BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002C04

Length=499
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009605268.1|  PREDICTED: patatin-like protein 6                49.7    1e-08   Nicotiana tomentosiformis
ref|XP_009764486.1|  PREDICTED: patatin-like protein 6                49.7    1e-08   Nicotiana sylvestris
ref|XP_010099619.1|  Patatin group A-3                                49.3    4e-08   
ref|XP_010264695.1|  PREDICTED: patatin-like protein 6 isoform X1     48.5    4e-08   Nelumbo nucifera [Indian lotus]
ref|XP_004142416.1|  PREDICTED: patatin group A-3-like isoform 1      47.4    4e-08   Cucumis sativus [cucumbers]
ref|XP_010264697.1|  PREDICTED: patatin-like protein 6 isoform X2     48.5    4e-08   Nelumbo nucifera [Indian lotus]
emb|CDP04363.1|  unnamed protein product                              48.1    4e-08   Coffea canephora [robusta coffee]
ref|XP_004142417.1|  PREDICTED: patatin group A-3-like isoform 2      47.0    5e-08   
ref|XP_002311098.1|  patatin-related family protein                   47.8    5e-08   
ref|XP_011031752.1|  PREDICTED: patatin-like protein 6 isoform X1     47.8    5e-08   Populus euphratica
ref|XP_011040991.1|  PREDICTED: patatin-like protein 6                48.1    5e-08   Populus euphratica
gb|KDP45100.1|  hypothetical protein JCGZ_18542                       48.1    6e-08   Jatropha curcas
ref|XP_011031755.1|  PREDICTED: patatin-like protein 6 isoform X2     47.8    6e-08   Populus euphratica
ref|XP_002529576.1|  Patatin T5 precursor, putative                   48.5    6e-08   Ricinus communis
ref|XP_010067297.1|  PREDICTED: patatin-like protein 6                44.7    7e-08   Eucalyptus grandis [rose gum]
ref|XP_004307392.1|  PREDICTED: patatin-like protein 6                47.8    7e-08   Fragaria vesca subsp. vesca
ref|XP_002316362.1|  patatin-related family protein                   47.8    7e-08   Populus trichocarpa [western balsam poplar]
ref|XP_010253644.1|  PREDICTED: patatin-like protein 6                47.8    7e-08   Nelumbo nucifera [Indian lotus]
ref|XP_009344752.1|  PREDICTED: patatin-like protein 6                47.4    8e-08   Pyrus x bretschneideri [bai li]
ref|XP_009349699.1|  PREDICTED: patatin-like protein 6                47.4    8e-08   Pyrus x bretschneideri [bai li]
ref|XP_008446892.1|  PREDICTED: patatin-like protein 6 isoform X1     47.4    9e-08   Cucumis melo [Oriental melon]
ref|XP_008368383.1|  PREDICTED: patatin-like protein 6                47.4    9e-08   
ref|XP_008377578.1|  PREDICTED: patatin-like protein 6                47.4    9e-08   Malus domestica [apple tree]
ref|XP_008446894.1|  PREDICTED: patatin-like protein 6 isoform X2     47.0    1e-07   
ref|XP_008446895.1|  PREDICTED: patatin-like protein 6 isoform X3     47.0    1e-07   Cucumis melo [Oriental melon]
ref|XP_011084360.1|  PREDICTED: patatin-like protein 6                44.7    1e-07   Sesamum indicum [beniseed]
ref|XP_009760706.1|  PREDICTED: patatin-like protein 6 isoform X1     43.9    1e-07   Nicotiana sylvestris
ref|XP_009345376.1|  PREDICTED: patatin-like protein 6                46.2    2e-07   Pyrus x bretschneideri [bai li]
ref|XP_009760715.1|  PREDICTED: patatin-like protein 6 isoform X2     43.9    2e-07   Nicotiana sylvestris
ref|XP_006854500.1|  hypothetical protein AMTR_s00175p00049630        45.1    2e-07   
emb|CBI31469.3|  unnamed protein product                              45.4    3e-07   Vitis vinifera
gb|EYU39583.1|  hypothetical protein MIMGU_mgv1a005615mg              44.3    3e-07   Erythranthe guttata [common monkey flower]
ref|XP_008456474.1|  PREDICTED: patatin-like protein 6                45.4    3e-07   Cucumis melo [Oriental melon]
ref|XP_002275108.1|  PREDICTED: patatin-like protein 6                45.1    3e-07   
gb|KDO42600.1|  hypothetical protein CISIN_1g012597mg                 45.1    4e-07   Citrus sinensis [apfelsine]
ref|XP_006436295.1|  hypothetical protein CICLE_v10031470mg           45.1    4e-07   
ref|XP_011077003.1|  PREDICTED: patatin-like protein 6                44.3    4e-07   Sesamum indicum [beniseed]
ref|XP_009630204.1|  PREDICTED: patatin-like protein 6 isoform X1     42.0    5e-07   Nicotiana tomentosiformis
ref|XP_007217968.1|  hypothetical protein PRUPE_ppa005326mg           44.3    6e-07   Prunus persica
ref|XP_008233331.1|  PREDICTED: LOW QUALITY PROTEIN: patatin-like...  44.3    6e-07   
ref|XP_010934351.1|  PREDICTED: patatin-like protein 7                41.6    6e-07   Elaeis guineensis
ref|XP_009630207.1|  PREDICTED: patatin-like protein 6 isoform X3     42.0    7e-07   Nicotiana tomentosiformis
ref|XP_009630205.1|  PREDICTED: patatin-like protein 6 isoform X2     42.0    7e-07   Nicotiana tomentosiformis
gb|EYU39817.1|  hypothetical protein MIMGU_mgv1a0057782mg             45.1    8e-07   Erythranthe guttata [common monkey flower]
ref|XP_006345802.1|  PREDICTED: patatin group D-2-like                44.3    1e-06   Solanum tuberosum [potatoes]
ref|XP_004239676.1|  PREDICTED: patatin-like protein 6                44.3    1e-06   Solanum lycopersicum
gb|KJB73585.1|  hypothetical protein B456_011G240000                  43.5    1e-06   Gossypium raimondii
ref|XP_008785344.1|  PREDICTED: patatin-like protein 7                41.6    1e-06   
ref|XP_007009821.1|  PATATIN-like protein 6, IIB                      43.5    1e-06   
gb|KJB74693.1|  hypothetical protein B456_012G004400                  43.5    1e-06   Gossypium raimondii
ref|XP_009413712.1|  PREDICTED: patatin-like protein 6                41.2    2e-06   
ref|XP_003556231.2|  PREDICTED: patatin-3-Kuras 1-like isoform X1     42.0    4e-06   Glycine max [soybeans]
gb|KHG03997.1|  Patatin group A-3                                     43.5    5e-06   Gossypium arboreum [tree cotton]
gb|KEH43521.1|  patatin-like phospholipase                            43.1    5e-06   Medicago truncatula
ref|XP_010557098.1|  PREDICTED: LOW QUALITY PROTEIN: patatin-like...  40.0    6e-06   Tarenaya hassleriana [spider flower]
ref|XP_010920397.1|  PREDICTED: patatin-like protein 7                42.7    7e-06   
ref|XP_008791525.1|  PREDICTED: patatin-like protein 6                38.9    1e-05   
ref|XP_007143699.1|  hypothetical protein PHAVU_007G094300g           42.4    1e-05   Phaseolus vulgaris [French bean]
ref|XP_006589431.1|  PREDICTED: patatin-3-Kuras 1-like                42.0    1e-05   Glycine max [soybeans]
ref|XP_004496284.1|  PREDICTED: patatin-1-Kuras 2-like                40.8    2e-05   Cicer arietinum [garbanzo]
gb|KHN17133.1|  hypothetical protein glysoja_011607                   42.0    2e-05   Glycine soja [wild soybean]
ref|XP_006606244.1|  PREDICTED: patatin-3-Kuras 1-like isoform X2     40.0    4e-05   Glycine max [soybeans]
ref|XP_010534282.1|  PREDICTED: patatin-like protein 8                36.6    3e-04   Tarenaya hassleriana [spider flower]
ref|XP_010529102.1|  PREDICTED: patatin-like protein 6                35.4    4e-04   Tarenaya hassleriana [spider flower]
ref|XP_009381968.1|  PREDICTED: patatin-like protein 6                35.8    8e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010670011.1|  PREDICTED: patatin-like protein 6                34.7    9e-04   



>ref|XP_009605268.1| PREDICTED: patatin-like protein 6 [Nicotiana tomentosiformis]
Length=475

 Score = 49.7 bits (117),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = +2

Query  431  LLESKFLFGYDDQKLWIPKTIAP  499
            +LESKFLFGYDDQKLWIPK IAP
Sbjct  26   ILESKFLFGYDDQKLWIPKQIAP  48


 Score = 35.8 bits (81),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 23/38 (61%), Gaps = 6/38 (16%)
 Frame = +1

Query  340  MAGTHRNVVQGLITEEEPSIDTDKLSYEIFSTGE*VFV  453
            MA  H      L   +EPSIDTDKLSYEIFS  E  F+
Sbjct  1    MACNH------LTDMQEPSIDTDKLSYEIFSILESKFL  32



>ref|XP_009764486.1| PREDICTED: patatin-like protein 6 [Nicotiana sylvestris]
Length=475

 Score = 49.7 bits (117),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = +2

Query  431  LLESKFLFGYDDQKLWIPKTIAP  499
            +LESKFLFGYDDQKLWIPK IAP
Sbjct  26   ILESKFLFGYDDQKLWIPKQIAP  48


 Score = 35.8 bits (81),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 23/38 (61%), Gaps = 6/38 (16%)
 Frame = +1

Query  340  MAGTHRNVVQGLITEEEPSIDTDKLSYEIFSTGE*VFV  453
            MA  H      L   +EPSIDTDKLSYEIFS  E  F+
Sbjct  1    MACNH------LTDMQEPSIDTDKLSYEIFSILESKFL  32



>ref|XP_010099619.1| Patatin group A-3 [Morus notabilis]
 gb|EXB80085.1| Patatin group A-3 [Morus notabilis]
Length=467

 Score = 49.3 bits (116),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = +2

Query  431  LLESKFLFGYDDQKLWIPKTIAP  499
            +LESKFLFGYDDQKLW+PK IAP
Sbjct  31   ILESKFLFGYDDQKLWVPKQIAP  53


 Score = 34.7 bits (78),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 15/16 (94%), Positives = 15/16 (94%), Gaps = 0/16 (0%)
 Frame = +1

Query  385  EEPSIDTDKLSYEIFS  432
             EPSIDTDKLSYEIFS
Sbjct  15   HEPSIDTDKLSYEIFS  30



>ref|XP_010264695.1| PREDICTED: patatin-like protein 6 isoform X1 [Nelumbo nucifera]
 ref|XP_010264696.1| PREDICTED: patatin-like protein 6 isoform X1 [Nelumbo nucifera]
Length=465

 Score = 48.5 bits (114),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = +2

Query  431  LLESKFLFGYDDQKLWIPKTIAP  499
            +LESKFLFGYDDQK+WIPK IAP
Sbjct  27   ILESKFLFGYDDQKVWIPKHIAP  49


 Score = 35.4 bits (80),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = +1

Query  385  EEPSIDTDKLSYEIFSTGE*VFV  453
            +EPSIDTDKLSYEIFS  E  F+
Sbjct  11   QEPSIDTDKLSYEIFSILESKFL  33



>ref|XP_004142416.1| PREDICTED: patatin group A-3-like isoform 1 [Cucumis sativus]
 gb|KGN52278.1| hypothetical protein Csa_5G623420 [Cucumis sativus]
Length=465

 Score = 47.4 bits (111),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = +2

Query  431  LLESKFLFGYDDQKLWIPKTIAP  499
            +LE+KFLFGYDDQKLWIPK I+P
Sbjct  25   ILETKFLFGYDDQKLWIPKQISP  47


 Score = 36.2 bits (82),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 18/27 (67%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +1

Query  373  LITEEEPSIDTDKLSYEIFSTGE*VFV  453
            L+  +EPSIDTDKLSYEIFS  E  F+
Sbjct  5    LLEMQEPSIDTDKLSYEIFSILETKFL  31



>ref|XP_010264697.1| PREDICTED: patatin-like protein 6 isoform X2 [Nelumbo nucifera]
Length=456

 Score = 48.5 bits (114),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = +2

Query  431  LLESKFLFGYDDQKLWIPKTIAP  499
            +LESKFLFGYDDQK+WIPK IAP
Sbjct  18   ILESKFLFGYDDQKVWIPKHIAP  40


 Score = 35.0 bits (79),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 15/16 (94%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = +1

Query  385  EEPSIDTDKLSYEIFS  432
            +EPSIDTDKLSYEIFS
Sbjct  2    QEPSIDTDKLSYEIFS  17



>emb|CDP04363.1| unnamed protein product [Coffea canephora]
Length=457

 Score = 48.1 bits (113),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = +2

Query  431  LLESKFLFGYDDQKLWIPKTIAP  499
            +LESKFLFGYDDQKLWIPK I+P
Sbjct  26   ILESKFLFGYDDQKLWIPKQISP  48


 Score = 35.4 bits (80),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = +1

Query  385  EEPSIDTDKLSYEIFSTGE*VFV  453
            +EPSIDTDKLSYEIFS  E  F+
Sbjct  10   QEPSIDTDKLSYEIFSILESKFL  32



>ref|XP_004142417.1| PREDICTED: patatin group A-3-like isoform 2 [Cucumis sativus]
 ref|XP_004172512.1| PREDICTED: patatin group A-3-like [Cucumis sativus]
Length=417

 Score = 47.0 bits (110),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = +2

Query  431  LLESKFLFGYDDQKLWIPKTIAP  499
            +LE+KFLFGYDDQKLWIPK I+P
Sbjct  25   ILETKFLFGYDDQKLWIPKQISP  47


 Score = 36.6 bits (83),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 18/27 (67%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +1

Query  373  LITEEEPSIDTDKLSYEIFSTGE*VFV  453
            L+  +EPSIDTDKLSYEIFS  E  F+
Sbjct  5    LLEMQEPSIDTDKLSYEIFSILETKFL  31



>ref|XP_002311098.1| patatin-related family protein [Populus trichocarpa]
 gb|EEE88465.1| patatin-related family protein [Populus trichocarpa]
Length=458

 Score = 47.8 bits (112),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = +2

Query  431  LLESKFLFGYDDQKLWIPKTIAP  499
            +LESKFLFGYDDQKLW+PK I+P
Sbjct  18   VLESKFLFGYDDQKLWVPKQISP  40


 Score = 35.8 bits (81),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = +1

Query  385  EEPSIDTDKLSYEIFSTGE*VFV  453
            +EPSIDTDKLSYEIFS  E  F+
Sbjct  2    QEPSIDTDKLSYEIFSVLESKFL  24



>ref|XP_011031752.1| PREDICTED: patatin-like protein 6 isoform X1 [Populus euphratica]
 ref|XP_011031754.1| PREDICTED: patatin-like protein 6 isoform X1 [Populus euphratica]
Length=479

 Score = 47.8 bits (112),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = +2

Query  431  LLESKFLFGYDDQKLWIPKTIAP  499
            +LESKFLFGYDDQKLW+PK I+P
Sbjct  26   VLESKFLFGYDDQKLWVPKQISP  48


 Score = 35.4 bits (80),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = +1

Query  385  EEPSIDTDKLSYEIFSTGE*VFV  453
            +EPSIDTDKLSYEIFS  E  F+
Sbjct  10   QEPSIDTDKLSYEIFSVLESKFL  32



>ref|XP_011040991.1| PREDICTED: patatin-like protein 6 [Populus euphratica]
Length=464

 Score = 48.1 bits (113),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = +2

Query  431  LLESKFLFGYDDQKLWIPKTIAP  499
            +LESKFLFGYDDQKLWIPK ++P
Sbjct  26   ILESKFLFGYDDQKLWIPKQVSP  48


 Score = 35.4 bits (80),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = +1

Query  385  EEPSIDTDKLSYEIFSTGE*VFV  453
            +EPSIDTDKLSYEIFS  E  F+
Sbjct  10   QEPSIDTDKLSYEIFSILESKFL  32



>gb|KDP45100.1| hypothetical protein JCGZ_18542 [Jatropha curcas]
Length=470

 Score = 48.1 bits (113),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = +2

Query  431  LLESKFLFGYDDQKLWIPKTIAP  499
            +LESKFLFGYDDQKLWIPK I+P
Sbjct  26   ILESKFLFGYDDQKLWIPKQISP  48


 Score = 35.0 bits (79),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = +1

Query  385  EEPSIDTDKLSYEIFSTGE*VFV  453
            +EPSIDTDKLSYEIFS  E  F+
Sbjct  10   QEPSIDTDKLSYEIFSILESKFL  32



>ref|XP_011031755.1| PREDICTED: patatin-like protein 6 isoform X2 [Populus euphratica]
Length=470

 Score = 47.8 bits (112),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = +2

Query  431  LLESKFLFGYDDQKLWIPKTIAP  499
            +LESKFLFGYDDQKLW+PK I+P
Sbjct  26   VLESKFLFGYDDQKLWVPKQISP  48


 Score = 35.4 bits (80),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = +1

Query  385  EEPSIDTDKLSYEIFSTGE*VFV  453
            +EPSIDTDKLSYEIFS  E  F+
Sbjct  10   QEPSIDTDKLSYEIFSVLESKFL  32



>ref|XP_002529576.1| Patatin T5 precursor, putative [Ricinus communis]
 gb|EEF32810.1| Patatin T5 precursor, putative [Ricinus communis]
Length=467

 Score = 48.5 bits (114),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = +2

Query  431  LLESKFLFGYDDQKLWIPKTIAP  499
            +LESKFLFGYDDQKLWIPK I+P
Sbjct  26   ILESKFLFGYDDQKLWIPKQISP  48


 Score = 34.7 bits (78),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = +1

Query  385  EEPSIDTDKLSYEIFSTGE*VFV  453
             EPSIDTDKLSYEIFS  E  F+
Sbjct  10   HEPSIDTDKLSYEIFSILESKFL  32



>ref|XP_010067297.1| PREDICTED: patatin-like protein 6 [Eucalyptus grandis]
 gb|KCW65398.1| hypothetical protein EUGRSUZ_G02825 [Eucalyptus grandis]
Length=468

 Score = 44.7 bits (104),  Expect(2) = 7e-08, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = +2

Query  431  LLESKFLFGYDDQKLWIPKTIAP  499
            +LESKFLFGYDD KLW+PK I P
Sbjct  38   ILESKFLFGYDDHKLWVPKQIDP  60


 Score = 38.1 bits (87),  Expect(2) = 7e-08, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 26/41 (63%), Gaps = 3/41 (7%)
 Frame = +1

Query  331  GDKMAGTHRNVVQGLITEEEPSIDTDKLSYEIFSTGE*VFV  453
            G  MA  + N  +    +EEPSIDTDKLSYEIFS  E  F+
Sbjct  7    GVPMASNNNNSSE---MQEEPSIDTDKLSYEIFSILESKFL  44



>ref|XP_004307392.1| PREDICTED: patatin-like protein 6 [Fragaria vesca subsp. vesca]
 ref|XP_011469663.1| PREDICTED: patatin-like protein 6 [Fragaria vesca subsp. vesca]
Length=457

 Score = 47.8 bits (112),  Expect(2) = 7e-08, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = +2

Query  431  LLESKFLFGYDDQKLWIPKTIAP  499
            +LESKFLFGYDDQKLW+PK I+P
Sbjct  25   ILESKFLFGYDDQKLWVPKQISP  47


 Score = 35.4 bits (80),  Expect(2) = 7e-08, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = +1

Query  385  EEPSIDTDKLSYEIFSTGE*VFV  453
            +EPSIDTDKLSYEIFS  E  F+
Sbjct  9    QEPSIDTDKLSYEIFSILESKFL  31



>ref|XP_002316362.1| patatin-related family protein [Populus trichocarpa]
 gb|EEF02533.1| patatin-related family protein [Populus trichocarpa]
Length=464

 Score = 47.8 bits (112),  Expect(2) = 7e-08, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = +2

Query  431  LLESKFLFGYDDQKLWIPKTIAP  499
            +LESKFLFGYDDQKLWIPK ++P
Sbjct  26   ILESKFLFGYDDQKLWIPKQVSP  48


 Score = 35.0 bits (79),  Expect(2) = 7e-08, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = +1

Query  385  EEPSIDTDKLSYEIFSTGE*VFV  453
            +EPSIDTDKLSYEIFS  E  F+
Sbjct  10   QEPSIDTDKLSYEIFSILESKFL  32



>ref|XP_010253644.1| PREDICTED: patatin-like protein 6 [Nelumbo nucifera]
 ref|XP_010253645.1| PREDICTED: patatin-like protein 6 [Nelumbo nucifera]
 ref|XP_010253647.1| PREDICTED: patatin-like protein 6 [Nelumbo nucifera]
Length=463

 Score = 47.8 bits (112),  Expect(2) = 7e-08, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = +2

Query  431  LLESKFLFGYDDQKLWIPKTIAP  499
            +LES FLFGYDDQKLWIPK IAP
Sbjct  25   ILESNFLFGYDDQKLWIPKQIAP  47


 Score = 35.0 bits (79),  Expect(2) = 7e-08, Method: Compositional matrix adjust.
 Identities = 15/16 (94%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = +1

Query  385  EEPSIDTDKLSYEIFS  432
            +EPSIDTDKLSYEIFS
Sbjct  9    QEPSIDTDKLSYEIFS  24



>ref|XP_009344752.1| PREDICTED: patatin-like protein 6 [Pyrus x bretschneideri]
 ref|XP_009344753.1| PREDICTED: patatin-like protein 6 [Pyrus x bretschneideri]
Length=478

 Score = 47.4 bits (111),  Expect(2) = 8e-08, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = +2

Query  431  LLESKFLFGYDDQKLWIPKTIAP  499
            +LESKFLFGYDDQKLW+PK ++P
Sbjct  26   ILESKFLFGYDDQKLWVPKQVSP  48


 Score = 35.4 bits (80),  Expect(2) = 8e-08, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = +1

Query  385  EEPSIDTDKLSYEIFSTGE*VFV  453
            +EPSIDTDKLSYEIFS  E  F+
Sbjct  10   QEPSIDTDKLSYEIFSILESKFL  32



>ref|XP_009349699.1| PREDICTED: patatin-like protein 6 [Pyrus x bretschneideri]
 ref|XP_009349700.1| PREDICTED: patatin-like protein 6 [Pyrus x bretschneideri]
Length=478

 Score = 47.4 bits (111),  Expect(2) = 8e-08, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = +2

Query  431  LLESKFLFGYDDQKLWIPKTIAP  499
            +LESKFLFGYDDQKLW+PK ++P
Sbjct  26   ILESKFLFGYDDQKLWVPKQVSP  48


 Score = 35.4 bits (80),  Expect(2) = 8e-08, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = +1

Query  385  EEPSIDTDKLSYEIFSTGE*VFV  453
            +EPSIDTDKLSYEIFS  E  F+
Sbjct  10   QEPSIDTDKLSYEIFSILESKFL  32



>ref|XP_008446892.1| PREDICTED: patatin-like protein 6 isoform X1 [Cucumis melo]
 ref|XP_008446893.1| PREDICTED: patatin-like protein 6 isoform X1 [Cucumis melo]
Length=466

 Score = 47.4 bits (111),  Expect(2) = 9e-08, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = +2

Query  431  LLESKFLFGYDDQKLWIPKTIAP  499
            +LE+KFLFGYDDQKLWIPK I+P
Sbjct  25   ILETKFLFGYDDQKLWIPKQISP  47


 Score = 35.4 bits (80),  Expect(2) = 9e-08, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = +1

Query  385  EEPSIDTDKLSYEIFSTGE*VFV  453
            +EPSIDTDKLSYEIFS  E  F+
Sbjct  9    QEPSIDTDKLSYEIFSILETKFL  31



>ref|XP_008368383.1| PREDICTED: patatin-like protein 6 [Malus domestica]
Length=478

 Score = 47.4 bits (111),  Expect(2) = 9e-08, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = +2

Query  431  LLESKFLFGYDDQKLWIPKTIAP  499
            +LESKFLFGYDDQKLW+PK ++P
Sbjct  26   ILESKFLFGYDDQKLWVPKQVSP  48


 Score = 35.0 bits (79),  Expect(2) = 9e-08, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = +1

Query  385  EEPSIDTDKLSYEIFSTGE*VFV  453
            +EPSIDTDKLSYEIFS  E  F+
Sbjct  10   QEPSIDTDKLSYEIFSILESKFL  32



>ref|XP_008377578.1| PREDICTED: patatin-like protein 6 [Malus domestica]
Length=477

 Score = 47.4 bits (111),  Expect(2) = 9e-08, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = +2

Query  431  LLESKFLFGYDDQKLWIPKTIAP  499
            +LESKFLFGYDDQKLW+PK ++P
Sbjct  25   ILESKFLFGYDDQKLWVPKQVSP  47


 Score = 35.4 bits (80),  Expect(2) = 9e-08, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = +1

Query  385  EEPSIDTDKLSYEIFSTGE*VFV  453
            +EPSIDTDKLSYEIFS  E  F+
Sbjct  9    QEPSIDTDKLSYEIFSILESKFL  31



>ref|XP_008446894.1| PREDICTED: patatin-like protein 6 isoform X2 [Cucumis melo]
Length=383

 Score = 47.0 bits (110),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = +2

Query  431  LLESKFLFGYDDQKLWIPKTIAP  499
            +LE+KFLFGYDDQKLWIPK I+P
Sbjct  25   ILETKFLFGYDDQKLWIPKQISP  47


 Score = 35.4 bits (80),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = +1

Query  385  EEPSIDTDKLSYEIFSTGE*VFV  453
            +EPSIDTDKLSYEIFS  E  F+
Sbjct  9    QEPSIDTDKLSYEIFSILETKFL  31



>ref|XP_008446895.1| PREDICTED: patatin-like protein 6 isoform X3 [Cucumis melo]
Length=381

 Score = 47.0 bits (110),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = +2

Query  431  LLESKFLFGYDDQKLWIPKTIAP  499
            +LE+KFLFGYDDQKLWIPK I+P
Sbjct  25   ILETKFLFGYDDQKLWIPKQISP  47


 Score = 35.4 bits (80),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = +1

Query  385  EEPSIDTDKLSYEIFSTGE*VFV  453
            +EPSIDTDKLSYEIFS  E  F+
Sbjct  9    QEPSIDTDKLSYEIFSILETKFL  31



>ref|XP_011084360.1| PREDICTED: patatin-like protein 6 [Sesamum indicum]
Length=471

 Score = 44.7 bits (104),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 18/22 (82%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = +2

Query  431  LLESKFLFGYDDQKLWIPKTIA  496
            +LESKFLFGYDD+KLW+PK IA
Sbjct  35   ILESKFLFGYDDRKLWVPKQIA  56


 Score = 37.7 bits (86),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 25/35 (71%), Gaps = 1/35 (3%)
 Frame = +1

Query  352  HRNVVQGLITE-EEPSIDTDKLSYEIFSTGE*VFV  453
            H N ++  + E +EPSIDTDKLSYEIFS  E  F+
Sbjct  7    HGNGIKSPVVEMQEPSIDTDKLSYEIFSILESKFL  41



>ref|XP_009760706.1| PREDICTED: patatin-like protein 6 isoform X1 [Nicotiana sylvestris]
Length=453

 Score = 43.9 bits (102),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  431  LLESKFLFGYDDQKLWIPKTI  493
            +LESKFLFGYDDQKLW+PK +
Sbjct  27   ILESKFLFGYDDQKLWVPKEL  47


 Score = 37.7 bits (86),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 16/18 (89%), Positives = 18/18 (100%), Gaps = 0/18 (0%)
 Frame = +1

Query  379  TEEEPSIDTDKLSYEIFS  432
            T++EPSIDTDKLSYEIFS
Sbjct  9    TQQEPSIDTDKLSYEIFS  26



>ref|XP_009345376.1| PREDICTED: patatin-like protein 6 [Pyrus x bretschneideri]
Length=477

 Score = 46.2 bits (108),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = +2

Query  431  LLESKFLFGYDDQKLWIPKTIAP  499
            +LE+KFLFGYDDQKLW+PK ++P
Sbjct  25   ILETKFLFGYDDQKLWVPKQVSP  47


 Score = 35.4 bits (80),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = +1

Query  385  EEPSIDTDKLSYEIFSTGE*VFV  453
            +EPSIDTDKLSYEIFS  E  F+
Sbjct  9    QEPSIDTDKLSYEIFSILETKFL  31



>ref|XP_009760715.1| PREDICTED: patatin-like protein 6 isoform X2 [Nicotiana sylvestris]
Length=376

 Score = 43.9 bits (102),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  431  LLESKFLFGYDDQKLWIPKTI  493
            +LESKFLFGYDDQKLW+PK +
Sbjct  27   ILESKFLFGYDDQKLWVPKEL  47


 Score = 37.7 bits (86),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 16/18 (89%), Positives = 18/18 (100%), Gaps = 0/18 (0%)
 Frame = +1

Query  379  TEEEPSIDTDKLSYEIFS  432
            T++EPSIDTDKLSYEIFS
Sbjct  9    TQQEPSIDTDKLSYEIFS  26



>ref|XP_006854500.1| hypothetical protein AMTR_s00175p00049630 [Amborella trichopoda]
 gb|ERN15967.1| hypothetical protein AMTR_s00175p00049630 [Amborella trichopoda]
Length=446

 Score = 45.1 bits (105),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 19/21 (90%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  431  LLESKFLFGYDDQKLWIPKTI  493
            +LESKFLFGYDDQKLWIPK I
Sbjct  18   ILESKFLFGYDDQKLWIPKDI  38


 Score = 36.2 bits (82),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = +1

Query  385  EEPSIDTDKLSYEIFSTGE*VFV  453
            EEPSIDTDKLSYEIFS  E  F+
Sbjct  2    EEPSIDTDKLSYEIFSILESKFL  24



>emb|CBI31469.3| unnamed protein product [Vitis vinifera]
Length=359

 Score = 45.4 bits (106),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 19/21 (90%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  431  LLESKFLFGYDDQKLWIPKTI  493
            +LESKFLFGYDDQKLWIPK I
Sbjct  26   ILESKFLFGYDDQKLWIPKQI  46


 Score = 35.4 bits (80),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = +1

Query  385  EEPSIDTDKLSYEIFSTGE*VFV  453
            +EPSIDTDKLSYEIFS  E  F+
Sbjct  10   QEPSIDTDKLSYEIFSILESKFL  32



>gb|EYU39583.1| hypothetical protein MIMGU_mgv1a005615mg [Erythranthe guttata]
Length=477

 Score = 44.3 bits (103),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = +2

Query  431  LLESKFLFGYDDQKLWIPKTIA  496
            +LESKFLFGYDDQK+W+PK I+
Sbjct  35   ILESKFLFGYDDQKIWVPKQIS  56


 Score = 36.6 bits (83),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = +1

Query  364  VQGLITEEEPSIDTDKLSYEIFS  432
            V  +I  +EPSIDTDKLSYEIFS
Sbjct  12   VAPMIGLQEPSIDTDKLSYEIFS  34



>ref|XP_008456474.1| PREDICTED: patatin-like protein 6 [Cucumis melo]
Length=467

 Score = 45.4 bits (106),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = +2

Query  431  LLESKFLFGYDDQKLWIPKTIAP  499
            +LES FLFGYDDQKLW+PK I P
Sbjct  18   ILESNFLFGYDDQKLWVPKQIPP  40


 Score = 35.0 bits (79),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 15/16 (94%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = +1

Query  385  EEPSIDTDKLSYEIFS  432
            +EPSIDTDKLSYEIFS
Sbjct  2    QEPSIDTDKLSYEIFS  17



>ref|XP_002275108.1| PREDICTED: patatin-like protein 6 [Vitis vinifera]
 ref|XP_010658410.1| PREDICTED: patatin-like protein 6 [Vitis vinifera]
Length=458

 Score = 45.1 bits (105),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 19/21 (90%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  431  LLESKFLFGYDDQKLWIPKTI  493
            +LESKFLFGYDDQKLWIPK I
Sbjct  26   ILESKFLFGYDDQKLWIPKQI  46


 Score = 35.4 bits (80),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = +1

Query  385  EEPSIDTDKLSYEIFSTGE*VFV  453
            +EPSIDTDKLSYEIFS  E  F+
Sbjct  10   QEPSIDTDKLSYEIFSILESKFL  32



>gb|KDO42600.1| hypothetical protein CISIN_1g012597mg [Citrus sinensis]
 gb|KDO42601.1| hypothetical protein CISIN_1g012597mg [Citrus sinensis]
Length=460

 Score = 45.1 bits (105),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 19/21 (90%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  431  LLESKFLFGYDDQKLWIPKTI  493
            +LESKFLFGYDDQKLWIPK I
Sbjct  26   ILESKFLFGYDDQKLWIPKQI  46


 Score = 35.4 bits (80),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = +1

Query  385  EEPSIDTDKLSYEIFSTGE*VFV  453
            +EPSIDTDKLSYEIFS  E  F+
Sbjct  10   QEPSIDTDKLSYEIFSILESKFL  32



>ref|XP_006436295.1| hypothetical protein CICLE_v10031470mg [Citrus clementina]
 ref|XP_006436296.1| hypothetical protein CICLE_v10031470mg [Citrus clementina]
 ref|XP_006485862.1| PREDICTED: patatin-3-Kuras 1-like [Citrus sinensis]
 gb|ESR49535.1| hypothetical protein CICLE_v10031470mg [Citrus clementina]
 gb|ESR49536.1| hypothetical protein CICLE_v10031470mg [Citrus clementina]
Length=460

 Score = 45.1 bits (105),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 19/21 (90%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  431  LLESKFLFGYDDQKLWIPKTI  493
            +LESKFLFGYDDQKLWIPK I
Sbjct  26   ILESKFLFGYDDQKLWIPKQI  46


 Score = 35.4 bits (80),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = +1

Query  385  EEPSIDTDKLSYEIFSTGE*VFV  453
            +EPSIDTDKLSYEIFS  E  F+
Sbjct  10   QEPSIDTDKLSYEIFSILESKFL  32



>ref|XP_011077003.1| PREDICTED: patatin-like protein 6 [Sesamum indicum]
Length=474

 Score = 44.3 bits (103),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  431  LLESKFLFGYDDQKLWIPKTIA  496
            +LESKFLFGYDDQKLW+P+ I 
Sbjct  35   ILESKFLFGYDDQKLWVPRQIG  56


 Score = 35.8 bits (81),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 15/20 (75%), Positives = 18/20 (90%), Gaps = 0/20 (0%)
 Frame = +1

Query  373  LITEEEPSIDTDKLSYEIFS  432
            ++  +EPSIDTDKLSYEIFS
Sbjct  15   MVGLQEPSIDTDKLSYEIFS  34



>ref|XP_009630204.1| PREDICTED: patatin-like protein 6 isoform X1 [Nicotiana tomentosiformis]
Length=453

 Score = 42.0 bits (97),  Expect(2) = 5e-07, Method: Compositional matrix adjust.
 Identities = 16/21 (76%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  431  LLESKFLFGYDDQKLWIPKTI  493
            +LESKFLFGY+DQKLW+PK +
Sbjct  27   ILESKFLFGYNDQKLWVPKEL  47


 Score = 37.7 bits (86),  Expect(2) = 5e-07, Method: Compositional matrix adjust.
 Identities = 18/25 (72%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = +1

Query  379  TEEEPSIDTDKLSYEIFSTGE*VFV  453
            T++EPSIDTDKLSYEIFS  E  F+
Sbjct  9    TQQEPSIDTDKLSYEIFSILESKFL  33



>ref|XP_007217968.1| hypothetical protein PRUPE_ppa005326mg [Prunus persica]
 gb|EMJ19167.1| hypothetical protein PRUPE_ppa005326mg [Prunus persica]
Length=466

 Score = 44.3 bits (103),  Expect(2) = 6e-07, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  431  LLESKFLFGYDDQKLWIPKTI  493
            +LESKFLFGYDDQKLW+PK +
Sbjct  25   ILESKFLFGYDDQKLWVPKQV  45


 Score = 35.4 bits (80),  Expect(2) = 6e-07, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = +1

Query  385  EEPSIDTDKLSYEIFSTGE*VFV  453
            +EPSIDTDKLSYEIFS  E  F+
Sbjct  9    QEPSIDTDKLSYEIFSILESKFL  31



>ref|XP_008233331.1| PREDICTED: LOW QUALITY PROTEIN: patatin-like protein 6 [Prunus 
mume]
Length=467

 Score = 44.3 bits (103),  Expect(2) = 6e-07, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  431  LLESKFLFGYDDQKLWIPKTI  493
            +LESKFLFGYDDQKLW+PK +
Sbjct  25   ILESKFLFGYDDQKLWVPKQV  45


 Score = 35.4 bits (80),  Expect(2) = 6e-07, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = +1

Query  385  EEPSIDTDKLSYEIFSTGE*VFV  453
            +EPSIDTDKLSYEIFS  E  F+
Sbjct  9    QEPSIDTDKLSYEIFSILESKFL  31



>ref|XP_010934351.1| PREDICTED: patatin-like protein 7 [Elaeis guineensis]
 ref|XP_010934352.1| PREDICTED: patatin-like protein 7 [Elaeis guineensis]
Length=462

 Score = 41.6 bits (96),  Expect(2) = 6e-07, Method: Compositional matrix adjust.
 Identities = 16/19 (84%), Positives = 18/19 (95%), Gaps = 0/19 (0%)
 Frame = +2

Query  431  LLESKFLFGYDDQKLWIPK  487
            +LESKFLFGYDD KLW+PK
Sbjct  36   ILESKFLFGYDDHKLWVPK  54


 Score = 38.1 bits (87),  Expect(2) = 6e-07, Method: Compositional matrix adjust.
 Identities = 17/17 (100%), Positives = 17/17 (100%), Gaps = 0/17 (0%)
 Frame = +1

Query  382  EEEPSIDTDKLSYEIFS  432
            EEEPSIDTDKLSYEIFS
Sbjct  19   EEEPSIDTDKLSYEIFS  35



>ref|XP_009630207.1| PREDICTED: patatin-like protein 6 isoform X3 [Nicotiana tomentosiformis]
Length=376

 Score = 42.0 bits (97),  Expect(2) = 7e-07, Method: Compositional matrix adjust.
 Identities = 16/21 (76%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  431  LLESKFLFGYDDQKLWIPKTI  493
            +LESKFLFGY+DQKLW+PK +
Sbjct  27   ILESKFLFGYNDQKLWVPKEL  47


 Score = 37.7 bits (86),  Expect(2) = 7e-07, Method: Compositional matrix adjust.
 Identities = 18/25 (72%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = +1

Query  379  TEEEPSIDTDKLSYEIFSTGE*VFV  453
            T++EPSIDTDKLSYEIFS  E  F+
Sbjct  9    TQQEPSIDTDKLSYEIFSILESKFL  33



>ref|XP_009630205.1| PREDICTED: patatin-like protein 6 isoform X2 [Nicotiana tomentosiformis]
Length=377

 Score = 42.0 bits (97),  Expect(2) = 7e-07, Method: Compositional matrix adjust.
 Identities = 16/21 (76%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  431  LLESKFLFGYDDQKLWIPKTI  493
            +LESKFLFGY+DQKLW+PK +
Sbjct  27   ILESKFLFGYNDQKLWVPKEL  47


 Score = 37.7 bits (86),  Expect(2) = 7e-07, Method: Compositional matrix adjust.
 Identities = 18/25 (72%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = +1

Query  379  TEEEPSIDTDKLSYEIFSTGE*VFV  453
            T++EPSIDTDKLSYEIFS  E  F+
Sbjct  9    TQQEPSIDTDKLSYEIFSILESKFL  33



>gb|EYU39817.1| hypothetical protein MIMGU_mgv1a0057782mg [Erythranthe guttata]
Length=471

 Score = 45.1 bits (105),  Expect(2) = 8e-07, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = +2

Query  431  LLESKFLFGYDDQKLWIPKTIAP  499
            +LESKF FGYDDQKLW+PK I+P
Sbjct  36   ILESKFWFGYDDQKLWVPKQISP  58


 Score = 34.3 bits (77),  Expect(2) = 8e-07, Method: Compositional matrix adjust.
 Identities = 15/16 (94%), Positives = 15/16 (94%), Gaps = 0/16 (0%)
 Frame = +1

Query  385  EEPSIDTDKLSYEIFS  432
             EPSIDTDKLSYEIFS
Sbjct  20   HEPSIDTDKLSYEIFS  35



>ref|XP_006345802.1| PREDICTED: patatin group D-2-like [Solanum tuberosum]
Length=466

 Score = 44.3 bits (103),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  431  LLESKFLFGYDDQKLWIPKTI  493
            +LESKFLFGYDDQKLW+PK +
Sbjct  27   ILESKFLFGYDDQKLWVPKNL  47


 Score = 34.7 bits (78),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = +1

Query  388  EPSIDTDKLSYEIFSTGE*VFV  453
            EPSIDTDKLSYEIFS  E  F+
Sbjct  12   EPSIDTDKLSYEIFSILESKFL  33



>ref|XP_004239676.1| PREDICTED: patatin-like protein 6 [Solanum lycopersicum]
 ref|XP_010321321.1| PREDICTED: patatin-like protein 6 [Solanum lycopersicum]
 ref|XP_010321322.1| PREDICTED: patatin-like protein 6 [Solanum lycopersicum]
Length=466

 Score = 44.3 bits (103),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  431  LLESKFLFGYDDQKLWIPKTI  493
            +LESKFLFGYDDQKLW+PK +
Sbjct  27   ILESKFLFGYDDQKLWVPKNL  47


 Score = 34.7 bits (78),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = +1

Query  388  EPSIDTDKLSYEIFSTGE*VFV  453
            EPSIDTDKLSYEIFS  E  F+
Sbjct  12   EPSIDTDKLSYEIFSILESKFL  33



>gb|KJB73585.1| hypothetical protein B456_011G240000 [Gossypium raimondii]
 gb|KJB73586.1| hypothetical protein B456_011G240000 [Gossypium raimondii]
Length=461

 Score = 43.5 bits (101),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 22/24 (92%), Gaps = 1/24 (4%)
 Frame = +2

Query  431  LLESKFLFGYDD-QKLWIPKTIAP  499
            +LESKFLFGYDD QKLWIPK I+P
Sbjct  26   ILESKFLFGYDDQQKLWIPKPISP  49


 Score = 35.0 bits (79),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = +1

Query  385  EEPSIDTDKLSYEIFSTGE*VFV  453
            +EPSIDTDKLSYEIFS  E  F+
Sbjct  10   QEPSIDTDKLSYEIFSILESKFL  32



>ref|XP_008785344.1| PREDICTED: patatin-like protein 7 [Phoenix dactylifera]
Length=467

 Score = 41.6 bits (96),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 16/19 (84%), Positives = 18/19 (95%), Gaps = 0/19 (0%)
 Frame = +2

Query  431  LLESKFLFGYDDQKLWIPK  487
            +LESKFLFGYDD KLW+PK
Sbjct  32   ILESKFLFGYDDHKLWVPK  50


 Score = 37.0 bits (84),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 16/17 (94%), Positives = 17/17 (100%), Gaps = 0/17 (0%)
 Frame = +1

Query  382  EEEPSIDTDKLSYEIFS  432
            EEEPSIDTDKL+YEIFS
Sbjct  15   EEEPSIDTDKLTYEIFS  31



>ref|XP_007009821.1| PATATIN-like protein 6, IIB [Theobroma cacao]
 gb|EOY18631.1| PATATIN-like protein 6, IIB [Theobroma cacao]
Length=460

 Score = 43.5 bits (101),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 22/24 (92%), Gaps = 1/24 (4%)
 Frame = +2

Query  431  LLESKFLFGYDD-QKLWIPKTIAP  499
            +LESKFLFGYDD QKLWIPK I+P
Sbjct  26   ILESKFLFGYDDHQKLWIPKPISP  49


 Score = 35.0 bits (79),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = +1

Query  385  EEPSIDTDKLSYEIFSTGE*VFV  453
            +EPSIDTDKLSYEIFS  E  F+
Sbjct  10   QEPSIDTDKLSYEIFSILESKFL  32



>gb|KJB74693.1| hypothetical protein B456_012G004400 [Gossypium raimondii]
 gb|KJB74694.1| hypothetical protein B456_012G004400 [Gossypium raimondii]
 gb|KJB74695.1| hypothetical protein B456_012G004400 [Gossypium raimondii]
 gb|KJB74696.1| hypothetical protein B456_012G004400 [Gossypium raimondii]
 gb|KJB74697.1| hypothetical protein B456_012G004400 [Gossypium raimondii]
Length=457

 Score = 43.5 bits (101),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 22/24 (92%), Gaps = 1/24 (4%)
 Frame = +2

Query  431  LLESKFLFGYDD-QKLWIPKTIAP  499
            +LESKFLFGYDD QKLWIPK I+P
Sbjct  26   ILESKFLFGYDDNQKLWIPKPISP  49


 Score = 35.0 bits (79),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = +1

Query  385  EEPSIDTDKLSYEIFSTGE*VFV  453
            +EPSIDTDKLSYEIFS  E  F+
Sbjct  10   QEPSIDTDKLSYEIFSILESKFL  32



>ref|XP_009413712.1| PREDICTED: patatin-like protein 6 [Musa acuminata subsp. malaccensis]
Length=494

 Score = 41.2 bits (95),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = +2

Query  431  LLESKFLFGYDDQKLWIPKTIAP  499
            +LESKFLFGYDD KLWIP    P
Sbjct  45   ILESKFLFGYDDHKLWIPTAPPP  67


 Score = 37.0 bits (84),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 18/25 (72%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = +1

Query  379  TEEEPSIDTDKLSYEIFSTGE*VFV  453
             EE+PSIDTDKLSYEIFS  E  F+
Sbjct  27   AEEDPSIDTDKLSYEIFSILESKFL  51



>ref|XP_003556231.2| PREDICTED: patatin-3-Kuras 1-like isoform X1 [Glycine max]
Length=544

 Score = 42.0 bits (97),  Expect(2) = 4e-06, Method: Composition-based stats.
 Identities = 17/21 (81%), Positives = 18/21 (86%), Gaps = 0/21 (0%)
 Frame = +2

Query  431  LLESKFLFGYDDQKLWIPKTI  493
            +LESKFLFGYDD KLW PK I
Sbjct  108  ILESKFLFGYDDPKLWFPKQI  128


 Score = 34.7 bits (78),  Expect(2) = 4e-06, Method: Composition-based stats.
 Identities = 16/23 (70%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = +1

Query  385  EEPSIDTDKLSYEIFSTGE*VFV  453
            +EPSI+TDKLSYEIFS  E  F+
Sbjct  92   QEPSIETDKLSYEIFSILESKFL  114



>gb|KHG03997.1| Patatin group A-3 [Gossypium arboreum]
Length=461

 Score = 43.5 bits (101),  Expect(2) = 5e-06, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 22/24 (92%), Gaps = 1/24 (4%)
 Frame = +2

Query  431  LLESKFLFGYDD-QKLWIPKTIAP  499
            +LESKFLFGYDD QKLWIPK I+P
Sbjct  26   ILESKFLFGYDDQQKLWIPKPISP  49


 Score = 33.1 bits (74),  Expect(2) = 5e-06, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = +1

Query  385  EEPSIDTDKLSYEIFSTGE*VFV  453
            +EPSI+TDKLSYEIFS  E  F+
Sbjct  10   QEPSIETDKLSYEIFSILESKFL  32



>gb|KEH43521.1| patatin-like phospholipase [Medicago truncatula]
Length=463

 Score = 43.1 bits (100),  Expect(2) = 5e-06, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = +2

Query  431  LLESKFLFGYDDQKLWIPKTI  493
            +LESKFLFGYDDQKLW PK I
Sbjct  26   ILESKFLFGYDDQKLWFPKQI  46


 Score = 33.5 bits (75),  Expect(2) = 5e-06, Method: Compositional matrix adjust.
 Identities = 14/16 (88%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = +1

Query  385  EEPSIDTDKLSYEIFS  432
            +EPSI+TDKLSYEIFS
Sbjct  10   QEPSIETDKLSYEIFS  25



>ref|XP_010557098.1| PREDICTED: LOW QUALITY PROTEIN: patatin-like protein 6 [Tarenaya 
hassleriana]
Length=509

 Score = 40.0 bits (92),  Expect(2) = 6e-06, Method: Composition-based stats.
 Identities = 15/23 (65%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = +2

Query  431  LLESKFLFGYDDQKLWIPKTIAP  499
            +LESKFLFGYDD KL +P+ + P
Sbjct  69   ILESKFLFGYDDPKLMVPRALEP  91


 Score = 36.6 bits (83),  Expect(2) = 6e-06, Method: Composition-based stats.
 Identities = 17/23 (74%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = +1

Query  385  EEPSIDTDKLSYEIFSTGE*VFV  453
            +EPSIDTDKLSYEIFS  E  F+
Sbjct  53   QEPSIDTDKLSYEIFSILESKFL  75



>ref|XP_010920397.1| PREDICTED: patatin-like protein 7 [Elaeis guineensis]
Length=540

 Score = 42.7 bits (99),  Expect(2) = 7e-06, Method: Composition-based stats.
 Identities = 16/19 (84%), Positives = 18/19 (95%), Gaps = 0/19 (0%)
 Frame = +2

Query  431  LLESKFLFGYDDQKLWIPK  487
            +LESKFLFGYDD KLW+PK
Sbjct  24   ILESKFLFGYDDHKLWVPK  42


 Score = 33.1 bits (74),  Expect(2) = 7e-06, Method: Composition-based stats.
 Identities = 15/22 (68%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = +1

Query  388  EPSIDTDKLSYEIFSTGE*VFV  453
            EPS+D DKLSYEIFS  E  F+
Sbjct  9    EPSLDVDKLSYEIFSILESKFL  30



>ref|XP_008791525.1| PREDICTED: patatin-like protein 6 [Phoenix dactylifera]
 ref|XP_008791526.1| PREDICTED: patatin-like protein 6 [Phoenix dactylifera]
Length=471

 Score = 38.9 bits (89),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 15/19 (79%), Positives = 18/19 (95%), Gaps = 0/19 (0%)
 Frame = +2

Query  431  LLESKFLFGYDDQKLWIPK  487
            +LESKFLFGYDD KLW+P+
Sbjct  36   ILESKFLFGYDDPKLWVPE  54


 Score = 36.6 bits (83),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = +1

Query  385  EEPSIDTDKLSYEIFSTGE*VFV  453
            EEPSIDTDKLSYEIFS  E  F+
Sbjct  20   EEPSIDTDKLSYEIFSILESKFL  42



>ref|XP_007143699.1| hypothetical protein PHAVU_007G094300g [Phaseolus vulgaris]
 gb|ESW15693.1| hypothetical protein PHAVU_007G094300g [Phaseolus vulgaris]
Length=458

 Score = 42.4 bits (98),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = +2

Query  431  LLESKFLFGYDDQKLWIPKTIAP  499
            +LESKFLFGYDD KLW PK I P
Sbjct  26   ILESKFLFGYDDPKLWFPKQIPP  48


 Score = 33.1 bits (74),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 14/16 (88%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = +1

Query  385  EEPSIDTDKLSYEIFS  432
            +EPSI+TDKLSYEIFS
Sbjct  10   QEPSIETDKLSYEIFS  25



>ref|XP_006589431.1| PREDICTED: patatin-3-Kuras 1-like [Glycine max]
Length=463

 Score = 42.0 bits (97),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = +2

Query  431  LLESKFLFGYDDQKLWIPKTIAP  499
            +LESKFLFGYDD KLW PK I P
Sbjct  26   ILESKFLFGYDDPKLWFPKQIPP  48


 Score = 33.1 bits (74),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = +1

Query  385  EEPSIDTDKLSYEIFSTGE*VFV  453
            +EPSI+TDKLSYEIFS  E  F+
Sbjct  10   QEPSIETDKLSYEIFSILESKFL  32



>ref|XP_004496284.1| PREDICTED: patatin-1-Kuras 2-like [Cicer arietinum]
Length=467

 Score = 40.8 bits (94),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 18/21 (86%), Gaps = 0/21 (0%)
 Frame = +2

Query  431  LLESKFLFGYDDQKLWIPKTI  493
            +LESKFLFGYDDQKLW P  I
Sbjct  26   ILESKFLFGYDDQKLWFPNLI  46


 Score = 33.5 bits (75),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = +1

Query  385  EEPSIDTDKLSYEIFSTGE*VFV  453
            +EPSI+TDKLSYEIFS  E  F+
Sbjct  10   QEPSIETDKLSYEIFSILESKFL  32



>gb|KHN17133.1| hypothetical protein glysoja_011607 [Glycine soja]
Length=88

 Score = 42.0 bits (97),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = +2

Query  431  LLESKFLFGYDDQKLWIPKTIAP  499
            +LESKFLFGYDD KLW PK I P
Sbjct  26   ILESKFLFGYDDPKLWFPKQIPP  48


 Score = 32.7 bits (73),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = +1

Query  385  EEPSIDTDKLSYEIFSTGE*VFV  453
            +EPSI+TDKLSYEIFS  E  F+
Sbjct  10   QEPSIETDKLSYEIFSILESKFL  32



>ref|XP_006606244.1| PREDICTED: patatin-3-Kuras 1-like isoform X2 [Glycine max]
Length=462

 Score = 40.0 bits (92),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 18/21 (86%), Gaps = 0/21 (0%)
 Frame = +2

Query  431  LLESKFLFGYDDQKLWIPKTI  493
            +LESKFLFGYDD KLW PK I
Sbjct  26   ILESKFLFGYDDPKLWFPKQI  46


 Score = 33.5 bits (75),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 14/16 (88%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = +1

Query  385  EEPSIDTDKLSYEIFS  432
            +EPSI+TDKLSYEIFS
Sbjct  10   QEPSIETDKLSYEIFS  25



>ref|XP_010534282.1| PREDICTED: patatin-like protein 8 [Tarenaya hassleriana]
Length=533

 Score = 36.6 bits (83),  Expect(2) = 3e-04, Method: Composition-based stats.
 Identities = 13/23 (57%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = +2

Query  431  LLESKFLFGYDDQKLWIPKTIAP  499
            +LE+KFLFGY+D + WIP++  P
Sbjct  69   ILENKFLFGYEDPRQWIPRSPRP  91


 Score = 34.3 bits (77),  Expect(2) = 3e-04, Method: Composition-based stats.
 Identities = 17/26 (65%), Positives = 18/26 (69%), Gaps = 0/26 (0%)
 Frame = +1

Query  376  ITEEEPSIDTDKLSYEIFSTGE*VFV  453
            I   EPSID DKLSYEIFS  E  F+
Sbjct  50   IKPHEPSIDPDKLSYEIFSILENKFL  75



>ref|XP_010529102.1| PREDICTED: patatin-like protein 6 [Tarenaya hassleriana]
Length=487

 Score = 35.4 bits (80),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 16/20 (80%), Positives = 17/20 (85%), Gaps = 0/20 (0%)
 Frame = +2

Query  431  LLESKFLFGYDDQKLWIPKT  490
            +LESKFLFGYDD KL  PKT
Sbjct  48   ILESKFLFGYDDTKLIDPKT  67


 Score = 34.7 bits (78),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 14/16 (88%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = +1

Query  385  EEPSIDTDKLSYEIFS  432
            +EPS+DTDKLSYEIFS
Sbjct  32   QEPSVDTDKLSYEIFS  47



>ref|XP_009381968.1| PREDICTED: patatin-like protein 6 [Musa acuminata subsp. malaccensis]
Length=482

 Score = 35.8 bits (81),  Expect(2) = 8e-04, Method: Compositional matrix adjust.
 Identities = 18/34 (53%), Positives = 23/34 (68%), Gaps = 0/34 (0%)
 Frame = +1

Query  352  HRNVVQGLITEEEPSIDTDKLSYEIFSTGE*VFV  453
            +R+  +     E+PSIDTDKLSYEIFS  E  F+
Sbjct  18   NRSGEEAATVAEDPSIDTDKLSYEIFSILESKFL  51


 Score = 33.5 bits (75),  Expect(2) = 8e-04, Method: Compositional matrix adjust.
 Identities = 13/16 (81%), Positives = 15/16 (94%), Gaps = 0/16 (0%)
 Frame = +2

Query  431  LLESKFLFGYDDQKLW  478
            +LESKFLFGYDD +LW
Sbjct  45   ILESKFLFGYDDPELW  60



>ref|XP_010670011.1| PREDICTED: patatin-like protein 6 [Beta vulgaris subsp. vulgaris]
 ref|XP_010670012.1| PREDICTED: patatin-like protein 6 [Beta vulgaris subsp. vulgaris]
 ref|XP_010670013.1| PREDICTED: patatin-like protein 6 [Beta vulgaris subsp. vulgaris]
Length=470

 Score = 34.7 bits (78),  Expect(2) = 9e-04, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = +1

Query  385  EEPSIDTDKLSYEIFSTGE*VFV  453
            +EPS+DTDKLSYEIFS  E  F+
Sbjct  6    QEPSVDTDKLSYEIFSILESKFL  28


 Score = 34.3 bits (77),  Expect(2) = 9e-04, Method: Compositional matrix adjust.
 Identities = 18/27 (67%), Positives = 20/27 (74%), Gaps = 4/27 (15%)
 Frame = +2

Query  431  LLESKFLFGY-DDQK---LWIPKTIAP  499
            +LESKFLFGY DDQ     WIPK I+P
Sbjct  22   ILESKFLFGYGDDQNNRVSWIPKQISP  48



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 567283606695