BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002C02

Length=528
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AAL49748.1|AF452010_1  channel-like protein                          294   8e-97   Petunia x hybrida [garden petunia]
ref|NP_001234139.1|  probable aquaporin PIP-type pTOM75                 293   2e-96   Solanum lycopersicum
dbj|BAA20075.1|  water channel protein                                  293   2e-96   Nicotiana excelsior
ref|XP_009793682.1|  PREDICTED: probable aquaporin PIP-type pTOM75      293   3e-96   Nicotiana sylvestris
ref|XP_009630280.1|  PREDICTED: probable aquaporin PIP-type pTOM75      293   3e-96   Nicotiana tomentosiformis
dbj|BAA20076.1|  water channel protein                                  292   3e-96   Nicotiana excelsior
ref|XP_009600058.1|  PREDICTED: probable aquaporin PIP-type pTOM75      291   9e-96   Nicotiana tomentosiformis
emb|CAA04750.1|  aquaporin 1                                            291   9e-96   Nicotiana tabacum [American tobacco]
ref|XP_009780083.1|  PREDICTED: probable aquaporin PIP-type pTOM75      291   9e-96   Nicotiana sylvestris
gb|ABJ97677.1|  major intrinsic protein                                 289   8e-95   Solanum tuberosum [potatoes]
ref|XP_006360691.1|  PREDICTED: probable aquaporin PIP-type pTOM7...    289   1e-94   
gb|ABC01892.1|  major intrinsic protein 1-like protein                  288   1e-94   Solanum tuberosum [potatoes]
gb|AFU61115.1|  water channel protein PIP                               288   1e-94   Capsicum annuum
ref|NP_001275388.1|  major intrinsic protein 1-like protein             288   2e-94   Solanum tuberosum [potatoes]
gb|ABB16979.1|  major intrinsic protein 1-like protein                  288   2e-94   Solanum tuberosum [potatoes]
ref|XP_006343971.1|  PREDICTED: probable aquaporin PIP-type pTOM7...    288   2e-94   Solanum tuberosum [potatoes]
ref|NP_001274291.1|  probable aquaporin PIP-type pTOM75-like            288   2e-94   Solanum lycopersicum
ref|NP_001289835.1|  probable aquaporin PIP-type pTOM75                 286   6e-94   
gb|ABB87103.1|  water channel protein-like                              285   1e-93   Solanum tuberosum [potatoes]
emb|CAA04653.1|  major intrinsic protein PIPB                           282   3e-92   Craterostigma plantagineum
ref|XP_006352272.1|  PREDICTED: probable aquaporin PIP-type pTOM7...    281   1e-91   Solanum tuberosum [potatoes]
ref|XP_009779003.1|  PREDICTED: probable aquaporin PIP-type pTOM75      280   1e-91   Nicotiana sylvestris
gb|AAL33585.1|AF440271_1  aquaporin                                     280   2e-91   Nicotiana tabacum [American tobacco]
ref|XP_009609568.1|  PREDICTED: probable aquaporin PIP-type pTOM75      280   2e-91   Nicotiana tomentosiformis
ref|XP_011072833.1|  PREDICTED: probable aquaporin PIP-type pTOM75      280   2e-91   Sesamum indicum [beniseed]
gb|AFC92657.1|  aquaporin PIP1;3                                        278   2e-90   Eustoma exaltatum subsp. russellianum [bluebells]
gb|ABG57184.1|  aquaporin                                               278   2e-90   Tamarix sp. ZDY-001908
gb|ACR56610.1|  plasma intrinsic protein 1;1                            278   2e-90   Juglans regia
ref|XP_011084932.1|  PREDICTED: probable aquaporin PIP1-2               277   2e-90   Sesamum indicum [beniseed]
ref|XP_011080941.1|  PREDICTED: probable aquaporin PIP-type pTOM75      277   2e-90   Sesamum indicum [beniseed]
ref|XP_009386206.1|  PREDICTED: probable aquaporin PIP1-2 isoform X1    276   8e-90   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAF71819.1|AF141899_1  putative aquaporin PIP1-3                     276   1e-89   Vitis cinerea var. helleri x Vitis rupestris
ref|XP_008437293.1|  PREDICTED: aquaporin PIP1-2                        275   1e-89   Cucumis melo [Oriental melon]
ref|XP_010544738.1|  PREDICTED: aquaporin PIP1-1-like                   275   2e-89   Tarenaya hassleriana [spider flower]
gb|EYU23442.1|  hypothetical protein MIMGU_mgv1a011177mg                275   2e-89   Erythranthe guttata [common monkey flower]
gb|AGG39697.1|  aquaporin protein AQU19                                 275   2e-89   Camellia sinensis [black tea]
gb|AHI54572.1|  aquaporin protein AQU19                                 275   2e-89   Camellia japonica [common camellia]
ref|XP_010523742.1|  PREDICTED: aquaporin PIP1-1                        275   2e-89   Tarenaya hassleriana [spider flower]
gb|EYU41267.1|  hypothetical protein MIMGU_mgv1a011292mg                273   3e-89   Erythranthe guttata [common monkey flower]
ref|XP_002889360.1|  hypothetical protein ARALYDRAFT_470115             275   3e-89   
ref|XP_010480063.1|  PREDICTED: aquaporin PIP1-3                        274   3e-89   Camelina sativa [gold-of-pleasure]
emb|CDY15165.1|  BnaC05g00440D                                          275   4e-89   Brassica napus [oilseed rape]
ref|XP_009386207.1|  PREDICTED: probable aquaporin PIP1-2 isoform X2    276   5e-89   
gb|KJB20657.1|  hypothetical protein B456_003G158100                    271   5e-89   Gossypium raimondii
ref|XP_010556545.1|  PREDICTED: aquaporin PIP1-3-like                   273   7e-89   Tarenaya hassleriana [spider flower]
ref|NP_974489.1|  plasma membrane intrinsic protein 1;4                 271   7e-89   Arabidopsis thaliana [mouse-ear cress]
gb|AAY22204.1|  putative aquaporin                                      273   8e-89   Phaseolus vulgaris [French bean]
ref|XP_004143901.1|  PREDICTED: probable aquaporin PIP1-2-like          273   8e-89   
ref|XP_007160075.1|  hypothetical protein PHAVU_002G290400g             273   8e-89   Phaseolus vulgaris [French bean]
gb|KFK30621.1|  hypothetical protein AALP_AA6G005800                    273   8e-89   Arabis alpina [alpine rockcress]
emb|CDY07221.1|  BnaCnng02360D                                          273   1e-88   
ref|XP_009134562.1|  PREDICTED: probable aquaporin PIP1-4               273   1e-88   Brassica rapa
gb|KDO76246.1|  hypothetical protein CISIN_1g023107mg                   271   1e-88   Citrus sinensis [apfelsine]
emb|CDY51161.1|  BnaA09g51960D                                          273   1e-88   Brassica napus [oilseed rape]
gb|EYU41266.1|  hypothetical protein MIMGU_mgv1a011292mg                273   1e-88   Erythranthe guttata [common monkey flower]
gb|AGT36590.1|  aquaporin                                               273   1e-88   Musa acuminata AAA Group [Cavendish banana]
gb|ABB13429.1|  plasma membrane intrinsic protein                       273   1e-88   Olea europaea
emb|CAB46350.1|  major intrinsic protein 1                              273   1e-88   Solanum tuberosum [potatoes]
gb|ABO71659.2|  trans-membrane water channel protein                    273   2e-88   Brassica juncea [brown mustard]
ref|NP_001078066.1|  aquaporin PIP1-2                                   272   2e-88   Arabidopsis thaliana [mouse-ear cress]
emb|CDX91911.1|  BnaC03g32130D                                          273   2e-88   
gb|KJB25853.1|  hypothetical protein B456_004G212800                    270   3e-88   Gossypium raimondii
emb|CDY48920.1|  BnaA09g39170D                                          272   3e-88   Brassica napus [oilseed rape]
ref|NP_001242504.1|  uncharacterized protein LOC100793242               272   3e-88   
gb|KDP25424.1|  hypothetical protein JCGZ_20580                         272   3e-88   Jatropha curcas
gb|KHM99966.1|  Putative aquaporin PIP1-2                               272   3e-88   Glycine soja [wild soybean]
ref|XP_006396241.1|  hypothetical protein EUTSA_v10028860mg             272   3e-88   Eutrema salsugineum [saltwater cress]
ref|XP_002509815.1|  Aquaporin PIP1.3, putative                         272   3e-88   Ricinus communis
gb|AHI54567.1|  aquaporin protein 7                                     272   4e-88   Camellia japonica [common camellia]
gb|KCW77504.1|  hypothetical protein EUGRSUZ_D01836                     271   4e-88   Eucalyptus grandis [rose gum]
gb|KDO76245.1|  hypothetical protein CISIN_1g023107mg                   271   4e-88   Citrus sinensis [apfelsine]
gb|AFQ98315.1|  MIP2                                                    271   4e-88   Eutrema halophilum
gb|AEA40492.1|  aquaporin PIP1-4                                        271   4e-88   Brassica oleracea var. italica [asparagus broccoli]
dbj|BAA32777.1|  plasma membrane aquaporin (PAQ1)                       271   4e-88   Raphanus sativus
gb|KCW77503.1|  hypothetical protein EUGRSUZ_D01836                     269   4e-88   Eucalyptus grandis [rose gum]
ref|XP_010533655.1|  PREDICTED: aquaporin PIP1-3-like                   271   4e-88   Tarenaya hassleriana [spider flower]
emb|CDX71738.1|  BnaC08g31360D                                          271   4e-88   
ref|XP_010508083.1|  PREDICTED: aquaporin PIP1-2-like isoform X1        271   4e-88   Camelina sativa [gold-of-pleasure]
gb|AAG23179.1|AF299050_1  aquaporin PIP1b1                              271   5e-88   Brassica oleracea
ref|XP_002872953.1|  hypothetical protein ARALYDRAFT_912203             271   5e-88   Arabidopsis lyrata subsp. lyrata
dbj|BAA92258.1|  plasma membrane aquaporin 1b                           271   5e-88   Raphanus sativus
gb|AAB61378.1|  aquaporin                                               271   5e-88   Brassica rapa subsp. oleifera [biennial turnip rape]
ref|NP_182120.1|  aquaporin PIP1-2                                      271   5e-88   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567178.1|  plasma membrane intrinsic protein 1;4                 271   5e-88   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009118823.1|  PREDICTED: aquaporin PIP1-3                        271   5e-88   Brassica rapa
ref|XP_010506589.1|  PREDICTED: aquaporin PIP1-2                        271   5e-88   Camelina sativa [gold-of-pleasure]
gb|AGG39696.1|  aquaporin protein AQU18                                 271   6e-88   Camellia sinensis [black tea]
gb|KJB25855.1|  hypothetical protein B456_004G212800                    269   6e-88   Gossypium raimondii
gb|AAT74898.1|  plasma membrane intrinsic protein PIP1-1                271   6e-88   Fraxinus excelsior
ref|XP_009138772.1|  PREDICTED: aquaporin PIP1-1                        271   7e-88   Brassica rapa
emb|CAA64895.1|  transmembrane channel protein                          271   8e-88   Brassica oleracea
gb|ACB38232.1|  aquaporin                                               271   8e-88   Gerbera hybrid cultivar
gb|AAF02782.1|AF195115_2  Similar to transmembrane protein; coded...    271   8e-88   Arabidopsis thaliana [mouse-ear cress]
gb|ADE34281.1|  aquaporin PIP1;12                                       270   9e-88   Gossypium hirsutum [American cotton]
gb|EYU19988.1|  hypothetical protein MIMGU_mgv1a011277mg                271   9e-88   Erythranthe guttata [common monkey flower]
gb|AGD98710.1|  aquaporin protein 7                                     271   9e-88   Camellia sinensis [black tea]
ref|XP_006294736.1|  hypothetical protein CARUB_v10023782mg             271   1e-87   Capsella rubella
gb|KHG25052.1|  putative aquaporin PIP1-2                               271   1e-87   Gossypium arboreum [tree cotton]
gb|ABD63904.1|  aquaporin 1                                             271   1e-87   Gossypium hirsutum [American cotton]
emb|CDX95670.1|  BnaC03g25510D                                          271   1e-87   
ref|XP_002880210.1|  hypothetical protein ARALYDRAFT_483737             271   1e-87   
gb|ACA50530.1|  putative aquaporin                                      270   1e-87   Brassica napus [oilseed rape]
gb|KEH21073.1|  major intrinsic protein (MIP) family transporter        269   1e-87   Medicago truncatula
ref|XP_006418439.1|  hypothetical protein EUTSA_v10008397mg             270   1e-87   Eutrema salsugineum [saltwater cress]
gb|ADE34282.1|  aquaporin PIP1;13                                       270   1e-87   Gossypium hirsutum [American cotton]
ref|XP_006439529.1|  hypothetical protein CICLE_v10021502mg             270   1e-87   Citrus clementina [clementine]
ref|XP_010518253.1|  PREDICTED: aquaporin PIP1-2 isoform X2             271   1e-87   
gb|AEA40490.1|  aquaporin PIP1-2                                        270   1e-87   Brassica oleracea var. italica [asparagus broccoli]
tpg|DAA33858.1|  TPA: aquaporin PIP1;4                                  270   1e-87   Gossypium hirsutum [American cotton]
emb|CDX90046.1|  BnaA10g00360D                                          270   1e-87   
gb|AAG23180.1|AF299051_1  aquaporin PIP1b2                              270   1e-87   Brassica oleracea
emb|CAA64896.1|  transmembrane channel protein                          270   1e-87   Brassica oleracea
gb|KFK37381.1|  hypothetical protein AALP_AA4G249600                    270   1e-87   Arabis alpina [alpine rockcress]
ref|XP_010508084.1|  PREDICTED: aquaporin PIP1-2-like isoform X2        270   1e-87   
gb|AEA40491.1|  aquaporin PIP1-3                                        270   2e-87   Brassica oleracea var. italica [asparagus broccoli]
gb|AEA40489.1|  aquaporin PIP1-1                                        270   2e-87   Brassica oleracea var. italica [asparagus broccoli]
ref|XP_009420459.1|  PREDICTED: probable aquaporin PIP1-2               270   2e-87   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010053244.1|  PREDICTED: aquaporin PIP1-3                        270   2e-87   Eucalyptus grandis [rose gum]
ref|XP_006476548.1|  PREDICTED: probable aquaporin PIP1-2-like is...    270   2e-87   Citrus sinensis [apfelsine]
ref|XP_009116806.1|  PREDICTED: aquaporin PIP1-1 isoform X1             270   2e-87   Brassica rapa
ref|NP_001267921.1|  aquaporin-like                                     270   2e-87   Vitis vinifera
gb|ABH09324.1|  putative aquaporin                                      270   2e-87   Vitis vinifera
ref|XP_010439184.1|  PREDICTED: probable aquaporin PIP1-5               270   2e-87   Camelina sativa [gold-of-pleasure]
ref|XP_009631880.1|  PREDICTED: probable aquaporin PIP1-2               270   2e-87   Nicotiana tomentosiformis
ref|NP_001078067.1|  aquaporin PIP1-2                                   270   3e-87   Arabidopsis thaliana [mouse-ear cress]
gb|ABH09325.1|  putative aquaporin                                      270   3e-87   Vitis vinifera
ref|XP_009142386.1|  PREDICTED: LOW QUALITY PROTEIN: aquaporin PI...    270   3e-87   Brassica rapa
gb|AHB33476.1|  plasma intrinsic protein 1-3                            270   3e-87   Cucumis sativus [cucumbers]
ref|XP_007040270.1|  Plasma membrane intrinsic protein 1,4 isoform 3    270   3e-87   
gb|AHX99531.1|  aquaporin PIP1                                          269   3e-87   Chrysanthemum x morifolium [florist's chrysanthemum]
gb|AAV41024.1|  plasma membrane intrinsic protein                       270   3e-87   Glycyrrhiza uralensis [Chinese licorice]
ref|XP_007040268.1|  Plasma membrane intrinsic protein 1,4 isoform 1    269   3e-87   
gb|ACV66985.1|  plasma membrane aquaporin 1                             269   4e-87   Hevea brasiliensis [jebe]
ref|XP_010095072.1|  Aquaporin PIP1-1                                   269   4e-87   Morus notabilis
ref|XP_009119712.1|  PREDICTED: aquaporin PIP1-3                        269   4e-87   Brassica rapa
ref|XP_009380931.1|  PREDICTED: aquaporin PIP1-1                        269   5e-87   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006288376.1|  hypothetical protein CARUB_v10001627mg             269   5e-87   Capsella rubella
gb|ABR68794.1|  aquaporin PIP1-2                                        269   5e-87   Gossypium hirsutum [American cotton]
ref|XP_009116807.1|  PREDICTED: aquaporin PIP1-1 isoform X2             269   5e-87   Brassica rapa
gb|EYU38340.1|  hypothetical protein MIMGU_mgv1a018376mg                268   5e-87   Erythranthe guttata [common monkey flower]
gb|KJB25854.1|  hypothetical protein B456_004G212800                    268   6e-87   Gossypium raimondii
ref|XP_010089092.1|  putative aquaporin PIP1-4                          268   6e-87   Morus notabilis
ref|XP_009400253.1|  PREDICTED: probable aquaporin PIP1-2               268   7e-87   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010241866.1|  PREDICTED: aquaporin PIP1-2                        268   7e-87   Nelumbo nucifera [Indian lotus]
ref|XP_010255327.1|  PREDICTED: aquaporin PIP1-2-like                   268   8e-87   Nelumbo nucifera [Indian lotus]
ref|XP_007051783.1|  Plasma membrane intrinsic protein 1B               268   1e-86   Theobroma cacao [chocolate]
ref|XP_002526866.1|  Aquaporin PIP1.3, putative                         268   1e-86   Ricinus communis
gb|KHG19073.1|  Aquaporin PIP1-3 -like protein                          268   1e-86   Gossypium arboreum [tree cotton]
gb|KEH21072.1|  major intrinsic protein (MIP) family transporter        268   1e-86   Medicago truncatula
ref|XP_009382780.1|  PREDICTED: probable aquaporin PIP1-2               268   1e-86   Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS61960.1|  hypothetical protein M569_12834                         268   1e-86   Genlisea aurea
ref|XP_006284249.1|  hypothetical protein CARUB_v10005414mg             268   1e-86   Capsella rubella
ref|XP_006848145.1|  hypothetical protein AMTR_s00029p00227660          268   1e-86   Amborella trichopoda
gb|AFH36341.1|  aquaporin PIP1;3                                        268   1e-86   Quercus petraea [durmast oak]
dbj|BAA20074.1|  water channel protein                                  268   2e-86   Nicotiana excelsior
emb|CAN74419.1|  hypothetical protein VITISV_016461                     268   2e-86   Vitis vinifera
ref|XP_010448716.1|  PREDICTED: probable aquaporin PIP1-5               268   2e-86   Camelina sativa [gold-of-pleasure]
ref|XP_002526867.1|  Aquaporin PIP1.3, putative                         268   2e-86   
tpg|DAA33859.1|  TPA: aquaporin PIP1;5                                  267   2e-86   Gossypium hirsutum [American cotton]
gb|AFH36340.1|  aquaporin PIP1;2                                        267   2e-86   Quercus petraea [durmast oak]
ref|XP_009762763.1|  PREDICTED: probable aquaporin PIP1-2               267   2e-86   Nicotiana sylvestris
emb|CAA04652.1|  major intrinsic protein PIPa2                          267   2e-86   Craterostigma plantagineum
ref|XP_010262799.1|  PREDICTED: probable aquaporin PIP1-2               267   2e-86   Nelumbo nucifera [Indian lotus]
ref|XP_006476549.1|  PREDICTED: probable aquaporin PIP1-2-like is...    268   2e-86   
ref|NP_001289902.1|  probable aquaporin PIP1-4                          267   3e-86   Camelina sativa [gold-of-pleasure]
ref|NP_001267949.1|  aquaporin PIP1;2                                   267   3e-86   Vitis vinifera
ref|XP_006413559.1|  hypothetical protein EUTSA_v10025910mg             267   3e-86   Eutrema salsugineum [saltwater cress]
gb|ABN14348.1|  aquaporin PIP1;2                                        266   3e-86   Vitis vinifera
emb|CAC85292.1|  putative plasma membrane intrinsic protein             267   4e-86   Posidonia oceanica
gb|AEO79975.1|  plasma intrinsic protein 1                              266   4e-86   Gladiolus communis
ref|XP_011035995.1|  PREDICTED: probable aquaporin PIP1-2               266   4e-86   Populus euphratica
ref|XP_010433914.1|  PREDICTED: probable aquaporin PIP1-5               266   4e-86   Camelina sativa [gold-of-pleasure]
ref|XP_008787474.1|  PREDICTED: probable aquaporin PIP1-2               266   4e-86   Phoenix dactylifera
dbj|BAI94500.1|  plasma membrane intrinsic protein                      266   4e-86   Dianthus caryophyllus [carnation]
gb|KCW72173.1|  hypothetical protein EUGRSUZ_E00628                     265   5e-86   Eucalyptus grandis [rose gum]
dbj|BAA22097.1|  transmembrane protein                                  266   5e-86   Arabidopsis thaliana [mouse-ear cress]
gb|AAF80557.1|AF188844_1  plasma membrane aquaporin                     266   6e-86   Vitis vinifera
ref|XP_004953388.1|  PREDICTED: aquaporin PIP1-2-like                   266   8e-86   Setaria italica
gb|AAF71818.1|AF141898_1  putative aquaporin PIP1-2                     266   8e-86   Vitis cinerea var. helleri x Vitis rupestris
ref|XP_010456290.1|  PREDICTED: probable aquaporin PIP1-4               266   8e-86   Camelina sativa [gold-of-pleasure]
ref|XP_011076723.1|  PREDICTED: probable aquaporin PIP1-5               266   8e-86   Sesamum indicum [beniseed]
ref|XP_011076721.1|  PREDICTED: probable aquaporin PIP1-5               266   8e-86   Sesamum indicum [beniseed]
ref|XP_002312147.1|  plasma membrane intrinsic protein 1-1              266   8e-86   Populus trichocarpa [western balsam poplar]
ref|XP_002454508.1|  hypothetical protein SORBIDRAFT_04g032430          266   9e-86   Sorghum bicolor [broomcorn]
ref|XP_011076722.1|  PREDICTED: probable aquaporin PIP1-5               266   9e-86   Sesamum indicum [beniseed]
gb|ACC85598.1|  aquaporin                                               265   1e-85   Knorringia sibirica
emb|CAH60719.1|  putative plasma membrane intrinsic protein             265   1e-85   Populus tremula x Populus tremuloides
gb|AAF71817.1|  putative aquaporin PIP1-1                               265   1e-85   Vitis cinerea var. helleri x Vitis rupestris
gb|ACU24274.1|  unknown                                                 265   1e-85   Glycine max [soybeans]
ref|XP_003532817.1|  PREDICTED: probable aquaporin PIP1-2               265   1e-85   
ref|XP_003616586.1|  Aquaporin PIP11                                    265   1e-85   Medicago truncatula
gb|AIP86906.1|  aquaporin                                               265   1e-85   Vitis heyneana
ref|NP_001267918.1|  aquaporin-like                                     265   1e-85   Vitis vinifera
ref|XP_010055664.1|  PREDICTED: aquaporin PIP1-2-like                   265   1e-85   Eucalyptus grandis [rose gum]
gb|AAA93521.1|  aquaporin                                               265   1e-85   Mesembryanthemum crystallinum
sp|Q7XSQ9.3|PIP12_ORYSJ  RecName: Full=Probable aquaporin PIP1-2;...    265   1e-85   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006362987.1|  PREDICTED: probable aquaporin PIP1-2-like          265   1e-85   Solanum tuberosum [potatoes]
gb|ACF84511.1|  unknown                                                 265   1e-85   Zea mays [maize]
gb|AFJ44204.1|  plasma membrane intrinsic protein 1                     265   1e-85   Hedychium coronarium
gb|ACL14797.1|  plasma membrane intrinsic protein 1                     265   1e-85   Populus alba x Populus glandulosa
gb|ABH09322.1|  putative aquaporin                                      265   1e-85   Vitis vinifera
ref|XP_010670234.1|  PREDICTED: probable aquaporin PIP1-5               265   2e-85   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004976483.1|  PREDICTED: aquaporin PIP1-1-like                   265   2e-85   Setaria italica
gb|KJB41349.1|  hypothetical protein B456_007G100000                    265   2e-85   Gossypium raimondii
gb|KHG18900.1|  putative aquaporin PIP1-4 -like protein                 265   2e-85   Gossypium arboreum [tree cotton]
gb|EYU32132.1|  hypothetical protein MIMGU_mgv1a011344mg                262   2e-85   Erythranthe guttata [common monkey flower]
ref|XP_010543744.1|  PREDICTED: probable aquaporin PIP1-4               265   2e-85   Tarenaya hassleriana [spider flower]
gb|AAZ91447.1|  PIP1 aquaporin                                          265   2e-85   Xerophyta humilis
gb|AAM61041.1|  aquaporin (plasma membrane intrinsic protein 1B)        265   2e-85   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010661719.1|  PREDICTED: aquaporin PIP1;2 isoform X1             266   2e-85   
emb|CAH59432.1|  aquaporin 2                                            265   2e-85   Plantago major [cart-track plant]
gb|AAF80556.1|AF188843_1  plasma membrane aquaporin                     265   2e-85   Vitis vinifera
gb|AEH76327.1|  plasma membrane intrinsic protein 1                     265   2e-85   Jatropha curcas
ref|XP_006429323.1|  hypothetical protein CICLE_v10012384mg             265   2e-85   Citrus clementina [clementine]
ref|NP_001104934.1|  aquaporin PIP1-2                                   265   3e-85   Zea mays [maize]
gb|AFD61600.1|  aquaporin PIP1                                          265   3e-85   Hevea brasiliensis [jebe]
gb|KDP44816.1|  hypothetical protein JCGZ_01316                         264   3e-85   Jatropha curcas
gb|ACC59097.1|  aquaporin                                               264   3e-85   Saccharum officinarum [noble cane]
ref|XP_010067506.1|  PREDICTED: probable aquaporin PIP1-2               264   3e-85   Eucalyptus grandis [rose gum]
ref|XP_009143195.1|  PREDICTED: aquaporin PIP1-2 isoform X1             264   4e-85   Brassica rapa
ref|XP_003570076.1|  PREDICTED: aquaporin PIP1-1-like                   264   4e-85   
ref|NP_001047672.1|  Os02g0666200                                       264   5e-85   
gb|AFK41734.1|  unknown                                                 264   5e-85   Medicago truncatula
gb|ACL52629.1|  unknown                                                 264   5e-85   Zea mays [maize]
gb|AAC17528.1|  aquaporin 1                                             264   5e-85   Samanea saman [cow-tamarind]
ref|XP_003600864.1|  Aquaporin protein PIP11                            261   6e-85   
ref|XP_006827580.1|  hypothetical protein AMTR_s00009p00231200          263   6e-85   Amborella trichopoda
gb|ACR56612.1|  plasma intrinsic protein 1;3                            263   6e-85   Juglans regia
ref|XP_006647653.1|  PREDICTED: aquaporin PIP1-1-like isoform X1        264   6e-85   
ref|XP_007209434.1|  hypothetical protein PRUPE_ppa009588mg             263   6e-85   Prunus persica
ref|XP_006647654.1|  PREDICTED: aquaporin PIP1-1-like isoform X2        263   6e-85   Oryza brachyantha
gb|AFM37319.1|  aquaporin                                               263   6e-85   Oryza sativa Japonica Group [Japonica rice]
gb|AAO86706.1|  plasma membrane intrinsic protein                       263   6e-85   Zea mays [maize]
ref|XP_004173962.1|  PREDICTED: LOW QUALITY PROTEIN: probable aqu...    260   7e-85   
ref|XP_006652632.1|  PREDICTED: probable aquaporin PIP1-2-like          264   7e-85   Oryza brachyantha
gb|KDO69068.1|  hypothetical protein CISIN_1g018895mg                   261   7e-85   Citrus sinensis [apfelsine]
gb|ABH09323.1|  putative aquaporin                                      263   8e-85   Vitis vinifera
gb|KFK28910.1|  hypothetical protein AALP_AA7G063900                    263   8e-85   Arabis alpina [alpine rockcress]
gb|AAR23268.1|  PIP1;2                                                  263   8e-85   Spinacia oleracea
ref|XP_011042268.1|  PREDICTED: probable aquaporin PIP1-2               263   9e-85   Populus euphratica
ref|XP_010940492.1|  PREDICTED: probable aquaporin PIP1-2               263   9e-85   Elaeis guineensis
dbj|BAG68660.1|  plasma membrane intrinsic protein                      263   1e-84   Tulipa gesneriana
ref|XP_010240237.1|  PREDICTED: probable aquaporin PIP1-2               263   1e-84   Brachypodium distachyon [annual false brome]
ref|XP_002315171.1|  hypothetical protein POPTR_0010s19930g             263   1e-84   Populus trichocarpa [western balsam poplar]
ref|XP_009143196.1|  PREDICTED: aquaporin PIP1-2 isoform X2             263   1e-84   Brassica rapa
gb|AFV92901.1|  putative PIP-type aquaporin                             263   1e-84   Lolium perenne [perennial ryegrass]
ref|XP_007009059.1|  Plasma membrane intrinsic protein 1,4              263   1e-84   Theobroma cacao [chocolate]
ref|XP_002446929.1|  hypothetical protein SORBIDRAFT_06g025150          263   1e-84   Sorghum bicolor [broomcorn]
emb|CAA70156.1|  transmembrane protein                                  263   2e-84   Oryza sativa [red rice]
gb|AFM37320.1|  aquaporin                                               263   2e-84   Oryza sativa Japonica Group [Japonica rice]
dbj|BAF44223.1|  aquaporin                                              264   2e-84   Iris x hollandica [Dutch iris]
gb|AFH36339.1|  aquaporin PIP1;1                                        263   2e-84   Quercus petraea [durmast oak]
gb|AFM37318.1|  aquaporin                                               263   2e-84   Oryza sativa Japonica Group [Japonica rice]
gb|AFD32162.1|  plasma membrane intrinsic protein                       262   2e-84   Chrysopogon zizanioides [cuscus grass]
gb|AAV80228.1|  aquaporin 1                                             262   2e-84   Aegiceras corniculatum
ref|XP_008463222.1|  PREDICTED: probable aquaporin PIP1-4               262   2e-84   Cucumis melo [Oriental melon]
dbj|BAG68659.1|  plasma membrane intrinsic protein                      262   2e-84   Tulipa gesneriana
emb|CAH60718.1|  putative plasma membrane intrinsic protein             262   2e-84   Populus tremula x Populus tremuloides
gb|KJB74255.1|  hypothetical protein B456_011G283200                    259   2e-84   Gossypium raimondii
dbj|BAD90696.1|  plasma membrane intrinsic protein 1;1                  262   2e-84   Mimosa pudica [sensitive-plant]
ref|XP_011022675.1|  PREDICTED: aquaporin PIP1-2                        262   2e-84   Populus euphratica
ref|XP_009340095.1|  PREDICTED: aquaporin PIP1-3 isoform X1             262   2e-84   Pyrus x bretschneideri [bai li]
ref|XP_002303596.1|  plasma membrane aquaporin family protein           262   2e-84   Populus trichocarpa [western balsam poplar]
gb|ADD59911.1|  aquaporin                                               263   2e-84   Chimonanthus praecox [wintersweet]
ref|XP_004503235.1|  PREDICTED: probable aquaporin PIP-type 7a-like     262   3e-84   Cicer arietinum [garbanzo]
gb|EYU32131.1|  hypothetical protein MIMGU_mgv1a011344mg                262   3e-84   Erythranthe guttata [common monkey flower]
gb|ACU00100.1|  plasma membrane intrinsic protein PIP1.3                262   3e-84   Populus trichocarpa x Populus deltoides
gb|ABJ98540.1|  PIP1 protein                                            261   3e-84   Stipa breviflora
ref|XP_008238916.1|  PREDICTED: aquaporin PIP1-2 isoform X1             261   3e-84   Prunus mume [ume]
emb|CAB56217.1|  PM28B protein                                          261   4e-84   Spinacia oleracea
gb|KEH34782.1|  major intrinsic protein (MIP) family transporter        261   4e-84   Medicago truncatula
gb|AIL92621.1|  plasma membrane intrinsic protein 1                     261   4e-84   Malus domestica [apple tree]
gb|AAB86380.1|  aquaporin-like transmembrane channel protein            261   4e-84   Medicago sativa [alfalfa]
gb|KJB20656.1|  hypothetical protein B456_003G158100                    260   5e-84   Gossypium raimondii
ref|XP_003600863.1|  Aquaporin protein PIP11                            261   5e-84   Medicago truncatula
ref|XP_008360708.1|  PREDICTED: aquaporin PIP1-3 isoform X1             261   5e-84   
ref|XP_009340096.1|  PREDICTED: aquaporin PIP1-2 isoform X2             261   5e-84   
gb|ACJ84222.1|  unknown                                                 261   6e-84   Medicago truncatula
ref|NP_001289851.1|  probable aquaporin PIP1-2                          261   6e-84   
emb|CDX10336.1|  aquaporin                                              261   6e-84   
emb|CDX10335.1|  aquaporin                                              261   6e-84   
gb|ABW34453.1|  aquaporin 1.1                                           261   7e-84   
ref|XP_004954451.1|  PREDICTED: aquaporin PIP1-5-like                   261   7e-84   
gb|ACV60508.1|  aquaporin                                               261   8e-84   
gb|AFK45475.1|  unknown                                                 261   8e-84   
gb|AFK38136.1|  unknown                                                 261   8e-84   
ref|XP_010935853.1|  PREDICTED: probable aquaporin PIP1-2               261   8e-84   
gb|AGQ21873.1|  putative PIP-type aquaporin                             260   1e-83   
gb|AGQ21874.1|  putative PIP-type aquaporin                             260   1e-83   
emb|CDY38017.1|  BnaCnng08780D                                          260   1e-83   
gb|KCW65649.1|  hypothetical protein EUGRSUZ_G03037                     260   1e-83   
gb|KDO69067.1|  hypothetical protein CISIN_1g018895mg                   259   1e-83   
ref|XP_009386050.1|  PREDICTED: probable aquaporin PIP1-2               260   1e-83   
ref|NP_001274378.1|  probable aquaporin PIP1-4-like                     260   1e-83   
gb|KHN35027.1|  Putative aquaporin PIP1-2                               260   1e-83   
gb|KHG01288.1|  putative aquaporin PIP-type 7a                          260   1e-83   
tpg|DAA33861.1|  TPA: aquaporin PIP1;7                                  260   2e-83   
gb|AAL49749.1|AF452011_1  aquaporin-like protein                        260   2e-83   
ref|XP_009759265.1|  PREDICTED: probable aquaporin PIP1-2               259   2e-83   
ref|XP_004503705.1|  PREDICTED: probable aquaporin PIP1-2-like          259   2e-83   
ref|XP_008232887.1|  PREDICTED: aquaporin PIP1-2-like                   259   2e-83   
gb|KEH27431.1|  major intrinsic protein (MIP) family transporter        257   2e-83   
gb|AEN95117.1|  aquaporin PIP1                                          260   2e-83   
ref|NP_001105131.1|  aquaporin PIP1-5                                   259   2e-83   
gb|KJB74256.1|  hypothetical protein B456_011G283300                    259   3e-83   
ref|XP_006435690.1|  hypothetical protein CICLE_v10032308mg             259   3e-83   
ref|NP_001241050.1|  uncharacterized protein LOC100791447               259   3e-83   
ref|XP_002531349.1|  Aquaporin PIP1.1, putative                         259   3e-83   
ref|XP_008360709.1|  PREDICTED: aquaporin PIP1-3 isoform X2             260   4e-83   
gb|ACU87553.1|  PIP protein                                             259   4e-83   
gb|ABK22355.1|  unknown                                                 259   4e-83   
gb|ADN94473.1|  aquaporin                                               259   4e-83   
dbj|BAA23746.2|  HvPIP1;5                                               259   4e-83   
gb|ADT91650.1|  putative major intrinsic protein                        259   4e-83   
ref|XP_009367824.1|  PREDICTED: aquaporin PIP1-1-like isoform X1        259   4e-83   
gb|AHG32322.1|  PIP1-2                                                  259   4e-83   
ref|XP_004490962.1|  PREDICTED: probable aquaporin PIP-type 7a-li...    259   5e-83   
ref|XP_003517470.1|  PREDICTED: aquaporin PIP1-3-like                   258   5e-83   
gb|KJB74254.1|  hypothetical protein B456_011G283200                    258   5e-83   
ref|XP_009763188.1|  PREDICTED: aquaporin PIP1-2                        258   5e-83   
ref|XP_011092531.1|  PREDICTED: probable aquaporin PIP1-5 isoform X1    258   6e-83   
gb|KDO69063.1|  hypothetical protein CISIN_1g018895mg                   259   6e-83   
gb|AAB67870.1|  plasma membrane major intrinsic protein 3               258   6e-83   
ref|NP_001267686.1|  uncharacterized protein LOC101215145               258   7e-83   
gb|AIA83103.1|  putative aquaporin PIP1                                 258   7e-83   
gb|ACB10396.1|  aquaporin                                               258   7e-83   
gb|AHA90706.1|  aquaporin                                               258   7e-83   
gb|ABK96216.1|  unknown                                                 258   8e-83   
ref|XP_009367826.1|  PREDICTED: aquaporin PIP1-2-like isoform X3        258   8e-83   
gb|AIA83105.1|  putative aquaporin PIP1                                 258   9e-83   
ref|XP_004490961.1|  PREDICTED: probable aquaporin PIP-type 7a-li...    259   9e-83   
dbj|BAA24016.1|  water channel protein                                  258   9e-83   
ref|XP_004306776.1|  PREDICTED: aquaporin PIP1-3                        258   9e-83   
ref|XP_007218332.1|  hypothetical protein PRUPE_ppa008510mg             259   9e-83   
sp|P25794.2|PIP2_PEA  RecName: Full=Probable aquaporin PIP-type 7...    258   1e-82   
gb|AEO13899.1|  aquaporin 8                                             258   1e-82   
ref|NP_001290008.1|  probable aquaporin PIP1-4                          258   1e-82   
ref|XP_008238917.1|  PREDICTED: aquaporin PIP1-2 isoform X2             259   1e-82   
ref|XP_006435692.1|  hypothetical protein CICLE_v10032298mg             258   1e-82   
ref|NP_001290534.1|  uncharacterized protein LOC105042909               258   1e-82   
gb|ABE03629.1|  plasma membrane major intrinsic protein                 258   1e-82   
ref|NP_001280950.1|  aquaporin PIP1-1                                   257   1e-82   
ref|XP_004149243.1|  PREDICTED: probable aquaporin PIP1-4-like is...    258   2e-82   
gb|KEH28860.1|  major intrinsic protein (MIP) family transporter        255   2e-82   
ref|XP_008341694.1|  PREDICTED: aquaporin PIP1-2 isoform X2             257   2e-82   
gb|AFB83065.1|  plasma intrinsic protein PIP1.1                         257   2e-82   
gb|AAY17047.1|  p-166-5                                                 254   3e-82   
ref|XP_011047429.1|  PREDICTED: probable aquaporin PIP1-4               257   3e-82   
ref|XP_009367825.1|  PREDICTED: aquaporin PIP1-3-like isoform X2        257   3e-82   
gb|KDO69062.1|  hypothetical protein CISIN_1g018895mg                   259   3e-82   
gb|ACZ51371.1|  plasma membrane intrinsic protein                       256   3e-82   
ref|XP_004298806.1|  PREDICTED: aquaporin PIP1-3                        256   3e-82   
ref|XP_007026768.1|  Plasma membrane intrinsic protein 1,4              256   3e-82   
ref|NP_001241148.1|  uncharacterized protein LOC100812711               256   3e-82   
ref|XP_003611079.1|  Aquaporin                                          256   3e-82   
gb|AFO63680.1|  plasma intrinsic protein 1                              256   3e-82   
dbj|BAF41978.1|  aquaporin                                              256   4e-82   
ref|XP_011092540.1|  PREDICTED: aquaporin PIP1-1-like isoform X2        257   4e-82   
ref|XP_009383904.1|  PREDICTED: probable aquaporin PIP1-2               256   4e-82   
gb|KJB46619.1|  hypothetical protein B456_007G378400                    256   4e-82   
gb|KHG11128.1|  putative aquaporin PIP1-2                               256   4e-82   
emb|CAA38241.1|  unnamed protein product                                256   5e-82   
tpg|DAA33860.1|  TPA: aquaporin PIP1;6                                  256   5e-82   
ref|XP_002511872.1|  Aquaporin PIP1.3, putative                         256   8e-82   
tpg|DAA33863.1|  TPA: aquaporin PIP1;9                                  254   9e-82   
emb|CAG27864.2|  aquaporin PIP1                                         255   9e-82   
ref|XP_009629839.1|  PREDICTED: probable aquaporin PIP1-5 isoform X1    255   1e-81   
ref|XP_009386408.1|  PREDICTED: probable aquaporin PIP1-2               255   1e-81   
gb|AAT76618.1|  aquaporin                                               255   1e-81   
gb|KJB36888.1|  hypothetical protein B456_006G181300                    254   2e-81   
ref|XP_007141791.1|  hypothetical protein PHAVU_008G226000g             255   2e-81   
ref|XP_008778916.1|  PREDICTED: probable aquaporin PIP1-2 isoform X1    254   2e-81   
gb|AGV54605.1|  aquaporin-1                                             254   2e-81   
gb|AGV54711.1|  aquaporin PIP-type 7a-like protein                      254   2e-81   
gb|EMS49467.1|  Aquaporin PIP1-2                                        261   2e-81   
gb|AHA84165.1|  aquaporin                                               254   2e-81   
ref|XP_010109640.1|  hypothetical protein L484_015595                   259   2e-81   
ref|NP_001280914.1|  probable aquaporin PIP1-4                          254   3e-81   
ref|XP_006573347.1|  PREDICTED: aquaporin PIP1-2-like                   253   3e-81   
ref|XP_009629840.1|  PREDICTED: aquaporin PIP1-2-like isoform X2        255   3e-81   
dbj|BAB40142.1|  plasma membrane intrinsic protein 1-1                  254   3e-81   
gb|AAB09747.1|  mipA                                                    254   3e-81   
gb|ABJ98538.1|  PIP1 protein                                            254   4e-81   
gb|ACF39901.1|  aquaporin                                               254   4e-81   
emb|CAB06080.1|  porin                                                  254   4e-81   
gb|EMT22814.1|  Putative aquaporin PIP1-2                               253   4e-81   
ref|XP_003570439.1|  PREDICTED: aquaporin PIP1-5                        254   4e-81   
ref|XP_006648149.1|  PREDICTED: aquaporin PIP 1-3-like                  253   5e-81   
gb|ABJ98535.1|  PIP1 protein                                            253   5e-81   
gb|KHG13859.1|  putative aquaporin PIP-type 7a                          253   6e-81   
gb|AHB33474.1|  plasma intrinsic protein 1-1                            253   6e-81   
ref|XP_007163523.1|  hypothetical protein PHAVU_001G241200g             253   6e-81   
gb|AHA84147.1|  plasma membrane intrinsic protein 1                     253   7e-81   
gb|KEH28859.1|  major intrinsic protein (MIP) family transporter        253   7e-81   
gb|AGG39695.1|  aquaporin protein AQU17                                 253   8e-81   
gb|ACU00101.1|  plasma membrane intrinsic protein PIP1.5                253   8e-81   
gb|ACJ84965.1|  unknown                                                 253   8e-81   
gb|AGD98706.1|  aquaporin protein 3                                     253   8e-81   
gb|ACN40976.1|  unknown                                                 253   8e-81   
gb|ABK24473.1|  unknown                                                 253   9e-81   
ref|XP_008233728.1|  PREDICTED: probable aquaporin PIP1-4               253   9e-81   
gb|AGV54650.1|  plasma membrane intrinsic protein 1;3                   253   1e-80   
gb|AAX92682.1|  probable aquaporin                                      253   1e-80   
gb|AFK41358.1|  unknown                                                 253   1e-80   
ref|XP_009411509.1|  PREDICTED: aquaporin PIP1-1-like                   253   1e-80   
ref|XP_007218768.1|  hypothetical protein PRUPE_ppa009506mg             253   1e-80   
ref|NP_001276263.1|  probable aquaporin PIP1-4-like                     252   2e-80   
gb|KHN31579.1|  Putative aquaporin PIP1-4                               252   2e-80   
gb|AAY44089.1|  plasma membrane intrinsic protein                       249   2e-80   
dbj|BAO18622.1|  plasmamembrane intrinsic protein 1;2                   252   2e-80   
ref|XP_009350886.1|  PREDICTED: probable aquaporin PIP1-4               252   2e-80   
ref|NP_001234413.1|  Aqp2 protein                                       252   2e-80   
gb|AGR83935.1|  aquaporin PIP1-1                                        251   2e-80   
gb|ABI96812.1|  plasma membrane intrinsic protein                       252   2e-80   
gb|ABJ98541.1|  PIP1 protein                                            252   2e-80   
ref|XP_008778924.1|  PREDICTED: probable aquaporin PIP1-2 isoform X2    253   2e-80   
emb|CAA54233.1|  transmembrane protein                                  251   3e-80   
ref|XP_010323861.1|  PREDICTED: aqp2 protein isoform X1                 252   3e-80   
gb|ACR56611.1|  plasma intrinsic protein 1;2                            251   3e-80   
ref|XP_010031252.1|  PREDICTED: probable aquaporin PIP1-4               251   4e-80   
gb|AFB83066.1|  plasma intrinsic protein PIP1.2                         251   4e-80   
ref|XP_007133932.1|  hypothetical protein PHAVU_010G004500g             251   4e-80   
gb|KCW50514.1|  hypothetical protein EUGRSUZ_J00237                     253   4e-80   
gb|KCW50515.1|  hypothetical protein EUGRSUZ_J00237                     252   4e-80   
gb|ACR54285.1|  aquaporin                                               251   4e-80   
ref|XP_004307619.1|  PREDICTED: probable aquaporin PIP-type 7a          251   4e-80   
gb|AAS55867.2|  aquaporin-like protein                                  251   5e-80   
gb|AEY75243.1|  plasma membrane intrinsic protein                       251   5e-80   
ref|XP_009344552.1|  PREDICTED: probable aquaporin PIP1-4               251   6e-80   
gb|ACU17565.1|  unknown                                                 248   6e-80   
ref|XP_006339582.1|  PREDICTED: probable aquaporin PIP1-5-like is...    251   7e-80   
ref|XP_011019143.1|  PREDICTED: probable aquaporin PIP1-4               251   7e-80   
gb|ACB56912.1|  aquaporin                                               251   7e-80   
ref|XP_002309126.1|  plasma membrane intrinsic protein 1-1              250   8e-80   
gb|AFW63312.1|  plasma membrane intrinsic protein1                      249   9e-80   
gb|AGR83938.1|  aquaporin PIP1-4                                        249   1e-79   
gb|ADJ57598.1|  plasma membrane intrinsic protein PIP1;1                250   1e-79   
gb|AGR83936.1|  aquaporin PIP1-2                                        249   1e-79   
ref|NP_001048566.1|  Os02g0823100                                       250   1e-79   
ref|XP_003552231.1|  PREDICTED: probable aquaporin PIP1-2               250   1e-79   
ref|XP_009783438.1|  PREDICTED: aquaporin PIP1-1-like                   246   1e-79   
ref|NP_001280922.1|  probable aquaporin PIP1-4                          250   2e-79   
gb|EAY88074.1|  hypothetical protein OsI_09504                          249   2e-79   
gb|ACU81080.1|  aquaporin                                               249   2e-79   
ref|XP_007140374.1|  hypothetical protein PHAVU_008G1064001g            248   2e-79   
ref|XP_006339584.1|  PREDICTED: probable aquaporin PIP1-5-like is...    250   3e-79   
ref|XP_004511567.1|  PREDICTED: probable aquaporin PIP1-2-like          249   3e-79   
dbj|BAJ99301.1|  predicted protein                                      247   3e-79   
ref|XP_002453072.1|  hypothetical protein SORBIDRAFT_04g037800          249   4e-79   
ref|XP_002275303.1|  PREDICTED: aquaporin PIP1-2                        249   4e-79   
gb|KHN15211.1|  Aquaporin PIP1-2                                        251   4e-79   
ref|NP_001105466.1|  aquaporin PIP1-1                                   248   4e-79   
ref|NP_001105022.1|  aquaporin PIP1-3/PIP1-4                            248   5e-79   
gb|EMS53768.1|  Aquaporin PIP1-5                                        248   7e-79   
ref|XP_009789917.1|  PREDICTED: aquaporin PIP1-1-like                   244   7e-79   
gb|AAB09757.1|  similar to mipB gene product in Mesembryanthemum ...    248   9e-79   
dbj|BAF62342.1|  aquaporin                                              247   2e-78   
gb|AAB72149.1|  putative aquaporin-1                                    247   2e-78   
tpg|DAA33862.1|  TPA: aquaporin PIP1;8                                  246   2e-78   
dbj|BAF33067.1|  aquaporin                                              246   4e-78   
gb|ABH85411.1|  plasma membrane intrinsic protein 1;3                   246   4e-78   
gb|AAF61465.1|AF139816_1  plasma membrane intrinsic protein 3           245   4e-78   
gb|EPS60284.1|  plasma membrane intrinsic protein                       246   5e-78   
dbj|BAA23745.2|  HvPIP1;3                                               246   5e-78   
gb|AAL32688.1|  plasma membrane intrinsic protein 1C (transmembra...    246   6e-78   
ref|NP_171668.1|  aquaporin PIP1-3                                      246   6e-78   
ref|XP_006304071.1|  hypothetical protein CARUB_v10009929mg             246   6e-78   
gb|KJB78792.1|  hypothetical protein B456_013G019300                    246   6e-78   
gb|KDP28617.1|  hypothetical protein JCGZ_14388                         245   7e-78   
ref|XP_003544110.1|  PREDICTED: probable aquaporin PIP-type 7a-li...    245   1e-77   
gb|KHN13075.1|  Putative aquaporin PIP-type 7a                          245   1e-77   
emb|CAA53475.1|  plasma membrane intrinsic protein 1a                   244   1e-77   
gb|AAM00368.1|AF366564_1  aquaporin PIP1                                244   2e-77   
ref|XP_003519383.1|  PREDICTED: probable aquaporin PIP-type 7a-like     244   2e-77   
ref|NP_191702.1|  aquaporin PIP1-1                                      244   2e-77   
gb|EMS50328.1|  Aquaporin PIP1-5                                        244   2e-77   
emb|CAA53476.1|  plasma membrane intrinsic protein 1c                   244   3e-77   
ref|XP_006595872.1|  PREDICTED: probable aquaporin PIP-type 7a-li...    245   3e-77   
gb|AHX84137.1|  aquaporin                                               244   3e-77   
dbj|BAF33068.1|  aquaporin                                              244   4e-77   
ref|XP_006402482.1|  hypothetical protein EUTSA_v10006141mg             243   6e-77   
ref|XP_002876612.1|  hypothetical protein ARALYDRAFT_486618             243   8e-77   
ref|XP_010512489.1|  PREDICTED: aquaporin PIP1-1                        243   8e-77   
emb|CAB37860.1|  PIP1b protein                                          243   1e-76   
gb|AAM65975.1|  plasma membrane intrinsic protein 1a                    242   1e-76   
ref|XP_006291433.1|  hypothetical protein CARUB_v10017571mg             244   2e-76   
gb|AAB04757.1|  aquaporin                                               241   2e-76   
ref|XP_010469077.1|  PREDICTED: aquaporin PIP1-1-like                   241   2e-76   
gb|ACA50529.1|  putative aquaporin                                      240   8e-76   
gb|AAB82140.1|  transmembrane protein                                   240   1e-75   
ref|XP_009802787.1|  PREDICTED: aquaporin PIP1-1-like                   236   2e-75   
ref|NP_194071.1|  putative aquaporin PIP1-5                             239   2e-75   
ref|XP_002869782.1|  PIP1_5/PIP1D                                       239   2e-75   
ref|XP_004173497.1|  PREDICTED: probable aquaporin PIP-type 7a-like     234   2e-75   
gb|KJB74258.1|  hypothetical protein B456_011G283400                    236   3e-75   
ref|XP_010256616.1|  PREDICTED: aquaporin PIP1-1-like                   238   4e-75   
ref|NP_001105023.1|  aquaporin PIP1-6                                   238   1e-74   
emb|CDY10936.1|  BnaA03g45950D                                          236   3e-74   
gb|AAM65493.1|  water channel-like protein                              236   3e-74   
dbj|BAA32081.1|  RWC-3                                                  236   5e-74   



>gb|AAL49748.1|AF452010_1 channel-like protein [Petunia x hybrida]
Length=286

 Score =   294 bits (752),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 142/152 (93%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MAESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFV  252
            MAE+KEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGEL+SWSFYRAGIAEF+
Sbjct  1    MAENKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFM  60

Query  253  ATFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTF  432
            ATFLFLYITILTVMGVKRSD +C SVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTF
Sbjct  61   ATFLFLYITILTVMGVKRSDSLCHSVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  433  GLFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            GLFLARKLSLT ALFY+VM CLGAICGAGVVK
Sbjct  121  GLFLARKLSLTRALFYIVMQCLGAICGAGVVK  152



>ref|NP_001234139.1| probable aquaporin PIP-type pTOM75 [Solanum lycopersicum]
 sp|Q08451.1|PIP1_SOLLC RecName: Full=Probable aquaporin PIP-type pTOM75; AltName: Full=Ripening-associated 
membrane protein; Short=RAMP [Solanum 
lycopersicum]
 emb|CAA52068.1| tomato ripening associated membrane protein [Solanum lycopersicum]
 dbj|BAO18624.1| plasmamembrane intrinsic protein 1;5 [Solanum lycopersicum]
Length=286

 Score =   293 bits (749),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 140/152 (92%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MAESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFV  252
            MAE+KEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGEL+SWSFYRAGIAEF+
Sbjct  1    MAENKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFM  60

Query  253  ATFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTF  432
            ATFLFLYITILTVMG+KRSD +C SVGIQG+AWAFGGMIFALVYCTAGIS GHINPAVTF
Sbjct  61   ATFLFLYITILTVMGLKRSDSLCSSVGIQGVAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  433  GLFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            GLFLARKLSLT A+FYMVM CLGAICGAGVVK
Sbjct  121  GLFLARKLSLTRAVFYMVMQCLGAICGAGVVK  152



>dbj|BAA20075.1| water channel protein [Nicotiana excelsior]
Length=287

 Score =   293 bits (749),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 140/152 (92%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MAESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFV  252
            MAE+KEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGEL+SWSFYRAGIAEF+
Sbjct  1    MAENKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFM  60

Query  253  ATFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTF  432
            ATFLFLYITILTVMG+KRSD +C SVGIQG+AWAFGGMIFALVYCTAGIS GHINPAVTF
Sbjct  61   ATFLFLYITILTVMGLKRSDSLCSSVGIQGVAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  433  GLFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            GLFLARKLSLT A+FYMVM CLGAICGAGVVK
Sbjct  121  GLFLARKLSLTRAIFYMVMQCLGAICGAGVVK  152



>ref|XP_009793682.1| PREDICTED: probable aquaporin PIP-type pTOM75 [Nicotiana sylvestris]
 tpg|DAA64669.1| TPA_exp: aquaporin PIP1 2a [Nicotiana tabacum]
Length=287

 Score =   293 bits (749),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 140/152 (92%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MAESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFV  252
            MAE+KEEDVKLGANK+RETQPLGTAAQTDKDYKEPPPAPLFEPGEL+SWSFYRAGIAEF+
Sbjct  1    MAENKEEDVKLGANKYRETQPLGTAAQTDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFM  60

Query  253  ATFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTF  432
            ATFLFLYITILTVMG+KRSD +C SVGIQG+AWAFGGMIFALVYCTAGIS GHINPAVTF
Sbjct  61   ATFLFLYITILTVMGLKRSDSLCSSVGIQGVAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  433  GLFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            GLFLARKLSLT ALFYMVM CLGAICGAGVVK
Sbjct  121  GLFLARKLSLTRALFYMVMQCLGAICGAGVVK  152



>ref|XP_009630280.1| PREDICTED: probable aquaporin PIP-type pTOM75 [Nicotiana tomentosiformis]
 tpg|DAA64670.1| TPA_exp: aquaporin PIP1 2b [Nicotiana tabacum]
Length=287

 Score =   293 bits (749),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 140/152 (92%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MAESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFV  252
            MAE+KEEDVKLGANK+RETQPLGTAAQTDKDYKEPPPAPLFEPGEL+SWSFYRAGIAEF+
Sbjct  1    MAENKEEDVKLGANKYRETQPLGTAAQTDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFM  60

Query  253  ATFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTF  432
            ATFLFLYITILTVMG+KRSD +C SVGIQG+AWAFGGMIFALVYCTAGIS GHINPAVTF
Sbjct  61   ATFLFLYITILTVMGLKRSDSLCSSVGIQGVAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  433  GLFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            GLFLARKLSLT ALFYMVM CLGAICGAGVVK
Sbjct  121  GLFLARKLSLTRALFYMVMQCLGAICGAGVVK  152



>dbj|BAA20076.1| water channel protein [Nicotiana excelsior]
Length=287

 Score =   292 bits (748),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 140/152 (92%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MAESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFV  252
            MAE+KEEDVKLGANK+RETQPLGTAAQTDKDYKEPPPAPLFEPGEL+SWSFYRAGIAEF+
Sbjct  1    MAENKEEDVKLGANKYRETQPLGTAAQTDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFM  60

Query  253  ATFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTF  432
            ATFLFLYITILTVMG+KRSD +C SVGIQG+AWAFGGMIFALVYCTAGIS GHINPAVTF
Sbjct  61   ATFLFLYITILTVMGLKRSDSLCSSVGIQGVAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  433  GLFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            GLFLARKLSLT ALFYMVM CLGAICGAGVVK
Sbjct  121  GLFLARKLSLTRALFYMVMQCLGAICGAGVVK  152



>ref|XP_009600058.1| PREDICTED: probable aquaporin PIP-type pTOM75 [Nicotiana tomentosiformis]
Length=287

 Score =   291 bits (745),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 139/152 (91%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MAESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFV  252
            MAE+KEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGEL+SWSFYRAGIAEF+
Sbjct  1    MAENKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFM  60

Query  253  ATFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTF  432
            ATFLFLYITILTVMG+KRSD +C SVGIQG+AWAFGGMIFALVYCTAGIS GHINPAVTF
Sbjct  61   ATFLFLYITILTVMGLKRSDSLCSSVGIQGVAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  433  GLFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            GLFLARKLSLT A+FY+VM CLGAICGAGVVK
Sbjct  121  GLFLARKLSLTRAVFYIVMQCLGAICGAGVVK  152



>emb|CAA04750.1| aquaporin 1 [Nicotiana tabacum]
 gb|AAB81601.1| aquaporin 1 [Nicotiana tabacum]
Length=287

 Score =   291 bits (745),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 139/152 (91%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MAESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFV  252
            MAE+KEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGEL+SWSFYRAGIAEF+
Sbjct  1    MAENKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFM  60

Query  253  ATFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTF  432
            ATFLFLYITILTVMG+KRSD +C SVGIQG+AWAFGGMIFALVYCTAGIS GHINPAVTF
Sbjct  61   ATFLFLYITILTVMGLKRSDSLCSSVGIQGVAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  433  GLFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            GLFLARKLSLT A+FY+VM CLGAICGAGVVK
Sbjct  121  GLFLARKLSLTRAIFYIVMQCLGAICGAGVVK  152



>ref|XP_009780083.1| PREDICTED: probable aquaporin PIP-type pTOM75 [Nicotiana sylvestris]
 gb|ABI93215.1| water channel protein [Nicotiana tabacum]
Length=287

 Score =   291 bits (745),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 139/152 (91%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MAESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFV  252
            MAE+KEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGEL+SWSFYRAGIAEF+
Sbjct  1    MAENKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFM  60

Query  253  ATFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTF  432
            ATFLFLYITILTVMG+KRSD +C SVGIQG+AWAFGGMIFALVYCTAGIS GHINPAVTF
Sbjct  61   ATFLFLYITILTVMGLKRSDSLCSSVGIQGVAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  433  GLFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            GLFLARKLSLT A+FY+VM CLGAICGAGVVK
Sbjct  121  GLFLARKLSLTRAIFYIVMQCLGAICGAGVVK  152



>gb|ABJ97677.1| major intrinsic protein [Solanum tuberosum]
Length=288

 Score =   289 bits (739),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 137/152 (90%), Positives = 146/152 (96%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MAESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFV  252
            MAE+KEEDV LGANK+RETQPLGTAAQTDKDYKEPPPAPLFEPGEL+SWSFYRAGIAEF+
Sbjct  1    MAENKEEDVNLGANKYRETQPLGTAAQTDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFM  60

Query  253  ATFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTF  432
            ATFLFLYITILTVMG+KRSD +C SVGIQG+AWAFGGMIFALVYCTAGIS GHINPAVTF
Sbjct  61   ATFLFLYITILTVMGLKRSDSLCSSVGIQGVAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  433  GLFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            GLFLARKLSLT A+FY+VM CLGAICGAGVVK
Sbjct  121  GLFLARKLSLTRAVFYIVMQCLGAICGAGVVK  152



>ref|XP_006360691.1| PREDICTED: probable aquaporin PIP-type pTOM75 isoform X2 [Solanum 
tuberosum]
Length=292

 Score =   289 bits (739),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 137/152 (90%), Positives = 146/152 (96%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MAESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFV  252
            MAE+KEEDV LGANK+RETQPLGTAAQTDKDYKEPPPAPLFEPGEL+SWSFYRAGIAEF+
Sbjct  1    MAENKEEDVNLGANKYRETQPLGTAAQTDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFM  60

Query  253  ATFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTF  432
            ATFLFLYITILTVMG+KRSD +C SVGIQG+AWAFGGMIFALVYCTAGIS GHINPAVTF
Sbjct  61   ATFLFLYITILTVMGLKRSDSLCSSVGIQGVAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  433  GLFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            GLFLARKLSLT A+FY+VM CLGAICGAGVVK
Sbjct  121  GLFLARKLSLTRAVFYIVMQCLGAICGAGVVK  152



>gb|ABC01892.1| major intrinsic protein 1-like protein [Solanum tuberosum]
Length=288

 Score =   288 bits (738),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 137/152 (90%), Positives = 146/152 (96%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MAESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFV  252
            MAE+KEEDV LGANK+RETQPLGTAAQTDKDYKEPPPAPLFEPGEL+SWSFYRAGIAEF+
Sbjct  1    MAENKEEDVNLGANKYRETQPLGTAAQTDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFM  60

Query  253  ATFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTF  432
            ATFLFLYITILTVMG+KRSD +C SVGIQG+AWAFGGMIFALVYCTAGIS GHINPAVTF
Sbjct  61   ATFLFLYITILTVMGLKRSDSLCSSVGIQGVAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  433  GLFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            GLFLARKLSLT A+FY+VM CLGAICGAGVVK
Sbjct  121  GLFLARKLSLTRAVFYIVMQCLGAICGAGVVK  152



>gb|AFU61115.1| water channel protein PIP [Capsicum annuum]
Length=286

 Score =   288 bits (737),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 137/152 (90%), Positives = 146/152 (96%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MAESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFV  252
            MAE+KEEDV LGANK+RETQPLGTAAQTDKDYKEPPPAPLFEPGEL+SWSFYRAGIAEF+
Sbjct  1    MAENKEEDVSLGANKYRETQPLGTAAQTDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFM  60

Query  253  ATFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTF  432
            ATFLFLYITILTVMG+KRSD +C SVGIQG+AWAFGGMIFALVYCTAGIS GHINPAVTF
Sbjct  61   ATFLFLYITILTVMGLKRSDSLCSSVGIQGVAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  433  GLFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            GLFLARKLSLT A+FY+VM CLGAICGAGVVK
Sbjct  121  GLFLARKLSLTRAIFYIVMQCLGAICGAGVVK  152



>ref|NP_001275388.1| major intrinsic protein 1-like protein [Solanum tuberosum]
 emb|CBI99235.1| major intrinsic protein 1 [Solanum tuberosum]
Length=288

 Score =   288 bits (737),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 136/152 (89%), Positives = 146/152 (96%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MAESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFV  252
            MAE+KEEDV LGANK+RETQPLGTAAQTDKDYKEPPPAPLFEPGEL+SWSFYRAGIAEF+
Sbjct  1    MAENKEEDVNLGANKYRETQPLGTAAQTDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFM  60

Query  253  ATFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTF  432
            ATFLFLYITILTVMG+KRSD +C SVG+QG+AWAFGGMIFALVYCTAGIS GHINPAVTF
Sbjct  61   ATFLFLYITILTVMGLKRSDSLCSSVGVQGVAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  433  GLFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            GLFLARKLSLT A+FY+VM CLGAICGAGVVK
Sbjct  121  GLFLARKLSLTRAVFYIVMQCLGAICGAGVVK  152



>gb|ABB16979.1| major intrinsic protein 1-like protein [Solanum tuberosum]
Length=288

 Score =   288 bits (736),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 136/152 (89%), Positives = 146/152 (96%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MAESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFV  252
            MAE+KEEDV LGANK+RETQPLGTAAQTDKDYKEPPPAPLFEPGEL+SWSFYRAGIAEF+
Sbjct  1    MAENKEEDVNLGANKYRETQPLGTAAQTDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFM  60

Query  253  ATFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTF  432
            ATFLFLYITILTVMG+KRSD +C SVG+QG+AWAFGGMIFALVYCTAGIS GHINPAVTF
Sbjct  61   ATFLFLYITILTVMGLKRSDSLCSSVGVQGVAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  433  GLFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            GLFLARKLSLT A+FY+VM CLGAICGAGVVK
Sbjct  121  GLFLARKLSLTRAVFYIVMQCLGAICGAGVVK  152



>ref|XP_006343971.1| PREDICTED: probable aquaporin PIP-type pTOM75-like [Solanum tuberosum]
Length=286

 Score =   288 bits (736),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 137/152 (90%), Positives = 146/152 (96%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MAESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFV  252
            MAE+KEEDVKLGANKFRETQPLGT+AQTDKDYKEPPPAPLFEPGEL+SWSFYRAGIAEF+
Sbjct  1    MAENKEEDVKLGANKFRETQPLGTSAQTDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFM  60

Query  253  ATFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTF  432
            ATFLFLYITILTVMG+KRSD +C SVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVT 
Sbjct  61   ATFLFLYITILTVMGLKRSDSLCSSVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTL  120

Query  433  GLFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            GLFLARKLSLT ++FY+VM CLGAICGAGVVK
Sbjct  121  GLFLARKLSLTRSVFYIVMQCLGAICGAGVVK  152



>ref|NP_001274291.1| probable aquaporin PIP-type pTOM75-like [Solanum lycopersicum]
 dbj|BAO18623.1| plasmamembrane intrinsic protein 1;3 [Solanum lycopersicum]
Length=288

 Score =   288 bits (736),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 136/152 (89%), Positives = 146/152 (96%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MAESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFV  252
            MAE+KEEDV LGANK+RETQPLGTAAQTDKDYKEPPPAPLFEPGEL+SWSFYRAGIAEF+
Sbjct  1    MAENKEEDVNLGANKYRETQPLGTAAQTDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFM  60

Query  253  ATFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTF  432
            ATFLFLYITILTVMG+KRSD +C SVG+QG+AWAFGGMIFALVYCTAGIS GHINPAVTF
Sbjct  61   ATFLFLYITILTVMGLKRSDSLCSSVGVQGVAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  433  GLFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            GLFLARKLSLT A+FY+VM CLGAICGAGVVK
Sbjct  121  GLFLARKLSLTRAVFYIVMQCLGAICGAGVVK  152



>ref|NP_001289835.1| probable aquaporin PIP-type pTOM75 [Solanum lycopersicum]
 dbj|BAO18621.1| plasmamembrane intrinsic protein 1;1 [Solanum lycopersicum]
Length=287

 Score =   286 bits (733),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 136/152 (89%), Positives = 145/152 (95%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MAESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFV  252
            MAE+KEEDV LGANKFRE QPLGT+AQTDKDYKEPPPAPL+EPGEL+SWSFYRAGIAEF+
Sbjct  1    MAENKEEDVNLGANKFREPQPLGTSAQTDKDYKEPPPAPLYEPGELSSWSFYRAGIAEFM  60

Query  253  ATFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTF  432
            ATFLFLYITILTVMG+KRSD +C SVGIQG+AWAFGGMIFALVYCTAGIS GHINPAVTF
Sbjct  61   ATFLFLYITILTVMGLKRSDSLCSSVGIQGVAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  433  GLFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            GLFLARKLSLT A+FYMVM CLGAICGAGVVK
Sbjct  121  GLFLARKLSLTRAVFYMVMQCLGAICGAGVVK  152



>gb|ABB87103.1| water channel protein-like [Solanum tuberosum]
Length=254

 Score =   285 bits (728),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 136/152 (89%), Positives = 145/152 (95%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MAESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFV  252
            MAE+KEEDV LGANK+RETQPLGTAAQTDKDYKEPPPAPLFEPGEL+SWSFYRAGIAEF+
Sbjct  1    MAENKEEDVNLGANKYRETQPLGTAAQTDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFM  60

Query  253  ATFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTF  432
            ATFL LYITILTVMG+KRSD +C SVGIQG+AWAFGGMIFALVYCTAGIS GHINPAVTF
Sbjct  61   ATFLSLYITILTVMGLKRSDSLCSSVGIQGVAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  433  GLFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            GLFLARKLSLT A+FY+VM CLGAICGAGVVK
Sbjct  121  GLFLARKLSLTRAVFYIVMQCLGAICGAGVVK  152



>emb|CAA04653.1| major intrinsic protein PIPB [Craterostigma plantagineum]
Length=288

 Score =   282 bits (722),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 134/152 (88%), Positives = 143/152 (94%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MAESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFV  252
            MAE++EEDV+LGANK+RETQP+GT+AQTDKDYKEPPPAPLFEPGEL SWSFYRAGIAEFV
Sbjct  1    MAENREEDVRLGANKYRETQPIGTSAQTDKDYKEPPPAPLFEPGELKSWSFYRAGIAEFV  60

Query  253  ATFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTF  432
            ATFLFLYITILTVMGV R+   C SVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTF
Sbjct  61   ATFLFLYITILTVMGVSRAPNKCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  433  GLFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            GLFLARKLSLT A+FYM+M CLGAICGAGVVK
Sbjct  121  GLFLARKLSLTRAIFYMIMQCLGAICGAGVVK  152



>ref|XP_006352272.1| PREDICTED: probable aquaporin PIP-type pTOM75-like [Solanum tuberosum]
Length=287

 Score =   281 bits (718),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 134/152 (88%), Positives = 143/152 (94%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MAESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFV  252
            MAE+KEEDV LGANKFRE QPLGT+AQTDKDY EPP APLFEPGEL+SWSFYRAGIAEF+
Sbjct  1    MAENKEEDVNLGANKFREPQPLGTSAQTDKDYNEPPAAPLFEPGELSSWSFYRAGIAEFM  60

Query  253  ATFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTF  432
            ATFLFLYITILTVMG+KRSD +C SVGIQG+AWAFGGMIFALVYCTAGIS GHINPAVTF
Sbjct  61   ATFLFLYITILTVMGLKRSDSLCSSVGIQGVAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  433  GLFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            GLFLARKLSLT A+FY+VM CLGAICGAGVVK
Sbjct  121  GLFLARKLSLTRAVFYIVMQCLGAICGAGVVK  152



>ref|XP_009779003.1| PREDICTED: probable aquaporin PIP-type pTOM75 [Nicotiana sylvestris]
Length=288

 Score =   280 bits (717),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 136/153 (89%), Positives = 145/153 (95%), Gaps = 1/153 (1%)
 Frame = +1

Query  73   MAESKEEDVKLGANKFRETQPLGTAAQT-DKDYKEPPPAPLFEPGELTSWSFYRAGIAEF  249
            MAE+KEEDV LGANK+RETQPLGTAAQT +KDY EPPPAPLFEPGEL+SWSFYRAGIAEF
Sbjct  1    MAENKEEDVNLGANKYRETQPLGTAAQTENKDYVEPPPAPLFEPGELSSWSFYRAGIAEF  60

Query  250  VATFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVT  429
            +ATFLFLYITILTVMG+KRSD +C SVGIQG+AWAFGGMIFALVYCTAGIS GHINPAVT
Sbjct  61   MATFLFLYITILTVMGLKRSDSLCSSVGIQGVAWAFGGMIFALVYCTAGISGGHINPAVT  120

Query  430  FGLFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FGLFLARKLSLT A+FYMVM CLGAICGAGVVK
Sbjct  121  FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVK  153



>gb|AAL33585.1|AF440271_1 aquaporin [Nicotiana tabacum]
Length=286

 Score =   280 bits (717),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 136/153 (89%), Positives = 145/153 (95%), Gaps = 1/153 (1%)
 Frame = +1

Query  73   MAESKEEDVKLGANKFRETQPLGTAAQT-DKDYKEPPPAPLFEPGELTSWSFYRAGIAEF  249
            MAE+KEEDV LGANK+RETQPLGTAAQT +KDY EPPPAPLFEPGEL+SWSFYRAGIAEF
Sbjct  1    MAENKEEDVNLGANKYRETQPLGTAAQTENKDYIEPPPAPLFEPGELSSWSFYRAGIAEF  60

Query  250  VATFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVT  429
            +ATFLFLYITILTVMG+KRSD +C SVGIQG+AWAFGGMIFALVYCTAGIS GHINPAVT
Sbjct  61   MATFLFLYITILTVMGLKRSDSLCSSVGIQGVAWAFGGMIFALVYCTAGISGGHINPAVT  120

Query  430  FGLFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FGLFLARKLSLT A+FYMVM CLGAICGAGVVK
Sbjct  121  FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVK  153



>ref|XP_009609568.1| PREDICTED: probable aquaporin PIP-type pTOM75 [Nicotiana tomentosiformis]
Length=288

 Score =   280 bits (717),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 136/153 (89%), Positives = 145/153 (95%), Gaps = 1/153 (1%)
 Frame = +1

Query  73   MAESKEEDVKLGANKFRETQPLGTAAQT-DKDYKEPPPAPLFEPGELTSWSFYRAGIAEF  249
            MAE+KEEDV LGANK+RETQPLGTAAQT +KDY EPPPAPLFEPGEL+SWSFYRAGIAEF
Sbjct  1    MAENKEEDVNLGANKYRETQPLGTAAQTENKDYIEPPPAPLFEPGELSSWSFYRAGIAEF  60

Query  250  VATFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVT  429
            +ATFLFLYITILTVMG+KRSD +C SVGIQG+AWAFGGMIFALVYCTAGIS GHINPAVT
Sbjct  61   MATFLFLYITILTVMGLKRSDSLCSSVGIQGVAWAFGGMIFALVYCTAGISGGHINPAVT  120

Query  430  FGLFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FGLFLARKLSLT A+FYMVM CLGAICGAGVVK
Sbjct  121  FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVK  153



>ref|XP_011072833.1| PREDICTED: probable aquaporin PIP-type pTOM75 [Sesamum indicum]
Length=288

 Score =   280 bits (716),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 137/152 (90%), Positives = 141/152 (93%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MAESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFV  252
            MAE+KEEDV+LGANKF E QPLGTAAQTDKDYKEPPPAPLFEPGEL SWSFYRAGIAEF+
Sbjct  1    MAENKEEDVRLGANKFTERQPLGTAAQTDKDYKEPPPAPLFEPGELQSWSFYRAGIAEFM  60

Query  253  ATFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTF  432
            ATFLFLYITILTVMGV RS   C SVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTF
Sbjct  61   ATFLFLYITILTVMGVGRSSSKCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  433  GLFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            GLFLARKLSLT A+FYMVM CLGAICGAGVVK
Sbjct  121  GLFLARKLSLTRAVFYMVMQCLGAICGAGVVK  152



>gb|AFC92657.1| aquaporin PIP1;3 [Eustoma exaltatum subsp. russellianum]
Length=287

 Score =   278 bits (710),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 135/152 (89%), Positives = 140/152 (92%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MAESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFV  252
            MAESKEEDVKLGANKF E QPLGTAAQTDKDYKE P APLFEPGEL+SWSFYRAGIAEF+
Sbjct  1    MAESKEEDVKLGANKFNERQPLGTAAQTDKDYKEAPAAPLFEPGELSSWSFYRAGIAEFI  60

Query  253  ATFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTF  432
            AT LFLYIT+LTVMG  RSD  CKSVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTF
Sbjct  61   ATLLFLYITVLTVMGYGRSDNKCKSVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  433  GLFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            GLFLARKLSLT ALFY+VM CLGAICGAG+VK
Sbjct  121  GLFLARKLSLTRALFYIVMQCLGAICGAGIVK  152



>gb|ABG57184.1| aquaporin [Tamarix sp. ZDY-001908]
Length=287

 Score =   278 bits (710),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 135/152 (89%), Positives = 142/152 (93%), Gaps = 2/152 (1%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQT--DKDYKEPPPAPLFEPGELTSWSFYRAGIAEFV  252
            E KEEDV+LGANKF E QP+GTAAQT  +KDY+EPPPAPLFEP ELTSWSFYRAGIAEF+
Sbjct  2    EGKEEDVRLGANKFPERQPIGTAAQTHEEKDYREPPPAPLFEPSELTSWSFYRAGIAEFI  61

Query  253  ATFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTF  432
            ATFLFLYITILTVMGVKRSD +CKSVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTF
Sbjct  62   ATFLFLYITILTVMGVKRSDSMCKSVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  121

Query  433  GLFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            GLFLARKLSLT ALFYM+M CLGAICGAGVVK
Sbjct  122  GLFLARKLSLTRALFYMIMQCLGAICGAGVVK  153



>gb|ACR56610.1| plasma intrinsic protein 1;1 [Juglans regia]
Length=287

 Score =   278 bits (710),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 135/150 (90%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDVKLGANK+ E QPLGTAAQTDKDYKEPPPAPLFEPGEL+SWSFYRAGIAEFVAT
Sbjct  2    EGKEEDVKLGANKYGERQPLGTAAQTDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFVAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYITILTVMGV +SD  CKSVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITILTVMGVGKSDSKCKSVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
             LARKLSLT ALFY++M CLGAICGAGVVK
Sbjct  122  LLARKLSLTRALFYIIMQCLGAICGAGVVK  151



>ref|XP_011084932.1| PREDICTED: probable aquaporin PIP1-2 [Sesamum indicum]
Length=286

 Score =   277 bits (709),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 135/151 (89%), Positives = 141/151 (93%), Gaps = 1/151 (1%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQT-DKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVA  255
            ESKEEDV+LGANKF E QP+GTAAQ+ DKDYKEPPPAPLFEPGELTSWSFYRAGIAEF+A
Sbjct  2    ESKEEDVRLGANKFSERQPIGTAAQSQDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFIA  61

Query  256  TFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFG  435
            TFLFLYITILTVMGV +SD  C +VGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFG
Sbjct  62   TFLFLYITILTVMGVSKSDSKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  121

Query  436  LFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            LFLARKLSLT ALFYMVM CLGAICGAGVVK
Sbjct  122  LFLARKLSLTRALFYMVMQCLGAICGAGVVK  152



>ref|XP_011080941.1| PREDICTED: probable aquaporin PIP-type pTOM75 [Sesamum indicum]
Length=289

 Score =   277 bits (709),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 135/152 (89%), Positives = 141/152 (93%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MAESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFV  252
            MAE++EEDVKLGANKF E QPLGTAAQTDKDYKEPPPAPLFEPGEL SWSFYRAGIAEF+
Sbjct  1    MAENREEDVKLGANKFTERQPLGTAAQTDKDYKEPPPAPLFEPGELKSWSFYRAGIAEFM  60

Query  253  ATFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTF  432
            A FLFLYITILTVMGV R++  C SVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTF
Sbjct  61   AIFLFLYITILTVMGVGRANNKCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  433  GLFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            GLFLARKLSLT ALFY+VM CLGAICGAGVVK
Sbjct  121  GLFLARKLSLTRALFYIVMQCLGAICGAGVVK  152



>ref|XP_009386206.1| PREDICTED: probable aquaporin PIP1-2 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=286

 Score =   276 bits (706),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 133/150 (89%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDV+LGANKF E QP+GTAAQ+DKDYKEPPPAPLFEPGELTSWSFYRAGIAEF+AT
Sbjct  2    EGKEEDVRLGANKFSERQPIGTAAQSDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFMAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYITILTVMGV +S+  C +VGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITILTVMGVVKSNSKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FLARKLSLT ALFYMVM CLGAICGAGVVK
Sbjct  122  FLARKLSLTRALFYMVMQCLGAICGAGVVK  151



>gb|AAF71819.1|AF141899_1 putative aquaporin PIP1-3 [Vitis cinerea var. helleri x Vitis 
rupestris]
Length=287

 Score =   276 bits (705),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 133/150 (89%), Positives = 139/150 (93%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDVKLGANKF E QPLGTAAQTDKDYKEPPPAPLFEPGEL SWSFYRAGIAEF+AT
Sbjct  2    EGKEEDVKLGANKFTERQPLGTAAQTDKDYKEPPPAPLFEPGELKSWSFYRAGIAEFMAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYITILTVMGVK+S  +C SVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITILTVMGVKKSSTMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
             LARKLSLT A+FY++M CLGAICGAGVVK
Sbjct  122  LLARKLSLTRAIFYIIMQCLGAICGAGVVK  151



>ref|XP_008437293.1| PREDICTED: aquaporin PIP1-2 [Cucumis melo]
Length=286

 Score =   275 bits (704),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 132/150 (88%), Positives = 139/150 (93%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDVKLGANKF E QP+GT+AQTDKDYKEPPPAPL+EPGELTSWSFYRAGIAEF+AT
Sbjct  2    EGKEEDVKLGANKFSERQPIGTSAQTDKDYKEPPPAPLYEPGELTSWSFYRAGIAEFMAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYITILTVMGV RS   C +VGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITILTVMGVSRSPSKCNTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FLARKLSLT ALFY++M CLGAICGAGVVK
Sbjct  122  FLARKLSLTRALFYIIMQCLGAICGAGVVK  151



>ref|XP_010544738.1| PREDICTED: aquaporin PIP1-1-like [Tarenaya hassleriana]
Length=286

 Score =   275 bits (703),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 130/150 (87%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDV++GANKF E QP+GT+AQTDKDYKEPPPAPLFEPGEL+SWSF+RAGIAEF+AT
Sbjct  2    EGKEEDVRVGANKFPERQPIGTSAQTDKDYKEPPPAPLFEPGELSSWSFWRAGIAEFIAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYIT+LTVMGVKRS  +C SVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITVLTVMGVKRSPSMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FLARKLSLT A++YMVM CLGAICGAGVVK
Sbjct  122  FLARKLSLTRAVYYMVMQCLGAICGAGVVK  151



>gb|EYU23442.1| hypothetical protein MIMGU_mgv1a011177mg [Erythranthe guttata]
 gb|EYU23443.1| hypothetical protein MIMGU_mgv1a011177mg [Erythranthe guttata]
Length=290

 Score =   275 bits (703),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 135/152 (89%), Positives = 140/152 (92%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MAESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFV  252
            MAESKEEDVKLGANK+ E QPLGTAAQTDKDYKE PPAPLFEPGEL SWSFYRAGIAEFV
Sbjct  1    MAESKEEDVKLGANKYTERQPLGTAAQTDKDYKEAPPAPLFEPGELKSWSFYRAGIAEFV  60

Query  253  ATFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTF  432
            ATFLFLYITILTVMGV ++   C SVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTF
Sbjct  61   ATFLFLYITILTVMGVGKAHNKCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  433  GLFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            GLFLARKLSLT A+FY+VM CLGAICGAGVVK
Sbjct  121  GLFLARKLSLTRAVFYIVMQCLGAICGAGVVK  152



>gb|AGG39697.1| aquaporin protein AQU19 [Camellia sinensis]
Length=286

 Score =   275 bits (703),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 134/150 (89%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDVKLGANKF E QPLGTAAQTDKDYKEPPPAPLFEPGEL SWSFYRAGIAEF+AT
Sbjct  2    EGKEEDVKLGANKFSERQPLGTAAQTDKDYKEPPPAPLFEPGELVSWSFYRAGIAEFMAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYIT+LTVMGV R+   C SVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITLLTVMGVVRAPNKCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FLARKLSLT A+FYMVM CLGAICGAGVVK
Sbjct  122  FLARKLSLTRAVFYMVMQCLGAICGAGVVK  151



>gb|AHI54572.1| aquaporin protein AQU19 [Camellia japonica]
Length=286

 Score =   275 bits (703),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 134/150 (89%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDVKLGANKF E QPLGTAAQTDKDYKEPPPAPLFEPGEL SWSFYRAGIAEF+AT
Sbjct  2    EGKEEDVKLGANKFSERQPLGTAAQTDKDYKEPPPAPLFEPGELVSWSFYRAGIAEFMAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYIT+LTVMGV R+   C SVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITLLTVMGVVRAPNKCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FLARKLSLT A+FYMVM CLGAICGAGVVK
Sbjct  122  FLARKLSLTRAVFYMVMQCLGAICGAGVVK  151



>ref|XP_010523742.1| PREDICTED: aquaporin PIP1-1 [Tarenaya hassleriana]
 ref|XP_010523743.1| PREDICTED: aquaporin PIP1-1 [Tarenaya hassleriana]
 ref|XP_010523744.1| PREDICTED: aquaporin PIP1-1 [Tarenaya hassleriana]
 ref|XP_010523746.1| PREDICTED: aquaporin PIP1-1 [Tarenaya hassleriana]
 ref|XP_010523747.1| PREDICTED: aquaporin PIP1-1 [Tarenaya hassleriana]
 ref|XP_010523748.1| PREDICTED: aquaporin PIP1-1 [Tarenaya hassleriana]
Length=286

 Score =   275 bits (702),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 129/150 (86%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDV++GANKF E QP+GT+AQTDKDYKEPPPAPLFEPGEL+SWSF+RAGIAEF+AT
Sbjct  2    EGKEEDVRVGANKFPERQPIGTSAQTDKDYKEPPPAPLFEPGELSSWSFWRAGIAEFIAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLY+T+LTVMGVKRS  +C SVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYVTVLTVMGVKRSPSMCSSVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FLARKLSLT A++YMVM CLGAICGAGVVK
Sbjct  122  FLARKLSLTRAVYYMVMQCLGAICGAGVVK  151



>gb|EYU41267.1| hypothetical protein MIMGU_mgv1a011292mg [Erythranthe guttata]
Length=258

 Score =   273 bits (699),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 132/151 (87%), Positives = 141/151 (93%), Gaps = 1/151 (1%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQT-DKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVA  255
            ESKEEDV++GANK+ E QP+GTAAQ+ DKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVA
Sbjct  2    ESKEEDVRVGANKYSERQPIGTAAQSQDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVA  61

Query  256  TFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFG  435
            TFLFLYITILTVMGV +SD  C +VGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFG
Sbjct  62   TFLFLYITILTVMGVSKSDSKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  121

Query  436  LFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            LFLARKLSLT A+FY+VM CLGAICGAGVVK
Sbjct  122  LFLARKLSLTRAVFYIVMQCLGAICGAGVVK  152



>ref|XP_002889360.1| hypothetical protein ARALYDRAFT_470115 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65619.1| hypothetical protein ARALYDRAFT_470115 [Arabidopsis lyrata subsp. 
lyrata]
Length=286

 Score =   275 bits (702),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 130/150 (87%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDV++GANKF E QP+GT+AQTDKDYKEPPPAPLFEPGEL+SWSFYRAGIAEF+AT
Sbjct  2    EGKEEDVRVGANKFPERQPIGTSAQTDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFIAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYIT+LTVMGVKR+  +C SVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FLARKLSLT A+FY+VM CLGAICGAGVVK
Sbjct  122  FLARKLSLTRAVFYIVMQCLGAICGAGVVK  151



>ref|XP_010480063.1| PREDICTED: aquaporin PIP1-3 [Camelina sativa]
 ref|XP_010457103.1| PREDICTED: aquaporin PIP1-3 [Camelina sativa]
 ref|XP_010457104.1| PREDICTED: aquaporin PIP1-3 [Camelina sativa]
 ref|XP_010474769.1| PREDICTED: aquaporin PIP1-3 [Camelina sativa]
 gb|KFK42522.1| hypothetical protein AALP_AA1G005400 [Arabis alpina]
Length=286

 Score =   274 bits (701),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 130/150 (87%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDV++GANKF E QP+GT+AQTDKDYKEPPPAPLFEPGEL+SWSFYRAGIAEF+AT
Sbjct  2    EGKEEDVRVGANKFPERQPIGTSAQTDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFIAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYIT+LTVMGVKR+  +C SVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FLARKLSLT A+FY+VM CLGAICGAGVVK
Sbjct  122  FLARKLSLTRAVFYIVMQCLGAICGAGVVK  151



>emb|CDY15165.1| BnaC05g00440D [Brassica napus]
Length=324

 Score =   275 bits (704),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 130/150 (87%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDV++GANKF E QP+GT+AQTDKDYKEPPPAPLFEPGEL+SWSF+RAGIAEF+AT
Sbjct  40   EGKEEDVRVGANKFPERQPIGTSAQTDKDYKEPPPAPLFEPGELSSWSFWRAGIAEFIAT  99

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYIT+LTVMGVKR+  +C SVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  100  FLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  159

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FLARKLSLT A+FYMVM CLGAICGAGVVK
Sbjct  160  FLARKLSLTRAVFYMVMQCLGAICGAGVVK  189



>ref|XP_009386207.1| PREDICTED: probable aquaporin PIP1-2 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=335

 Score =   276 bits (705),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 133/150 (89%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDV+LGANKF E QP+GTAAQ+DKDYKEPPPAPLFEPGELTSWSFYRAGIAEF+AT
Sbjct  2    EGKEEDVRLGANKFSERQPIGTAAQSDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFMAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYITILTVMGV +S+  C +VGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITILTVMGVVKSNSKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FLARKLSLT ALFYMVM CLGAICGAGVVK
Sbjct  122  FLARKLSLTRALFYMVMQCLGAICGAGVVK  151



>gb|KJB20657.1| hypothetical protein B456_003G158100 [Gossypium raimondii]
Length=222

 Score =   271 bits (694),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 130/150 (87%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDVKLGANKF E QP+GT+AQTDKDYKEPPPAPLFEPGEL SWSFYRAGIAEFVAT
Sbjct  2    EGKEEDVKLGANKFSERQPIGTSAQTDKDYKEPPPAPLFEPGELKSWSFYRAGIAEFVAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYIT+LTVMGV +S   C +VGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITVLTVMGVSQSKTKCTTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
             LARKLSLT A+FYM+M CLGAICGAGVVK
Sbjct  122  LLARKLSLTRAVFYMIMQCLGAICGAGVVK  151



>ref|XP_010556545.1| PREDICTED: aquaporin PIP1-3-like [Tarenaya hassleriana]
Length=286

 Score =   273 bits (699),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 131/150 (87%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDV++GANKF E QP+GT+AQTDKDYKEPPPAPLFEPGELTSWSF+RAGIAEF+AT
Sbjct  2    EGKEEDVRVGANKFTERQPIGTSAQTDKDYKEPPPAPLFEPGELTSWSFWRAGIAEFMAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYIT+LTVMGVKRS  +C SVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITVLTVMGVKRSPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FLARKLSLT A+FYMVM  LGAICGAGVVK
Sbjct  122  FLARKLSLTRAVFYMVMQSLGAICGAGVVK  151



>ref|NP_974489.1| plasma membrane intrinsic protein 1;4 [Arabidopsis thaliana]
 gb|AEE81878.1| plasma membrane intrinsic protein 1;4 [Arabidopsis thaliana]
Length=219

 Score =   271 bits (693),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 130/151 (86%), Positives = 141/151 (93%), Gaps = 1/151 (1%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQ-TDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVA  255
            E KEEDV++GANKF E QP+GT+AQ TDKDYKEPPPAPLFEPGEL+SWSFYRAGIAEF+A
Sbjct  2    EGKEEDVRVGANKFPERQPIGTSAQSTDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFIA  61

Query  256  TFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFG  435
            TFLFLYIT+LTVMGVKR+  +C SVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFG
Sbjct  62   TFLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  121

Query  436  LFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            LFLARKLSLT A+FYM+M CLGAICGAGVVK
Sbjct  122  LFLARKLSLTRAVFYMIMQCLGAICGAGVVK  152



>gb|AAY22204.1| putative aquaporin [Phaseolus vulgaris]
Length=287

 Score =   273 bits (699),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 132/150 (88%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E+KEEDVK+GANKF E QPLGTAAQ DKDYKEPPPAPLFEPGEL SWSFYRAGIAEFVAT
Sbjct  2    ENKEEDVKVGANKFTERQPLGTAAQGDKDYKEPPPAPLFEPGELKSWSFYRAGIAEFVAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYITILTVMGV RS   C SVGIQGIAW+FGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITILTVMGVNRSSSKCSSVGIQGIAWSFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FLARKLSLT A+FY++M CLGAICGAGVVK
Sbjct  122  FLARKLSLTRAVFYIIMQCLGAICGAGVVK  151



>ref|XP_004143901.1| PREDICTED: probable aquaporin PIP1-2-like [Cucumis sativus]
 ref|XP_004159943.1| PREDICTED: probable aquaporin PIP1-2-like [Cucumis sativus]
 gb|KGN50087.1| Aquaporin 1 [Cucumis sativus]
Length=286

 Score =   273 bits (699),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 131/150 (87%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDVKLGANKF E QP+GT+AQTDKDYKEPPPAPL+EPGEL SWSFYRAGIAEF+AT
Sbjct  2    EGKEEDVKLGANKFSERQPIGTSAQTDKDYKEPPPAPLYEPGELKSWSFYRAGIAEFMAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYITILTVMGV RS   C SVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITILTVMGVNRSPSKCNSVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FLARKLSLT A+FY++M CLGAICGAGVVK
Sbjct  122  FLARKLSLTRAVFYIIMQCLGAICGAGVVK  151



>ref|XP_007160075.1| hypothetical protein PHAVU_002G290400g [Phaseolus vulgaris]
 gb|ESW32069.1| hypothetical protein PHAVU_002G290400g [Phaseolus vulgaris]
Length=287

 Score =   273 bits (699),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 132/150 (88%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E+KEEDVK+GANKF E QPLGTAAQ DKDYKEPPPAPLFEPGEL SWSFYRAGIAEFVAT
Sbjct  2    ENKEEDVKVGANKFTERQPLGTAAQGDKDYKEPPPAPLFEPGELKSWSFYRAGIAEFVAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYITILTVMGV RS   C SVGIQGIAW+FGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITILTVMGVNRSSSKCSSVGIQGIAWSFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FLARKLSLT A+FY++M CLGAICGAGVVK
Sbjct  122  FLARKLSLTRAVFYIIMQCLGAICGAGVVK  151



>gb|KFK30621.1| hypothetical protein AALP_AA6G005800 [Arabis alpina]
Length=286

 Score =   273 bits (699),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDV++GANKF E QP+GT+AQ+DKDYKEPPPAPLFEPGEL+SWSF+RAGIAEF+AT
Sbjct  2    EGKEEDVRVGANKFPEKQPIGTSAQSDKDYKEPPPAPLFEPGELSSWSFWRAGIAEFIAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYIT+LTVMGVKR+  +C SVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FLARKLSLT A+FYM+M CLGAICGAGVVK
Sbjct  122  FLARKLSLTRAVFYMIMQCLGAICGAGVVK  151



>emb|CDY07221.1| BnaCnng02360D [Brassica napus]
Length=286

 Score =   273 bits (698),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDV++GANKF E QP+GT+AQ+DKDYKEPPPAPLFEPGEL+SWSF+RAGIAEF+AT
Sbjct  2    EGKEEDVRVGANKFPERQPIGTSAQSDKDYKEPPPAPLFEPGELSSWSFWRAGIAEFIAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYIT+LTVMGVKR+  +C SVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FLARKLSLT A+FYM+M CLGAICGAGVVK
Sbjct  122  FLARKLSLTRAVFYMIMQCLGAICGAGVVK  151



>ref|XP_009134562.1| PREDICTED: probable aquaporin PIP1-4 [Brassica rapa]
 emb|CDX74334.1| BnaA03g27130D [Brassica napus]
Length=288

 Score =   273 bits (698),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDV++GANKF E QP+GT+AQ+DKDYKEPPPAPLFEPGEL+SWSF+RAGIAEF+AT
Sbjct  2    EGKEEDVRVGANKFPERQPIGTSAQSDKDYKEPPPAPLFEPGELSSWSFWRAGIAEFIAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYIT+LTVMGVKR+  +C SVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FLARKLSLT A+FYM+M CLGAICGAGVVK
Sbjct  122  FLARKLSLTRAVFYMIMQCLGAICGAGVVK  151



>gb|KDO76246.1| hypothetical protein CISIN_1g023107mg [Citrus sinensis]
 gb|KDO76247.1| hypothetical protein CISIN_1g023107mg [Citrus sinensis]
Length=228

 Score =   271 bits (693),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDVKLGANKF E QP+GT+AQ+DKDYKEPPPAPLFEPGEL SWSFYRAGIAEF+AT
Sbjct  2    EGKEEDVKLGANKFSERQPIGTSAQSDKDYKEPPPAPLFEPGELKSWSFYRAGIAEFMAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYIT+LTVMGV +S+  C +VGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITVLTVMGVSKSNTKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
             LARKLSLT A+FYMVM CLGA+CGAGVVK
Sbjct  122  LLARKLSLTRAVFYMVMQCLGAVCGAGVVK  151



>emb|CDY51161.1| BnaA09g51960D [Brassica napus]
Length=286

 Score =   273 bits (698),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDV++GANKF E QP+GT+AQ+DKDYKEPPPAPLFEPGEL+SWSF+RAGIAEF+AT
Sbjct  2    EGKEEDVRVGANKFPERQPIGTSAQSDKDYKEPPPAPLFEPGELSSWSFWRAGIAEFIAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYIT+LTVMGVKR+  +C SVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FLARKLSLT A+FYM+M CLGAICGAGVVK
Sbjct  122  FLARKLSLTRAVFYMIMQCLGAICGAGVVK  151



>gb|EYU41266.1| hypothetical protein MIMGU_mgv1a011292mg [Erythranthe guttata]
Length=286

 Score =   273 bits (698),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 132/151 (87%), Positives = 141/151 (93%), Gaps = 1/151 (1%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQT-DKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVA  255
            ESKEEDV++GANK+ E QP+GTAAQ+ DKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVA
Sbjct  2    ESKEEDVRVGANKYSERQPIGTAAQSQDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVA  61

Query  256  TFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFG  435
            TFLFLYITILTVMGV +SD  C +VGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFG
Sbjct  62   TFLFLYITILTVMGVSKSDSKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  121

Query  436  LFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            LFLARKLSLT A+FY+VM CLGAICGAGVVK
Sbjct  122  LFLARKLSLTRAVFYIVMQCLGAICGAGVVK  152



>gb|AGT36590.1| aquaporin [Musa acuminata AAA Group]
Length=286

 Score =   273 bits (697),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 132/150 (88%), Positives = 139/150 (93%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDV+LGANKF E QP+GTAAQ+DK YKEPPPAPLFEPGELTSWSFYRAGIAEF+AT
Sbjct  2    EGKEEDVRLGANKFSERQPIGTAAQSDKGYKEPPPAPLFEPGELTSWSFYRAGIAEFMAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYITILTVMGV +S+  C +VGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITILTVMGVVKSNSKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FLARKLSLT ALFYMVM CLGAICGAGVVK
Sbjct  122  FLARKLSLTRALFYMVMQCLGAICGAGVVK  151



>gb|ABB13429.1| plasma membrane intrinsic protein [Olea europaea]
Length=285

 Score =   273 bits (697),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 131/151 (87%), Positives = 141/151 (93%), Gaps = 1/151 (1%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQT-DKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVA  255
            ESKEEDV++GANKF E QP+GTAAQ+ DKDYKEPPPAPLFEPGEL+SWSFYRAGIAEF+A
Sbjct  2    ESKEEDVRVGANKFAERQPIGTAAQSQDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFIA  61

Query  256  TFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFG  435
            TFLFLYIT+LTVMGV +SD  CK+VGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFG
Sbjct  62   TFLFLYITVLTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  121

Query  436  LFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            LFL RKLSLT A+FYMVM CLGAICGAGVVK
Sbjct  122  LFLGRKLSLTRAVFYMVMQCLGAICGAGVVK  152



>emb|CAB46350.1| major intrinsic protein 1 [Solanum tuberosum]
Length=288

 Score =   273 bits (697),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 130/152 (86%), Positives = 140/152 (92%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MAESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFV  252
            MAE+KEEDV LGANK+RETQPL TAAQTDKDYKEPPPAPLFEPGEL+SWSFYRAGIAEF+
Sbjct  1    MAENKEEDVNLGANKYRETQPLKTAAQTDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFM  60

Query  253  ATFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTF  432
            ATFLFLYITILTVMG+KRSD +C SVGIQG+AWAFGGMIFALVYCTAGIS GHINPAVT 
Sbjct  61   ATFLFLYITILTVMGLKRSDSLCSSVGIQGVAWAFGGMIFALVYCTAGISGGHINPAVTI  120

Query  433  GLFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
               L +KLSLT A+FY+VM CLGAICGAGVVK
Sbjct  121  WSVLGKKLSLTRAVFYIVMQCLGAICGAGVVK  152



>gb|ABO71659.2| trans-membrane water channel protein [Brassica juncea]
Length=288

 Score =   273 bits (697),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDV++GANKF E QP+GT+AQ+DKDYKEPPPAPLFEPGEL+SWSF+RAGIAEF+AT
Sbjct  2    EGKEEDVRVGANKFPERQPIGTSAQSDKDYKEPPPAPLFEPGELSSWSFWRAGIAEFIAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYIT+LTVMGVKR+  +C SVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FLARKLSLT A+FYM+M CLGAICGAGV+K
Sbjct  122  FLARKLSLTRAVFYMIMQCLGAICGAGVIK  151



>ref|NP_001078066.1| aquaporin PIP1-2 [Arabidopsis thaliana]
 dbj|BAH19586.1| AT2G45960 [Arabidopsis thaliana]
 gb|AEC10623.1| aquaporin PIP1-2 [Arabidopsis thaliana]
Length=274

 Score =   272 bits (695),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDV++GANKF E QP+GT+AQ+DKDYKEPPPAPLFEPGEL SWSF+RAGIAEF+AT
Sbjct  2    EGKEEDVRVGANKFPERQPIGTSAQSDKDYKEPPPAPLFEPGELASWSFWRAGIAEFIAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYIT+LTVMGVKRS  +C SVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITVLTVMGVKRSPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FLARKLSLT A++Y+VM CLGAICGAGVVK
Sbjct  122  FLARKLSLTRAVYYIVMQCLGAICGAGVVK  151



>emb|CDX91911.1| BnaC03g32130D [Brassica napus]
Length=288

 Score =   273 bits (697),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDV++GANKF E QP+GT+AQ+DKDYKEPPPAPLFEPGEL+SWSF+RAGIAEF+AT
Sbjct  2    EGKEEDVRVGANKFPERQPIGTSAQSDKDYKEPPPAPLFEPGELSSWSFWRAGIAEFIAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYIT+LTVMGVKR+  +C SVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FLARKLSLT A+FYM+M CLGA+CGAGVVK
Sbjct  122  FLARKLSLTRAVFYMIMQCLGAVCGAGVVK  151



>gb|KJB25853.1| hypothetical protein B456_004G212800 [Gossypium raimondii]
Length=217

 Score =   270 bits (689),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 130/150 (87%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDVKLGANKF E QP+GT+AQTDKDYKEPP AP FEPGEL SWSFYRAGIAEFVAT
Sbjct  2    EGKEEDVKLGANKFSERQPIGTSAQTDKDYKEPPAAPFFEPGELKSWSFYRAGIAEFVAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYIT+LTVMGV +S   C +VGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITVLTVMGVSQSKTKCATVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FLARKLSLT ALFYM+M CLGAICGAGVVK
Sbjct  122  FLARKLSLTRALFYMIMQCLGAICGAGVVK  151



>emb|CDY48920.1| BnaA09g39170D [Brassica napus]
Length=286

 Score =   272 bits (695),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDV++GANKF E QP+GT+AQ+DKDY EPPPAPLFEPGEL+SWSF+RAGIAEF+AT
Sbjct  2    EGKEEDVRVGANKFPERQPIGTSAQSDKDYNEPPPAPLFEPGELSSWSFWRAGIAEFIAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYIT+LTVMGVKRS  +C SVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITVLTVMGVKRSPNMCSSVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FLARKLSLT AL+Y+VM CLGAICGAGVVK
Sbjct  122  FLARKLSLTRALYYIVMQCLGAICGAGVVK  151



>ref|NP_001242504.1| uncharacterized protein LOC100793242 [Glycine max]
 gb|ACU24246.1| unknown [Glycine max]
Length=287

 Score =   272 bits (695),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 132/150 (88%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            ESKEEDV++GA KF E QP+GTAAQ DKDYKEPPPAPLFEPGEL SWSFYRAGIAEFVAT
Sbjct  2    ESKEEDVRVGATKFSERQPIGTAAQGDKDYKEPPPAPLFEPGELKSWSFYRAGIAEFVAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYITILTVMGV RS   C SVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITILTVMGVNRSPSKCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FLARKLSLT ALFY++M CLGAICGAGVVK
Sbjct  122  FLARKLSLTRALFYIIMQCLGAICGAGVVK  151



>gb|KDP25424.1| hypothetical protein JCGZ_20580 [Jatropha curcas]
Length=287

 Score =   272 bits (695),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 130/150 (87%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDV+LGANKF E QP+GTAAQTDKDYKEPPPAPLFEPGEL+SWSFYRAGIAEFVAT
Sbjct  2    EGKEEDVRLGANKFTERQPIGTAAQTDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFVAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYIT+LTVMGV +S   C +VG QGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITVLTVMGVSKSGNKCATVGTQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FLARKLSLT ALFY++M CLGAICGAGVVK
Sbjct  122  FLARKLSLTRALFYIIMQCLGAICGAGVVK  151



>gb|KHM99966.1| Putative aquaporin PIP1-2 [Glycine soja]
Length=287

 Score =   272 bits (695),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 132/150 (88%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            ESKEEDV++GA KF E QP+GTAAQ DKDYKEPPPAPLFEPGEL SWSFYRAGIAEFVAT
Sbjct  2    ESKEEDVRVGATKFSERQPIGTAAQGDKDYKEPPPAPLFEPGELKSWSFYRAGIAEFVAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYITILTVMGV RS   C SVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITILTVMGVNRSPSKCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FLARKLSLT ALFY++M CLGAICGAGVVK
Sbjct  122  FLARKLSLTRALFYIIMQCLGAICGAGVVK  151



>ref|XP_006396241.1| hypothetical protein EUTSA_v10028860mg [Eutrema salsugineum]
 dbj|BAJ34288.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ37694.1| hypothetical protein EUTSA_v10028860mg [Eutrema salsugineum]
Length=286

 Score =   272 bits (695),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            + KEEDV++GANKF E QP+GT+AQ+DKDYKEPPPAPLFEPGEL+SWSF+RAGIAEF+AT
Sbjct  2    DGKEEDVRVGANKFPERQPIGTSAQSDKDYKEPPPAPLFEPGELSSWSFWRAGIAEFIAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYIT+LTVMGVKR+  +C SVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FLARKLSLT A+FYM+M CLGAICGAGVVK
Sbjct  122  FLARKLSLTRAVFYMIMQCLGAICGAGVVK  151



>ref|XP_002509815.1| Aquaporin PIP1.3, putative [Ricinus communis]
 gb|EEF51202.1| Aquaporin PIP1.3, putative [Ricinus communis]
Length=287

 Score =   272 bits (695),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 130/150 (87%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDV+LGANKF E QP+GT+AQTDKDYKEPPPAPLFEPGEL+SWSFYRAGIAEF+AT
Sbjct  2    EGKEEDVRLGANKFTERQPIGTSAQTDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFMAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYIT+LTVMGV +S   C +VG QGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITVLTVMGVSKSGNKCATVGTQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FLARKLSLT ALFYMVM CLGAICGAGVVK
Sbjct  122  FLARKLSLTRALFYMVMQCLGAICGAGVVK  151



>gb|AHI54567.1| aquaporin protein 7 [Camellia japonica]
Length=286

 Score =   272 bits (695),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 133/150 (89%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDVKLGANKF E QPLGTAAQTDKDYKEPPPAPLFEPGEL SWSFYRAGIAEF+AT
Sbjct  2    EGKEEDVKLGANKFTERQPLGTAAQTDKDYKEPPPAPLFEPGELKSWSFYRAGIAEFMAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYIT+LTVMGV R+   C SVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITLLTVMGVVRAPTKCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FLARKLSLT A+FY+VM CLGAICGAGVVK
Sbjct  122  FLARKLSLTRAVFYIVMQCLGAICGAGVVK  151



>gb|KCW77504.1| hypothetical protein EUGRSUZ_D01836 [Eucalyptus grandis]
Length=255

 Score =   271 bits (692),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDV+LGANKF E QP+GT+AQTDKDYKEPPPAPLFEPGEL SWSFYRAGIAEFVAT
Sbjct  2    EGKEEDVRLGANKFSERQPIGTSAQTDKDYKEPPPAPLFEPGELQSWSFYRAGIAEFVAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYIT+LTVMGV +S   C +VG+QGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITVLTVMGVSQSKTKCTTVGVQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FLARKLSLT A+FY++M CLGAICGAGVVK
Sbjct  122  FLARKLSLTRAVFYIIMQCLGAICGAGVVK  151



>gb|KDO76245.1| hypothetical protein CISIN_1g023107mg [Citrus sinensis]
Length=257

 Score =   271 bits (692),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDVKLGANKF E QP+GT+AQ+DKDYKEPPPAPLFEPGEL SWSFYRAGIAEF+AT
Sbjct  2    EGKEEDVKLGANKFSERQPIGTSAQSDKDYKEPPPAPLFEPGELKSWSFYRAGIAEFMAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYIT+LTVMGV +S+  C +VGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITVLTVMGVSKSNTKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
             LARKLSLT A+FYMVM CLGA+CGAGVVK
Sbjct  122  LLARKLSLTRAVFYMVMQCLGAVCGAGVVK  151



>gb|AFQ98315.1| MIP2 [Eutrema halophilum]
Length=284

 Score =   271 bits (694),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            + KEEDV++GANKF E QP+GT+AQ+DKDYKEPPPAPLFEPGEL+SWSF+RAGIAEF+AT
Sbjct  2    DGKEEDVRVGANKFPERQPIGTSAQSDKDYKEPPPAPLFEPGELSSWSFWRAGIAEFIAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYIT+LTVMGVKR+  +C SVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FLARKLSLT A+FYM+M CLGAICGAGVVK
Sbjct  122  FLARKLSLTRAVFYMIMQCLGAICGAGVVK  151



>gb|AEA40492.1| aquaporin PIP1-4 [Brassica oleracea var. italica]
Length=280

 Score =   271 bits (694),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDV++GANKF E QP+GT+AQ+DKDYKEPPPAPLFEPGEL SWSF+RAGIAEF+AT
Sbjct  1    EGKEEDVRVGANKFPERQPIGTSAQSDKDYKEPPPAPLFEPGELASWSFWRAGIAEFIAT  60

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYIT+LTVMGVKRS  +C SVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  61   FLFLYITVLTVMGVKRSPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  120

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FLARKLSLT A++Y+VM CLGAICGAGVVK
Sbjct  121  FLARKLSLTRAVYYIVMQCLGAICGAGVVK  150



>dbj|BAA32777.1| plasma membrane aquaporin (PAQ1) [Raphanus sativus]
Length=286

 Score =   271 bits (694),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDV++GANKF E QP+GT+AQ+DKDY EPPPAPLFEPGEL+SWSF+RAGIAEF+AT
Sbjct  2    EGKEEDVRVGANKFPERQPIGTSAQSDKDYNEPPPAPLFEPGELSSWSFWRAGIAEFIAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYIT+LTVMGVKRS  +C SVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITVLTVMGVKRSPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FLARKLSLT AL+Y+VM CLGAICGAGVVK
Sbjct  122  FLARKLSLTRALYYIVMQCLGAICGAGVVK  151



>gb|KCW77503.1| hypothetical protein EUGRSUZ_D01836 [Eucalyptus grandis]
Length=217

 Score =   269 bits (688),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDV+LGANKF E QP+GT+AQTDKDYKEPPPAPLFEPGEL SWSFYRAGIAEFVAT
Sbjct  2    EGKEEDVRLGANKFSERQPIGTSAQTDKDYKEPPPAPLFEPGELQSWSFYRAGIAEFVAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYIT+LTVMGV +S   C +VG+QGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITVLTVMGVSQSKTKCTTVGVQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FLARKLSLT A+FY++M CLGAICGAGVVK
Sbjct  122  FLARKLSLTRAVFYIIMQCLGAICGAGVVK  151



>ref|XP_010533655.1| PREDICTED: aquaporin PIP1-3-like [Tarenaya hassleriana]
Length=286

 Score =   271 bits (694),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 131/150 (87%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            ESKEEDV+LGANKF E QP+GTAAQT KDYKEPPPAPL EP EL SWSFYRAGIAEF+AT
Sbjct  2    ESKEEDVRLGANKFSERQPIGTAAQTGKDYKEPPPAPLIEPSELKSWSFYRAGIAEFMAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYITILTVMGVKRS  +C SVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITILTVMGVKRSPSMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
             LARKLSLT A+FYM+M CLGAICGAGVVK
Sbjct  122  LLARKLSLTRAVFYMIMQCLGAICGAGVVK  151



>emb|CDX71738.1| BnaC08g31360D [Brassica napus]
Length=286

 Score =   271 bits (694),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDV++GANKF E QP+GT+AQ+DKDY EPPPAPLFEPGEL+SWSF+RAGIAEF+AT
Sbjct  2    EGKEEDVRVGANKFPERQPIGTSAQSDKDYNEPPPAPLFEPGELSSWSFWRAGIAEFIAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYIT+LTVMGVKRS  +C SVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITVLTVMGVKRSPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FLARKLSLT AL+Y+VM CLGAICGAGVVK
Sbjct  122  FLARKLSLTRALYYIVMQCLGAICGAGVVK  151



>ref|XP_010508083.1| PREDICTED: aquaporin PIP1-2-like isoform X1 [Camelina sativa]
Length=286

 Score =   271 bits (694),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDV++GANKF E QP+GT+AQ+DKDYKEPPPAPLFEPGEL SWSF+RAGIAEF+AT
Sbjct  2    EGKEEDVRVGANKFPERQPIGTSAQSDKDYKEPPPAPLFEPGELASWSFWRAGIAEFIAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYIT+LTVMGVKRS  +C SVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITVLTVMGVKRSPSMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FLARKLSLT A++Y+VM CLGAICGAGVVK
Sbjct  122  FLARKLSLTRAVYYIVMQCLGAICGAGVVK  151



>gb|AAG23179.1|AF299050_1 aquaporin PIP1b1 [Brassica oleracea]
 emb|CDY18886.1| BnaC04g04640D [Brassica napus]
Length=286

 Score =   271 bits (694),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDV++GANKF E QP+GT+AQ+DKDYKEPPPAPLFEPGEL SWSF+RAGIAEF+AT
Sbjct  2    EGKEEDVRVGANKFPERQPIGTSAQSDKDYKEPPPAPLFEPGELASWSFWRAGIAEFIAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYIT+LTVMGVKRS  +C SVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITVLTVMGVKRSPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FLARKLSLT A++Y+VM CLGAICGAGVVK
Sbjct  122  FLARKLSLTRAVYYIVMQCLGAICGAGVVK  151



>ref|XP_002872953.1| hypothetical protein ARALYDRAFT_912203 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49212.1| hypothetical protein ARALYDRAFT_912203 [Arabidopsis lyrata subsp. 
lyrata]
Length=287

 Score =   271 bits (694),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 130/151 (86%), Positives = 141/151 (93%), Gaps = 1/151 (1%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQ-TDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVA  255
            E KEEDV++GANKF E QP+GT+AQ TDKDYKEPPPAPLFEPGEL+SWSFYRAGIAEF+A
Sbjct  2    EGKEEDVRVGANKFPERQPIGTSAQSTDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFIA  61

Query  256  TFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFG  435
            TFLFLYIT+LTVMGVKR+  +C SVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFG
Sbjct  62   TFLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  121

Query  436  LFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            LFLARKLSLT A+FYM+M CLGAICGAGVVK
Sbjct  122  LFLARKLSLTRAVFYMIMQCLGAICGAGVVK  152



>dbj|BAA92258.1| plasma membrane aquaporin 1b [Raphanus sativus]
 gb|AHV84996.1| aquaporin [Brassica rapa]
 emb|CDX74777.1| BnaA05g05230D [Brassica napus]
Length=286

 Score =   271 bits (694),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDV++GANKF E QP+GT+AQ+DKDYKEPPPAPLFEPGEL SWSF+RAGIAEF+AT
Sbjct  2    EGKEEDVRVGANKFPERQPIGTSAQSDKDYKEPPPAPLFEPGELASWSFWRAGIAEFIAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYIT+LTVMGVKRS  +C SVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITVLTVMGVKRSPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FLARKLSLT A++Y+VM CLGAICGAGVVK
Sbjct  122  FLARKLSLTRAVYYIVMQCLGAICGAGVVK  151



>gb|AAB61378.1| aquaporin [Brassica rapa subsp. oleifera]
 emb|CDX83385.1| BnaA03g21210D [Brassica napus]
Length=286

 Score =   271 bits (694),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDV++GANKF E QP+GT+AQ+DKDYKEPPPAPLFEPGEL SWSF+RAGIAEF+AT
Sbjct  2    EGKEEDVRVGANKFPERQPIGTSAQSDKDYKEPPPAPLFEPGELASWSFWRAGIAEFIAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYIT+LTVMGVKRS  +C SVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITVLTVMGVKRSPSMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FLARKLSLT A++Y+VM CLGAICGAGVVK
Sbjct  122  FLARKLSLTRAVYYIVMQCLGAICGAGVVK  151



>ref|NP_182120.1| aquaporin PIP1-2 [Arabidopsis thaliana]
 ref|XP_006397781.1| hypothetical protein EUTSA_v10001573mg [Eutrema salsugineum]
 sp|Q06611.1|PIP12_ARATH RecName: Full=Aquaporin PIP1-2; Short=AtPIP1;2; AltName: Full=Plasma 
membrane intrinsic protein 1b; Short=PIP1b; AltName: 
Full=Transmembrane protein A; Short=AthH2; Short=TMP-A [Arabidopsis 
thaliana]
 emb|CAA48356.1| transmembrane protein [Arabidopsis thaliana]
 gb|AAC28529.1| aquaporin (plasma membrane intrinsic protein 1B) [Arabidopsis 
thaliana]
 gb|AAK82556.1| At2g45960/F4I18.6 [Arabidopsis thaliana]
 gb|AAL36287.1| putative aquaporin, plasma membrane intrinsic protein 1B [Arabidopsis 
thaliana]
 gb|AAM14193.1| putative aquaporin protein [Arabidopsis thaliana]
 gb|ADJ21813.1| aquaporin [Arabidopsis thaliana]
 gb|AEC10622.1| aquaporin PIP1-2 [Arabidopsis thaliana]
 gb|AFT64208.1| MIP4 [Eutrema halophilum]
 gb|ESQ39234.1| hypothetical protein EUTSA_v10001573mg [Eutrema salsugineum]
Length=286

 Score =   271 bits (693),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDV++GANKF E QP+GT+AQ+DKDYKEPPPAPLFEPGEL SWSF+RAGIAEF+AT
Sbjct  2    EGKEEDVRVGANKFPERQPIGTSAQSDKDYKEPPPAPLFEPGELASWSFWRAGIAEFIAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYIT+LTVMGVKRS  +C SVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITVLTVMGVKRSPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FLARKLSLT A++Y+VM CLGAICGAGVVK
Sbjct  122  FLARKLSLTRAVYYIVMQCLGAICGAGVVK  151



>ref|NP_567178.1| plasma membrane intrinsic protein 1;4 [Arabidopsis thaliana]
 sp|Q39196.1|PIP14_ARATH RecName: Full=Probable aquaporin PIP1-4; AltName: Full=Plasma 
membrane intrinsic protein 1-4; Short=AtPIP1;4; AltName: Full=Transmembrane 
protein C; Short=TMP-C [Arabidopsis thaliana]
 dbj|BAA05654.1| transmembrane protein [Arabidopsis thaliana]
 gb|AAM20676.1| probable plasma membrane intrinsic protein 1c [Arabidopsis thaliana]
 gb|AAM53343.1| probable plasma membrane intrinsic protein 1c [Arabidopsis thaliana]
 gb|AAN15649.1| probable plasma membrane intrinsic protein 1c [Arabidopsis thaliana]
 gb|AAP13421.1| At4g00430 [Arabidopsis thaliana]
 gb|AEE81879.1| plasma membrane intrinsic protein 1;4 [Arabidopsis thaliana]
Length=287

 Score =   271 bits (694),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 130/151 (86%), Positives = 141/151 (93%), Gaps = 1/151 (1%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQ-TDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVA  255
            E KEEDV++GANKF E QP+GT+AQ TDKDYKEPPPAPLFEPGEL+SWSFYRAGIAEF+A
Sbjct  2    EGKEEDVRVGANKFPERQPIGTSAQSTDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFIA  61

Query  256  TFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFG  435
            TFLFLYIT+LTVMGVKR+  +C SVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFG
Sbjct  62   TFLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  121

Query  436  LFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            LFLARKLSLT A+FYM+M CLGAICGAGVVK
Sbjct  122  LFLARKLSLTRAVFYMIMQCLGAICGAGVVK  152



>ref|XP_009118823.1| PREDICTED: aquaporin PIP1-3 [Brassica rapa]
Length=286

 Score =   271 bits (693),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDV++GANKF E QP+GT+AQ+DKDYKEPPPAPLFEPGEL+SWSF+RAGIAEF+AT
Sbjct  2    EGKEEDVRVGANKFPERQPIGTSAQSDKDYKEPPPAPLFEPGELSSWSFWRAGIAEFIAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYIT+LTVMGVKR+  +C SVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FLARKLSLT A+FY+VM CLGA+CGAGVVK
Sbjct  122  FLARKLSLTRAVFYIVMQCLGAVCGAGVVK  151



>ref|XP_010506589.1| PREDICTED: aquaporin PIP1-2 [Camelina sativa]
 ref|XP_010518252.1| PREDICTED: aquaporin PIP1-2 isoform X1 [Camelina sativa]
Length=286

 Score =   271 bits (693),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDV++GANKF E QP+GT+AQ+DKDYKEPPPAPLFEPGEL SWSF+RAGIAEF+AT
Sbjct  2    EGKEEDVRVGANKFPERQPIGTSAQSDKDYKEPPPAPLFEPGELASWSFWRAGIAEFIAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYIT+LTVMGVKRS  +C SVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITVLTVMGVKRSPSMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FLARKLSLT A++Y+VM CLGAICGAGVVK
Sbjct  122  FLARKLSLTRAVYYIVMQCLGAICGAGVVK  151



>gb|AGG39696.1| aquaporin protein AQU18 [Camellia sinensis]
Length=286

 Score =   271 bits (693),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 132/150 (88%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDVKLGANKF E QP+GTAAQTDKDYKEPPPAPLFEPGEL SWSFYRAGIAEF+AT
Sbjct  2    EGKEEDVKLGANKFTERQPIGTAAQTDKDYKEPPPAPLFEPGELKSWSFYRAGIAEFMAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYIT+LTVMGV R+   C SVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITLLTVMGVVRAPTKCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FLARKLSLT A+FY+VM CLGAICGAGVVK
Sbjct  122  FLARKLSLTRAVFYIVMQCLGAICGAGVVK  151



>gb|KJB25855.1| hypothetical protein B456_004G212800 [Gossypium raimondii]
Length=236

 Score =   269 bits (688),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 130/150 (87%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDVKLGANKF E QP+GT+AQTDKDYKEPP AP FEPGEL SWSFYRAGIAEFVAT
Sbjct  2    EGKEEDVKLGANKFSERQPIGTSAQTDKDYKEPPAAPFFEPGELKSWSFYRAGIAEFVAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYIT+LTVMGV +S   C +VGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITVLTVMGVSQSKTKCATVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FLARKLSLT ALFYM+M CLGAICGAGVVK
Sbjct  122  FLARKLSLTRALFYMIMQCLGAICGAGVVK  151



>gb|AAT74898.1| plasma membrane intrinsic protein PIP1-1 [Fraxinus excelsior]
Length=286

 Score =   271 bits (693),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 130/151 (86%), Positives = 140/151 (93%), Gaps = 1/151 (1%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQT-DKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVA  255
            ESKEEDV++GANKF E QP+GTAAQ+ DKDYKEPPPAPLF+PGEL+SWSFYRAGIAEF+A
Sbjct  2    ESKEEDVRVGANKFNERQPIGTAAQSQDKDYKEPPPAPLFDPGELSSWSFYRAGIAEFIA  61

Query  256  TFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFG  435
            TFLFLYI ILTVMGV +SD  C +VGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFG
Sbjct  62   TFLFLYIAILTVMGVSKSDSKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  121

Query  436  LFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            LFLARKLSLT A+FYMVM CLGAICGAGVVK
Sbjct  122  LFLARKLSLTRAIFYMVMQCLGAICGAGVVK  152



>ref|XP_009138772.1| PREDICTED: aquaporin PIP1-1 [Brassica rapa]
Length=286

 Score =   271 bits (693),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEED+++GANKF E QP+GT+AQ+DKDY EPPPAPLFEPGEL+SWSF+RAGIAEF+AT
Sbjct  2    EGKEEDIRVGANKFPERQPIGTSAQSDKDYNEPPPAPLFEPGELSSWSFWRAGIAEFIAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYIT+LTVMGVKRS  +C SVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITVLTVMGVKRSPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FLARKLSLT AL+Y+VM CLGAICGAGVVK
Sbjct  122  FLARKLSLTRALYYIVMQCLGAICGAGVVK  151



>emb|CAA64895.1| transmembrane channel protein [Brassica oleracea]
Length=286

 Score =   271 bits (692),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDV++GANKF E QP+GT+AQ+DKDYKEPPPAPLFEPGEL SWSF+RAGIAEF+AT
Sbjct  2    EGKEEDVRVGANKFPERQPIGTSAQSDKDYKEPPPAPLFEPGELASWSFWRAGIAEFIAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYIT+LTVMGVKRS  +C SVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITVLTVMGVKRSPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FLARKLS+T A++Y+VM CLGAICGAGVVK
Sbjct  122  FLARKLSMTRAVYYIVMQCLGAICGAGVVK  151



>gb|ACB38232.1| aquaporin [Gerbera hybrid cultivar]
Length=287

 Score =   271 bits (692),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 130/150 (87%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDVKLGANKF E QP+GT+AQTDKDYKEPPPAPLFEPGEL+SWSFYRAGIAEF+AT
Sbjct  2    EGKEEDVKLGANKFSERQPIGTSAQTDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFIAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYI++LTVMGV +S   C +VGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYISVLTVMGVAKSPTKCGTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
             LARKLSLT ALFYMVM CLGAICGAGVVK
Sbjct  122  LLARKLSLTRALFYMVMQCLGAICGAGVVK  151



>gb|AAF02782.1|AF195115_2 Similar to transmembrane protein; coded for by A. thaliana cDNA 
H36862; coded for by A. thaliana cDNA H37637; coded for by 
A. thaliana cDNA T04371; coded for by A. thaliana cDNA T41850; 
coded for by A. thaliana cDNA R84071; coded for by A. thaliana 
cDNA T13717; coded for by A. thaliana cDNA T43049; coded 
for by A. thaliana cDNA T43789; coded for by A. thaliana 
cDNA N37205 [Arabidopsis thaliana]
 gb|AAB62824.1| Similar to transmembrane protein; coded for by A. thaliana cDNA 
H37637; coded for by A. thaliana cDNA T41850; coded for by 
A. thaliana cDNA T13717; coded for by A. thaliana cDNA T04371; 
coded for by A. thaliana cDNA T43789; coded for by A. thaliana 
cDNA N37205; coded for by A. thaliana cDNA R84071; coded 
for by A. thaliana cDNA H36862; coded for by A. thaliana 
cDNA T43049 [Arabidopsis thaliana]
 emb|CAB80801.1| probable plasma membrane intrinsic protein 1c [Arabidopsis thaliana]
Length=295

 Score =   271 bits (693),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 130/151 (86%), Positives = 141/151 (93%), Gaps = 1/151 (1%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQ-TDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVA  255
            E KEEDV++GANKF E QP+GT+AQ TDKDYKEPPPAPLFEPGEL+SWSFYRAGIAEF+A
Sbjct  2    EGKEEDVRVGANKFPERQPIGTSAQSTDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFIA  61

Query  256  TFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFG  435
            TFLFLYIT+LTVMGVKR+  +C SVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFG
Sbjct  62   TFLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  121

Query  436  LFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            LFLARKLSLT A+FYM+M CLGAICGAGVVK
Sbjct  122  LFLARKLSLTRAVFYMIMQCLGAICGAGVVK  152



>gb|ADE34281.1| aquaporin PIP1;12, partial [Gossypium hirsutum]
Length=267

 Score =   270 bits (690),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 130/150 (87%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDVKLGANKF E QP+GT+AQTDKDYKEPPPAPLFEPGEL SWSFYRAGIAEFVAT
Sbjct  2    EGKEEDVKLGANKFSERQPIGTSAQTDKDYKEPPPAPLFEPGELKSWSFYRAGIAEFVAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYIT+LTVMGV +S   C +VGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITVLTVMGVSQSKTKCTTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
             LARKLSLT A+FYM+M CLGAICGAGVVK
Sbjct  122  LLARKLSLTRAVFYMIMQCLGAICGAGVVK  151



>gb|EYU19988.1| hypothetical protein MIMGU_mgv1a011277mg [Erythranthe guttata]
Length=287

 Score =   271 bits (692),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 130/151 (86%), Positives = 140/151 (93%), Gaps = 1/151 (1%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQT-DKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVA  255
            ESKEEDV++GAN+F E QP+GTAAQT DKDYKEPPPAPLFEPGEL SWSFYRAGIAEFVA
Sbjct  2    ESKEEDVRVGANRFDERQPIGTAAQTQDKDYKEPPPAPLFEPGELASWSFYRAGIAEFVA  61

Query  256  TFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFG  435
            TFLFLYIT+LTVMGV +S+  C +VGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFG
Sbjct  62   TFLFLYITVLTVMGVSKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  121

Query  436  LFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            LFLARKLSLT A++YMVM CLGAICGAGVVK
Sbjct  122  LFLARKLSLTRAVYYMVMQCLGAICGAGVVK  152



>gb|AGD98710.1| aquaporin protein 7 [Camellia sinensis]
Length=286

 Score =   271 bits (692),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 132/150 (88%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDVKLGANKF E QP+GTAAQTDKDYKEPPPAPLFEPGEL SWSFYRAGIAEF+AT
Sbjct  2    EGKEEDVKLGANKFTERQPIGTAAQTDKDYKEPPPAPLFEPGELKSWSFYRAGIAEFMAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYIT+LTVMGV R+   C SVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITLLTVMGVVRAPTKCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FLARKLSLT A+FY+VM CLGAICGAGVVK
Sbjct  122  FLARKLSLTRAVFYIVMQCLGAICGAGVVK  151



>ref|XP_006294736.1| hypothetical protein CARUB_v10023782mg [Capsella rubella]
 gb|EOA27634.1| hypothetical protein CARUB_v10023782mg [Capsella rubella]
Length=286

 Score =   271 bits (692),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDV++GANKF E QP+GT+AQ+DKDYKEPPPAPLFEPGE+ SWSF+RAGIAEF+AT
Sbjct  2    EGKEEDVRVGANKFPERQPIGTSAQSDKDYKEPPPAPLFEPGEIASWSFWRAGIAEFIAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYIT+LTVMGVKRS  +C SVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITVLTVMGVKRSPSMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FLARKLSLT A++Y+VM CLGAICGAGVVK
Sbjct  122  FLARKLSLTRAVYYIVMQCLGAICGAGVVK  151



>gb|KHG25052.1| putative aquaporin PIP1-2 [Gossypium arboreum]
Length=287

 Score =   271 bits (692),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 130/150 (87%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDVKLGANKF E QP+GT+AQTDKDYKEPPPAPLFEPGEL SWSFYRAGIAEFVAT
Sbjct  2    EGKEEDVKLGANKFSERQPIGTSAQTDKDYKEPPPAPLFEPGELKSWSFYRAGIAEFVAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYIT+LTVMGV +S   C +VGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITVLTVMGVSQSKTKCTTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
             LARKLSLT A+FYM+M CLGAICGAGVVK
Sbjct  122  LLARKLSLTRAVFYMIMQCLGAICGAGVVK  151



>gb|ABD63904.1| aquaporin 1 [Gossypium hirsutum]
 gb|KJB20655.1| hypothetical protein B456_003G158100 [Gossypium raimondii]
Length=287

 Score =   271 bits (692),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 130/150 (87%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDVKLGANKF E QP+GT+AQTDKDYKEPPPAPLFEPGEL SWSFYRAGIAEFVAT
Sbjct  2    EGKEEDVKLGANKFSERQPIGTSAQTDKDYKEPPPAPLFEPGELKSWSFYRAGIAEFVAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYIT+LTVMGV +S   C +VGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITVLTVMGVSQSKTKCTTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
             LARKLSLT A+FYM+M CLGAICGAGVVK
Sbjct  122  LLARKLSLTRAVFYMIMQCLGAICGAGVVK  151



>emb|CDX95670.1| BnaC03g25510D [Brassica napus]
Length=286

 Score =   271 bits (692),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDV++GANKF E QP+GT+AQ+DKDYKEPPPAPLFEPGEL SWSF+RAGIAEF+AT
Sbjct  2    EGKEEDVRVGANKFPERQPIGTSAQSDKDYKEPPPAPLFEPGELASWSFWRAGIAEFIAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYIT+LTVMGVKRS  +C SVGIQGIAWAFGGMIFALVYCTAG+S GHINPAVTFGL
Sbjct  62   FLFLYITVLTVMGVKRSPSMCASVGIQGIAWAFGGMIFALVYCTAGVSGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FLARKLSLT A++Y+VM CLGAICGAGVVK
Sbjct  122  FLARKLSLTRAVYYIVMQCLGAICGAGVVK  151



>ref|XP_002880210.1| hypothetical protein ARALYDRAFT_483737 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56469.1| hypothetical protein ARALYDRAFT_483737 [Arabidopsis lyrata subsp. 
lyrata]
Length=286

 Score =   271 bits (692),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDV++GANKF E QP+GT+AQ+DKDYKEPPPAPLFEPGE+ SWSF+RAGIAEF+AT
Sbjct  2    EGKEEDVRVGANKFPERQPIGTSAQSDKDYKEPPPAPLFEPGEIASWSFWRAGIAEFIAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYIT+LTVMGVKRS  +C SVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITVLTVMGVKRSPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FLARKLSLT A++Y+VM CLGAICGAGVVK
Sbjct  122  FLARKLSLTRAVYYIVMQCLGAICGAGVVK  151



>gb|ACA50530.1| putative aquaporin [Brassica napus]
Length=286

 Score =   270 bits (691),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E +EEDV++GANKF E QP+GT+AQ+DKDYKEPPPAPLFEPGEL SWSF+RAGIAEF+AT
Sbjct  2    EGREEDVRVGANKFPERQPIGTSAQSDKDYKEPPPAPLFEPGELASWSFWRAGIAEFIAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYIT+LTVMGVKRS  +C SVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITVLTVMGVKRSPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FLARKLSLT A++Y+VM CLGAICGAGVVK
Sbjct  122  FLARKLSLTRAVYYIVMQCLGAICGAGVVK  151



>gb|KEH21073.1| major intrinsic protein (MIP) family transporter [Medicago truncatula]
Length=235

 Score =   269 bits (687),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 132/149 (89%), Positives = 137/149 (92%), Gaps = 1/149 (1%)
 Frame = +1

Query  85   KEEDVKLGANKFRETQPLGTAAQTD-KDYKEPPPAPLFEPGELTSWSFYRAGIAEFVATF  261
            KEEDVK+GANKF E QPLGTAAQ+D KDYKEPPPAPLFEPGEL SWSFYRAGIAEFVATF
Sbjct  3    KEEDVKVGANKFSERQPLGTAAQSDSKDYKEPPPAPLFEPGELKSWSFYRAGIAEFVATF  62

Query  262  LFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGLF  441
            LFLYITILTVMGV RS   C SVGIQGIAW+FGGMIFALVYCTAGIS GHINPAVTFGLF
Sbjct  63   LFLYITILTVMGVNRSTSKCSSVGIQGIAWSFGGMIFALVYCTAGISGGHINPAVTFGLF  122

Query  442  LARKLSLTXALFYMVMXCLGAICGAGVVK  528
            LARKLSLT A+FY+VM CLGAICGAGVVK
Sbjct  123  LARKLSLTRAIFYIVMQCLGAICGAGVVK  151



>ref|XP_006418439.1| hypothetical protein EUTSA_v10008397mg [Eutrema salsugineum]
 gb|ESQ36792.1| hypothetical protein EUTSA_v10008397mg [Eutrema salsugineum]
Length=286

 Score =   270 bits (691),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDV++GANK+ E QP+GT+AQTDKDYKEPPPAPLFEPGEL+SWSF+RAGIAEF+AT
Sbjct  2    EGKEEDVRVGANKYPERQPIGTSAQTDKDYKEPPPAPLFEPGELSSWSFWRAGIAEFIAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYIT+LTVMGVKR+  +C SVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
             LARKLSL+ A+FYMVM CLGAICGAGVVK
Sbjct  122  LLARKLSLSRAVFYMVMQCLGAICGAGVVK  151



>gb|ADE34282.1| aquaporin PIP1;13 [Gossypium hirsutum]
Length=267

 Score =   270 bits (690),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 130/150 (87%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDVKLGANKF E QP+GT+AQTDKDYKEPPPAPLFEPGEL SWSFYRAGIAEFVAT
Sbjct  2    EGKEEDVKLGANKFSERQPIGTSAQTDKDYKEPPPAPLFEPGELKSWSFYRAGIAEFVAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYIT+LTVMGV +S   C +VGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITVLTVMGVSQSKTKCTTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
             LARKLSLT A+FYM+M CLGAICGAGVVK
Sbjct  122  LLARKLSLTRAVFYMIMQCLGAICGAGVVK  151



>ref|XP_006439529.1| hypothetical protein CICLE_v10021502mg [Citrus clementina]
 gb|ESR52769.1| hypothetical protein CICLE_v10021502mg [Citrus clementina]
Length=287

 Score =   270 bits (691),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 129/150 (86%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDVKLGANKF E QP+GT+AQ+DKDYKEPPPAPLFEPGEL SWSFYRAGIAEF+AT
Sbjct  2    EGKEEDVKLGANKFSERQPIGTSAQSDKDYKEPPPAPLFEPGELKSWSFYRAGIAEFMAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYIT+LTVMGV +S+  C +VGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITVLTVMGVSKSNTKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
             LARKLSLT A+FYMVM CLGAICGAGVVK
Sbjct  122  LLARKLSLTRAVFYMVMQCLGAICGAGVVK  151



>ref|XP_010518253.1| PREDICTED: aquaporin PIP1-2 isoform X2 [Camelina sativa]
Length=289

 Score =   271 bits (692),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDV++GANKF E QP+GT+AQ+DKDYKEPPPAPLFEPGEL SWSF+RAGIAEF+AT
Sbjct  2    EGKEEDVRVGANKFPERQPIGTSAQSDKDYKEPPPAPLFEPGELASWSFWRAGIAEFIAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYIT+LTVMGVKRS  +C SVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITVLTVMGVKRSPSMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FLARKLSLT A++Y+VM CLGAICGAGVVK
Sbjct  122  FLARKLSLTRAVYYIVMQCLGAICGAGVVK  151



>gb|AEA40490.1| aquaporin PIP1-2 [Brassica oleracea var. italica]
Length=280

 Score =   270 bits (691),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDV++GANKF E QP+GT+AQ+DKDYKEPPPAPLFEPGEL SWSF+RAGIAEF+AT
Sbjct  1    EGKEEDVRVGANKFPERQPIGTSAQSDKDYKEPPPAPLFEPGELASWSFWRAGIAEFIAT  60

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYIT+LTVMGVKR+  +C SVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  61   FLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  120

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FLARKLSLT A++Y+VM CLGAICGAGVVK
Sbjct  121  FLARKLSLTRAVYYIVMQCLGAICGAGVVK  150



>tpg|DAA33858.1| TPA_inf: aquaporin PIP1;4 [Gossypium hirsutum]
Length=287

 Score =   270 bits (691),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 130/150 (87%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDVKLGANKF E QP+GT+AQTDKDYKEPPPAPLFEPGEL SWSFYRAGIAEFVAT
Sbjct  2    EGKEEDVKLGANKFSERQPIGTSAQTDKDYKEPPPAPLFEPGELKSWSFYRAGIAEFVAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYIT+LTVMGV +S   C +VGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITVLTVMGVSQSKTKCTTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
             LARKLSLT A+FYM+M CLGAICGAGVVK
Sbjct  122  LLARKLSLTRAVFYMIMQCLGAICGAGVVK  151



>emb|CDX90046.1| BnaA10g00360D [Brassica napus]
Length=286

 Score =   270 bits (691),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDV++GANKF E QP+GT+AQTDKDYKEPPPAPLFEPGEL+SWSF+RAGIAEF+AT
Sbjct  2    EGKEEDVRVGANKFPERQPIGTSAQTDKDYKEPPPAPLFEPGELSSWSFWRAGIAEFIAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYIT+LTVMGVKR+  +C SVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FLARKLSLT A+ Y+VM CLGA+CGAGVVK
Sbjct  122  FLARKLSLTRAVLYIVMQCLGAVCGAGVVK  151



>gb|AAG23180.1|AF299051_1 aquaporin PIP1b2 [Brassica oleracea]
Length=286

 Score =   270 bits (691),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDV++GANKF E QP+GT+AQ+DKDYKEPPPAPLFEPGEL SWSF+RAGIAEF+AT
Sbjct  2    EGKEEDVRVGANKFPERQPIGTSAQSDKDYKEPPPAPLFEPGELASWSFWRAGIAEFIAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYIT+LTVMGVKR+  +C SVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FLARKLSLT A++Y+VM CLGAICGAGVVK
Sbjct  122  FLARKLSLTRAVYYIVMQCLGAICGAGVVK  151



>emb|CAA64896.1| transmembrane channel protein [Brassica oleracea]
 dbj|BAA92259.1| plasma membrane aquaporin 1c [Raphanus sativus]
 gb|ABD84431.1| aquaporin PIP1 [Noccaea caerulescens]
 emb|CDY37078.1| BnaA04g26560D [Brassica napus]
 emb|CDY27346.1| BnaC04g50590D [Brassica napus]
Length=286

 Score =   270 bits (691),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDV++GANKF E QP+GT+AQ+DKDYKEPPPAPLFEPGEL SWSF+RAGIAEF+AT
Sbjct  2    EGKEEDVRVGANKFPERQPIGTSAQSDKDYKEPPPAPLFEPGELASWSFWRAGIAEFIAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYIT+LTVMGVKR+  +C SVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FLARKLSLT A++Y+VM CLGAICGAGVVK
Sbjct  122  FLARKLSLTRAVYYIVMQCLGAICGAGVVK  151



>gb|KFK37381.1| hypothetical protein AALP_AA4G249600 [Arabis alpina]
Length=286

 Score =   270 bits (691),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDV++GANKF E QP+GT+AQ+DKDYKEPPPAPLFEPGEL SWSF+RAGIAEF+AT
Sbjct  2    EGKEEDVRVGANKFPERQPIGTSAQSDKDYKEPPPAPLFEPGELASWSFWRAGIAEFIAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYIT+LTVMGVKR+  +C SVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FLARKLSLT A++Y+VM CLGAICGAGVVK
Sbjct  122  FLARKLSLTRAVYYIVMQCLGAICGAGVVK  151



>ref|XP_010508084.1| PREDICTED: aquaporin PIP1-2-like isoform X2 [Camelina sativa]
Length=289

 Score =   270 bits (691),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDV++GANKF E QP+GT+AQ+DKDYKEPPPAPLFEPGEL SWSF+RAGIAEF+AT
Sbjct  2    EGKEEDVRVGANKFPERQPIGTSAQSDKDYKEPPPAPLFEPGELASWSFWRAGIAEFIAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYIT+LTVMGVKRS  +C SVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITVLTVMGVKRSPSMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FLARKLSLT A++Y+VM CLGAICGAGVVK
Sbjct  122  FLARKLSLTRAVYYIVMQCLGAICGAGVVK  151



>gb|AEA40491.1| aquaporin PIP1-3 [Brassica oleracea var. italica]
Length=280

 Score =   270 bits (690),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDV++GANKF E QP+GT+AQ+DKDYKEPPPAPLFEPGEL SWSF+RAGIAEF+AT
Sbjct  1    EGKEEDVRVGANKFPERQPIGTSAQSDKDYKEPPPAPLFEPGELASWSFWRAGIAEFIAT  60

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYIT+LTVMGVKR+  +C SVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  61   FLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  120

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FLARKLSLT A++Y+VM CLGAICGAGVVK
Sbjct  121  FLARKLSLTRAVYYIVMQCLGAICGAGVVK  150



>gb|AEA40489.1| aquaporin PIP1-1 [Brassica oleracea var. italica]
Length=280

 Score =   270 bits (690),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDV++GANKF E QP+GT+AQ+DKDYKEPPPAPLFEPGEL SWSF+RAGIAEF+AT
Sbjct  1    EGKEEDVRVGANKFPERQPIGTSAQSDKDYKEPPPAPLFEPGELASWSFWRAGIAEFIAT  60

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYIT+LTVMGVKR+  +C SVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  61   FLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  120

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FLARKLSLT A++Y+VM CLGAICGAGVVK
Sbjct  121  FLARKLSLTRAVYYIVMQCLGAICGAGVVK  150



>ref|XP_009420459.1| PREDICTED: probable aquaporin PIP1-2 [Musa acuminata subsp. malaccensis]
Length=287

 Score =   270 bits (690),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 133/151 (88%), Positives = 139/151 (92%), Gaps = 1/151 (1%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQT-DKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVA  255
            E KEEDV+LGANKF E QP+GTAAQ+ DKDYKEPPPAPLFEPGEL+SWSFYRAGIAEFVA
Sbjct  2    EGKEEDVRLGANKFTERQPIGTAAQSQDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFVA  61

Query  256  TFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFG  435
            TFLFLYITILTVMGV +S   C +VGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFG
Sbjct  62   TFLFLYITILTVMGVVKSSTKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  121

Query  436  LFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            LFLARKLSLT ALFYMVM CLGAICGAGVVK
Sbjct  122  LFLARKLSLTRALFYMVMQCLGAICGAGVVK  152



>ref|XP_010053244.1| PREDICTED: aquaporin PIP1-3 [Eucalyptus grandis]
 gb|KCW77501.1| hypothetical protein EUGRSUZ_D01836 [Eucalyptus grandis]
Length=287

 Score =   270 bits (690),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDV+LGANKF E QP+GT+AQTDKDYKEPPPAPLFEPGEL SWSFYRAGIAEFVAT
Sbjct  2    EGKEEDVRLGANKFSERQPIGTSAQTDKDYKEPPPAPLFEPGELQSWSFYRAGIAEFVAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYIT+LTVMGV +S   C +VG+QGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITVLTVMGVSQSKTKCTTVGVQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FLARKLSLT A+FY++M CLGAICGAGVVK
Sbjct  122  FLARKLSLTRAVFYIIMQCLGAICGAGVVK  151



>ref|XP_006476548.1| PREDICTED: probable aquaporin PIP1-2-like isoform X1 [Citrus 
sinensis]
 gb|KDO76244.1| hypothetical protein CISIN_1g023107mg [Citrus sinensis]
Length=287

 Score =   270 bits (690),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDVKLGANKF E QP+GT+AQ+DKDYKEPPPAPLFEPGEL SWSFYRAGIAEF+AT
Sbjct  2    EGKEEDVKLGANKFSERQPIGTSAQSDKDYKEPPPAPLFEPGELKSWSFYRAGIAEFMAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYIT+LTVMGV +S+  C +VGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITVLTVMGVSKSNTKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
             LARKLSLT A+FYMVM CLGA+CGAGVVK
Sbjct  122  LLARKLSLTRAVFYMVMQCLGAVCGAGVVK  151



>ref|XP_009116806.1| PREDICTED: aquaporin PIP1-1 isoform X1 [Brassica rapa]
Length=286

 Score =   270 bits (690),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 139/150 (93%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDV++GANKF E QP+GT+AQ+DKDY EPPPAPLFEPGEL+SWSF+RAGIAEF+AT
Sbjct  2    EGKEEDVRVGANKFPERQPIGTSAQSDKDYNEPPPAPLFEPGELSSWSFWRAGIAEFIAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYIT+LTVMGVKRS  +C SVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITVLTVMGVKRSPNMCSSVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FLARKLSLT AL+Y+VM C GAICGAGVVK
Sbjct  122  FLARKLSLTRALYYIVMQCWGAICGAGVVK  151



>ref|NP_001267921.1| aquaporin-like [Vitis vinifera]
 gb|ABN14349.1| aquaporin PIP1;3 [Vitis vinifera]
Length=287

 Score =   270 bits (690),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 131/150 (87%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDVKLGANKF E QPLGTAAQTDKDYK+ PPAPLFEPGEL SWSFYRAGIAEF+AT
Sbjct  2    EGKEEDVKLGANKFTERQPLGTAAQTDKDYKDLPPAPLFEPGELKSWSFYRAGIAEFMAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYITILTVMGVK+S  +C SVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITILTVMGVKKSPTMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
             LARKLSLT A+FY++M CLGAICGAGVVK
Sbjct  122  LLARKLSLTRAIFYIIMQCLGAICGAGVVK  151



>gb|ABH09324.1| putative aquaporin [Vitis vinifera]
Length=287

 Score =   270 bits (690),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 131/150 (87%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDVKLGANKF E QPLGTAAQTDKDYK+ PPAPLFEPGEL SWSFYRAGIAEF+AT
Sbjct  2    EGKEEDVKLGANKFTERQPLGTAAQTDKDYKDLPPAPLFEPGELKSWSFYRAGIAEFMAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYITILTVMGVK+S  +C SVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITILTVMGVKKSPTMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
             LARKLSLT A+FY++M CLGAICGAGVVK
Sbjct  122  LLARKLSLTRAIFYIIMQCLGAICGAGVVK  151



>ref|XP_010439184.1| PREDICTED: probable aquaporin PIP1-5 [Camelina sativa]
Length=287

 Score =   270 bits (689),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 131/151 (87%), Positives = 139/151 (92%), Gaps = 1/151 (1%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTD-KDYKEPPPAPLFEPGELTSWSFYRAGIAEFVA  255
            E KEEDV +GANKF E QP+GTAAQTD KDYKEPPPAPLFEPGEL SWSFYRAGIAEF+A
Sbjct  2    EGKEEDVNVGANKFPEKQPIGTAAQTDSKDYKEPPPAPLFEPGELKSWSFYRAGIAEFIA  61

Query  256  TFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFG  435
            TFLFLYIT+LTVMGVKR+  +C SVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFG
Sbjct  62   TFLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  121

Query  436  LFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            LFLARKLSLT AL+Y+VM CLGAICGAGVVK
Sbjct  122  LFLARKLSLTRALYYIVMQCLGAICGAGVVK  152



>ref|XP_009631880.1| PREDICTED: probable aquaporin PIP1-2 [Nicotiana tomentosiformis]
 tpg|DAA64671.1| TPA_exp: aquaporin PIP1 4 [Nicotiana tabacum]
Length=285

 Score =   270 bits (689),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 129/150 (86%), Positives = 139/150 (93%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E+KEEDV+LGANK+ E Q +GTAAQ+DKDYKEPPPAPLFE GELTSWSFYRAGIAEF+AT
Sbjct  2    ENKEEDVRLGANKYSERQAIGTAAQSDKDYKEPPPAPLFEAGELTSWSFYRAGIAEFMAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYITILTVMGV +S+  C +VGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITILTVMGVSKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FLARKLSLT A+FYMVM CLGAICGAGVVK
Sbjct  122  FLARKLSLTRAVFYMVMQCLGAICGAGVVK  151



>ref|NP_001078067.1| aquaporin PIP1-2 [Arabidopsis thaliana]
 gb|AEC10624.1| aquaporin PIP1-2 [Arabidopsis thaliana]
Length=301

 Score =   270 bits (690),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDV++GANKF E QP+GT+AQ+DKDYKEPPPAPLFEPGEL SWSF+RAGIAEF+AT
Sbjct  2    EGKEEDVRVGANKFPERQPIGTSAQSDKDYKEPPPAPLFEPGELASWSFWRAGIAEFIAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYIT+LTVMGVKRS  +C SVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITVLTVMGVKRSPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FLARKLSLT A++Y+VM CLGAICGAGVVK
Sbjct  122  FLARKLSLTRAVYYIVMQCLGAICGAGVVK  151



>gb|ABH09325.1| putative aquaporin [Vitis vinifera]
Length=286

 Score =   270 bits (689),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 130/150 (87%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDVKLGANKF E QPLGTAAQTDKDY+EPPPAPLFEPGEL SWSF+RAGIAEF+AT
Sbjct  2    EGKEEDVKLGANKFTERQPLGTAAQTDKDYREPPPAPLFEPGELHSWSFWRAGIAEFMAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYIT+LTVMGV RS   C +VGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITVLTVMGVVRSPSKCATVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
             LARKLSLT A+FYM+M CLGAICGAGVVK
Sbjct  122  LLARKLSLTRAVFYMIMQCLGAICGAGVVK  151



>ref|XP_009142386.1| PREDICTED: LOW QUALITY PROTEIN: aquaporin PIP1-2-like [Brassica 
rapa]
Length=286

 Score =   270 bits (689),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDV++GANKF E QP+GT+AQ+DKDYKEPPPAPLFEPGEL SWSF+RAGIAEF+AT
Sbjct  2    EGKEEDVRVGANKFPERQPIGTSAQSDKDYKEPPPAPLFEPGELGSWSFWRAGIAEFIAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYIT+LTVMGVKR+  +C SVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FLARKLSLT A++Y+VM CLGAICGAGVVK
Sbjct  122  FLARKLSLTRAVYYIVMQCLGAICGAGVVK  151



>gb|AHB33476.1| plasma intrinsic protein 1-3 [Cucumis sativus]
Length=286

 Score =   270 bits (689),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 129/150 (86%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDVKLGANKF E QP+GT+AQTDKDYKEPPPAPL+EPGEL SWSFYRAGIAEF+AT
Sbjct  2    EGKEEDVKLGANKFSERQPIGTSAQTDKDYKEPPPAPLYEPGELKSWSFYRAGIAEFMAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLY TIL VMGV RS   C SVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYTTILMVMGVNRSPSKCNSVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FLARKLSLT A+FY++M CLGAICGAGVVK
Sbjct  122  FLARKLSLTRAVFYIIMQCLGAICGAGVVK  151



>ref|XP_007040270.1| Plasma membrane intrinsic protein 1,4 isoform 3, partial [Theobroma 
cacao]
 gb|EOY24771.1| Plasma membrane intrinsic protein 1,4 isoform 3, partial [Theobroma 
cacao]
Length=289

 Score =   270 bits (689),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 130/150 (87%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDVKLGANKF E QP+GT+AQTDKDYKEPPPAPLFEPGEL SWSFYRAGIAEFVAT
Sbjct  4    EGKEEDVKLGANKFPERQPIGTSAQTDKDYKEPPPAPLFEPGELKSWSFYRAGIAEFVAT  63

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYITILTVMGV +S   C +VGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  64   FLFLYITILTVMGVSQSKTKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  123

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
             LARKLSLT A+FY++M CLGAICGAGVVK
Sbjct  124  LLARKLSLTRAVFYIIMQCLGAICGAGVVK  153



>gb|AHX99531.1| aquaporin PIP1 [Chrysanthemum x morifolium]
Length=287

 Score =   269 bits (688),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 129/150 (86%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDVKLGANK+ E QP+GT+AQTDKDYKEPPPAPLFEPGEL+SWSFYRAGIAEF+AT
Sbjct  2    EGKEEDVKLGANKYSERQPIGTSAQTDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFIAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYI++LTVMGV +S   C +VGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYISVLTVMGVVKSPTKCGTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
             LARKLSLT ALFYMVM CLGAICGAGVVK
Sbjct  122  LLARKLSLTRALFYMVMQCLGAICGAGVVK  151



>gb|AAV41024.1| plasma membrane intrinsic protein [Glycyrrhiza uralensis]
Length=289

 Score =   270 bits (689),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 134/153 (88%), Positives = 138/153 (90%), Gaps = 3/153 (2%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTD---KDYKEPPPAPLFEPGELTSWSFYRAGIAEF  249
            E KE+DV LGANKF E QP+GTAAQT    KDYKEPPPAPLFEP ELTSWSFYRAGIAEF
Sbjct  2    EGKEQDVSLGANKFPERQPIGTAAQTQDDGKDYKEPPPAPLFEPNELTSWSFYRAGIAEF  61

Query  250  VATFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVT  429
            VATFLFLYITILTVMGV RS+  CKSVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVT
Sbjct  62   VATFLFLYITILTVMGVNRSESKCKSVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  121

Query  430  FGLFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FGLFLARKLSLT A+FYMVM CLGAICGAGVVK
Sbjct  122  FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVK  154



>ref|XP_007040268.1| Plasma membrane intrinsic protein 1,4 isoform 1 [Theobroma cacao]
 ref|XP_007040269.1| Plasma membrane intrinsic protein 1,4 isoform 1 [Theobroma cacao]
 gb|EOY24769.1| Plasma membrane intrinsic protein 1,4 isoform 1 [Theobroma cacao]
 gb|EOY24770.1| Plasma membrane intrinsic protein 1,4 isoform 1 [Theobroma cacao]
Length=287

 Score =   269 bits (688),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 130/150 (87%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDVKLGANKF E QP+GT+AQTDKDYKEPPPAPLFEPGEL SWSFYRAGIAEFVAT
Sbjct  2    EGKEEDVKLGANKFPERQPIGTSAQTDKDYKEPPPAPLFEPGELKSWSFYRAGIAEFVAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYITILTVMGV +S   C +VGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITILTVMGVSQSKTKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
             LARKLSLT A+FY++M CLGAICGAGVVK
Sbjct  122  LLARKLSLTRAVFYIIMQCLGAICGAGVVK  151



>gb|ACV66985.1| plasma membrane aquaporin 1 [Hevea brasiliensis]
Length=287

 Score =   269 bits (688),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDV+LGANKF E QP+GT+AQTDKDYKEPPPAPLFEPGEL+SWSFYRAGIAEF+AT
Sbjct  2    EGKEEDVRLGANKFTERQPIGTSAQTDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFIAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYIT+LTVMG  + +  C +VG QGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITVLTVMGFSKPNNKCTTVGTQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FLARKLSLT ALFYM+M CLGAICGAGVVK
Sbjct  122  FLARKLSLTRALFYMIMQCLGAICGAGVVK  151



>ref|XP_010095072.1| Aquaporin PIP1-1 [Morus notabilis]
 gb|EXB58178.1| Aquaporin PIP1-1 [Morus notabilis]
Length=288

 Score =   269 bits (688),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 132/153 (86%), Positives = 139/153 (91%), Gaps = 3/153 (2%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTD---KDYKEPPPAPLFEPGELTSWSFYRAGIAEF  249
            E KEEDV+LGANKF E QP+GTAAQT    KDYKEPPPAPLFEPGELTSWSFYRAGIAEF
Sbjct  2    EGKEEDVRLGANKFSERQPIGTAAQTQDDGKDYKEPPPAPLFEPGELTSWSFYRAGIAEF  61

Query  250  VATFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVT  429
            +ATFLFLYITILTVMGV + D  CK+VGIQGIAWAFGGMIFALVYCTAGIS GHINPAVT
Sbjct  62   IATFLFLYITILTVMGVVKEDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  121

Query  430  FGLFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FGLFLARKLSLT A+FY+VM CLGAICGAGVVK
Sbjct  122  FGLFLARKLSLTRAVFYIVMQCLGAICGAGVVK  154



>ref|XP_009119712.1| PREDICTED: aquaporin PIP1-3 [Brassica rapa]
Length=286

 Score =   269 bits (688),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDV++GANKF E QP+GT+AQTDKDYKEPPPAPLFEPGEL+SWSF+RAGIAEF+AT
Sbjct  2    EGKEEDVRVGANKFPERQPIGTSAQTDKDYKEPPPAPLFEPGELSSWSFWRAGIAEFIAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYIT+LTVMGVKR+  +C SVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FLARKLSLT A+ Y+VM CLGA+CGAGVVK
Sbjct  122  FLARKLSLTRAVPYIVMQCLGAVCGAGVVK  151



>ref|XP_009380931.1| PREDICTED: aquaporin PIP1-1 [Musa acuminata subsp. malaccensis]
Length=285

 Score =   269 bits (687),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 132/150 (88%), Positives = 137/150 (91%), Gaps = 1/150 (1%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDVK+GANKF E QP+GTAAQ DKDYKEPPPAPLFEPGEL SWSFYRAGIAEFVAT
Sbjct  2    EGKEEDVKIGANKFSERQPIGTAAQ-DKDYKEPPPAPLFEPGELKSWSFYRAGIAEFVAT  60

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYITILTVMGV +S   C +VGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  61   FLFLYITILTVMGVVKSSSKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  120

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FLARKLSLT A+FYMVM CLGAICGAGVVK
Sbjct  121  FLARKLSLTRAIFYMVMQCLGAICGAGVVK  150



>ref|XP_006288376.1| hypothetical protein CARUB_v10001627mg [Capsella rubella]
 gb|EOA21274.1| hypothetical protein CARUB_v10001627mg [Capsella rubella]
Length=287

 Score =   269 bits (687),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 141/151 (93%), Gaps = 1/151 (1%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQ-TDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVA  255
            E KEEDV++GANKF E QP+GT+AQ T+KDYKEPPPAPLFEPGEL+SWSFYRAGIAEF+A
Sbjct  2    EGKEEDVRVGANKFPERQPIGTSAQSTEKDYKEPPPAPLFEPGELSSWSFYRAGIAEFIA  61

Query  256  TFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFG  435
            TFLFLYIT+LTVMGVKR+  +C SVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFG
Sbjct  62   TFLFLYITVLTVMGVKRAPTMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  121

Query  436  LFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            LFLARKLSLT A+FYM+M CLGAICGAGVVK
Sbjct  122  LFLARKLSLTRAVFYMIMQCLGAICGAGVVK  152



>gb|ABR68794.1| aquaporin PIP1-2 [Gossypium hirsutum]
 gb|KJB25856.1| hypothetical protein B456_004G212800 [Gossypium raimondii]
Length=287

 Score =   269 bits (687),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 130/150 (87%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDVKLGANKF E QP+GT+AQTDKDYKEPP AP FEPGEL SWSFYRAGIAEFVAT
Sbjct  2    EGKEEDVKLGANKFSERQPIGTSAQTDKDYKEPPAAPFFEPGELKSWSFYRAGIAEFVAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYIT+LTVMGV +S   C +VGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITVLTVMGVSQSKTKCATVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FLARKLSLT ALFYM+M CLGAICGAGVVK
Sbjct  122  FLARKLSLTRALFYMIMQCLGAICGAGVVK  151



>ref|XP_009116807.1| PREDICTED: aquaporin PIP1-1 isoform X2 [Brassica rapa]
Length=289

 Score =   269 bits (687),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 139/150 (93%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDV++GANKF E QP+GT+AQ+DKDY EPPPAPLFEPGEL+SWSF+RAGIAEF+AT
Sbjct  2    EGKEEDVRVGANKFPERQPIGTSAQSDKDYNEPPPAPLFEPGELSSWSFWRAGIAEFIAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYIT+LTVMGVKRS  +C SVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITVLTVMGVKRSPNMCSSVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FLARKLSLT AL+Y+VM C GAICGAGVVK
Sbjct  122  FLARKLSLTRALYYIVMQCWGAICGAGVVK  151



>gb|EYU38340.1| hypothetical protein MIMGU_mgv1a018376mg [Erythranthe guttata]
Length=277

 Score =   268 bits (686),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 131/150 (87%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = +1

Query  73   MAESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFV  252
            MAE+KEEDV LGAN+F E QPLGTAAQTDKDYKEPPPAPLFE GEL SWSFYRAGIAEFV
Sbjct  1    MAENKEEDVNLGANQFTERQPLGTAAQTDKDYKEPPPAPLFETGELKSWSFYRAGIAEFV  60

Query  253  ATFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTF  432
            ATFLFLYITILTVMGV RS   C SVGIQGI W+FGGMIFALVYCTAGIS GHINPAVTF
Sbjct  61   ATFLFLYITILTVMGVGRSPSKCASVGIQGITWSFGGMIFALVYCTAGISGGHINPAVTF  120

Query  433  GLFLARKLSLTXALFYMVMXCLGAICGAGV  522
            GLFLARKLSLT A+FY+VM CLGAICGAGV
Sbjct  121  GLFLARKLSLTRAVFYIVMQCLGAICGAGV  150



>gb|KJB25854.1| hypothetical protein B456_004G212800 [Gossypium raimondii]
Length=279

 Score =   268 bits (686),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 130/150 (87%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDVKLGANKF E QP+GT+AQTDKDYKEPP AP FEPGEL SWSFYRAGIAEFVAT
Sbjct  2    EGKEEDVKLGANKFSERQPIGTSAQTDKDYKEPPAAPFFEPGELKSWSFYRAGIAEFVAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYIT+LTVMGV +S   C +VGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITVLTVMGVSQSKTKCATVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FLARKLSLT ALFYM+M CLGAICGAGVVK
Sbjct  122  FLARKLSLTRALFYMIMQCLGAICGAGVVK  151



>ref|XP_010089092.1| putative aquaporin PIP1-4 [Morus notabilis]
 gb|EXB37339.1| putative aquaporin PIP1-4 [Morus notabilis]
Length=287

 Score =   268 bits (686),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDVKLGANKF E QP+GT+AQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEF+AT
Sbjct  2    EGKEEDVKLGANKFSERQPIGTSAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFIAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYITILTVMGV ++   C +VG+QGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITILTVMGVSKAPTKCSTVGVQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FLARKLSLT A+FY++M  LGAICGAGVVK
Sbjct  122  FLARKLSLTRAVFYIIMQTLGAICGAGVVK  151



>ref|XP_009400253.1| PREDICTED: probable aquaporin PIP1-2 [Musa acuminata subsp. malaccensis]
Length=285

 Score =   268 bits (686),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 131/150 (87%), Positives = 138/150 (92%), Gaps = 1/150 (1%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDVKLGANKF E QP+GTAAQ DKDYKEPPPAPLFEPGEL SWSFYRAGIAEF+AT
Sbjct  2    EGKEEDVKLGANKFSERQPIGTAAQ-DKDYKEPPPAPLFEPGELKSWSFYRAGIAEFMAT  60

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYITILTVMGV +S+  C +VGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  61   FLFLYITILTVMGVVKSNSKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  120

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FLARKLSLT A+FYMVM CLGA+CGAGVVK
Sbjct  121  FLARKLSLTRAVFYMVMQCLGAVCGAGVVK  150



>ref|XP_010241866.1| PREDICTED: aquaporin PIP1-2 [Nelumbo nucifera]
Length=286

 Score =   268 bits (686),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 130/150 (87%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDVKLGANKF E QP+GTAAQTDKDYKEPPPAPLFEPGEL SWSF+RAGIAEF+AT
Sbjct  2    EGKEEDVKLGANKFSERQPIGTAAQTDKDYKEPPPAPLFEPGELKSWSFWRAGIAEFMAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYITILTVMGV R+   C SVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITILTVMGVGRAPSKCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
             LARKLSL  ALFY++M CLGAICGAGVVK
Sbjct  122  LLARKLSLVRALFYIIMQCLGAICGAGVVK  151



>ref|XP_010255327.1| PREDICTED: aquaporin PIP1-2-like [Nelumbo nucifera]
Length=286

 Score =   268 bits (685),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 130/150 (87%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDVKLGANKF E QPLGTAAQTDKDYKEPPPAPLFEPGEL SWSF+RAGIAEF+AT
Sbjct  2    EGKEEDVKLGANKFSERQPLGTAAQTDKDYKEPPPAPLFEPGELKSWSFWRAGIAEFMAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYITILTVMGV RS   C SVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFG+
Sbjct  62   FLFLYITILTVMGVGRSGNKCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGM  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
             LARKLSL  A+FY++M CLGAICGAGVVK
Sbjct  122  LLARKLSLVRAVFYIIMQCLGAICGAGVVK  151



>ref|XP_007051783.1| Plasma membrane intrinsic protein 1B [Theobroma cacao]
 gb|EOX95940.1| Plasma membrane intrinsic protein 1B [Theobroma cacao]
Length=286

 Score =   268 bits (685),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 130/150 (87%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDVKLGANKF E QP+GT+AQTDKDYKE PPAPLFEPGEL SWSF+RAGIAEFVAT
Sbjct  2    EGKEEDVKLGANKFTERQPIGTSAQTDKDYKEQPPAPLFEPGELQSWSFWRAGIAEFVAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYIT+LTVMGV R+   C SVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITVLTVMGVNRAPTKCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FLARKLSLT A+FY+VM CLGAICGAGVVK
Sbjct  122  FLARKLSLTRAIFYIVMQCLGAICGAGVVK  151



>ref|XP_002526866.1| Aquaporin PIP1.3, putative [Ricinus communis]
 gb|EEF35497.1| Aquaporin PIP1.3, putative [Ricinus communis]
Length=287

 Score =   268 bits (685),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 130/152 (86%), Positives = 140/152 (92%), Gaps = 2/152 (1%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQT--DKDYKEPPPAPLFEPGELTSWSFYRAGIAEFV  252
            E KEEDV+LGANK+RETQP+GTAAQ+  DKDY EPPPAPLFEPGELTSWSFYRAGIAEF+
Sbjct  2    EGKEEDVRLGANKYRETQPIGTAAQSQDDKDYTEPPPAPLFEPGELTSWSFYRAGIAEFI  61

Query  253  ATFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTF  432
            ATFLFLYI++LTVMGV ++   C +VGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTF
Sbjct  62   ATFLFLYISVLTVMGVVKAPTKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  121

Query  433  GLFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            GLFLARKLSLT ALFYMVM CLGAICGAGVVK
Sbjct  122  GLFLARKLSLTRALFYMVMQCLGAICGAGVVK  153



>gb|KHG19073.1| Aquaporin PIP1-3 -like protein [Gossypium arboreum]
Length=287

 Score =   268 bits (685),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 129/150 (86%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDVKLGANKF E QP+GT+AQTDKDYKEPP AP FEPGEL SWSFYRAGIAEFVAT
Sbjct  2    EGKEEDVKLGANKFSERQPIGTSAQTDKDYKEPPAAPFFEPGELKSWSFYRAGIAEFVAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYIT+LTVMGV +S   C +VGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITVLTVMGVSQSKTKCATVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FLARKLSLT A+FYM+M CLGAICGAGVVK
Sbjct  122  FLARKLSLTRAVFYMIMQCLGAICGAGVVK  151



>gb|KEH21072.1| major intrinsic protein (MIP) family transporter [Medicago truncatula]
Length=287

 Score =   268 bits (685),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 132/150 (88%), Positives = 137/150 (91%), Gaps = 1/150 (1%)
 Frame = +1

Query  82   SKEEDVKLGANKFRETQPLGTAAQTD-KDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
             KEEDVK+GANKF E QPLGTAAQ+D KDYKEPPPAPLFEPGEL SWSFYRAGIAEFVAT
Sbjct  2    EKEEDVKVGANKFSERQPLGTAAQSDSKDYKEPPPAPLFEPGELKSWSFYRAGIAEFVAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYITILTVMGV RS   C SVGIQGIAW+FGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITILTVMGVNRSTSKCSSVGIQGIAWSFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FLARKLSLT A+FY+VM CLGAICGAGVVK
Sbjct  122  FLARKLSLTRAIFYIVMQCLGAICGAGVVK  151



>ref|XP_009382780.1| PREDICTED: probable aquaporin PIP1-2 [Musa acuminata subsp. malaccensis]
Length=287

 Score =   268 bits (685),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 132/151 (87%), Positives = 139/151 (92%), Gaps = 1/151 (1%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQT-DKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVA  255
            E KEEDV+LGAN+F E QP+GTAAQ+ DKDYKEPP APLFEPGEL+SWSFYRAGIAEFVA
Sbjct  2    EGKEEDVRLGANRFSERQPIGTAAQSQDKDYKEPPLAPLFEPGELSSWSFYRAGIAEFVA  61

Query  256  TFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFG  435
            TFLFLYITILTVMGV +SD  C +VGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFG
Sbjct  62   TFLFLYITILTVMGVVKSDTKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  121

Query  436  LFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            LFLARKLSLT ALFYMVM CLGAICGAGVVK
Sbjct  122  LFLARKLSLTRALFYMVMQCLGAICGAGVVK  152



>gb|EPS61960.1| hypothetical protein M569_12834, partial [Genlisea aurea]
Length=285

 Score =   268 bits (684),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 131/150 (87%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E+KEEDV LGA KFRE QPLGTAAQTDKDY+EPPPA LF+P EL SWSFYRAGIAEFVAT
Sbjct  1    EAKEEDVVLGATKFRERQPLGTAAQTDKDYREPPPAALFDPDELASWSFYRAGIAEFVAT  60

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYITILTVMGV R+   C SVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  61   FLFLYITILTVMGVNRASTKCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  120

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FLARKLSLT ALFY+VM CLGAICGAGVVK
Sbjct  121  FLARKLSLTRALFYIVMQCLGAICGAGVVK  150



>ref|XP_006284249.1| hypothetical protein CARUB_v10005414mg [Capsella rubella]
 gb|EOA17147.1| hypothetical protein CARUB_v10005414mg [Capsella rubella]
Length=287

 Score =   268 bits (684),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 130/151 (86%), Positives = 139/151 (92%), Gaps = 1/151 (1%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTD-KDYKEPPPAPLFEPGELTSWSFYRAGIAEFVA  255
            E KEEDV +GANKF E QP+GTAAQT+ KDYKEPPPAPLFEPGEL SWSFYRAGIAEF+A
Sbjct  2    EGKEEDVNVGANKFPERQPIGTAAQTESKDYKEPPPAPLFEPGELKSWSFYRAGIAEFIA  61

Query  256  TFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFG  435
            TFLFLYIT+LTVMGVKR+  +C SVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFG
Sbjct  62   TFLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  121

Query  436  LFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            LFLARKLSLT A+FY+VM CLGAICGAGVVK
Sbjct  122  LFLARKLSLTRAVFYIVMQCLGAICGAGVVK  152



>ref|XP_006848145.1| hypothetical protein AMTR_s00029p00227660 [Amborella trichopoda]
 gb|ERN09726.1| hypothetical protein AMTR_s00029p00227660 [Amborella trichopoda]
Length=287

 Score =   268 bits (684),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 130/151 (86%), Positives = 138/151 (91%), Gaps = 1/151 (1%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQT-DKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVA  255
            E KEEDVKLGANK+ E QP+GTAAQ+ DKDYKEPPPAPLFEPGEL SWSF+RAGIAEF+A
Sbjct  2    EGKEEDVKLGANKYSERQPIGTAAQSQDKDYKEPPPAPLFEPGELQSWSFWRAGIAEFIA  61

Query  256  TFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFG  435
            TFLFLYITILTVMGVK+   +C SVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFG
Sbjct  62   TFLFLYITILTVMGVKKETTLCSSVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  121

Query  436  LFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            L LARKLSLT A+FYMVM CLGAICGAGVVK
Sbjct  122  LLLARKLSLTRAVFYMVMQCLGAICGAGVVK  152



>gb|AFH36341.1| aquaporin PIP1;3 [Quercus petraea]
Length=286

 Score =   268 bits (684),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 129/150 (86%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDVKLGANKF E QP+GT+AQTDKDYKEPPPAPLFEPGEL SWSF+RAGIAEF+AT
Sbjct  2    EGKEEDVKLGANKFSERQPIGTSAQTDKDYKEPPPAPLFEPGELHSWSFWRAGIAEFIAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYITILTVMG  R+   C SVG QGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITILTVMGYSRTTNKCASVGAQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FLARKLSLT A+FY+VM CLGAICGAGVVK
Sbjct  122  FLARKLSLTRAVFYIVMQCLGAICGAGVVK  151



>dbj|BAA20074.1| water channel protein [Nicotiana excelsior]
Length=285

 Score =   268 bits (684),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E+KEEDV+LGANK+ E Q +GTAAQ+DKDY EPPPAPLFE GELTSWSFYRAGIAEF+AT
Sbjct  2    ENKEEDVRLGANKYSERQAIGTAAQSDKDYTEPPPAPLFEAGELTSWSFYRAGIAEFMAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYITILTVMGV +S+  C +VGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITILTVMGVSKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FLARKLSLT A+FYMVM CLGAICGAGVVK
Sbjct  122  FLARKLSLTRAVFYMVMQCLGAICGAGVVK  151



>emb|CAN74419.1| hypothetical protein VITISV_016461 [Vitis vinifera]
Length=287

 Score =   268 bits (684),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 131/150 (87%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDVKLGANKF E QPLGTAAQTDKDYK  PPAPLFEPGEL SWSFYRAGIAEF+AT
Sbjct  2    EGKEEDVKLGANKFTERQPLGTAAQTDKDYKXXPPAPLFEPGELKSWSFYRAGIAEFMAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYITILTVMGVK+S  +C SVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITILTVMGVKKSXTMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
             LARKLSLT A+FY+ M CLGAICGAGVVK
Sbjct  122  LLARKLSLTRAIFYIXMQCLGAICGAGVVK  151



>ref|XP_010448716.1| PREDICTED: probable aquaporin PIP1-5 [Camelina sativa]
Length=287

 Score =   268 bits (684),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 139/151 (92%), Gaps = 1/151 (1%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTD-KDYKEPPPAPLFEPGELTSWSFYRAGIAEFVA  255
            E KEEDV +GANKF E QP+GTAAQT+ KDYKEPPPAPLFEPGEL SWSFYRAGIAEF+A
Sbjct  2    EGKEEDVNVGANKFPEKQPIGTAAQTESKDYKEPPPAPLFEPGELKSWSFYRAGIAEFIA  61

Query  256  TFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFG  435
            TFLFLY+T+LTVMGVKR+  +C SVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFG
Sbjct  62   TFLFLYVTVLTVMGVKRAPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  121

Query  436  LFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            LFLARKLSLT AL+Y+VM CLGAICGAGVVK
Sbjct  122  LFLARKLSLTRALYYIVMQCLGAICGAGVVK  152



>ref|XP_002526867.1| Aquaporin PIP1.3, putative [Ricinus communis]
 emb|CAE53882.1| aquaporin [Ricinus communis]
 gb|EEF35498.1| Aquaporin PIP1.3, putative [Ricinus communis]
Length=288

 Score =   268 bits (684),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 130/152 (86%), Positives = 140/152 (92%), Gaps = 2/152 (1%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQT--DKDYKEPPPAPLFEPGELTSWSFYRAGIAEFV  252
            E KEEDV+LGANK+RETQP+GTAAQ+  DKDY EPPPAPLFEPGELTSWSFYRAGIAEF+
Sbjct  2    EGKEEDVRLGANKYRETQPIGTAAQSQDDKDYTEPPPAPLFEPGELTSWSFYRAGIAEFI  61

Query  253  ATFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTF  432
            ATFLFLYI++LTVMGV ++   C +VGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTF
Sbjct  62   ATFLFLYISVLTVMGVVKAPTKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  121

Query  433  GLFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            GLFLARKLSLT ALFYMVM CLGAICGAGVVK
Sbjct  122  GLFLARKLSLTRALFYMVMQCLGAICGAGVVK  153



>tpg|DAA33859.1| TPA_inf: aquaporin PIP1;5 [Gossypium hirsutum]
Length=278

 Score =   267 bits (683),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 130/150 (87%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDVKLGANKF E QP+GT+AQTDKDYKEPP AP FEPGEL SWSFYRAGIAEFVAT
Sbjct  2    EGKEEDVKLGANKFSERQPIGTSAQTDKDYKEPPAAPFFEPGELKSWSFYRAGIAEFVAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYIT+LTVMGV +S   C +VGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITVLTVMGVSQSKTKCATVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FLARKLSLT ALFYM+M CLGAICGAGVVK
Sbjct  122  FLARKLSLTRALFYMIMQCLGAICGAGVVK  151



>gb|AFH36340.1| aquaporin PIP1;2 [Quercus petraea]
Length=286

 Score =   267 bits (683),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDVK+GANK+ E QPLGT+AQTDKDYKEPPPAPLFEPGEL+SWSFYRAGIAEF+AT
Sbjct  2    EGKEEDVKVGANKYSERQPLGTSAQTDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFIAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYITILTVMG  +S   C +VGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITILTVMGYNKSTNKCTTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
             LARKLSLT A+FY++M CLGAICGAGVVK
Sbjct  122  LLARKLSLTRAVFYIIMQCLGAICGAGVVK  151



>ref|XP_009762763.1| PREDICTED: probable aquaporin PIP1-2 [Nicotiana sylvestris]
Length=285

 Score =   267 bits (683),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E+KEEDV+LGANK+ E Q +GTAAQ+DKDY EPPPAPLFE GELTSWSFYRAGIAEF+AT
Sbjct  2    ENKEEDVRLGANKYSERQAIGTAAQSDKDYTEPPPAPLFEAGELTSWSFYRAGIAEFMAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYITILTVMGV +S+  C +VGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITILTVMGVSKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FLARKLSLT A+FYMVM CLGAICGAGVVK
Sbjct  122  FLARKLSLTRAVFYMVMQCLGAICGAGVVK  151



>emb|CAA04652.1| major intrinsic protein PIPa2 [Craterostigma plantagineum]
Length=287

 Score =   267 bits (683),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 131/152 (86%), Positives = 138/152 (91%), Gaps = 2/152 (1%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQT--DKDYKEPPPAPLFEPGELTSWSFYRAGIAEFV  252
            E+KEEDV+LGANKF E  P+GTAAQT  DKDY EPPPAPLFEPGEL+SWSFYRAGIAEF+
Sbjct  2    EAKEEDVRLGANKFSERNPIGTAAQTHDDKDYTEPPPAPLFEPGELSSWSFYRAGIAEFM  61

Query  253  ATFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTF  432
            ATFLFLYITILTVMGV R+   C SVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTF
Sbjct  62   ATFLFLYITILTVMGVNRAPNKCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  121

Query  433  GLFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            GLFLARKLSLT A+FYMVM CLGAICGAGVVK
Sbjct  122  GLFLARKLSLTRAVFYMVMQCLGAICGAGVVK  153



>ref|XP_010262799.1| PREDICTED: probable aquaporin PIP1-2 [Nelumbo nucifera]
Length=286

 Score =   267 bits (682),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 138/151 (91%), Gaps = 1/151 (1%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTD-KDYKEPPPAPLFEPGELTSWSFYRAGIAEFVA  255
            E KEEDV++GANK+ E QP+GTAAQ+D +DYKEPPPAPLFEPGEL+SWSFYRAGIAEF+A
Sbjct  2    EGKEEDVRVGANKYSEKQPIGTAAQSDDRDYKEPPPAPLFEPGELSSWSFYRAGIAEFMA  61

Query  256  TFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFG  435
            TFLFLYITILTVMGV RS   C +VGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFG
Sbjct  62   TFLFLYITILTVMGVSRSSNKCATVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  121

Query  436  LFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            L LARKLSLT ALFYMVM CLGAICGAGVVK
Sbjct  122  LLLARKLSLTRALFYMVMQCLGAICGAGVVK  152



>ref|XP_006476549.1| PREDICTED: probable aquaporin PIP1-2-like isoform X2 [Citrus 
sinensis]
Length=316

 Score =   268 bits (685),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDVKLGANKF E QP+GT+AQ+DKDYKEPPPAPLFEPGEL SWSFYRAGIAEF+AT
Sbjct  2    EGKEEDVKLGANKFSERQPIGTSAQSDKDYKEPPPAPLFEPGELKSWSFYRAGIAEFMAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYIT+LTVMGV +S+  C +VGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITVLTVMGVSKSNTKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
             LARKLSLT A+FYMVM CLGA+CGAGVVK
Sbjct  122  LLARKLSLTRAVFYMVMQCLGAVCGAGVVK  151



>ref|NP_001289902.1| probable aquaporin PIP1-4 [Camelina sativa]
 ref|XP_010427011.1| PREDICTED: probable aquaporin PIP1-4 [Camelina sativa]
 gb|AEH76328.1| plasma membrane intrinsic protein 1-4 [Camelina sativa]
Length=287

 Score =   267 bits (682),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 141/151 (93%), Gaps = 1/151 (1%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQ-TDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVA  255
            E KEEDV++GANKF E QP+GT+AQ T+KDYKEPPPAPLFEPGEL+SWSFYRAGIAEF+A
Sbjct  2    EGKEEDVRVGANKFPERQPIGTSAQSTEKDYKEPPPAPLFEPGELSSWSFYRAGIAEFIA  61

Query  256  TFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFG  435
            TFLFLYIT+LTVMGVKR+  +C SVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFG
Sbjct  62   TFLFLYITVLTVMGVKRAPTMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  121

Query  436  LFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            LFLARKLSLT A+FY++M CLGAICGAGVVK
Sbjct  122  LFLARKLSLTRAVFYIIMQCLGAICGAGVVK  152



>ref|NP_001267949.1| aquaporin PIP1;2 [Vitis vinifera]
 gb|ABN14350.1| aquaporin PIP1;4 [Vitis vinifera]
 gb|AIK66514.1| putative aquaporin [Vitis vinifera]
Length=286

 Score =   267 bits (682),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDV+LGANKF E QP+GT+AQTDKDY+EPPPAPLFEPGEL SWSF+RAGIAEF+AT
Sbjct  2    EGKEEDVRLGANKFTERQPIGTSAQTDKDYREPPPAPLFEPGELHSWSFWRAGIAEFMAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYIT+LTVMGV RS   C +VGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITVLTVMGVVRSPSKCATVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
             LARKLSLT A+FYM+M CLGAICGAGVVK
Sbjct  122  LLARKLSLTRAVFYMIMQCLGAICGAGVVK  151



>ref|XP_006413559.1| hypothetical protein EUTSA_v10025910mg [Eutrema salsugineum]
 gb|ESQ55012.1| hypothetical protein EUTSA_v10025910mg [Eutrema salsugineum]
Length=287

 Score =   267 bits (682),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 139/151 (92%), Gaps = 1/151 (1%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTD-KDYKEPPPAPLFEPGELTSWSFYRAGIAEFVA  255
            E KEEDV +GANKF E QP+GTAAQT+ KDY+EPPPAPLFEPGEL SWSFYRAGIAEF+A
Sbjct  2    EGKEEDVNVGANKFPERQPIGTAAQTESKDYQEPPPAPLFEPGELKSWSFYRAGIAEFIA  61

Query  256  TFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFG  435
            TFLFLYIT+LTVMGVKR+  +C SVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFG
Sbjct  62   TFLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  121

Query  436  LFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            LFLARKLSLT A+FY+VM CLGAICGAGVVK
Sbjct  122  LFLARKLSLTRAVFYIVMQCLGAICGAGVVK  152



>gb|ABN14348.1| aquaporin PIP1;2 [Vitis vinifera]
Length=286

 Score =   266 bits (681),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDV+LGANKF E QP+GT+AQTDKDY+EPPPAPLFEPGEL SWSF+RAGIAEF+AT
Sbjct  2    EGKEEDVRLGANKFTERQPIGTSAQTDKDYREPPPAPLFEPGELHSWSFWRAGIAEFMAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYIT+LTVMGV RS   C +VGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITVLTVMGVVRSPSKCATVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
             LARKLSLT A+FYM+M CLGAICGAGVVK
Sbjct  122  LLARKLSLTRAVFYMIMQCLGAICGAGVVK  151



>emb|CAC85292.1| putative plasma membrane intrinsic protein [Posidonia oceanica]
Length=290

 Score =   267 bits (682),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 130/152 (86%), Positives = 138/152 (91%), Gaps = 2/152 (1%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQT--DKDYKEPPPAPLFEPGELTSWSFYRAGIAEFV  252
            E KEEDVKLGANKF E QP+GTAAQT  D+DYKEPPPAPL+EPGEL SWSFYRAGIAEF+
Sbjct  2    EGKEEDVKLGANKFSERQPIGTAAQTGDDRDYKEPPPAPLYEPGELISWSFYRAGIAEFM  61

Query  253  ATFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTF  432
            ATFLFLYITILTVMG ++ D  CK+VG QGIAWAFGGMIFALVYCTAGIS GHINPAVTF
Sbjct  62   ATFLFLYITILTVMGYEKVDNKCKTVGTQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  121

Query  433  GLFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            GLFLARKLS+T ALFYMVM CLGAICGAGVVK
Sbjct  122  GLFLARKLSMTRALFYMVMQCLGAICGAGVVK  153



>gb|AEO79975.1| plasma intrinsic protein 1 [Gladiolus communis]
 gb|AFU52635.1| plasma membrane intrinsic protein, partial [Gladiolus hybrid 
cultivar]
Length=288

 Score =   266 bits (681),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 131/152 (86%), Positives = 137/152 (90%), Gaps = 2/152 (1%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTD--KDYKEPPPAPLFEPGELTSWSFYRAGIAEFV  252
            E KEEDVKLGANKF E QP+GTAAQ    KDYKEPPPAPLFEPGEL SWSFYRAGIAEF+
Sbjct  2    EGKEEDVKLGANKFSEGQPIGTAAQVSDSKDYKEPPPAPLFEPGELKSWSFYRAGIAEFI  61

Query  253  ATFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTF  432
            ATFLFLYITILTVMGV +S   C++VGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTF
Sbjct  62   ATFLFLYITILTVMGVSKSPSKCQTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  121

Query  433  GLFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            GLFLARKLSLT A+FYMVM CLGAICGAGVVK
Sbjct  122  GLFLARKLSLTRAIFYMVMQCLGAICGAGVVK  153



>ref|XP_011035995.1| PREDICTED: probable aquaporin PIP1-2 [Populus euphratica]
Length=287

 Score =   266 bits (681),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 130/152 (86%), Positives = 138/152 (91%), Gaps = 2/152 (1%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQT--DKDYKEPPPAPLFEPGELTSWSFYRAGIAEFV  252
            E KEEDV+LGANKF E QPLGTAAQ+  DKDYKEPPPAPLFEPGELTSWSFYRAGIAEF+
Sbjct  2    EGKEEDVRLGANKFNERQPLGTAAQSQDDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFM  61

Query  253  ATFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTF  432
            ATFLFLYIT+LTVMGV +    C +VGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTF
Sbjct  62   ATFLFLYITVLTVMGVSKDTTKCTTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  121

Query  433  GLFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            GLFLARKLSLT A+FYM+M CLGAICGAGVVK
Sbjct  122  GLFLARKLSLTRAVFYMLMQCLGAICGAGVVK  153



>ref|XP_010433914.1| PREDICTED: probable aquaporin PIP1-5 [Camelina sativa]
Length=287

 Score =   266 bits (681),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 139/151 (92%), Gaps = 1/151 (1%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTD-KDYKEPPPAPLFEPGELTSWSFYRAGIAEFVA  255
            E KEEDV +GANKF E QP+GTAAQT+ KDYKEPPPAPLFEPGEL SWSFYRAGIAEF+A
Sbjct  2    EGKEEDVNVGANKFPEKQPIGTAAQTESKDYKEPPPAPLFEPGELKSWSFYRAGIAEFIA  61

Query  256  TFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFG  435
            TFLFLY+T+LTVMGVKR+  +C SVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFG
Sbjct  62   TFLFLYVTVLTVMGVKRAPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  121

Query  436  LFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            LFLARKLSLT AL+Y+VM C+GAICGAGVVK
Sbjct  122  LFLARKLSLTRALYYIVMQCIGAICGAGVVK  152



>ref|XP_008787474.1| PREDICTED: probable aquaporin PIP1-2 [Phoenix dactylifera]
Length=287

 Score =   266 bits (681),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 130/151 (86%), Positives = 138/151 (91%), Gaps = 1/151 (1%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQT-DKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVA  255
            E KEEDV+LGANKF E QP+GTAAQ+ DKDYKEPPPAPLFEPGEL SWSFYRAGIAEF+A
Sbjct  2    EGKEEDVRLGANKFSERQPIGTAAQSQDKDYKEPPPAPLFEPGELQSWSFYRAGIAEFMA  61

Query  256  TFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFG  435
            TFLFLYITILTVMGV +S+  C +VGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFG
Sbjct  62   TFLFLYITILTVMGVVKSNSKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  121

Query  436  LFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            L LARKLSLT A+FYMVM CLGAICGAGVVK
Sbjct  122  LLLARKLSLTRAVFYMVMQCLGAICGAGVVK  152



>dbj|BAI94500.1| plasma membrane intrinsic protein [Dianthus caryophyllus]
Length=289

 Score =   266 bits (681),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 138/150 (92%), Gaps = 1/150 (1%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDVKLGANK+ E QP+GT+AQT KDYKEPPPAPLFEPGEL SWSFYRAGIAEF+AT
Sbjct  2    EGKEEDVKLGANKYSERQPIGTSAQT-KDYKEPPPAPLFEPGELKSWSFYRAGIAEFIAT  60

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYIT+LTVMGVKR+  +C SVG+QGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  61   FLFLYITVLTVMGVKRAPNMCASVGVQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  120

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
             LARKLSLT A+FYM+M CLGAICGAGVVK
Sbjct  121  LLARKLSLTRAVFYMIMQCLGAICGAGVVK  150



>gb|KCW72173.1| hypothetical protein EUGRSUZ_E00628 [Eucalyptus grandis]
 gb|KCW72174.1| hypothetical protein EUGRSUZ_E00628 [Eucalyptus grandis]
Length=261

 Score =   265 bits (678),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDV+ GANKF + QP+GT+AQTDKDYKEPPPAPLFEPGEL SWSFYRAGIAEFVAT
Sbjct  2    EGKEEDVREGANKFPDRQPIGTSAQTDKDYKEPPPAPLFEPGELASWSFYRAGIAEFVAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYITILTVMG   +   CK+VG+QGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITILTVMGFANNQNKCKTVGVQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FLA+KLSLT A+FYMVM CLGAICGAGVVK
Sbjct  122  FLAKKLSLTRAVFYMVMQCLGAICGAGVVK  151



>dbj|BAA22097.1| transmembrane protein [Arabidopsis thaliana]
Length=287

 Score =   266 bits (680),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 139/151 (92%), Gaps = 1/151 (1%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQ-TDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVA  255
            E KEEDV++GANKF E QP+GT+ Q TDKDYKEPPPA LFEPGEL+SWSFYRAGIAEF+A
Sbjct  2    EGKEEDVRVGANKFPERQPIGTSVQSTDKDYKEPPPASLFEPGELSSWSFYRAGIAEFIA  61

Query  256  TFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFG  435
            TFLFLYIT+LTVMGVKR+  +C SVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFG
Sbjct  62   TFLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  121

Query  436  LFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            LFLARKLSLT A+FYM+M CLGAICGAGVVK
Sbjct  122  LFLARKLSLTRAVFYMIMQCLGAICGAGVVK  152



>gb|AAF80557.1|AF188844_1 plasma membrane aquaporin [Vitis vinifera]
Length=287

 Score =   266 bits (680),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 129/150 (86%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDVKLGA KF E QPLGTAAQ+DKDYK+ PPAPLFEPGEL SWSFYRAGIAEF+AT
Sbjct  2    EGKEEDVKLGATKFTERQPLGTAAQSDKDYKDLPPAPLFEPGELKSWSFYRAGIAEFMAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYITILTVMGVK+S  +C SVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITILTVMGVKKSPTMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
             LARKLSLT A+FY++M CLGAICGAGVVK
Sbjct  122  LLARKLSLTRAIFYIIMQCLGAICGAGVVK  151



>ref|XP_004953388.1| PREDICTED: aquaporin PIP1-2-like [Setaria italica]
Length=289

 Score =   266 bits (679),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 129/153 (84%), Positives = 138/153 (90%), Gaps = 3/153 (2%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQ---TDKDYKEPPPAPLFEPGELTSWSFYRAGIAEF  249
            E KEEDV+LGANKF E QP+GTAAQ    DKDYKEPPPAPLFEPGEL SWSFYRAGIAEF
Sbjct  2    EGKEEDVRLGANKFSERQPIGTAAQGAGDDKDYKEPPPAPLFEPGELKSWSFYRAGIAEF  61

Query  250  VATFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVT  429
            VATFLFLYITILTVMGV +S+  C +VGIQGIAW+FGGMIFALVYCTAGIS GHINPAVT
Sbjct  62   VATFLFLYITILTVMGVSKSNSKCATVGIQGIAWSFGGMIFALVYCTAGISGGHINPAVT  121

Query  430  FGLFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FGLFLARKLSLT A+FY++M CLGAICGAGVVK
Sbjct  122  FGLFLARKLSLTRAIFYIIMQCLGAICGAGVVK  154



>gb|AAF71818.1|AF141898_1 putative aquaporin PIP1-2 [Vitis cinerea var. helleri x Vitis 
rupestris]
Length=286

 Score =   266 bits (679),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 126/150 (84%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDV+LGANK+ E QP+GT+AQTDKDY+EPPPAPLFEPGEL SWSF+RAGIAEF+AT
Sbjct  2    EGKEEDVRLGANKYTERQPIGTSAQTDKDYREPPPAPLFEPGELHSWSFWRAGIAEFMAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYIT+LTVMGV RS   C +VGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITVLTVMGVVRSPSKCATVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
             LARKLSLT A+FYM+M CLGAICGAGVVK
Sbjct  122  LLARKLSLTRAVFYMIMQCLGAICGAGVVK  151



>ref|XP_010456290.1| PREDICTED: probable aquaporin PIP1-4 [Camelina sativa]
Length=287

 Score =   266 bits (679),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 141/151 (93%), Gaps = 1/151 (1%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQ-TDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVA  255
            E KEEDV++GANKF E QP+GT+AQ T+KDYKEPPPAPLFEPGEL+SWSFYRAGIAEF+A
Sbjct  2    EGKEEDVRVGANKFPERQPIGTSAQSTEKDYKEPPPAPLFEPGELSSWSFYRAGIAEFIA  61

Query  256  TFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFG  435
            TFLFLYIT+LTVMGVKR+  +C +VGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFG
Sbjct  62   TFLFLYITVLTVMGVKRAPTMCATVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  121

Query  436  LFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            LFLARKLSLT A+FY++M CLGAICGAGVVK
Sbjct  122  LFLARKLSLTRAVFYIIMQCLGAICGAGVVK  152



>ref|XP_011076723.1| PREDICTED: probable aquaporin PIP1-5 [Sesamum indicum]
Length=286

 Score =   266 bits (679),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 137/151 (91%), Gaps = 1/151 (1%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQT-DKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVA  255
            ESKEEDV +GANKF E QP+GTAAQ+ DKDY+EPPP PLF P ELTSWSFYRAGIAEF+A
Sbjct  2    ESKEEDVNVGANKFSERQPIGTAAQSQDKDYREPPPEPLFVPSELTSWSFYRAGIAEFIA  61

Query  256  TFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFG  435
            TFLFLY++ILTVMGV +SD  C +VGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFG
Sbjct  62   TFLFLYVSILTVMGVSKSDSKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  121

Query  436  LFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            LFLARKLSLT ALFYMVM CLGAICGAGVVK
Sbjct  122  LFLARKLSLTRALFYMVMQCLGAICGAGVVK  152



>ref|XP_011076721.1| PREDICTED: probable aquaporin PIP1-5 [Sesamum indicum]
Length=286

 Score =   266 bits (679),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 137/151 (91%), Gaps = 1/151 (1%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQT-DKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVA  255
            ESKEEDV +GANKF E QP+GTAAQ+ DKDY+EPPP PLF P ELTSWSFYRAGIAEF+A
Sbjct  2    ESKEEDVNVGANKFSERQPIGTAAQSQDKDYREPPPEPLFVPSELTSWSFYRAGIAEFIA  61

Query  256  TFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFG  435
            TFLFLY++ILTVMGV +SD  C +VGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFG
Sbjct  62   TFLFLYVSILTVMGVNKSDSKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  121

Query  436  LFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            LFLARKLSLT ALFYMVM CLGAICGAGVVK
Sbjct  122  LFLARKLSLTRALFYMVMQCLGAICGAGVVK  152



>ref|XP_002312147.1| plasma membrane intrinsic protein 1-1 [Populus trichocarpa]
 gb|ABK96483.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEE89514.1| plasma membrane intrinsic protein 1-1 [Populus trichocarpa]
Length=287

 Score =   266 bits (679),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 129/152 (85%), Positives = 138/152 (91%), Gaps = 2/152 (1%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQT--DKDYKEPPPAPLFEPGELTSWSFYRAGIAEFV  252
            E KEEDV+LGAN+F E QP+GTAAQ+  DKDYKEPPPAPLFEPGELTSWSFYRAGIAEF+
Sbjct  2    EGKEEDVRLGANRFNERQPIGTAAQSLDDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFM  61

Query  253  ATFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTF  432
            ATFLFLYIT+LTVMGV +    C +VGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTF
Sbjct  62   ATFLFLYITVLTVMGVVKDQTKCTTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  121

Query  433  GLFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            GLFLARKLSLT A+FYMVM CLGAICGAGVVK
Sbjct  122  GLFLARKLSLTRAVFYMVMQCLGAICGAGVVK  153



>ref|XP_002454508.1| hypothetical protein SORBIDRAFT_04g032430 [Sorghum bicolor]
 gb|EES07484.1| hypothetical protein SORBIDRAFT_04g032430 [Sorghum bicolor]
Length=289

 Score =   266 bits (679),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 129/153 (84%), Positives = 138/153 (90%), Gaps = 3/153 (2%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQ---TDKDYKEPPPAPLFEPGELTSWSFYRAGIAEF  249
            E KEEDV+LGANKF E QP+GTAAQ    DKDYKEPPPAPLFEPGEL SWSFYRAGIAEF
Sbjct  2    EGKEEDVRLGANKFSERQPIGTAAQGAGDDKDYKEPPPAPLFEPGELKSWSFYRAGIAEF  61

Query  250  VATFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVT  429
            VATFLFLYITILTVMGV +S+  C +VGIQGIAW+FGGMIFALVYCTAGIS GHINPAVT
Sbjct  62   VATFLFLYITILTVMGVSKSNSKCATVGIQGIAWSFGGMIFALVYCTAGISGGHINPAVT  121

Query  430  FGLFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FGLFLARKLSLT A+FY++M CLGAICGAGVVK
Sbjct  122  FGLFLARKLSLTRAIFYIIMQCLGAICGAGVVK  154



>ref|XP_011076722.1| PREDICTED: probable aquaporin PIP1-5 [Sesamum indicum]
Length=286

 Score =   266 bits (679),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 136/151 (90%), Gaps = 1/151 (1%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQT-DKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVA  255
            ESKEEDV LGANKF E QP+GTAAQ+ DKDY EPPP PLF P ELTSWSFYRAGIAEF+A
Sbjct  2    ESKEEDVNLGANKFSERQPIGTAAQSQDKDYTEPPPEPLFVPSELTSWSFYRAGIAEFIA  61

Query  256  TFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFG  435
            TFLFLY++ILTVMGV +SD  C +VGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFG
Sbjct  62   TFLFLYVSILTVMGVNKSDSKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  121

Query  436  LFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            LFLARKLSLT ALFYMVM CLGAICGAGVVK
Sbjct  122  LFLARKLSLTRALFYMVMQCLGAICGAGVVK  152



>gb|ACC85598.1| aquaporin [Knorringia sibirica]
Length=285

 Score =   265 bits (678),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 129/150 (86%), Positives = 138/150 (92%), Gaps = 1/150 (1%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDV+LGANKF E QPLGT+AQT KDYKEPPPAPLFEPGEL+SWSFYRAGIAEFVAT
Sbjct  2    EGKEEDVRLGANKFPERQPLGTSAQT-KDYKEPPPAPLFEPGELSSWSFYRAGIAEFVAT  60

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYI+ILTVMG+KR+  +C SVGIQGIAWAFGGMIFALVYCTAGIS GH NPAVTFGL
Sbjct  61   FLFLYISILTVMGLKRAPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHTNPAVTFGL  120

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
             LARKLSLT A+FYM+M CLGAICGAGVVK
Sbjct  121  LLARKLSLTRAVFYMIMQCLGAICGAGVVK  150



>emb|CAH60719.1| putative plasma membrane intrinsic protein [Populus tremula x 
Populus tremuloides]
Length=278

 Score =   265 bits (678),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 130/152 (86%), Positives = 138/152 (91%), Gaps = 2/152 (1%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQT--DKDYKEPPPAPLFEPGELTSWSFYRAGIAEFV  252
            E KEEDV+LGANKF E QPLGTAAQ+  DKDYKEPPPAPLFEPGELTSWSFYRAGIAEF+
Sbjct  2    EGKEEDVRLGANKFNERQPLGTAAQSQDDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFM  61

Query  253  ATFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTF  432
            ATFLFLYIT+LTVMGV +    C +VGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTF
Sbjct  62   ATFLFLYITVLTVMGVVKDPTKCTTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  121

Query  433  GLFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            GLFLARKLSLT A+FYM+M CLGAICGAGVVK
Sbjct  122  GLFLARKLSLTRAVFYMLMQCLGAICGAGVVK  153



>gb|AAF71817.1| putative aquaporin PIP1-1 [Vitis cinerea var. helleri x Vitis 
rupestris]
 gb|ABN14347.1| aquaporin PIP1;1 [Vitis vinifera]
 emb|CAN77353.1| hypothetical protein VITISV_038809 [Vitis vinifera]
Length=286

 Score =   265 bits (678),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 138/151 (91%), Gaps = 1/151 (1%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQ-TDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVA  255
            E KEEDV++GANKF E QP+GTAAQ  DKDYKEPPPAPLFEPGEL SWSFYRAGIAEF+A
Sbjct  2    EGKEEDVRVGANKFSERQPIGTAAQGDDKDYKEPPPAPLFEPGELCSWSFYRAGIAEFIA  61

Query  256  TFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFG  435
            TFLFLY+++LTVMGV R+D  C +VGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFG
Sbjct  62   TFLFLYVSVLTVMGVVRADSKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  121

Query  436  LFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            LFLARKLSLT A++YMVM CLGAICGAGVVK
Sbjct  122  LFLARKLSLTRAVYYMVMQCLGAICGAGVVK  152



>gb|ACU24274.1| unknown [Glycine max]
Length=289

 Score =   265 bits (678),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 132/152 (87%), Positives = 136/152 (89%), Gaps = 2/152 (1%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQT--DKDYKEPPPAPLFEPGELTSWSFYRAGIAEFV  252
            ESKEEDV +GANKF E QP+GTAAQ   DKDYKE PPAPLFEPGEL SWSFYRAGIAEFV
Sbjct  2    ESKEEDVNVGANKFSERQPIGTAAQGGGDKDYKEAPPAPLFEPGELKSWSFYRAGIAEFV  61

Query  253  ATFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTF  432
            ATFLFLYITILTVMGV RS   C SVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTF
Sbjct  62   ATFLFLYITILTVMGVNRSPSKCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  121

Query  433  GLFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            GLFLARKLSLT ALFY++M CLGAICGAGVVK
Sbjct  122  GLFLARKLSLTRALFYIIMQCLGAICGAGVVK  153



>ref|XP_003532817.1| PREDICTED: probable aquaporin PIP1-2 [Glycine max]
 gb|KHN16814.1| Putative aquaporin PIP1-2 [Glycine soja]
Length=289

 Score =   265 bits (678),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 132/152 (87%), Positives = 136/152 (89%), Gaps = 2/152 (1%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQT--DKDYKEPPPAPLFEPGELTSWSFYRAGIAEFV  252
            ESKEEDV +GANKF E QP+GTAAQ   DKDYKE PPAPLFEPGEL SWSFYRAGIAEFV
Sbjct  2    ESKEEDVNVGANKFSERQPIGTAAQGGGDKDYKEAPPAPLFEPGELKSWSFYRAGIAEFV  61

Query  253  ATFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTF  432
            ATFLFLYITILTVMGV RS   C SVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTF
Sbjct  62   ATFLFLYITILTVMGVNRSPSKCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  121

Query  433  GLFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            GLFLARKLSLT ALFY++M CLGAICGAGVVK
Sbjct  122  GLFLARKLSLTRALFYIIMQCLGAICGAGVVK  153



>ref|XP_003616586.1| Aquaporin PIP11 [Medicago truncatula]
 gb|AAK66766.1|AF386739_1 aquaporin protein PIP1;1 [Medicago truncatula]
 gb|AES99544.1| major intrinsic protein (MIP) family transporter [Medicago truncatula]
Length=289

 Score =   265 bits (678),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 131/153 (86%), Positives = 138/153 (90%), Gaps = 3/153 (2%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTD---KDYKEPPPAPLFEPGELTSWSFYRAGIAEF  249
            E+KE+DV LGANKF E QPLG AAQ+    KDY+EPPPAPLFEP ELTSWSFYRAGIAEF
Sbjct  2    EAKEQDVSLGANKFPERQPLGIAAQSQDDPKDYQEPPPAPLFEPSELTSWSFYRAGIAEF  61

Query  250  VATFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVT  429
            VATFLFLYIT+LTVMGV R+D  CK+VGIQGIAWAFGGMIFALVYCTAGIS GHINPAVT
Sbjct  62   VATFLFLYITVLTVMGVVRADSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  121

Query  430  FGLFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FGLFLARKLSLT ALFYMVM CLGAICGAGVVK
Sbjct  122  FGLFLARKLSLTRALFYMVMQCLGAICGAGVVK  154



>gb|AIP86906.1| aquaporin [Vitis heyneana]
Length=286

 Score =   265 bits (678),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 138/151 (91%), Gaps = 1/151 (1%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQ-TDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVA  255
            E KEEDV++GANKF E QP+GTAAQ  DKDYKEPPPAPLFEPGEL SWSFYRAGIAEF+A
Sbjct  2    EGKEEDVRVGANKFSERQPIGTAAQGDDKDYKEPPPAPLFEPGELCSWSFYRAGIAEFIA  61

Query  256  TFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFG  435
            TFLFLY+++LTVMGV R+D  C +VGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFG
Sbjct  62   TFLFLYVSVLTVMGVVRADSKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  121

Query  436  LFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            LFLARKLSLT A++YMVM CLGAICGAGVVK
Sbjct  122  LFLARKLSLTRAVYYMVMQCLGAICGAGVVK  152



>ref|NP_001267918.1| aquaporin-like [Vitis vinifera]
 gb|AEZ35024.1| plasma membrane 1;1 aquaporin [Vitis vinifera]
Length=286

 Score =   265 bits (678),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 138/151 (91%), Gaps = 1/151 (1%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQ-TDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVA  255
            E KEEDV++GANKF E QP+GTAAQ  DKDYKEPPPAPLFEPGEL SWSFYRAGIAEF+A
Sbjct  2    EGKEEDVRVGANKFSERQPIGTAAQGDDKDYKEPPPAPLFEPGELCSWSFYRAGIAEFIA  61

Query  256  TFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFG  435
            TFLFLY+++LTVMGV R+D  C +VGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFG
Sbjct  62   TFLFLYVSVLTVMGVVRADSKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  121

Query  436  LFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            LFLARKLSLT A++YMVM CLGAICGAGVVK
Sbjct  122  LFLARKLSLTRAVYYMVMQCLGAICGAGVVK  152



>ref|XP_010055664.1| PREDICTED: aquaporin PIP1-2-like [Eucalyptus grandis]
 gb|KCW72172.1| hypothetical protein EUGRSUZ_E00628 [Eucalyptus grandis]
Length=287

 Score =   265 bits (678),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDV+ GANKF + QP+GT+AQTDKDYKEPPPAPLFEPGEL SWSFYRAGIAEFVAT
Sbjct  2    EGKEEDVREGANKFPDRQPIGTSAQTDKDYKEPPPAPLFEPGELASWSFYRAGIAEFVAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYITILTVMG   +   CK+VG+QGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITILTVMGFANNQNKCKTVGVQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FLA+KLSLT A+FYMVM CLGAICGAGVVK
Sbjct  122  FLAKKLSLTRAVFYMVMQCLGAICGAGVVK  151



>gb|AAA93521.1| aquaporin [Mesembryanthemum crystallinum]
Length=285

 Score =   265 bits (678),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 129/150 (86%), Positives = 137/150 (91%), Gaps = 1/150 (1%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDV+LGANKF E QPLGT+AQT KDYKEPPPAPLFEPGEL SWSF+RAGIAEFVAT
Sbjct  2    EGKEEDVRLGANKFTERQPLGTSAQT-KDYKEPPPAPLFEPGELQSWSFWRAGIAEFVAT  60

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYIT+LTVMGV+RS   C SVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  61   FLFLYITVLTVMGVQRSSSKCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  120

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
             LARKLSL+ A+FYM+M CLGAICGAGVVK
Sbjct  121  LLARKLSLSRAVFYMIMQCLGAICGAGVVK  150



>sp|Q7XSQ9.3|PIP12_ORYSJ RecName: Full=Probable aquaporin PIP1-2; AltName: Full=OsPIP1;2; 
AltName: Full=Plasma membrane intrinsic protein 1-2 [Oryza 
sativa Japonica Group]
 emb|CAH68052.1| B0103C08-B0602B01.9 [Oryza sativa Indica Group]
 gb|EAY95145.1| hypothetical protein OsI_16963 [Oryza sativa Indica Group]
 gb|EAZ31617.1| hypothetical protein OsJ_15761 [Oryza sativa Japonica Group]
Length=288

 Score =   265 bits (678),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 130/152 (86%), Positives = 136/152 (89%), Gaps = 2/152 (1%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQ--TDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFV  252
            E KEEDV+LGANKF E QP+GTAAQ   DKDYKEPPPAPLFEPGEL SWSFYRAGIAEF+
Sbjct  2    EGKEEDVRLGANKFSERQPIGTAAQGSDDKDYKEPPPAPLFEPGELKSWSFYRAGIAEFM  61

Query  253  ATFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTF  432
            ATFLFLYIT+LTVMGV  S   C +VGIQGIAW+FGGMIFALVYCTAGIS GHINPAVTF
Sbjct  62   ATFLFLYITVLTVMGVNNSTSKCATVGIQGIAWSFGGMIFALVYCTAGISGGHINPAVTF  121

Query  433  GLFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            GLFLARKLSLT ALFYMVM CLGAICGAGVVK
Sbjct  122  GLFLARKLSLTRALFYMVMQCLGAICGAGVVK  153



>ref|XP_006362987.1| PREDICTED: probable aquaporin PIP1-2-like [Solanum tuberosum]
Length=286

 Score =   265 bits (678),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 137/151 (91%), Gaps = 1/151 (1%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQT-DKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVA  255
            E +EEDV+LGANK+ E Q +G AAQ+ DKDYKEPPPAPLFEPGEL SWSFYRAGIAEFVA
Sbjct  2    EHREEDVRLGANKYSERQAIGIAAQSQDKDYKEPPPAPLFEPGELMSWSFYRAGIAEFVA  61

Query  256  TFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFG  435
            TFLFLYIT+LTVMGV +SD  C +VGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFG
Sbjct  62   TFLFLYITVLTVMGVSKSDSKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  121

Query  436  LFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            LFLARKLSLT A+FYMVM CLGAICGAGVVK
Sbjct  122  LFLARKLSLTRAVFYMVMQCLGAICGAGVVK  152



>gb|ACF84511.1| unknown [Zea mays]
 gb|ACG37183.1| aquaporin PIP1.1 [Zea mays]
 gb|AFW72702.1| plasma membrane intrinsic protein1 [Zea mays]
Length=289

 Score =   265 bits (678),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 130/153 (85%), Positives = 137/153 (90%), Gaps = 3/153 (2%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQ---TDKDYKEPPPAPLFEPGELTSWSFYRAGIAEF  249
            E KEEDV+LGANKF E QP+GTAAQ    DKDYKEPPPAPLFEPGEL SWSFYRAGIAEF
Sbjct  2    EGKEEDVRLGANKFSERQPIGTAAQGAADDKDYKEPPPAPLFEPGELKSWSFYRAGIAEF  61

Query  250  VATFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVT  429
            VATFLFLYITILTVMGV +S   C +VGIQGIAW+FGGMIFALVYCTAGIS GHINPAVT
Sbjct  62   VATFLFLYITILTVMGVSKSTSKCATVGIQGIAWSFGGMIFALVYCTAGISGGHINPAVT  121

Query  430  FGLFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FGLFLARKLSLT ALFY++M CLGAICGAGVVK
Sbjct  122  FGLFLARKLSLTRALFYIIMQCLGAICGAGVVK  154



>gb|AFJ44204.1| plasma membrane intrinsic protein 1 [Hedychium coronarium]
Length=286

 Score =   265 bits (677),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDV+LGANKF E QP+GTAAQ DKDY EPP APLFEPGEL+SWSFYRAGIAEFVAT
Sbjct  2    EGKEEDVRLGANKFPERQPIGTAAQGDKDYTEPPAAPLFEPGELSSWSFYRAGIAEFVAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYI+ILTVMGV ++D  C +VGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYISILTVMGVVKADSKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FLARKLSLT A+FY+VM CLGAICGAGVVK
Sbjct  122  FLARKLSLTRAVFYIVMQCLGAICGAGVVK  151



>gb|ACL14797.1| plasma membrane intrinsic protein 1 [Populus alba x Populus glandulosa]
Length=287

 Score =   265 bits (677),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 129/152 (85%), Positives = 138/152 (91%), Gaps = 2/152 (1%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQT--DKDYKEPPPAPLFEPGELTSWSFYRAGIAEFV  252
            E KEEDV+LGAN+F E QP+GTAAQ+  DKDYKEPPPAPLFEPGELTSWSFYRAGIAEF+
Sbjct  2    EGKEEDVRLGANRFNERQPIGTAAQSLDDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFM  61

Query  253  ATFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTF  432
            ATFLFLYIT+LTVMGV +    C +VGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTF
Sbjct  62   ATFLFLYITVLTVMGVVKDKTKCTTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  121

Query  433  GLFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            GLFLARKLSLT A+FYMVM CLGAICGAGVVK
Sbjct  122  GLFLARKLSLTRAVFYMVMQCLGAICGAGVVK  153



>gb|ABH09322.1| putative aquaporin [Vitis vinifera]
Length=286

 Score =   265 bits (677),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 138/151 (91%), Gaps = 1/151 (1%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQ-TDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVA  255
            E KEEDV++GANKF E QP+GTAAQ  DKDYKEPPPAPLFEPGEL SWSFYRAGIAEF+A
Sbjct  2    EGKEEDVRVGANKFSERQPIGTAAQGDDKDYKEPPPAPLFEPGELCSWSFYRAGIAEFIA  61

Query  256  TFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFG  435
            TFLFLY+++LTVMGV R+D  C +VGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFG
Sbjct  62   TFLFLYVSVLTVMGVVRADSKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  121

Query  436  LFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            LFLARKLSLT A++YMVM CLGAICGAGVVK
Sbjct  122  LFLARKLSLTRAVYYMVMQCLGAICGAGVVK  152



>ref|XP_010670234.1| PREDICTED: probable aquaporin PIP1-5 [Beta vulgaris subsp. vulgaris]
Length=285

 Score =   265 bits (677),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 138/150 (92%), Gaps = 1/150 (1%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDV+LGANK+ E QPLGT+AQT KDYKEPPPAPLFEPGEL SWSF+RAGIAEF+AT
Sbjct  2    EGKEEDVRLGANKYSERQPLGTSAQT-KDYKEPPPAPLFEPGELQSWSFWRAGIAEFMAT  60

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYIT+LTVMGVKR+  +C SVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  61   FLFLYITVLTVMGVKRTPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  120

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
             LARKLSLT A+FYM+M CLGAICGAGVVK
Sbjct  121  LLARKLSLTRAVFYMIMQCLGAICGAGVVK  150



>ref|XP_004976483.1| PREDICTED: aquaporin PIP1-1-like [Setaria italica]
Length=288

 Score =   265 bits (677),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/152 (84%), Positives = 137/152 (90%), Gaps = 2/152 (1%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQ--TDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFV  252
            E KEEDV+LGANK+ E QP+GTAAQ   DKDYKEPPPAPLFEPGEL SWSFYRAGIAEFV
Sbjct  2    EGKEEDVRLGANKYSERQPIGTAAQGSDDKDYKEPPPAPLFEPGELKSWSFYRAGIAEFV  61

Query  253  ATFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTF  432
            ATFLFLYI+ILTVMGV +S   C +VGIQGIAW+FGGMIFALVYCTAGIS GHINPAVTF
Sbjct  62   ATFLFLYISILTVMGVSKSQSKCATVGIQGIAWSFGGMIFALVYCTAGISGGHINPAVTF  121

Query  433  GLFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            GLFLARKLSLT A+FYM+M CLGAICGAGVVK
Sbjct  122  GLFLARKLSLTRAVFYMIMQCLGAICGAGVVK  153



>gb|KJB41349.1| hypothetical protein B456_007G100000 [Gossypium raimondii]
Length=286

 Score =   265 bits (677),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDV+LGANKF E QP+GT AQTDKDY EPPPAPLFE GEL SWSF+RAGIAEFVAT
Sbjct  2    EGKEEDVRLGANKFSERQPIGTTAQTDKDYNEPPPAPLFEHGELYSWSFWRAGIAEFVAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYIT+LTVMGV R+   C SVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITVLTVMGVNRAPSKCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
             LARKLSLT A+FYMVM CLGAICGAGVVK
Sbjct  122  LLARKLSLTRAIFYMVMQCLGAICGAGVVK  151



>gb|KHG18900.1| putative aquaporin PIP1-4 -like protein [Gossypium arboreum]
Length=286

 Score =   265 bits (677),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDV+LGANKF E QP+GT AQTDKDY EPPPAPLFE GEL SWSF+RAGIAEFVAT
Sbjct  2    EGKEEDVRLGANKFSERQPIGTTAQTDKDYNEPPPAPLFEHGELYSWSFWRAGIAEFVAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYIT+LTVMGV R+   C SVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITVLTVMGVNRAPSKCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
             LARKLSLT A+FYMVM CLGAICGAGVVK
Sbjct  122  LLARKLSLTRAIFYMVMQCLGAICGAGVVK  151



>gb|EYU32132.1| hypothetical protein MIMGU_mgv1a011344mg [Erythranthe guttata]
Length=210

 Score =   262 bits (670),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 136/150 (91%), Gaps = 1/150 (1%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDV LGANK+ E QPLGT+AQT KDYKEPPPAPLFEPGEL SWSF+RAGIAEFVAT
Sbjct  2    EGKEEDVSLGANKYSERQPLGTSAQT-KDYKEPPPAPLFEPGELKSWSFWRAGIAEFVAT  60

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYIT+LTVMGV +S   C +VGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  61   FLFLYITVLTVMGVSKSPSKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  120

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FLARKLSLT A+FY+VM CLGAICGAGVVK
Sbjct  121  FLARKLSLTRAVFYIVMQCLGAICGAGVVK  150



>ref|XP_010543744.1| PREDICTED: probable aquaporin PIP1-4 [Tarenaya hassleriana]
Length=287

 Score =   265 bits (677),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 129/153 (84%), Positives = 138/153 (90%), Gaps = 3/153 (2%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTD---KDYKEPPPAPLFEPGELTSWSFYRAGIAEF  249
            E KEEDV++GANKF E QP+GTAAQ+    KDYKEPPPAPLFE GELTSWSFYRAGIAEF
Sbjct  2    EGKEEDVRVGANKFPERQPIGTAAQSQDEGKDYKEPPPAPLFEAGELTSWSFYRAGIAEF  61

Query  250  VATFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVT  429
            +ATFLFLYI+ILTVMGVKR D +C +VGIQGIAWAFGGMIFALVYCTAGIS GHINPAVT
Sbjct  62   IATFLFLYISILTVMGVKRGDSMCATVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  121

Query  430  FGLFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
             GLFLARKLSLT A+FYMVM CLGAICGAGVVK
Sbjct  122  LGLFLARKLSLTRAVFYMVMQCLGAICGAGVVK  154



>gb|AAZ91447.1| PIP1 aquaporin [Xerophyta humilis]
Length=286

 Score =   265 bits (677),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDV+LGANKF E QP+GT+AQT++DY EPPPAPLFEPGEL+SWSFYRAGIAEF+AT
Sbjct  2    EGKEEDVRLGANKFSERQPIGTSAQTERDYVEPPPAPLFEPGELSSWSFYRAGIAEFIAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYITILTVMGV +S   C +VGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITILTVMGVVKSPTKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FLARKLSLT ALFYMVM  LGAICGAGVVK
Sbjct  122  FLARKLSLTRALFYMVMQRLGAICGAGVVK  151



>gb|AAM61041.1| aquaporin (plasma membrane intrinsic protein 1B) [Arabidopsis 
thaliana]
Length=285

 Score =   265 bits (676),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 139/150 (93%), Gaps = 1/150 (1%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDV++GANKF E QP+GT+AQ+D DYKEPPPAPLFEPGEL SWSF+RAGIAEF+AT
Sbjct  2    EGKEEDVRVGANKFPERQPIGTSAQSD-DYKEPPPAPLFEPGELASWSFWRAGIAEFIAT  60

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYIT+LTVMGVKRS  +C SVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  61   FLFLYITVLTVMGVKRSPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  120

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FLARKLSLT A++Y+VM CLGAICGAGVVK
Sbjct  121  FLARKLSLTRAVYYIVMQCLGAICGAGVVK  150



>ref|XP_010661719.1| PREDICTED: aquaporin PIP1;2 isoform X1 [Vitis vinifera]
Length=313

 Score =   266 bits (679),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDV+LGANKF E QP+GT+AQTDKDY+EPPPAPLFEPGEL SWSF+RAGIAEF+AT
Sbjct  2    EGKEEDVRLGANKFTERQPIGTSAQTDKDYREPPPAPLFEPGELHSWSFWRAGIAEFMAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYIT+LTVMGV RS   C +VGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITVLTVMGVVRSPSKCATVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
             LARKLSLT A+FYM+M CLGAICGAGVVK
Sbjct  122  LLARKLSLTRAVFYMIMQCLGAICGAGVVK  151



>emb|CAH59432.1| aquaporin 2 [Plantago major]
Length=282

 Score =   265 bits (676),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/148 (86%), Positives = 136/148 (92%), Gaps = 2/148 (1%)
 Frame = +1

Query  91   EDVKLGANKFRETQPLGTAAQT--DKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVATFL  264
            EDV LGANK+ E QP+GTAAQT  DKDYKEPPPAPLFEPGEL+SWSFYRAGIAEFVATFL
Sbjct  1    EDVNLGANKYSERQPIGTAAQTHDDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFVATFL  60

Query  265  FLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGLFL  444
            FLYIT+LTVMGV +SD  C +VGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGLFL
Sbjct  61   FLYITVLTVMGVSKSDSKCATVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGLFL  120

Query  445  ARKLSLTXALFYMVMXCLGAICGAGVVK  528
            ARKLSLT A+FYM+M CLGAICGAGVVK
Sbjct  121  ARKLSLTRAVFYMIMQCLGAICGAGVVK  148



>gb|AAF80556.1|AF188843_1 plasma membrane aquaporin [Vitis vinifera]
Length=286

 Score =   265 bits (676),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 126/150 (84%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDV+LGANKF E QP+GT+AQTDKDY+EPPPAPLFEPGEL SWSF+RAGIAEF+AT
Sbjct  2    EGKEEDVRLGANKFTERQPIGTSAQTDKDYREPPPAPLFEPGELHSWSFWRAGIAEFMAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYIT+LTVMGV RS   C +VGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITVLTVMGVVRSPSKCATVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
             LARKLSLT A+FYM+M CLGAICGA VVK
Sbjct  122  LLARKLSLTRAVFYMIMQCLGAICGASVVK  151



>gb|AEH76327.1| plasma membrane intrinsic protein 1 [Jatropha curcas]
Length=289

 Score =   265 bits (676),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/152 (84%), Positives = 139/152 (91%), Gaps = 2/152 (1%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQT--DKDYKEPPPAPLFEPGELTSWSFYRAGIAEFV  252
            E KEEDV+LGANKFRETQP+GTAAQ+  DKDY EPPPAPLFEP ELTSWSFYRAGIAEF+
Sbjct  2    EGKEEDVRLGANKFRETQPIGTAAQSQDDKDYTEPPPAPLFEPTELTSWSFYRAGIAEFI  61

Query  253  ATFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTF  432
            ATFLFLYI++LTVMGV ++   C +VGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTF
Sbjct  62   ATFLFLYISVLTVMGVVKAPTKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  121

Query  433  GLFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            GLFLARKLSLT A++YMVM CLGAICGAGVVK
Sbjct  122  GLFLARKLSLTRAIYYMVMQCLGAICGAGVVK  153



>ref|XP_006429323.1| hypothetical protein CICLE_v10012384mg [Citrus clementina]
 ref|XP_006480986.1| PREDICTED: probable aquaporin PIP1-2-like [Citrus sinensis]
 gb|ESR42563.1| hypothetical protein CICLE_v10012384mg [Citrus clementina]
 gb|KDO53256.1| hypothetical protein CISIN_1g023069mg [Citrus sinensis]
Length=287

 Score =   265 bits (676),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 126/152 (83%), Positives = 138/152 (91%), Gaps = 2/152 (1%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTD--KDYKEPPPAPLFEPGELTSWSFYRAGIAEFV  252
            E KEEDV++GAN++RE+QP+GTAAQT   KDY EPPPAPLFEPGEL+SWSFYRAGIAEFV
Sbjct  2    EGKEEDVRVGANRYRESQPIGTAAQTQDVKDYTEPPPAPLFEPGELSSWSFYRAGIAEFV  61

Query  253  ATFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTF  432
            ATFLFLYIT+LTVMGV +S   C +VGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTF
Sbjct  62   ATFLFLYITVLTVMGVSKSKSKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  121

Query  433  GLFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            GLFLARKLSLT A+FYM+M CLGAICGA VVK
Sbjct  122  GLFLARKLSLTRAVFYMIMQCLGAICGAAVVK  153



>ref|NP_001104934.1| aquaporin PIP1-2 [Zea mays]
 sp|Q9XF59.1|PIP12_MAIZE RecName: Full=Aquaporin PIP1-2; AltName: Full=Plasma membrane 
intrinsic protein 1-2; AltName: Full=ZmPIP1-2; AltName: Full=ZmPIP1;2; 
AltName: Full=ZmPIP1b [Zea mays]
 gb|AAD29676.1|AF131201_1 plasma membrane MIP protein [Zea mays]
Length=289

 Score =   265 bits (676),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 129/153 (84%), Positives = 137/153 (90%), Gaps = 3/153 (2%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQ---TDKDYKEPPPAPLFEPGELTSWSFYRAGIAEF  249
            E KEEDV+LGANKF E QP+GTAAQ    DKDYKEPPPAPLFEPGEL SWSFYRAGIAEF
Sbjct  2    EGKEEDVRLGANKFSERQPIGTAAQGAADDKDYKEPPPAPLFEPGELKSWSFYRAGIAEF  61

Query  250  VATFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVT  429
            VATFLFLYITILTVMGV +S   C +VGIQGIAW+FGGMIFALVYCTAGIS GHINPAVT
Sbjct  62   VATFLFLYITILTVMGVSKSTSKCATVGIQGIAWSFGGMIFALVYCTAGISGGHINPAVT  121

Query  430  FGLFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FGLFLARKLSLT ALFY++M CLGA+CGAGVVK
Sbjct  122  FGLFLARKLSLTRALFYIIMQCLGAVCGAGVVK  154



>gb|AFD61600.1| aquaporin PIP1 [Hevea brasiliensis]
Length=287

 Score =   265 bits (676),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 129/152 (85%), Positives = 139/152 (91%), Gaps = 2/152 (1%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQT--DKDYKEPPPAPLFEPGELTSWSFYRAGIAEFV  252
            E KEEDV+LGANK+RETQP+GTAAQ+  DKDY EPPPAPLFEP ELTSWSFYRAGIAEF+
Sbjct  2    EGKEEDVRLGANKYRETQPIGTAAQSLDDKDYTEPPPAPLFEPTELTSWSFYRAGIAEFI  61

Query  253  ATFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTF  432
            ATFLFLYI+ILTVMGV ++   C +VGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTF
Sbjct  62   ATFLFLYISILTVMGVVKAPTKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  121

Query  433  GLFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            GLFLARKLSLT AL+YMVM CLGAICGAGVVK
Sbjct  122  GLFLARKLSLTRALYYMVMQCLGAICGAGVVK  153



>gb|KDP44816.1| hypothetical protein JCGZ_01316 [Jatropha curcas]
Length=287

 Score =   264 bits (675),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 128/152 (84%), Positives = 139/152 (91%), Gaps = 2/152 (1%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQT--DKDYKEPPPAPLFEPGELTSWSFYRAGIAEFV  252
            E KEEDV+LGANKFRETQP+GTAAQ+  DKDY EPPPAPLFEP ELTSWSFYRAGIAEF+
Sbjct  2    EGKEEDVRLGANKFRETQPIGTAAQSQDDKDYTEPPPAPLFEPTELTSWSFYRAGIAEFI  61

Query  253  ATFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTF  432
            ATFLFLYI++LTVMGV ++   C +VGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTF
Sbjct  62   ATFLFLYISVLTVMGVVKAPTKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  121

Query  433  GLFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            GLFLARKLSLT A++YMVM CLGAICGAGVVK
Sbjct  122  GLFLARKLSLTRAIYYMVMQCLGAICGAGVVK  153



>gb|ACC59097.1| aquaporin [Saccharum officinarum]
Length=289

 Score =   264 bits (675),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 129/153 (84%), Positives = 137/153 (90%), Gaps = 3/153 (2%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQ---TDKDYKEPPPAPLFEPGELTSWSFYRAGIAEF  249
            E KEEDV+LGANKF E QP+GTAAQ    DKDYKEPPPAPLFEPGEL SWSFYRAGIAEF
Sbjct  2    EGKEEDVRLGANKFSERQPIGTAAQGAGDDKDYKEPPPAPLFEPGELKSWSFYRAGIAEF  61

Query  250  VATFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVT  429
            VATFLFLYITILTVMGV +S   C +VGIQGIAW+FGGMIFALVYCTAGIS GHINPAVT
Sbjct  62   VATFLFLYITILTVMGVSKSTSKCATVGIQGIAWSFGGMIFALVYCTAGISGGHINPAVT  121

Query  430  FGLFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FGLFLARKLSLT A+FY++M CLGAICGAGVVK
Sbjct  122  FGLFLARKLSLTRAIFYIIMQCLGAICGAGVVK  154



>ref|XP_010067506.1| PREDICTED: probable aquaporin PIP1-2 [Eucalyptus grandis]
 ref|XP_010067507.1| PREDICTED: probable aquaporin PIP1-2 [Eucalyptus grandis]
 gb|KCW65650.1| hypothetical protein EUGRSUZ_G03037 [Eucalyptus grandis]
Length=287

 Score =   264 bits (675),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 129/152 (85%), Positives = 136/152 (89%), Gaps = 2/152 (1%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTD--KDYKEPPPAPLFEPGELTSWSFYRAGIAEFV  252
            E +EEDV++GANKF E QP+GTAAQT   KDY+EPPPAPL EP ELTSWSFYRAGIAEFV
Sbjct  2    EGREEDVRVGANKFSERQPIGTAAQTQDGKDYREPPPAPLIEPSELTSWSFYRAGIAEFV  61

Query  253  ATFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTF  432
            ATFLFLYIT+LTVMGV RS   C SVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTF
Sbjct  62   ATFLFLYITVLTVMGVSRSPTKCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  121

Query  433  GLFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            GLFLARKLSLT A+FYMVM CLGAICGAGVVK
Sbjct  122  GLFLARKLSLTRAVFYMVMQCLGAICGAGVVK  153



>ref|XP_009143195.1| PREDICTED: aquaporin PIP1-2 isoform X1 [Brassica rapa]
Length=286

 Score =   264 bits (675),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 126/150 (84%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDV++GANKF E QP+GT+AQ+DKD KEPPPAPLFEPGEL SWSF RAGIAEF+A 
Sbjct  2    EGKEEDVRVGANKFPERQPIGTSAQSDKDCKEPPPAPLFEPGELASWSFGRAGIAEFIAA  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYIT+LTVMGVKRS  +C SVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITVLTVMGVKRSPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FLARKLSLT A++Y+VM CLGAICGAGVVK
Sbjct  122  FLARKLSLTRAVYYIVMQCLGAICGAGVVK  151



>ref|XP_003570076.1| PREDICTED: aquaporin PIP1-1-like [Brachypodium distachyon]
Length=286

 Score =   264 bits (674),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 128/153 (84%), Positives = 137/153 (90%), Gaps = 3/153 (2%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQ---TDKDYKEPPPAPLFEPGELTSWSFYRAGIAEF  249
            E KEEDV+LGANKF E QP+GTAAQ    DKDYKEPPPAPLFEPGEL SWSFYRAGIAEF
Sbjct  2    EGKEEDVRLGANKFSERQPIGTAAQGGGDDKDYKEPPPAPLFEPGELKSWSFYRAGIAEF  61

Query  250  VATFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVT  429
            +ATFLFLYIT+LTVMGV +S   C +VGIQGIAW+FGGMIFALVYCTAGIS GHINPAVT
Sbjct  62   IATFLFLYITVLTVMGVSKSPSKCATVGIQGIAWSFGGMIFALVYCTAGISGGHINPAVT  121

Query  430  FGLFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FGLFLARKLSLT A+FY+VM CLGAICGAGVVK
Sbjct  122  FGLFLARKLSLTRAIFYIVMQCLGAICGAGVVK  154



>ref|NP_001047672.1| Os02g0666200 [Oryza sativa Japonica Group]
 sp|Q6EU94.1|PIP11_ORYSJ RecName: Full=Aquaporin PIP1-1; AltName: Full=OsPIP1;1; AltName: 
Full=Plasma membrane intrinsic protein 1-1; AltName: Full=Plasma 
membrane intrinsic protein 1a; Short=PIP1a; AltName: 
Full=Water channel protein RWC1; Short=RWC-1 [Oryza sativa 
Japonica Group]
 emb|CAA11896.1| aquaporin [Oryza sativa]
 dbj|BAD28398.1| aquaporin [Oryza sativa Japonica Group]
 dbj|BAD27775.1| aquaporin [Oryza sativa Japonica Group]
 dbj|BAF09586.1| Os02g0666200 [Oryza sativa Japonica Group]
 gb|EAY86995.1| hypothetical protein OsI_08388 [Oryza sativa Indica Group]
 gb|ACA50520.1| aquaporin [Oryza sativa Japonica Group]
 gb|AEV58397.1| aquaporin [Oryza sativa Japonica Group]
 gb|AIR95997.1| aquaporin [Oryza sativa Japonica Group]
Length=289

 Score =   264 bits (674),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 128/153 (84%), Positives = 137/153 (90%), Gaps = 3/153 (2%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQ---TDKDYKEPPPAPLFEPGELTSWSFYRAGIAEF  249
            E KEEDV+LGAN++ E QP+GTAAQ    DKDYKEPPPAPLFEPGEL SWSFYRAGIAEF
Sbjct  2    EGKEEDVRLGANRYSERQPIGTAAQGAGDDKDYKEPPPAPLFEPGELKSWSFYRAGIAEF  61

Query  250  VATFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVT  429
            VATFLFLYITILTVMGV +S   C +VGIQGIAW+FGGMIFALVYCTAGIS GHINPAVT
Sbjct  62   VATFLFLYITILTVMGVSKSSSKCATVGIQGIAWSFGGMIFALVYCTAGISGGHINPAVT  121

Query  430  FGLFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FGLFLARKLSLT A+FY+VM CLGAICGAGVVK
Sbjct  122  FGLFLARKLSLTRAIFYIVMQCLGAICGAGVVK  154



>gb|AFK41734.1| unknown [Medicago truncatula]
Length=289

 Score =   264 bits (674),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 130/153 (85%), Positives = 137/153 (90%), Gaps = 3/153 (2%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTD---KDYKEPPPAPLFEPGELTSWSFYRAGIAEF  249
            E+KE+DV LGANKF E QPLG AAQ+    KDY+EPPPAPLFEP ELTSWSFYRAGIAEF
Sbjct  2    EAKEQDVSLGANKFPERQPLGIAAQSQDDPKDYQEPPPAPLFEPSELTSWSFYRAGIAEF  61

Query  250  VATFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVT  429
            VATFLFLYI +LTVMGV R+D  CK+VGIQGIAWAFGGMIFALVYCTAGIS GHINPAVT
Sbjct  62   VATFLFLYIAVLTVMGVVRADSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  121

Query  430  FGLFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FGLFLARKLSLT ALFYMVM CLGAICGAGVVK
Sbjct  122  FGLFLARKLSLTRALFYMVMQCLGAICGAGVVK  154



>gb|ACL52629.1| unknown [Zea mays]
Length=289

 Score =   264 bits (674),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 129/153 (84%), Positives = 136/153 (89%), Gaps = 3/153 (2%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQ---TDKDYKEPPPAPLFEPGELTSWSFYRAGIAEF  249
            E KEEDV+LGANKF E QP+GTAAQ    DKDYKEPPPAPLFEPGEL SWSFYRAGI EF
Sbjct  2    EGKEEDVRLGANKFSERQPIGTAAQGAADDKDYKEPPPAPLFEPGELKSWSFYRAGITEF  61

Query  250  VATFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVT  429
            VATFLFLYITILTVMGV +S   C +VGIQGIAW+FGGMIFALVYCTAGIS GHINPAVT
Sbjct  62   VATFLFLYITILTVMGVSKSTSKCATVGIQGIAWSFGGMIFALVYCTAGISGGHINPAVT  121

Query  430  FGLFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FGLFLARKLSLT ALFY++M CLGAICGAGVVK
Sbjct  122  FGLFLARKLSLTRALFYIIMQCLGAICGAGVVK  154



>gb|AAC17528.1| aquaporin 1 [Samanea saman]
Length=289

 Score =   264 bits (674),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 129/153 (84%), Positives = 136/153 (89%), Gaps = 3/153 (2%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTD---KDYKEPPPAPLFEPGELTSWSFYRAGIAEF  249
            E KE+DV LGANKF E QP+GTAAQ+    KDY+EPPPAPLFEP ELTSWSFYRAGIAEF
Sbjct  2    EGKEQDVSLGANKFSERQPIGTAAQSQDDGKDYQEPPPAPLFEPSELTSWSFYRAGIAEF  61

Query  250  VATFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVT  429
            VATFLFLYITILTVMGV RSD  CK+VGIQGIAWAFGGMIFALVYCTAGIS GHINPAVT
Sbjct  62   VATFLFLYITILTVMGVSRSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  121

Query  430  FGLFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FGLFL RKLSLT  +FY+VM CLGAICGAGVVK
Sbjct  122  FGLFLGRKLSLTRTIFYIVMQCLGAICGAGVVK  154



>ref|XP_003600864.1| Aquaporin protein PIP11 [Medicago truncatula]
 gb|AES71115.1| major intrinsic protein (MIP) family transporter [Medicago truncatula]
Length=215

 Score =   261 bits (667),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 129/153 (84%), Positives = 137/153 (90%), Gaps = 3/153 (2%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTD---KDYKEPPPAPLFEPGELTSWSFYRAGIAEF  249
            E+KE+DV LGANKF E QP+G AAQ+    KDYKEPPPAPLFEP ELTSWSFYRAGIAEF
Sbjct  2    EAKEQDVSLGANKFPERQPIGIAAQSHDDGKDYKEPPPAPLFEPSELTSWSFYRAGIAEF  61

Query  250  VATFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVT  429
            VATFLFLYITILTVMGV RS+  CK+VGIQGIAW+FGGMIFALVYCTAGIS GHINPAVT
Sbjct  62   VATFLFLYITILTVMGVNRSESKCKTVGIQGIAWSFGGMIFALVYCTAGISGGHINPAVT  121

Query  430  FGLFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FGLFLARKLSLT A+FYMVM  LGAICGAGVVK
Sbjct  122  FGLFLARKLSLTRAVFYMVMQTLGAICGAGVVK  154



>ref|XP_006827580.1| hypothetical protein AMTR_s00009p00231200 [Amborella trichopoda]
 gb|ERM94996.1| hypothetical protein AMTR_s00009p00231200 [Amborella trichopoda]
Length=287

 Score =   263 bits (673),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 137/151 (91%), Gaps = 1/151 (1%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQT-DKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVA  255
            E KEEDVKLGANKF E QP+GTAAQ+ DKDYKEPPPAPLFEP EL SWSF+RAGIAEF+A
Sbjct  2    EGKEEDVKLGANKFSERQPIGTAAQSGDKDYKEPPPAPLFEPEELKSWSFWRAGIAEFIA  61

Query  256  TFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFG  435
            TFLFLYIT+LTVMGVK+   +C SVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFG
Sbjct  62   TFLFLYITVLTVMGVKKEKTMCTSVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  121

Query  436  LFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            L LARKLSLT A+FYM+M CLGAICGAGVVK
Sbjct  122  LLLARKLSLTRAVFYMIMQCLGAICGAGVVK  152



>gb|ACR56612.1| plasma intrinsic protein 1;3 [Juglans regia]
Length=285

 Score =   263 bits (673),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 126/152 (83%), Positives = 138/152 (91%), Gaps = 2/152 (1%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTD--KDYKEPPPAPLFEPGELTSWSFYRAGIAEFV  252
            E K+EDV+LGAN++RE QP+GT AQ+   KDY+EPPPAPLFEPGEL+SWSFYRAGIAEFV
Sbjct  2    EGKDEDVRLGANRYRERQPIGTTAQSQDVKDYQEPPPAPLFEPGELSSWSFYRAGIAEFV  61

Query  253  ATFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTF  432
            ATFLFLYIT+LTVMGV RS   C SVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTF
Sbjct  62   ATFLFLYITVLTVMGVARSPSKCSSVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  121

Query  433  GLFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            GLFLARKLSLT A+FY++M CLGAICGAGVVK
Sbjct  122  GLFLARKLSLTRAVFYIIMQCLGAICGAGVVK  153



>ref|XP_006647653.1| PREDICTED: aquaporin PIP1-1-like isoform X1 [Oryza brachyantha]
Length=295

 Score =   264 bits (674),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 128/153 (84%), Positives = 137/153 (90%), Gaps = 3/153 (2%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQ---TDKDYKEPPPAPLFEPGELTSWSFYRAGIAEF  249
            E KEEDV+LGAN+F E QP+GTAAQ    DKDYKEPPPAPLFEPGEL SWSFYRAGIAEF
Sbjct  2    EGKEEDVRLGANRFSERQPIGTAAQGAGDDKDYKEPPPAPLFEPGELKSWSFYRAGIAEF  61

Query  250  VATFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVT  429
            VATFLFLYIT+LTVMGV +S   C +VGIQGIAW+FGGMIFALVYCTAGIS GHINPAVT
Sbjct  62   VATFLFLYITVLTVMGVSKSPSKCATVGIQGIAWSFGGMIFALVYCTAGISGGHINPAVT  121

Query  430  FGLFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FGLFLARKLSLT A+FY+VM CLGAICGAGVVK
Sbjct  122  FGLFLARKLSLTRAIFYIVMQCLGAICGAGVVK  154



>ref|XP_007209434.1| hypothetical protein PRUPE_ppa009588mg [Prunus persica]
 gb|EMJ10633.1| hypothetical protein PRUPE_ppa009588mg [Prunus persica]
Length=286

 Score =   263 bits (673),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 129/150 (86%), Positives = 135/150 (90%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDVKLGANKF E QP+GT+AQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEF+AT
Sbjct  2    EGKEEDVKLGANKFPERQPIGTSAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFIAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYITILTVMGV R+   C SVGIQGIAWAFGG IFALVY TAGIS GHINPAVTFGL
Sbjct  62   FLFLYITILTVMGVNRAPSKCASVGIQGIAWAFGGTIFALVYSTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FLARKLSLT A+FY+VM  LGAI GAGVVK
Sbjct  122  FLARKLSLTRAVFYIVMQTLGAIAGAGVVK  151



>ref|XP_006647654.1| PREDICTED: aquaporin PIP1-1-like isoform X2 [Oryza brachyantha]
Length=289

 Score =   263 bits (673),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 128/153 (84%), Positives = 137/153 (90%), Gaps = 3/153 (2%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQ---TDKDYKEPPPAPLFEPGELTSWSFYRAGIAEF  249
            E KEEDV+LGAN+F E QP+GTAAQ    DKDYKEPPPAPLFEPGEL SWSFYRAGIAEF
Sbjct  2    EGKEEDVRLGANRFSERQPIGTAAQGAGDDKDYKEPPPAPLFEPGELKSWSFYRAGIAEF  61

Query  250  VATFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVT  429
            VATFLFLYIT+LTVMGV +S   C +VGIQGIAW+FGGMIFALVYCTAGIS GHINPAVT
Sbjct  62   VATFLFLYITVLTVMGVSKSPSKCATVGIQGIAWSFGGMIFALVYCTAGISGGHINPAVT  121

Query  430  FGLFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FGLFLARKLSLT A+FY+VM CLGAICGAGVVK
Sbjct  122  FGLFLARKLSLTRAIFYIVMQCLGAICGAGVVK  154



>gb|AFM37319.1| aquaporin [Oryza sativa Japonica Group]
Length=289

 Score =   263 bits (673),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 128/153 (84%), Positives = 137/153 (90%), Gaps = 3/153 (2%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQ---TDKDYKEPPPAPLFEPGELTSWSFYRAGIAEF  249
            E KEEDV+LGAN++ E QP+GTAAQ    DKDYKEPPPAPLFEPGEL SWSFYRAGIAEF
Sbjct  2    EGKEEDVRLGANRYSERQPIGTAAQGAGDDKDYKEPPPAPLFEPGELKSWSFYRAGIAEF  61

Query  250  VATFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVT  429
            VATFLFLYITILTVMGV +S   C +VGIQGIAW+FGGMIFALVYCTAGIS GHINPAVT
Sbjct  62   VATFLFLYITILTVMGVSKSSSKCATVGIQGIAWSFGGMIFALVYCTAGISGGHINPAVT  121

Query  430  FGLFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FGLFLARKLSLT A+FY+VM CLGAICGAGVVK
Sbjct  122  FGLFLARKLSLTRAIFYIVMQCLGAICGAGVVK  154



>gb|AAO86706.1| plasma membrane intrinsic protein [Zea mays]
 gb|ACF82668.1| unknown [Zea mays]
 gb|ACF84488.1| unknown [Zea mays]
 tpg|DAA36473.1| TPA: aquaporin PIP1-1(ZmPIP1-1) [Zea mays]
Length=288

 Score =   263 bits (673),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 128/152 (84%), Positives = 137/152 (90%), Gaps = 2/152 (1%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQ--TDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFV  252
            E KEEDV+LGANKF E QP+GTAAQ   DKDYKEPPPAPLFEPGEL SWSFYRAGIAEFV
Sbjct  2    EGKEEDVRLGANKFSERQPIGTAAQGTDDKDYKEPPPAPLFEPGELKSWSFYRAGIAEFV  61

Query  253  ATFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTF  432
            ATFLFLYI+ILTVMGV +S   C +VGIQGIAW+FGGMIFALVYCTAGIS GHINPAVTF
Sbjct  62   ATFLFLYISILTVMGVSKSTSKCATVGIQGIAWSFGGMIFALVYCTAGISGGHINPAVTF  121

Query  433  GLFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            GLFLARKLSLT A+FY++M CLGAICGAGVVK
Sbjct  122  GLFLARKLSLTRAVFYIIMQCLGAICGAGVVK  153



>ref|XP_004173962.1| PREDICTED: LOW QUALITY PROTEIN: probable aquaporin PIP1-4-like, 
partial [Cucumis sativus]
Length=192

 Score =   260 bits (664),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 131/157 (83%), Positives = 138/157 (88%), Gaps = 7/157 (4%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTD---KDYKEPPPAPLFEPGELTSWSFYRAGIAEF  249
            E KEEDV+LGANKF E QP+GTAAQ+    KDYKEPPPAPLFEP ELTSWSFYRAGIAEF
Sbjct  2    EGKEEDVRLGANKFNERQPIGTAAQSQDDAKDYKEPPPAPLFEPEELTSWSFYRAGIAEF  61

Query  250  VATFLFLYITILTVMGVKRSDGI----CKSVGIQGIAWAFGGMIFALVYCTAGISXGHIN  417
             ATFLFLYIT+LTVMGV RS  I    CK+VGIQGIAWAFGGMIFALVYCTAGIS GHIN
Sbjct  62   FATFLFLYITVLTVMGVVRSKSIEGNTCKTVGIQGIAWAFGGMIFALVYCTAGISGGHIN  121

Query  418  PAVTFGLFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            PAVTFGLFLARKLSLT A+FY+VM CLGAICGAGVVK
Sbjct  122  PAVTFGLFLARKLSLTRAVFYIVMQCLGAICGAGVVK  158



>ref|XP_006652632.1| PREDICTED: probable aquaporin PIP1-2-like [Oryza brachyantha]
Length=295

 Score =   264 bits (674),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 129/152 (85%), Positives = 136/152 (89%), Gaps = 2/152 (1%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQ--TDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFV  252
            E KEEDV+LGANKF E QP+GTAAQ   DKDYKEPPPAPLFEPGEL SWSFYRAGIAEF+
Sbjct  2    EGKEEDVRLGANKFSERQPIGTAAQGSDDKDYKEPPPAPLFEPGELKSWSFYRAGIAEFM  61

Query  253  ATFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTF  432
            ATFLFLYIT+LTVMGV  S   C SVGIQGIAW+FGGMIFALVYCTAGIS GHINPAVTF
Sbjct  62   ATFLFLYITVLTVMGVNNSPSKCASVGIQGIAWSFGGMIFALVYCTAGISGGHINPAVTF  121

Query  433  GLFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            GLFLARKLSLT A+FY+VM CLGAICGAGVVK
Sbjct  122  GLFLARKLSLTRAVFYIVMQCLGAICGAGVVK  153



>gb|KDO69068.1| hypothetical protein CISIN_1g018895mg [Citrus sinensis]
 gb|KDO69069.1| hypothetical protein CISIN_1g018895mg [Citrus sinensis]
 gb|KDO69070.1| hypothetical protein CISIN_1g018895mg [Citrus sinensis]
Length=213

 Score =   261 bits (666),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 127/152 (84%), Positives = 135/152 (89%), Gaps = 2/152 (1%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTD--KDYKEPPPAPLFEPGELTSWSFYRAGIAEFV  252
            E KEEDV+LGANKF E QP+GTAAQT   KDY EPPPAPLFEPGEL SWSFYRAGIAEF+
Sbjct  2    EGKEEDVRLGANKFAERQPIGTAAQTQDGKDYVEPPPAPLFEPGELKSWSFYRAGIAEFI  61

Query  253  ATFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTF  432
            ATFLFLYI++LTVMGV +S+  C +VGIQGIAWAFGGMIF LVYCTAGIS GHINPAVT 
Sbjct  62   ATFLFLYISVLTVMGVVKSNTKCSTVGIQGIAWAFGGMIFVLVYCTAGISGGHINPAVTL  121

Query  433  GLFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            GLFLARKLSLT ALFYMVM CLGAICGAGVVK
Sbjct  122  GLFLARKLSLTRALFYMVMQCLGAICGAGVVK  153



>gb|ABH09323.1| putative aquaporin [Vitis vinifera]
Length=286

 Score =   263 bits (673),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 125/150 (83%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDV+LGANKF E QP+GT+AQTDKDY+EPPPAPLFEPGEL SWSF+RAGIAEF+AT
Sbjct  2    EGKEEDVRLGANKFTERQPIGTSAQTDKDYREPPPAPLFEPGELHSWSFWRAGIAEFMAT  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLF YIT+LTVMGV RS   C +VGIQGIAWAFGGMIFALVYCTAGIS GH+NPAVTFGL
Sbjct  62   FLFPYITVLTVMGVVRSPSKCATVGIQGIAWAFGGMIFALVYCTAGISGGHVNPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
             LARKLSLT A+FYM+M CLGAICGAGVVK
Sbjct  122  LLARKLSLTRAVFYMIMQCLGAICGAGVVK  151



>gb|KFK28910.1| hypothetical protein AALP_AA7G063900 [Arabis alpina]
Length=287

 Score =   263 bits (672),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 138/151 (91%), Gaps = 1/151 (1%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTD-KDYKEPPPAPLFEPGELTSWSFYRAGIAEFVA  255
            ESKEEDV +GANKF E QP+GTAAQT+ KDYKEPPPAP FE GEL SWSFYRAGIAEF+A
Sbjct  2    ESKEEDVNVGANKFPERQPIGTAAQTESKDYKEPPPAPFFERGELKSWSFYRAGIAEFIA  61

Query  256  TFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFG  435
            TFLFLYIT+LTVMGVKR+  +C SVGIQGIAWAFGGMIFALVYCTAG+S GHINPAVTFG
Sbjct  62   TFLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIFALVYCTAGVSGGHINPAVTFG  121

Query  436  LFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            LFLARKLSLT AL+Y++M CLGAICGAGVVK
Sbjct  122  LFLARKLSLTRALYYIIMQCLGAICGAGVVK  152



>gb|AAR23268.1| PIP1;2 [Spinacia oleracea]
Length=285

 Score =   263 bits (672),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 137/150 (91%), Gaps = 1/150 (1%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E K+EDV+LGANK+ E Q LGT AQ D+DYKEPPPAPLFEPGELTSWSFYRAGIAEF+AT
Sbjct  2    EGKDEDVRLGANKYGEKQGLGTVAQ-DRDYKEPPPAPLFEPGELTSWSFYRAGIAEFIAT  60

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYI+ILTVMG  R+D  CK+VGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  61   FLFLYISILTVMGYSRADNKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  120

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FLARKLSLT A+FYM+M CLGAICGAGVVK
Sbjct  121  FLARKLSLTRAVFYMIMQCLGAICGAGVVK  150



>ref|XP_011042268.1| PREDICTED: probable aquaporin PIP1-2 [Populus euphratica]
Length=288

 Score =   263 bits (672),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 128/152 (84%), Positives = 137/152 (90%), Gaps = 2/152 (1%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQT--DKDYKEPPPAPLFEPGELTSWSFYRAGIAEFV  252
            E KEEDV+LGAN+F E QP+GTAAQ+  DKDYKEPPPAPLFEPGEL SWSFYRAGIAEF+
Sbjct  2    EGKEEDVRLGANRFNERQPIGTAAQSLDDKDYKEPPPAPLFEPGELISWSFYRAGIAEFM  61

Query  253  ATFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTF  432
            ATFLFLYIT+LTVMGV +    C +VGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTF
Sbjct  62   ATFLFLYITVLTVMGVVKDQTKCTTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  121

Query  433  GLFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            GLFLARKLSLT A+FYMVM CLGAICGAGVVK
Sbjct  122  GLFLARKLSLTRAVFYMVMQCLGAICGAGVVK  153



>ref|XP_010940492.1| PREDICTED: probable aquaporin PIP1-2 [Elaeis guineensis]
Length=287

 Score =   263 bits (672),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 130/151 (86%), Positives = 136/151 (90%), Gaps = 1/151 (1%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQT-DKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVA  255
            E KEEDV+LGANKF E QP+GTAA + DKDYKEPPPAPLFEPGEL SWSFYRAGIAEF+A
Sbjct  2    EGKEEDVRLGANKFSERQPIGTAAPSQDKDYKEPPPAPLFEPGELRSWSFYRAGIAEFMA  61

Query  256  TFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFG  435
            TFLFLYITILTVMGV +S   C +VGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFG
Sbjct  62   TFLFLYITILTVMGVVKSKSKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  121

Query  436  LFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            L LARKLSLT ALFYMVM CLGAICGAGVVK
Sbjct  122  LLLARKLSLTRALFYMVMQCLGAICGAGVVK  152



>dbj|BAG68660.1| plasma membrane intrinsic protein [Tulipa gesneriana]
Length=288

 Score =   263 bits (672),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 132/152 (87%), Positives = 136/152 (89%), Gaps = 2/152 (1%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQT-DKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVA  255
            E KEEDV LGANKF E QPLGTAAQT DKDY EPPPAPLFEPGEL SWSFYRAGIAEFVA
Sbjct  2    EGKEEDVSLGANKFTEHQPLGTAAQTHDKDYTEPPPAPLFEPGELASWSFYRAGIAEFVA  61

Query  256  TFLFLYITILTVMGVKRS-DGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTF  432
            TFLFLYITILTVMGV +S    C +VGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTF
Sbjct  62   TFLFLYITILTVMGVSKSPTNKCTTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  121

Query  433  GLFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            GLFLARKLSLT A+FYM+M CLGAICGAGVVK
Sbjct  122  GLFLARKLSLTRAVFYMIMQCLGAICGAGVVK  153



>ref|XP_010240237.1| PREDICTED: probable aquaporin PIP1-2 [Brachypodium distachyon]
Length=288

 Score =   263 bits (672),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 128/152 (84%), Positives = 136/152 (89%), Gaps = 2/152 (1%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQ--TDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFV  252
            E KEEDV+LGANKF E QP+GTAAQ   DKDYKEPPPAPLFEPGEL SWSFYRAGIAEF+
Sbjct  2    EGKEEDVRLGANKFSERQPIGTAAQGSEDKDYKEPPPAPLFEPGELKSWSFYRAGIAEFM  61

Query  253  ATFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTF  432
            ATFLFLY+TILTVMGV  S   C +VGIQGIAW+FGGMIFALVYCTAGIS GHINPAVTF
Sbjct  62   ATFLFLYVTILTVMGVNNSPSKCATVGIQGIAWSFGGMIFALVYCTAGISGGHINPAVTF  121

Query  433  GLFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            GLFLARKLSLT A+FY+VM CLGAICGAGVVK
Sbjct  122  GLFLARKLSLTRAVFYIVMQCLGAICGAGVVK  153



>ref|XP_002315171.1| hypothetical protein POPTR_0010s19930g [Populus trichocarpa]
 gb|ABK95101.1| unknown [Populus trichocarpa]
 gb|EEF01342.1| hypothetical protein POPTR_0010s19930g [Populus trichocarpa]
Length=287

 Score =   263 bits (672),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 129/152 (85%), Positives = 137/152 (90%), Gaps = 2/152 (1%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQT--DKDYKEPPPAPLFEPGELTSWSFYRAGIAEFV  252
            E KEEDV+LGANKF E QPLGTAAQ+  DKDYKEPPPAPLFEP ELTSWSFYRAGIAEF+
Sbjct  2    EGKEEDVRLGANKFNERQPLGTAAQSQDDKDYKEPPPAPLFEPSELTSWSFYRAGIAEFM  61

Query  253  ATFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTF  432
            ATFLFLYIT+LTVMGV +    C +VGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTF
Sbjct  62   ATFLFLYITVLTVMGVFKDTTKCTTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  121

Query  433  GLFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            GLFLARKLSLT A+FYM+M CLGAICGAGVVK
Sbjct  122  GLFLARKLSLTRAVFYMLMQCLGAICGAGVVK  153



>ref|XP_009143196.1| PREDICTED: aquaporin PIP1-2 isoform X2 [Brassica rapa]
Length=307

 Score =   263 bits (673),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 126/150 (84%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFVAT  258
            E KEEDV++GANKF E QP+GT+AQ+DKD KEPPPAPLFEPGEL SWSF RAGIAEF+A 
Sbjct  2    EGKEEDVRVGANKFPERQPIGTSAQSDKDCKEPPPAPLFEPGELASWSFGRAGIAEFIAA  61

Query  259  FLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTFGL  438
            FLFLYIT+LTVMGVKRS  +C SVGIQGIAWAFGGMIFALVYCTAGIS GHINPAVTFGL
Sbjct  62   FLFLYITVLTVMGVKRSPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  439  FLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FLARKLSLT A++Y+VM CLGAICGAGVVK
Sbjct  122  FLARKLSLTRAVYYIVMQCLGAICGAGVVK  151



>gb|AFV92901.1| putative PIP-type aquaporin [Lolium perenne]
Length=288

 Score =   263 bits (671),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 128/152 (84%), Positives = 136/152 (89%), Gaps = 2/152 (1%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQ--TDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFV  252
            E KEEDV+LGANKF E QP+GTAAQ   DKDYKEPPPAPLFEPGEL SWSFYRAGIAEF+
Sbjct  2    EGKEEDVRLGANKFSERQPIGTAAQGSEDKDYKEPPPAPLFEPGELKSWSFYRAGIAEFM  61

Query  253  ATFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTF  432
            ATFLFLY+TILTVMGV  S   C +VGIQGIAW+FGGMIFALVYCTAGIS GHINPAVTF
Sbjct  62   ATFLFLYVTILTVMGVNNSPSKCATVGIQGIAWSFGGMIFALVYCTAGISGGHINPAVTF  121

Query  433  GLFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            GLFLARKLSLT A+FY+VM CLGAICGAGVVK
Sbjct  122  GLFLARKLSLTRAVFYIVMQCLGAICGAGVVK  153



>ref|XP_007009059.1| Plasma membrane intrinsic protein 1,4 [Theobroma cacao]
 gb|EOY17869.1| Plasma membrane intrinsic protein 1,4 [Theobroma cacao]
Length=289

 Score =   263 bits (671),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 130/153 (85%), Positives = 137/153 (90%), Gaps = 3/153 (2%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQT---DKDYKEPPPAPLFEPGELTSWSFYRAGIAEF  249
            E KEEDV+LGANKF E QP+GTAAQ+   +KDY EPPPAPLFEPGELTSWSFYRAGIAEF
Sbjct  2    EGKEEDVRLGANKFSERQPIGTAAQSQDEEKDYTEPPPAPLFEPGELTSWSFYRAGIAEF  61

Query  250  VATFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVT  429
            VATFLFLYITILTVMGV +    C +VGIQGIAWAFGGMIFALVYCTAGIS GHINPAVT
Sbjct  62   VATFLFLYITILTVMGVVKETTKCPTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  121

Query  430  FGLFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FGLFLARKLSLT A+FYMVM CLGAICGAGVVK
Sbjct  122  FGLFLARKLSLTRAIFYMVMQCLGAICGAGVVK  154



>ref|XP_002446929.1| hypothetical protein SORBIDRAFT_06g025150 [Sorghum bicolor]
 gb|EES11257.1| hypothetical protein SORBIDRAFT_06g025150 [Sorghum bicolor]
Length=288

 Score =   263 bits (671),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 127/152 (84%), Positives = 137/152 (90%), Gaps = 2/152 (1%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQ--TDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFV  252
            E KEEDV+LGANK+ E QP+GTAAQ   DKDYKEPPPAPLFEPGEL SWSFYRAGIAEFV
Sbjct  2    EGKEEDVRLGANKYSERQPIGTAAQGTDDKDYKEPPPAPLFEPGELKSWSFYRAGIAEFV  61

Query  253  ATFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTF  432
            ATFLFLYI+ILTVMGV +S   C +VGIQGIAW+FGGMIFALVYCTAGIS GHINPAVTF
Sbjct  62   ATFLFLYISILTVMGVSKSTSKCATVGIQGIAWSFGGMIFALVYCTAGISGGHINPAVTF  121

Query  433  GLFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            GLFLARKLSLT A+FY++M CLGAICGAGVVK
Sbjct  122  GLFLARKLSLTRAVFYIIMQCLGAICGAGVVK  153



>emb|CAA70156.1| transmembrane protein [Oryza sativa]
 gb|AAB18817.1| transmembrane protein [Oryza sativa Indica Group]
Length=291

 Score =   263 bits (671),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 129/152 (85%), Positives = 135/152 (89%), Gaps = 2/152 (1%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQ--TDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFV  252
            E KEEDV+LGANKF E QP+GTAAQ   DKDYKEPPPAPLFEPGEL SWSFYRAGIAEF+
Sbjct  2    EGKEEDVRLGANKFSERQPIGTAAQGSDDKDYKEPPPAPLFEPGELKSWSFYRAGIAEFM  61

Query  253  ATFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVTF  432
            ATFLFLYIT+LTVMGV  S   C +VGIQGIAW+FGGMIFALVYCTAGIS GHINPAVTF
Sbjct  62   ATFLFLYITVLTVMGVNNSTSKCATVGIQGIAWSFGGMIFALVYCTAGISGGHINPAVTF  121

Query  433  GLFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            GLFLAR LSLT ALFYMVM CLGAICGAGVVK
Sbjct  122  GLFLARNLSLTRALFYMVMQCLGAICGAGVVK  153



>gb|AFM37320.1| aquaporin [Oryza sativa Japonica Group]
Length=289

 Score =   263 bits (671),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 127/153 (83%), Positives = 137/153 (90%), Gaps = 3/153 (2%)
 Frame = +1

Query  79   ESKEEDVKLGANKFRETQPLGTAAQ---TDKDYKEPPPAPLFEPGELTSWSFYRAGIAEF  249
            E KEEDV+LGAN++ + QP+GTAAQ    DKDYKEPPPAPLFEPGEL SWSFYRAGIAEF
Sbjct  2    EGKEEDVRLGANRYSDRQPIGTAAQGAGDDKDYKEPPPAPLFEPGELKSWSFYRAGIAEF  61

Query  250  VATFLFLYITILTVMGVKRSDGICKSVGIQGIAWAFGGMIFALVYCTAGISXGHINPAVT  429
            VATFLFLYITILTVMGV +S   C +VGIQGIAW+FGGMIFALVYCTAGIS GHINPAVT
Sbjct  62   VATFLFLYITILTVMGVSKSSSKCATVGIQGIAWSFGGMIFALVYCTAGISGGHINPAVT  121

Query  430  FGLFLARKLSLTXALFYMVMXCLGAICGAGVVK  528
            FGLFLARKLSLT A+FY+VM CLGAICGAGVVK
Sbjct  122  FGLFLARKLSLTRAIFYIVMQCLGAICGAGVVK  154



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 559039970400