVLE+EE+EKVV+ MWDVY   R  RLP+FWQEAFEAAYEE+T
Sbjct  80   EDLDVLEMEEREKVVKHMWDVYNNGRRIRLPRFWQEAFEAAYEELT  125



>ref|XP_009138437.1| PREDICTED: uncharacterized protein LOC103862481 [Brassica rapa]
 emb|CDY42699.1| BnaA03g53520D [Brassica napus]
Length=169

 Score = 83.2 bits (204),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 64/121 (53%), Positives = 86/121 (71%), Gaps = 10/121 (8%)
 Frame = +2

Query  182  MKDEEA--QVITSAGKKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL----  343
            MK+++A     T+  KKEH       LFGRG+YK +   A+LLLAFWSMFTG++TL    
Sbjct  1    MKEDDALPTTATANSKKEHSE---SVLFGRGRYKFYAFAALLLLAFWSMFTGTVTLRLST  57

Query  344  -SLNRVSDSSGFPLHddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEM  520
             +LNR+S+      +D LD LE+EE+E+VV++MWDVYT SR  +LP+FWQEAF AAY+E+
Sbjct  58   GNLNRLSEDLRVRNYDHLDALEMEERERVVKRMWDVYTNSRRIKLPQFWQEAFVAAYDEL  117

Query  521  T  523
            T
Sbjct  118  T  118



>ref|XP_002320589.2| hypothetical protein POPTR_0014s17990g [Populus trichocarpa]
 gb|EEE98904.2| hypothetical protein POPTR_0014s17990g [Populus trichocarpa]
Length=183

 Score = 82.4 bits (202),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 72/96 (75%), Gaps = 6/96 (6%)
 Frame = +2

Query  251  GLFGRGKYKLWVILAILLLAFWSMFTGSLTL-----SLNRVSDSSGFPLHddldvlevee  415
             L  + +YK WV+ AILLLAFWSMFTGS+TL      L++  D+ GF   DD+D+LEVEE
Sbjct  39   SLLCKTRYKFWVLSAILLLAFWSMFTGSITLKWSTGDLSQHPDNLGFQTQDDVDILEVEE  98

Query  416  kekvvRQMWDVYTQ-SRSSRLPKFWQEAFEAAYEEM  520
            K+K+V +MWDVYT  SR +RLP+FW+ AF+AAYE +
Sbjct  99   KKKLVWRMWDVYTHSSRGTRLPRFWERAFQAAYEAL  134



>ref|XP_004160032.1| PREDICTED: uncharacterized protein LOC101224396 [Cucumis sativus]
 gb|KGN62590.1| hypothetical protein Csa_2G361550 [Cucumis sativus]
Length=169

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 57/120 (48%), Positives = 77/120 (64%), Gaps = 8/120 (7%)
 Frame = +2

Query  182  MKDEEAQVITSAGKKEHGSDGGHGLF--GRGKYKLWVILAILLLAFWSMFTGSLTL----  343
            MK E +  + +A KK+  SD     F   + +YK W +  ILLLAFWSMFTGS++L    
Sbjct  1    MKSELSPTM-AALKKDTSSDSAFSFFLSKKARYKFWALAVILLLAFWSMFTGSVSLKWSA  59

Query  344  -SLNRVSDSSGFPLHddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEM  520
             +  R  D    P+ DDLD+LEVEE+E+ VR MW++YT     RLP+FW +AFEAAYE++
Sbjct  60   GTFARFYDGPLKPIFDDLDILEVEERERDVRHMWNLYTHGGGGRLPRFWSDAFEAAYEDL  119



>ref|XP_011012938.1| PREDICTED: uncharacterized protein LOC105117091 [Populus euphratica]
Length=187

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 70/96 (73%), Gaps = 6/96 (6%)
 Frame = +2

Query  251  GLFGRGKYKLWVILAILLLAFWSMFTGSLTL-----SLNRVSDSSGFPLHddldvlevee  415
             L  + +YK WV+ AILLLAFWSMFTGS+TL      L++  D+ GF   DD+D+L VEE
Sbjct  40   SLLCKTRYKFWVLSAILLLAFWSMFTGSITLKWSTGDLSQHPDNLGFQTQDDVDILVVEE  99

Query  416  kekvvRQMWDVYTQS-RSSRLPKFWQEAFEAAYEEM  520
            K+K+V +MWDVY  S R +RLP+FW+ AF+AAYE +
Sbjct  100  KKKLVWRMWDVYKHSNRGTRLPRFWERAFQAAYEAL  135



>gb|KFK44072.1| hypothetical protein AALP_AA1G212500 [Arabis alpina]
Length=153

 Score = 79.0 bits (193),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 69/91 (76%), Gaps = 4/91 (4%)
 Frame = +2

Query  263  RGKYKLWVILAILLLAFWSMFTGSLTLS----LNRVSDSSGFPLHddldvleveekekvv  430
            R  YKLWV++A+LLLAF SM TGS++L      + V    GFP+ DDLD+LE+EE+EKVV
Sbjct  27   RAGYKLWVLIAVLLLAFGSMLTGSVSLKGTGLFHSVDGEYGFPVGDDLDILEIEEREKVV  86

Query  431  RQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
            R MWDVY +S   ++P+FW+EAFEAAYE +T
Sbjct  87   RHMWDVYGRSGGIKVPRFWREAFEAAYEFLT  117



>ref|XP_008667655.1| PREDICTED: uncharacterized protein LOC100276045 isoform X1 [Zea 
mays]
 gb|ACN31558.1| unknown [Zea mays]
 tpg|DAA41383.1| TPA: hypothetical protein ZEAMMB73_276453 [Zea mays]
Length=164

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 74/96 (77%), Gaps = 6/96 (6%)
 Frame = +2

Query  251  GLFGRGKYKLWVILAILLLAFWSMFTGSLTLSLNRVSDSSGF-----PLHddldvlevee  415
             LFG+G+YK+W + AI LLA WSMF  S+TL L+ V  ++ F     PL D+LD LE+E+
Sbjct  37   ALFGKGRYKVWALAAIALLALWSMFAASVTLRLSSVDLATTFGDASDPLIDELDPLEMEQ  96

Query  416  kekvvRQMWDVYTQSRSS-RLPKFWQEAFEAAYEEM  520
            +EK+VR+MWDVYT++ +  RLP+FWQEAFEAAYEE+
Sbjct  97   REKLVRRMWDVYTRTDNHVRLPRFWQEAFEAAYEEL  132



>gb|ACG40814.1| hypothetical protein [Zea mays]
Length=164

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 74/96 (77%), Gaps = 6/96 (6%)
 Frame = +2

Query  251  GLFGRGKYKLWVILAILLLAFWSMFTGSLTLSLNRVSDSSGF-----PLHddldvlevee  415
             LFG+G+YK+W + AI LLA WSMF  S+TL L+ V  ++ F     PL D+LD LE+E+
Sbjct  37   ALFGKGRYKVWALAAIALLALWSMFAASVTLRLSSVDLATTFGDASDPLIDELDPLEMEQ  96

Query  416  kekvvRQMWDVYTQSRSS-RLPKFWQEAFEAAYEEM  520
            +EK+VR+MWDVYT++ +  RLP+FWQEAFEAAYEE+
Sbjct  97   REKLVRRMWDVYTRTDNHVRLPRFWQEAFEAAYEEL  132



>ref|XP_002463166.1| hypothetical protein SORBIDRAFT_02g038920 [Sorghum bicolor]
 gb|EER99687.1| hypothetical protein SORBIDRAFT_02g038920 [Sorghum bicolor]
Length=164

 Score = 76.3 bits (186),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 75/101 (74%), Gaps = 6/101 (6%)
 Frame = +2

Query  236  SDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTLSLNRVSDSSGF-----PLHddldv  400
            S G   LFG+G+YK+W + AI LLA WSMF  S+TL L+    ++ F     PL DDLD 
Sbjct  32   SSGEAALFGKGRYKVWALAAIALLALWSMFAASVTLRLSSGELAATFGDVSDPLIDDLDP  91

Query  401  leveekekvvRQMWDVYTQSRSS-RLPKFWQEAFEAAYEEM  520
            LE+E++EK+VR+MWDVYT++ +  RLP+FWQEAFEAAYEE+
Sbjct  92   LEMEQREKLVRRMWDVYTRTDNHVRLPRFWQEAFEAAYEEL  132



>ref|XP_009627619.1| PREDICTED: uncharacterized protein LOC104118125 isoform X3 [Nicotiana 
tomentosiformis]
Length=196

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 86/130 (66%), Gaps = 17/130 (13%)
 Frame = +2

Query  179  EMKDEEAQVITSAGKKEHGS----------DGGHGLFGRGKYKLWVILAILLLAFWSMFT  328
            EMKD++A  +++     H S          +  + LFGRG+YK W + AILLLAFWSM T
Sbjct  21   EMKDDDALPVSTPTA--HSSVIPTSTLPRKESSNSLFGRGRYKFWALAAILLLAFWSMLT  78

Query  329  GSLTL-----SLNRVSDSSGFPLHddldvleveekekvvRQMWDVYTQSRSSRLPKFWQE  493
            G++TL     +LN +SD     L +DLDVLE+EE+EK+V+++WDVYT +    L  FWQE
Sbjct  79   GTVTLRWSAGNLNGLSDDFDTHLPEDLDVLELEEREKLVKRLWDVYTNTHRIGLTTFWQE  138

Query  494  AFEAAYEEMT  523
            AFEAAYEE++
Sbjct  139  AFEAAYEELS  148



>ref|XP_009627627.1| PREDICTED: uncharacterized protein LOC104118125 isoform X4 [Nicotiana 
tomentosiformis]
Length=182

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 86/130 (66%), Gaps = 17/130 (13%)
 Frame = +2

Query  179  EMKDEEAQVITSAGKKEHGS----------DGGHGLFGRGKYKLWVILAILLLAFWSMFT  328
            EMKD++A  +++     H S          +  + LFGRG+YK W + AILLLAFWSM T
Sbjct  21   EMKDDDALPVSTPTA--HSSVIPTSTLPRKESSNSLFGRGRYKFWALAAILLLAFWSMLT  78

Query  329  GSLTL-----SLNRVSDSSGFPLHddldvleveekekvvRQMWDVYTQSRSSRLPKFWQE  493
            G++TL     +LN +SD     L +DLDVLE+EE+EK+V+++WDVYT +    L  FWQE
Sbjct  79   GTVTLRWSAGNLNGLSDDFDTHLPEDLDVLELEEREKLVKRLWDVYTNTHRIGLTTFWQE  138

Query  494  AFEAAYEEMT  523
            AFEAAYEE++
Sbjct  139  AFEAAYEELS  148



>ref|XP_009627612.1| PREDICTED: uncharacterized protein LOC104118125 isoform X2 [Nicotiana 
tomentosiformis]
Length=202

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 86/130 (66%), Gaps = 17/130 (13%)
 Frame = +2

Query  179  EMKDEEAQVITSAGKKEHGS----------DGGHGLFGRGKYKLWVILAILLLAFWSMFT  328
            EMKD++A  +++     H S          +  + LFGRG+YK W + AILLLAFWSM T
Sbjct  21   EMKDDDALPVSTPTA--HSSVIPTSTLPRKESSNSLFGRGRYKFWALAAILLLAFWSMLT  78

Query  329  GSLTL-----SLNRVSDSSGFPLHddldvleveekekvvRQMWDVYTQSRSSRLPKFWQE  493
            G++TL     +LN +SD     L +DLDVLE+EE+EK+V+++WDVYT +    L  FWQE
Sbjct  79   GTVTLRWSAGNLNGLSDDFDTHLPEDLDVLELEEREKLVKRLWDVYTNTHRIGLTTFWQE  138

Query  494  AFEAAYEEMT  523
            AFEAAYEE++
Sbjct  139  AFEAAYEELS  148



>ref|XP_004152705.1| PREDICTED: uncharacterized protein LOC101218892 [Cucumis sativus]
Length=177

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 51/129 (40%), Positives = 71/129 (55%), Gaps = 16/129 (12%)
 Frame = +2

Query  182  MKDEEAQVITSAGKKEHGSDGGHGLF--GRGKYKLWVILAILLLAFWSMFTGSLTL----  343
            MK E +  + +A KK+  SD     F   + +YK W +  ILLLAFWSMFTGS++L    
Sbjct  1    MKSELSPTM-AALKKDTSSDSAFSFFLSKKARYKFWALAVILLLAFWSMFTGSVSLKWSA  59

Query  344  ---------SLNRVSDSSGFPLHddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEA  496
                      L  + D     ++      EVEE+E+ VR MW++YT     RLP+FW +A
Sbjct  60   GTFARFYDGPLKPIFDDLDILVNLFSHFHEVEERERDVRHMWNLYTHGGGGRLPRFWSDA  119

Query  497  FEAAYEEMT  523
            FEAAYE++ 
Sbjct  120  FEAAYEDLI  128



>ref|XP_009627606.1| PREDICTED: uncharacterized protein LOC104118125 isoform X1 [Nicotiana 
tomentosiformis]
Length=233

 Score = 75.9 bits (185),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 86/130 (66%), Gaps = 17/130 (13%)
 Frame = +2

Query  179  EMKDEEAQVITSAGKKEHGS----------DGGHGLFGRGKYKLWVILAILLLAFWSMFT  328
            EMKD++A  +++     H S          +  + LFGRG+YK W + AILLLAFWSM T
Sbjct  21   EMKDDDALPVSTPTA--HSSVIPTSTLPRKESSNSLFGRGRYKFWALAAILLLAFWSMLT  78

Query  329  GSLTL-----SLNRVSDSSGFPLHddldvleveekekvvRQMWDVYTQSRSSRLPKFWQE  493
            G++TL     +LN +SD     L +DLDVLE+EE+EK+V+++WDVYT +    L  FWQE
Sbjct  79   GTVTLRWSAGNLNGLSDDFDTHLPEDLDVLELEEREKLVKRLWDVYTNTHRIGLTTFWQE  138

Query  494  AFEAAYEEMT  523
            AFEAAYEE++
Sbjct  139  AFEAAYEELS  148



>ref|NP_173371.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAF79423.1|AC025808_5 F18O14.10 [Arabidopsis thaliana]
 gb|AAS76218.1| At1g19380 [Arabidopsis thaliana]
 gb|AAS88771.1| At1g19380 [Arabidopsis thaliana]
 dbj|BAF00843.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE29841.1| uncharacterized protein AT1G19380 [Arabidopsis thaliana]
Length=147

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 56/115 (49%), Positives = 76/115 (66%), Gaps = 10/115 (9%)
 Frame = +2

Query  182  MKDEEAQVITSAGKKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTLS----L  349
            MK +E++ +    K  +G+    G      YKLWV++A+LLLAF SM TGS++L      
Sbjct  1    MKFDESKTLLPVRKPVNGNRKTAG------YKLWVLIAVLLLAFGSMLTGSVSLKGIGLF  54

Query  350  NRVSDSSGFPLHddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYE  514
            +     + F   DDLDVLE+EE+EKVVRQMWDVY +S   ++P+FW+EAFEAAYE
Sbjct  55   HSADGVNAFSFGDDLDVLEIEEREKVVRQMWDVYGRSGGVKVPRFWREAFEAAYE  109



>ref|XP_009396443.1| PREDICTED: uncharacterized protein LOC103981440 [Musa acuminata 
subsp. malaccensis]
Length=171

 Score = 74.3 bits (181),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 75/106 (71%), Gaps = 5/106 (5%)
 Frame = +2

Query  212  SAGKKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL--SLNRVSDSSGFPLH  385
            SA  K H       L G+G+YKLWV  AILLLA WS+ TG++TL  S+   +  S  P+ 
Sbjct  12   SANPKRHSP---FPLLGKGRYKLWVCAAILLLALWSLLTGTVTLKWSIGGANSPSDAPVF  68

Query  386  ddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
             DLDVLEVEE+EKVVR MWDVY  SR +RLP+FWQEAFEAAYEE+ 
Sbjct  69   GDLDVLEVEEREKVVRHMWDVYVHSRIARLPRFWQEAFEAAYEELA  114



>ref|XP_011083699.1| PREDICTED: uncharacterized protein LOC105166154 [Sesamum indicum]
Length=186

 Score = 73.9 bits (180),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 85/133 (64%), Gaps = 20/133 (15%)
 Frame = +2

Query  182  MKDEEAQVITSAGK--------------KEHGSDGGHGLFGRGKYKLWVILAILLLAFWS  319
            MKDEEAQ I +                 K+ GS G  GLFGRGKYKLW + AI LLA WS
Sbjct  1    MKDEEAQRIQTTPSSSSTSTASAPSFSVKKDGS-GFEGLFGRGKYKLWALAAITLLALWS  59

Query  320  MFTGSLTL-----SLNRVSDSSGFPLHddldvleveekekvvRQMWDVYTQSRSSRLPKF  484
            M+TGS+TL     +L   SD     +H DLDVL+V+E+ K+V QMW+VY  S  +RLP+F
Sbjct  60   MYTGSVTLKWSADNLTNSSDDLDHSIHGDLDVLDVDERVKMVTQMWNVYKHSSIARLPRF  119

Query  485  WQEAFEAAYEEMT  523
            W++AF AAY+E+T
Sbjct  120  WRDAFGAAYQELT  132



>ref|XP_006425705.1| hypothetical protein CICLE_v10027139mg [Citrus clementina]
 gb|ESR38945.1| hypothetical protein CICLE_v10027139mg [Citrus clementina]
Length=140

 Score = 72.8 bits (177),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 65/119 (55%), Gaps = 24/119 (20%)
 Frame = +2

Query  182  MKDEEAQVITSAGKKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL-----S  346
            MKD+E+   T+             +FG+G+YK W + AILLLAFWSMFTG++TL     +
Sbjct  1    MKDDESVPTTTTLNVTKKESSDSSIFGKGRYKFWALAAILLLAFWSMFTGTVTLRWSAGN  60

Query  347  LNRVSDSSGFPLHddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
            LNR+SD  G P+H                   D      S ++ +FWQEAFEAAYEE++
Sbjct  61   LNRLSDDLGSPIH-------------------DDLDVLPSDQITEFWQEAFEAAYEELS  100



>gb|ABK27045.1| unknown [Picea sitchensis]
Length=162

 Score = 72.8 bits (177),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 63/94 (67%), Gaps = 5/94 (5%)
 Frame = +2

Query  254  LFGRGKYKLWVILAILLLAFWSMFTGSLTL-----SLNRVSDSSGFPLHddldvleveek  418
            L G+G+YK W +  I+LLAFWSM +GS +L     +L   SD     L DD DVLE+E +
Sbjct  14   LLGKGRYKFWALAIIILLAFWSMLSGSASLKWSAGNLMLFSDELDKRLQDDFDVLEIEAR  73

Query  419  ekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEM  520
            EKVVR MWD+Y  +   +L  FWQEAF+AAYEE+
Sbjct  74   EKVVRHMWDIYIHNPRLKLSSFWQEAFQAAYEEL  107



>gb|KEH36150.1| transmembrane protein, putative [Medicago truncatula]
Length=146

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 55/95 (58%), Positives = 67/95 (71%), Gaps = 7/95 (7%)
 Frame = +2

Query  260  GRGKYKLWVILAILLLAFWSMFTGSLTL-----SLNRVSDSSGFPLHddldvleveekek  424
            G+  YKL  + AI+L+A W MFTGS+TL     +LN  SD     + DDLDVLEVEE+EK
Sbjct  7    GKRHYKLCALAAIVLIALWFMFTGSITLKLSINNLNPFSDDLDSMILDDLDVLEVEEREK  66

Query  425  vvRQMWDVYTQSRSSR--LPKFWQEAFEAAYEEMT  523
            VVR MWDVYT+S S+   LP+FW EAFEAAYE + 
Sbjct  67   VVRHMWDVYTRSHSNSIGLPQFWLEAFEAAYEHLV  101



>ref|XP_007136586.1| hypothetical protein PHAVU_009G057300g [Phaseolus vulgaris]
 gb|ESW08580.1| hypothetical protein PHAVU_009G057300g [Phaseolus vulgaris]
Length=154

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 70/101 (69%), Gaps = 4/101 (4%)
 Frame = +2

Query  230  HGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTLSLNRV-SDSSGFPLHddldvle  406
            H +D G+G   R ++  WV+  ++L+  WSMF GS+TL  +   +D  G  +  DLDVLE
Sbjct  7    HDADSGNGNRKR-QFLFWVLAVVILVGLWSMFAGSVTLKWSTTDNDDFGSTIIQDLDVLE  65

Query  407  veekekvvRQMWDVYTQSRSSR--LPKFWQEAFEAAYEEMT  523
            VEE+EKVVRQMWD+Y+ SR+    LPKFW EAFEAAYEE+ 
Sbjct  66   VEEREKVVRQMWDLYSHSRTKSVGLPKFWWEAFEAAYEELV  106



>gb|KEH36149.1| transmembrane protein, putative [Medicago truncatula]
Length=166

 Score = 71.6 bits (174),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 55/95 (58%), Positives = 67/95 (71%), Gaps = 7/95 (7%)
 Frame = +2

Query  260  GRGKYKLWVILAILLLAFWSMFTGSLTL-----SLNRVSDSSGFPLHddldvleveekek  424
            G+  YKL  + AI+L+A W MFTGS+TL     +LN  SD     + DDLDVLEVEE+EK
Sbjct  7    GKRHYKLCALAAIVLIALWFMFTGSITLKLSINNLNPFSDDLDSMILDDLDVLEVEEREK  66

Query  425  vvRQMWDVYTQSRSSR--LPKFWQEAFEAAYEEMT  523
            VVR MWDVYT+S S+   LP+FW EAFEAAYE + 
Sbjct  67   VVRHMWDVYTRSHSNSIGLPQFWLEAFEAAYEHLV  101



>ref|XP_009365595.1| PREDICTED: uncharacterized protein LOC103955427 [Pyrus x bretschneideri]
Length=188

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 72/98 (73%), Gaps = 8/98 (8%)
 Frame = +2

Query  254  LFGRGKYKLWVILAILLLAFWSMFTGSLTL-----SLNRVSDSSGFPLHddldvleveek  418
               +  YK W + AILLLAFWSMFTGS+TL     +L+R+SD    P  DDLD+LEVEE+
Sbjct  34   FLDKNGYKFWALAAILLLAFWSMFTGSVTLKWSTGNLSRLSDDLDIPTFDDLDILEVEER  93

Query  419  ekvvRQMWDVY---TQSRSSRLPKFWQEAFEAAYEEMT  523
            EKVVR MWD+Y   T + +SRLP+FWQEAFEAAYE +T
Sbjct  94   EKVVRHMWDLYTQTTSTSTSRLPRFWQEAFEAAYEHLT  131



>gb|ACG31735.1| hypothetical protein [Zea mays]
Length=213

 Score = 68.2 bits (165),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 70/92 (76%), Gaps = 6/92 (7%)
 Frame = +2

Query  251  GLFGRGKYKLWVILAILLLAFWSMFTGSLTLSLNRVSDSSGF-----PLHddldvlevee  415
             LFG+G+YK+W + AI LLA WSMF  S+TL L+ V  ++ F     PL D+LD LE+E+
Sbjct  37   ALFGKGRYKVWALAAIALLALWSMFAASVTLRLSSVDLATTFGDASDPLIDELDPLEMEQ  96

Query  416  kekvvRQMWDVYTQSRSS-RLPKFWQEAFEAA  508
            +EK+VR+MWDVYT++ +  RLP+FWQEAFEA+
Sbjct  97   REKLVRRMWDVYTRTDNHVRLPRFWQEAFEAS  128



>gb|EPS67837.1| hypothetical protein M569_06941, partial [Genlisea aurea]
Length=158

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 67/107 (63%), Gaps = 5/107 (5%)
 Frame = +2

Query  218  GKKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL-----SLNRVSDSSGFPL  382
             K++H S      FGR  YK W +  ILLLA WSM  G+ TL      LNR +D    P 
Sbjct  26   SKRDHSSRSSAHPFGRSHYKFWALAVILLLALWSMIIGAATLRWSAGDLNRPTDDYSSPS  85

Query  383  HddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
             +DLDVL +EE+E++V+ +WDVYT SR  +   FWQ+AF AAYE++T
Sbjct  86   VEDLDVLILEERERLVKHLWDVYTNSRRIKFSGFWQDAFVAAYEDLT  132



>ref|NP_001237413.1| uncharacterized protein LOC100500653 [Glycine max]
 gb|ACU15793.1| unknown [Glycine max]
Length=155

 Score = 65.5 bits (158),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 70/106 (66%), Gaps = 6/106 (6%)
 Frame = +2

Query  218  GKKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL--SLNRVSDSSGFPLHdd  391
            G  E+  D G+    R    LW++ A++L+A WSMF GS+TL  SL+   D     L  D
Sbjct  5    GSHEYDGDSGNANSKR-HLLLWILAAVILIALWSMFAGSVTLKWSLSNNDDLDSTILE-D  62

Query  392  ldvleveekekvvRQMWDVY--TQSRSSRLPKFWQEAFEAAYEEMT  523
            LDVLEVEE+EKVVR MWD+Y  T ++S  LPKFW EAFEAAY+++ 
Sbjct  63   LDVLEVEEREKVVRHMWDLYSHTNTKSVGLPKFWWEAFEAAYQQLV  108



>gb|KHN45844.1| hypothetical protein glysoja_023067 [Glycine soja]
Length=155

 Score = 64.7 bits (156),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 70/106 (66%), Gaps = 6/106 (6%)
 Frame = +2

Query  218  GKKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL--SLNRVSDSSGFPLHdd  391
            G  E+  D G+    R    LW++ A++L+A WSMF GS+TL  SL+   D     L  D
Sbjct  5    GSHEYDGDSGNTNSKR-HLLLWILAAVILIALWSMFAGSVTLKWSLSNNDDLDSTILE-D  62

Query  392  ldvleveekekvvRQMWDVY--TQSRSSRLPKFWQEAFEAAYEEMT  523
            LDVLEVEE+EKVVR MWD+Y  T ++S  LPKFW EAFEAAY+++ 
Sbjct  63   LDVLEVEEREKVVRHMWDLYSHTNTKSVGLPKFWWEAFEAAYQQLV  108



>emb|CAN75408.1| hypothetical protein VITISV_042285 [Vitis vinifera]
Length=125

 Score = 54.3 bits (129),  Expect(2) = 6e-10, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  431  RQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
            + MWDVYT SR  RLP+FWQEAFEAAYE++ 
Sbjct  88   KHMWDVYTNSRRGRLPRFWQEAFEAAYEDLA  118


 Score = 35.8 bits (81),  Expect(2) = 6e-10, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 33/66 (50%), Gaps = 7/66 (11%)
 Frame = +3

Query  228  SMAQMAAMACLVEESTSFGLYLRFSC*PFGPCSPAPSLS-----VSTGFLILPASPSTMI  392
             +AQM A    V  STS G + RF     G CSPAP LS      ST F       STMI
Sbjct  18   KIAQMRAFLGRV--STSSGCWQRFCSLLSGLCSPAPLLSGGPPVTSTIFPTTSTPTSTMI  75

Query  393  LMFWKW  410
             MFWKW
Sbjct  76   SMFWKW  81



>ref|XP_008444700.1| PREDICTED: uncharacterized protein LOC103487960 [Cucumis melo]
Length=171

 Score = 64.7 bits (156),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 49/91 (54%), Positives = 65/91 (71%), Gaps = 5/91 (5%)
 Frame = +2

Query  263  RGKYKLWVILAILLLAFWSMFTGSLTL-----SLNRVSDSSGFPLHddldvleveekekv  427
            + +YK W + AILLLAFWSMFTGS++L     +  R  D    P+ DDLD+LEVE++E+ 
Sbjct  31   KARYKFWALAAILLLAFWSMFTGSVSLKWSAGTFARFYDGPLKPIFDDLDILEVEDRERD  90

Query  428  vRQMWDVYTQSRSSRLPKFWQEAFEAAYEEM  520
            VR MW++YT     RLP+FW EAFEAAYE++
Sbjct  91   VRHMWNLYTHGGGGRLPRFWSEAFEAAYEDL  121



>ref|XP_011097125.1| PREDICTED: uncharacterized protein LOC105176117, partial [Sesamum 
indicum]
Length=182

 Score = 64.3 bits (155),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 72/107 (67%), Gaps = 7/107 (7%)
 Frame = +2

Query  221  KKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTLS------LNRVSDSSGFPL  382
            +K+  SD  + +F RG+YK W + AILLLAFWSM TG++TL        NR +D      
Sbjct  28   RKDSSSDQLN-IFRRGRYKFWALAAILLLAFWSMLTGTVTLRWSAGDLKNRFADDYNSHA  86

Query  383  HddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
             +DLDVL++EE+EK+V+ MWDVYT S   R   FWQEAF AAYE++T
Sbjct  87   AEDLDVLDLEEREKLVKHMWDVYTNSPRFRFGGFWQEAFVAAYEDLT  133



>ref|XP_009394309.1| PREDICTED: uncharacterized protein LOC103979819 [Musa acuminata 
subsp. malaccensis]
Length=177

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 76/117 (65%), Gaps = 3/117 (3%)
 Frame = +2

Query  182  MKDEEAQVITSAGKKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL--SLNR  355
            MK+    +++SA            L  R +YKLW + A+LLLA WSM  G+ TL  S  R
Sbjct  1    MKEVSESLLSSATACPSRPSPSGPLLSRVRYKLWALAAVLLLALWSMLAGTFTLKWSARR  60

Query  356  VSDSSGFPLHddldvleveekekvvRQMWDVYTQSRSS-RLPKFWQEAFEAAYEEMT  523
             SD    PL +D+DVLE+EE+ KVVR MWDVY  S S+ RLP+FWQ+AFEAAYEE++
Sbjct  61   PSDDLDGPLLEDVDVLEMEERAKVVRHMWDVYAHSHSTGRLPRFWQQAFEAAYEELS  117



>ref|XP_004958258.1| PREDICTED: uncharacterized protein LOC101780353 [Setaria italica]
Length=159

 Score = 61.6 bits (148),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 55/104 (53%), Positives = 69/104 (66%), Gaps = 13/104 (13%)
 Frame = +2

Query  236  SDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL--------SLNRVSDSSGFPLHdd  391
            S G   LFG+G+YK W + AI LLA WSMF  S+TL        +    SD    PL D+
Sbjct  28   SSGEAALFGKGRYKAWALAAIALLALWSMFAASVTLRWSSGELATFGNASD----PLIDE  83

Query  392  ldvleveekekvvRQMWDVYTQSRSS-RLPKFWQEAFEAAYEEM  520
             D LE+EE+EK+ R+MWDVYT++    RLP+FWQEAFEAAYEE+
Sbjct  84   FDPLEMEEREKLARRMWDVYTRTGDHVRLPRFWQEAFEAAYEEL  127



>ref|NP_001144135.1| uncharacterized protein LOC100276984 [Zea mays]
 gb|ACF86246.1| unknown [Zea mays]
 gb|ACG38155.1| hypothetical protein [Zea mays]
 gb|ACG40221.1| hypothetical protein [Zea mays]
Length=182

 Score = 61.6 bits (148),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 66/98 (67%), Gaps = 7/98 (7%)
 Frame = +2

Query  251  GLFGRGKYKLWVILAILLLAFWSMFTGSLTL------SLNRVSDSSGFPLHddldvleve  412
             L G+G+YK+W + AI LLA WSM   S++L       L  V      PL DDLD LE+E
Sbjct  37   ALLGKGRYKVWALAAIALLALWSMSAASVSLRWSSSGDLASVYGDLDVPLADDLDSLEME  96

Query  413  ekekvvRQMWDVYTQ-SRSSRLPKFWQEAFEAAYEEMT  523
            E+EK+V +MWD+YT+ S   RLP+FWQEAFEAAYEE+ 
Sbjct  97   EREKLVGRMWDMYTRTSDEVRLPRFWQEAFEAAYEELA  134



>ref|NP_001143565.1| uncharacterized protein LOC100276262 [Zea mays]
 gb|ACG33090.1| hypothetical protein [Zea mays]
Length=178

 Score = 61.2 bits (147),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 66/98 (67%), Gaps = 7/98 (7%)
 Frame = +2

Query  251  GLFGRGKYKLWVILAILLLAFWSMFTGSLTL------SLNRVSDSSGFPLHddldvleve  412
             L G+G+YK+W + AI LLA WSM   S++L       L  V      PL DDLD LE+E
Sbjct  33   ALLGKGRYKVWALAAIALLALWSMSAASVSLRWSSSGDLASVYGDLDVPLADDLDSLEME  92

Query  413  ekekvvRQMWDVYTQ-SRSSRLPKFWQEAFEAAYEEMT  523
            E+EK+V +MWD+YT+ S   RLP+FWQEAFEAAYEE+ 
Sbjct  93   EREKLVGRMWDMYTRTSDEVRLPRFWQEAFEAAYEELA  130



>ref|XP_010529511.1| PREDICTED: uncharacterized protein LOC104806349 [Tarenaya hassleriana]
Length=161

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 60/130 (46%), Positives = 82/130 (63%), Gaps = 23/130 (18%)
 Frame = +2

Query  182  MKDEEAQVIT------SAGKKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL  343
            MKDEE+   +      SAG+ ++    G  + G   +K+W++ AIL LA WS+FT S+TL
Sbjct  1    MKDEESLTTSPPSLTFSAGRTKY-PVAGRIITG---FKIWLLAAILFLALWSVFTSSVTL  56

Query  344  S-------------LNRVSDSSGFPLHddldvleveekekvvRQMWDVYTQSRSSRLPKF  484
                          L  +S  +GF    +LD+LEVEE+EKVVR+MWDVYT++  SRLP+F
Sbjct  57   KGFFGGCDGGRGRYLCYLSGVNGFSGGGELDILEVEEREKVVRKMWDVYTRAAGSRLPRF  116

Query  485  WQEAFEAAYE  514
            W+EAFEAAYE
Sbjct  117  WREAFEAAYE  126



>ref|XP_010498354.1| PREDICTED: uncharacterized protein LOC104776052 [Camelina sativa]
 ref|XP_010498356.1| PREDICTED: uncharacterized protein LOC104776054 [Camelina sativa]
Length=155

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 81/119 (68%), Gaps = 10/119 (8%)
 Frame = +2

Query  182  MKDEEAQVITSAGKKEHGSDGGHGLFGRGK----YKLWVILAILLLAFWSMFTGSLTLS-  346
            MK EE+Q +    K  +G  GG     R +    YKLWV+ A+LLLAF SM TGS++L  
Sbjct  1    MKFEESQTLLPLRKPVNG--GGCLTLTRDRKRAGYKLWVLAAVLLLAFGSMLTGSVSLKG  58

Query  347  ---LNRVSDSSGFPLHddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYE  514
                + V   +GF + DDLDVLE+EE+EKVVRQMWDVY++S   R+P+FW+EAFEAAYE
Sbjct  59   IGLFHSVDGVNGFSVGDDLDVLEIEEREKVVRQMWDVYSRSGGVRVPRFWREAFEAAYE  117



>gb|EYU40147.1| hypothetical protein MIMGU_mgv1a015364mg [Erythranthe guttata]
Length=160

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 54/119 (45%), Positives = 78/119 (66%), Gaps = 9/119 (8%)
 Frame = +2

Query  182  MKDEEAQVITSAGKKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL-----S  346
            MKD++A ++  +           GLFGR +YK W + AILLLAF SM T +++L      
Sbjct  1    MKDDDA-LLPVSTPTSSSVVSFSGLFGRRRYKCWALAAILLLAFCSMLTATVSLRRSAGD  59

Query  347  LNRVSDSSGFPLHddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
             +R++DS   P  + LDVL++EE+EK+V+QMWDVYT S  + L  FWQ+AF AAYE+++
Sbjct  60   FSRLNDS---PAVEFLDVLDLEEREKLVKQMWDVYTGSHRTGLVGFWQDAFVAAYEDLS  115



>ref|XP_004501128.1| PREDICTED: uncharacterized protein LOC101512645 [Cicer arietinum]
Length=157

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 65/96 (68%), Gaps = 6/96 (6%)
 Frame = +2

Query  248  HGLFGRGKYKLWVILAILLLAFWSMFTGSLTL-----SLNRVSDSSGFPLHddldvleve  412
            H   G+  Y L  +  I+++A W MFTGS+TL     +LN+ SD     + +DLDVLEVE
Sbjct  3    HAGAGKRHYMLCALATIVIVALWFMFTGSITLKWSAGNLNQFSDDLDSMILEDLDVLEVE  62

Query  413  ekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYEEM  520
            E+EKVV+ MWDVYT+S++  L +FW EAFEA YE +
Sbjct  63   EREKVVKHMWDVYTRSQNG-LSQFWLEAFEAGYEHL  97



>dbj|BAK05463.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=180

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 65/98 (66%), Gaps = 7/98 (7%)
 Frame = +2

Query  251  GLFGRGKYKLWVILAILLLAFWSMFTGSLTLS------LNRVSDSSGFPLHddldvleve  412
             L G+G+YK+W + AI LLA WSM   S++L          V+     PL  DLD LE+E
Sbjct  34   ALLGKGRYKVWALAAIALLALWSMSAASVSLRWSAGDLAAAVAGDLDAPLRGDLDSLEME  93

Query  413  ekekvvRQMWDVYTQSRSS-RLPKFWQEAFEAAYEEMT  523
            E+EK+V +MWD+YT++    RLP+FWQEAFEAAYEE+ 
Sbjct  94   EREKLVGRMWDMYTRTSDEIRLPRFWQEAFEAAYEELA  131



>ref|XP_010477152.1| PREDICTED: uncharacterized protein LOC104756282 [Camelina sativa]
Length=155

 Score = 59.7 bits (143),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 79/119 (66%), Gaps = 10/119 (8%)
 Frame = +2

Query  182  MKDEEAQVITSAGKKEHGSDGGHGLFGRGK----YKLWVILAILLLAFWSMFTGSLTLS-  346
            MK EE+Q +    K  +G  GG     R +    YKLWV+ A+LLLAF SM TGS++L  
Sbjct  1    MKFEESQTLLPVRKPVNG--GGCITLSRDRKRAGYKLWVLAAVLLLAFGSMLTGSVSLKG  58

Query  347  ---LNRVSDSSGFPLHddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYE  514
                + V   +GF   DDLDVLE+EE+EKVVRQMWDVY +S   R+P+FW+EAFEAAYE
Sbjct  59   IGLFHSVDGVNGFSTGDDLDVLEIEEREKVVRQMWDVYGRSGGVRVPRFWREAFEAAYE  117



>gb|EMT24196.1| hypothetical protein F775_30518 [Aegilops tauschii]
Length=198

 Score = 60.1 bits (144),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 53/102 (52%), Positives = 66/102 (65%), Gaps = 6/102 (6%)
 Frame = +2

Query  233  GSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL-----SLNRVSDSSGFPLHddld  397
            G      L G+G+YK W + AI LLA WSMF  S+TL      L         PL DDLD
Sbjct  30   GGGAEAALLGKGRYKAWTLAAIALLALWSMFAASVTLRWSSGDLAAAPWDLSSPLLDDLD  89

Query  398  vleveekekvvRQMWDVYTQSRSSR-LPKFWQEAFEAAYEEM  520
             LE+EE+EK+VR+MWD+YT++     LP+FWQEAFEAAYEE+
Sbjct  90   PLEMEEREKLVRRMWDLYTRTGDHVWLPRFWQEAFEAAYEEL  131



>ref|XP_006650190.1| PREDICTED: uncharacterized protein LOC102720218 [Oryza brachyantha]
Length=184

 Score = 60.1 bits (144),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 70/106 (66%), Gaps = 9/106 (8%)
 Frame = +2

Query  233  GSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTL--SLNR------VSDSSGFPLHd  388
             ++     FG+G+YK+W   AI LLA WSM   S++L  S  R       S+    PL D
Sbjct  30   AAEAAPPPFGKGRYKVWAFAAIALLALWSMSAASVSLRWSSGRFLLAAAASEDLDAPLRD  89

Query  389  dldvleveekekvvRQMWDVYTQSRSS-RLPKFWQEAFEAAYEEMT  523
            DLD LE+EE+EK+V +MWD+YT++    RLP+FWQEAFEAAYEE++
Sbjct  90   DLDSLEMEEREKLVGRMWDMYTRTGDEVRLPRFWQEAFEAAYEELS  135



>ref|XP_006416510.1| hypothetical protein EUTSA_v10008999mg [Eutrema salsugineum]
 gb|ESQ34863.1| hypothetical protein EUTSA_v10008999mg [Eutrema salsugineum]
Length=152

 Score = 58.9 bits (141),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 77/115 (67%), Gaps = 5/115 (4%)
 Frame = +2

Query  182  MKDEEAQVITSAGKKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTLS----L  349
            MK EE+Q +    K  +G         R  YKLWV++A+LLLA  SM TGS++L      
Sbjct  1    MKFEESQTLLPVRKPVNGCCLSSNR-KRAGYKLWVLVAVLLLALGSMLTGSVSLKGLGLF  59

Query  350  NRVSDSSGFPLHddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYE  514
            + V    GFP+ DDLDVLE+EE+EKVVRQMWDVY +S   R+P+FW+EAFEAAYE
Sbjct  60   HSVDGEFGFPVGDDLDVLEIEEREKVVRQMWDVYGRSGGVRIPRFWREAFEAAYE  114



>emb|CAN60001.1| hypothetical protein VITISV_043637 [Vitis vinifera]
Length=127

 Score = 54.3 bits (129),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  431  RQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
            + MWDVYT SR  RLP+FWQEAFEAAYE++ 
Sbjct  88   KHMWDVYTNSRRGRLPRFWQEAFEAAYEDLA  118


 Score = 29.3 bits (64),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 30/66 (45%), Gaps = 7/66 (11%)
 Frame = +3

Query  228  SMAQMAAMACLVEESTSFGLYLRFSC*PFGPCSPAPSLS-----VSTGFLILPASPSTMI  392
             +AQM A    V  STS   + RF     G CSP P LS      ST F       ST I
Sbjct  18   KIAQMRAFLGRV--STSSERWQRFCSLLCGLCSPGPLLSGGPPATSTIFPTTSTPTSTTI  75

Query  393  LMFWKW  410
             MFWKW
Sbjct  76   SMFWKW  81



>ref|XP_003570023.1| PREDICTED: uncharacterized protein LOC100822234 [Brachypodium 
distachyon]
Length=177

 Score = 58.9 bits (141),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 50/97 (52%), Positives = 68/97 (70%), Gaps = 7/97 (7%)
 Frame = +2

Query  254  LFGRGKYKLWVILAILLLAFWSMFTGSLTL---SLNRVSDSSG---FPLHddldvlevee  415
            L G+G+YK+W + AI LLA WSM   S++L   + +  + +SG    P   DLD LE+EE
Sbjct  32   LLGKGRYKVWALAAIALLALWSMSAASVSLRWSAGDLAASASGDLDAPFSQDLDSLEMEE  91

Query  416  kekvvRQMWDVYTQ-SRSSRLPKFWQEAFEAAYEEMT  523
            +EK+V +MWD+YT+ S   RLP+FWQEAFEAAYEE+ 
Sbjct  92   REKLVGRMWDMYTRTSDEVRLPRFWQEAFEAAYEELV  128



>ref|NP_001281179.1| uncharacterized protein LOC100276045 [Zea mays]
 gb|ACR38676.1| unknown [Zea mays]
Length=105

 Score = 57.4 bits (137),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 56/73 (77%), Gaps = 6/73 (8%)
 Frame = +2

Query  320  MFTGSLTLSLNRVSDSSGF-----PLHddldvleveekekvvRQMWDVYTQSRSS-RLPK  481
            MF  S+TL L+ V  ++ F     PL D+LD LE+E++EK+VR+MWDVYT++ +  RLP+
Sbjct  1    MFAASVTLRLSSVDLATTFGDASDPLIDELDPLEMEQREKLVRRMWDVYTRTDNHVRLPR  60

Query  482  FWQEAFEAAYEEM  520
            FWQEAFEAAYEE+
Sbjct  61   FWQEAFEAAYEEL  73



>ref|XP_010459607.1| PREDICTED: uncharacterized protein LOC104740635 [Camelina sativa]
Length=154

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 77/121 (64%), Gaps = 15/121 (12%)
 Frame = +2

Query  182  MKDEEAQVITSAGKKEHGSDGGHGLFGRGK------YKLWVILAILLLAFWSMFTGSLTL  343
            MK EE Q +    K  +G     G   R +      YKLWV+ A+LLLAF SM TGS++L
Sbjct  1    MKFEETQTLLPVRKPVNG-----GCHSRDRKRAGYNYKLWVLAAVLLLAFGSMLTGSVSL  55

Query  344  S----LNRVSDSSGFPLHddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAY  511
                  + V   +GF   DDLDVLE+EE+EKVVRQMWDVY +S   R+P+FW+EAFEAAY
Sbjct  56   KGIGLFHSVDGVNGFSAGDDLDVLEIEEREKVVRQMWDVYGRSGGVRVPRFWREAFEAAY  115

Query  512  E  514
            E
Sbjct  116  E  116



>ref|XP_002467700.1| hypothetical protein SORBIDRAFT_01g032680 [Sorghum bicolor]
 gb|EER94698.1| hypothetical protein SORBIDRAFT_01g032680 [Sorghum bicolor]
Length=176

 Score = 56.6 bits (135),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 64/94 (68%), Gaps = 7/94 (7%)
 Frame = +2

Query  263  RGKYKLWVILAILLLAFWSMFTGSLTL------SLNRVSDSSGFPLHddldvleveekek  424
            +G+YK+W + AI LLA WSM   S++L       L  V      PL DDLD LE+EE+EK
Sbjct  36   KGRYKVWALAAIALLALWSMSAASVSLRWSSSGDLASVYGDLDVPLADDLDSLEMEEREK  95

Query  425  vvRQMWDVYTQ-SRSSRLPKFWQEAFEAAYEEMT  523
            +V +MWD+YT+ S   RLP+FWQEAFEAAYEE+ 
Sbjct  96   LVGRMWDMYTRTSDEVRLPRFWQEAFEAAYEELA  129



>ref|XP_002890331.1| hypothetical protein ARALYDRAFT_472165 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66590.1| hypothetical protein ARALYDRAFT_472165 [Arabidopsis lyrata subsp. 
lyrata]
Length=146

 Score = 55.8 bits (133),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 67/85 (79%), Gaps = 4/85 (5%)
 Frame = +2

Query  272  YKLWVILAILLLAFWSMFTGSLTLS----LNRVSDSSGFPLHddldvleveekekvvRQM  439
            YKLWV++A+LLLAF SM TGS++L      + V  ++ F + DDLDVLE+EE+E+VVRQM
Sbjct  24   YKLWVLIALLLLAFGSMLTGSVSLKGIGLFHSVDGTNAFSVGDDLDVLEIEERERVVRQM  83

Query  440  WDVYTQSRSSRLPKFWQEAFEAAYE  514
            WDVY +S   +LP+FW+EAFEAAYE
Sbjct  84   WDVYGRSGGVKLPRFWREAFEAAYE  108



>ref|XP_006657943.1| PREDICTED: uncharacterized protein LOC102708073 [Oryza brachyantha]
Length=160

 Score = 55.8 bits (133),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 69/97 (71%), Gaps = 6/97 (6%)
 Frame = +2

Query  251  GLFGRGKYKLWVILAILLLAFWSMFTGSLTLSLNRVSDSSGF-----PLHddldvlevee  415
             L G+G+YK W + AI LLA WSMF  S+++  +    ++ F     PL DDLD LE+EE
Sbjct  33   ALLGKGRYKAWALAAIALLALWSMFAASVSIRWSSGDLAATFGDLPDPLIDDLDPLEMEE  92

Query  416  kekvvRQMWDVYTQSRSS-RLPKFWQEAFEAAYEEMT  523
            +EK+VR+MWDVYT++    RLP+FWQEAFEAAYEE+ 
Sbjct  93   REKLVRRMWDVYTRTGDRVRLPRFWQEAFEAAYEELA  129



>ref|XP_006305739.1| hypothetical protein CARUB_v10010542mg [Capsella rubella]
 gb|EOA38637.1| hypothetical protein CARUB_v10010542mg [Capsella rubella]
Length=154

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 66/88 (75%), Gaps = 4/88 (5%)
 Frame = +2

Query  263  RGKYKLWVILAILLLAFWSMFTGSLTLS----LNRVSDSSGFPLHddldvleveekekvv  430
            R  YKLWV++A+LLLAF SM TGS++L      + V   + F   DDLDVLE+EE+EKVV
Sbjct  29   RAGYKLWVLVAVLLLAFGSMLTGSVSLKGIGLFHSVDGVNAFSAGDDLDVLEIEEREKVV  88

Query  431  RQMWDVYTQSRSSRLPKFWQEAFEAAYE  514
            RQMWDVY +S   R+P+FW+EAFEAAYE
Sbjct  89   RQMWDVYGRSGGVRVPRFWREAFEAAYE  116



>gb|KCW45824.1| hypothetical protein EUGRSUZ_L00342, partial [Eucalyptus grandis]
Length=68

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  431  RQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
            R +WDVYTQS+ SRLPKFW++AF+A YE +T
Sbjct  3    RDLWDVYTQSKRSRLPKFWRDAFQAGYEFLT  33



>ref|XP_010039660.1| PREDICTED: uncharacterized protein LOC104428358 [Eucalyptus grandis]
Length=109

 Score = 52.4 bits (124),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  431  RQMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
            R +WDVYTQS+ SRLPKFW++AF+A YE +T
Sbjct  19   RDLWDVYTQSKRSRLPKFWRDAFQAGYEFLT  49



>gb|EAZ04660.1| hypothetical protein OsI_26812 [Oryza sativa Indica Group]
Length=164

 Score = 53.1 bits (126),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 67/93 (72%), Gaps = 7/93 (8%)
 Frame = +2

Query  263  RGKYKLWVILAILLLAFWSMFTGSLTLSLNRVSDSSGF-----PLHddldvleveekekv  427
            +G+YK W + AI LLA WSMF  S+T+  +    ++ F     PL DDLD LE+E++EK+
Sbjct  40   KGRYKAWALAAIALLALWSMFAASVTIRWSSGDLAAAFGDLPDPLIDDLDPLEMEDREKL  99

Query  428  vRQMWDVYTQS--RSSRLPKFWQEAFEAAYEEM  520
            VR+MWDVYT++     RLP+FWQEAFEAAYEE+
Sbjct  100  VRRMWDVYTRTGVDRVRLPRFWQEAFEAAYEEL  132



>ref|NP_001241923.1| uncharacterized protein LOC100803339 [Glycine max]
 gb|ACU17571.1| unknown [Glycine max]
Length=130

 Score = 52.0 bits (123),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 54/76 (71%), Gaps = 11/76 (14%)
 Frame = +2

Query  320  MFTGSLTL-----SLNRVSDSSGFPLHddldvleveekekvvRQMWDVYTQSRSSR---L  475
            MFT SLTL     +LNR  DS+     +D DVLEVEE+EKVVR+MWDVYTQS+S R   L
Sbjct  1    MFTASLTLKWSAGNLNRDFDSATL---NDFDVLEVEEREKVVRRMWDVYTQSKSGRGSGL  57

Query  476  PKFWQEAFEAAYEEMT  523
            P+FW +AF AAY+ + 
Sbjct  58   PRFWSDAFHAAYDHLV  73



>gb|ACG48314.1| hypothetical protein [Zea mays]
Length=71

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 28/31 (90%), Gaps = 1/31 (3%)
 Frame = +2

Query  431  RQMWDVYTQSRSS-RLPKFWQEAFEAAYEEM  520
            R+MWDVYT++ +  RLP+FWQEAFEAAYEE+
Sbjct  9    RRMWDVYTRTDNHVRLPRFWQEAFEAAYEEL  39



>ref|NP_001060236.1| Os07g0607500 [Oryza sativa Japonica Group]
 dbj|BAD31152.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD32031.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF22150.1| Os07g0607500 [Oryza sativa Japonica Group]
 gb|EAZ40602.1| hypothetical protein OsJ_25063 [Oryza sativa Japonica Group]
Length=164

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 67/93 (72%), Gaps = 7/93 (8%)
 Frame = +2

Query  263  RGKYKLWVILAILLLAFWSMFTGSLTLSLNRVSDSSGF-----PLHddldvleveekekv  427
            +G+YK W + AI LLA WSMF  S+T+  +    ++ F     PL DDLD LE+E++EK+
Sbjct  40   KGRYKAWALAAIALLALWSMFAASVTIRWSSGDLAAEFGDLPDPLIDDLDPLEMEDREKL  99

Query  428  vRQMWDVYTQS--RSSRLPKFWQEAFEAAYEEM  520
            VR+MWDVYT++     RLP+FWQEAFEAAYEE+
Sbjct  100  VRRMWDVYTRTGVDRVRLPRFWQEAFEAAYEEL  132



>ref|NP_001050350.1| Os03g0411600 [Oryza sativa Japonica Group]
 gb|AAO37508.1| expressed protein [Oryza sativa Japonica Group]
 gb|ABF96570.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF12264.1| Os03g0411600 [Oryza sativa Japonica Group]
 gb|EAY90431.1| hypothetical protein OsI_12018 [Oryza sativa Indica Group]
 gb|EAZ27304.1| hypothetical protein OsJ_11244 [Oryza sativa Japonica Group]
Length=178

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 67/98 (68%), Gaps = 9/98 (9%)
 Frame = +2

Query  257  FGRGKYKLWVILAILLLAFWSMFTGSLTL--SLNR------VSDSSGFPLHddldvleve  412
            FG+G+YK+W + AI LLA WSM   S +L  S  R       S+    PL DDLD LE+E
Sbjct  35   FGKGRYKVWALAAIALLALWSMSAASASLRWSSGRFLLAATASEDLDAPLLDDLDSLEME  94

Query  413  ekekvvRQMWDVYTQSRSS-RLPKFWQEAFEAAYEEMT  523
            E+EK+V +MWD+YT++    RLP+FWQEAFEAAYEE+ 
Sbjct  95   EREKLVGRMWDMYTRTGDEVRLPRFWQEAFEAAYEELA  132



>emb|CDX96663.1| BnaA08g22060D [Brassica napus]
Length=149

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 74/115 (64%), Gaps = 8/115 (7%)
 Frame = +2

Query  182  MKDEEAQVITSAGKKEHGSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTLS----L  349
            MK E +Q +    K  +G         R  YKLWV++A+LLLA  SM TGS++L      
Sbjct  1    MKFEGSQTLLPVRKPANGGSDRK----RAGYKLWVLVAVLLLALGSMLTGSVSLKGLGLF  56

Query  350  NRVSDSSGFPLHddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYE  514
            + V    GF + DDLDVLE+EE+EKVVR MWDVY +S   R+P+FW+EAFEAAYE
Sbjct  57   HSVDGKFGFHVSDDLDVLEIEEREKVVRHMWDVYGRSGGVRVPQFWREAFEAAYE  111



>emb|CDX83766.1| BnaC08g18790D [Brassica napus]
Length=149

 Score = 50.4 bits (119),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 76/116 (66%), Gaps = 10/116 (9%)
 Frame = +2

Query  182  MKDEEAQVITSAGKKEH-GSDGGHGLFGRGKYKLWVILAILLLAFWSMFTGSLTLS----  346
            MK E +Q +    K  + GSD       R  YKLWV++A+LLLA  SM TGS++L     
Sbjct  1    MKFEGSQTLLPVRKPANCGSD-----RKRAGYKLWVLVAVLLLALGSMLTGSVSLKGLGL  55

Query  347  LNRVSDSSGFPLHddldvleveekekvvRQMWDVYTQSRSSRLPKFWQEAFEAAYE  514
             + V    GF + DDLDVLE+EE+EKVVR MWDVY +S   R+P+FW+EAFEAAYE
Sbjct  56   FHSVDGKFGFHVSDDLDVLEIEEREKVVRHMWDVYGRSGGVRVPQFWREAFEAAYE  111



>ref|XP_009110276.1| PREDICTED: uncharacterized protein LOC103835844 [Brassica rapa]
Length=149

 Score = 50.1 bits (118),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 52/88 (59%), Positives = 65/88 (74%), Gaps = 4/88 (5%)
 Frame = +2

Query  263  RGKYKLWVILAILLLAFWSMFTGSLTLS----LNRVSDSSGFPLHddldvleveekekvv  430
            R  YKLWV++A+LLLA  SM TGS++L      + V    GF + DDLDVLE+EE+EKVV
Sbjct  24   RAGYKLWVLVAVLLLALGSMLTGSVSLKGLGLFHSVDGKFGFHVSDDLDVLEIEEREKVV  83

Query  431  RQMWDVYTQSRSSRLPKFWQEAFEAAYE  514
            R MWDVY +S   R+P+FW+EAFEAAYE
Sbjct  84   RHMWDVYGRSGGVRVPQFWREAFEAAYE  111



>ref|XP_010317714.1| PREDICTED: uncharacterized protein LOC101254457 isoform X2 [Solanum 
lycopersicum]
Length=161

 Score = 50.4 bits (119),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 45/90 (50%), Positives = 53/90 (59%), Gaps = 16/90 (18%)
 Frame = +2

Query  254  LFGRGKYKLWVILAILLLAFWSMFTGSLTLSLNRVSDSSGFPLHddldvleveekekvvR  433
            LFGRG   L           WS        +LN +SD    P  DDLDVLE+E++EK+V 
Sbjct  34   LFGRGTVSLR----------WSAG------NLNSLSDLFDIPKSDDLDVLEMEDREKLVN  77

Query  434  QMWDVYTQSRSSRLPKFWQEAFEAAYEEMT  523
             MWDVYT S   R+ KFWQEAFEAAYEE+ 
Sbjct  78   HMWDVYTNSPRIRILKFWQEAFEAAYEELN  107



>gb|EPS71215.1| hypothetical protein M569_03548, partial [Genlisea aurea]
Length=108

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 57/88 (65%), Gaps = 3/88 (3%)
 Frame = +2

Query  266  GKYKLWVILAILLLAFWSMFTGSLTLSLNRVS-DSSGFPLHddldvleveekekvvRQMW  442
            G +KLW  +AI+ LA  SM T S+TL  + +        L  DLD+L++EE+ K+V QMW
Sbjct  1    GTHKLWAFIAIISLASCSMLTASITLKWSPLDLKQQKDFLDADLDLLDLEERVKMVMQMW  60

Query  443  DVYTQ--SRSSRLPKFWQEAFEAAYEEM  520
            D Y Q  + ++RL  FW+EAF AAY+++
Sbjct  61   DTYQQHAATTARLSSFWREAFGAAYQQL  88



>ref|XP_004984041.1| PREDICTED: uncharacterized protein LOC101766086 isoform X2 [Setaria 
italica]
Length=171

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 62/90 (69%), Gaps = 7/90 (8%)
 Frame = +2

Query  275  KLWVILAILLLAFWSMFTGSLTLSLNRVSDSSGFP------LHddldvleveekekvvRQ  436
            K+WV+ AI LLA WSM   S++L  +   D + F       L DDLD LE+EE+EK+V +
Sbjct  35   KVWVLAAIALLALWSMSAASVSLRWSSSGDLAAFSGDLDVPLLDDLDSLEMEEREKLVGR  94

Query  437  MWDVYTQ-SRSSRLPKFWQEAFEAAYEEMT  523
            MWD+YT+ S   RLP+FWQEAFEAAYEE+ 
Sbjct  95   MWDMYTRTSDEVRLPRFWQEAFEAAYEELA  124



>gb|EMT26061.1| hypothetical protein F775_27408 [Aegilops tauschii]
Length=130

 Score = 47.4 bits (111),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 26/31 (84%), Gaps = 1/31 (3%)
 Frame = +2

Query  434  QMWDVYTQ-SRSSRLPKFWQEAFEAAYEEMT  523
            +MWD+YT+ S   RLP+FWQEAFEAAYEE+ 
Sbjct  60   RMWDMYTRTSDEVRLPRFWQEAFEAAYEELA  90



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 631248065840