BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002B23

Length=414
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|EYU33614.1|  hypothetical protein MIMGU_mgv1a016641mg                146   7e-42   Erythranthe guttata [common monkey flower]
ref|XP_010232448.1|  PREDICTED: protein translation factor SUI1 h...    147   8e-42   Brachypodium distachyon [annual false brome]
ref|XP_006363526.1|  PREDICTED: protein translation factor SUI1 h...    145   1e-41   Solanum tuberosum [potatoes]
ref|XP_004244151.1|  PREDICTED: protein translation factor SUI1 h...    144   3e-41   Solanum lycopersicum
ref|XP_004248369.1|  PREDICTED: protein translation factor SUI1 h...    144   3e-41   Solanum lycopersicum
ref|XP_006352492.1|  PREDICTED: protein translation factor SUI1 h...    144   4e-41   Solanum tuberosum [potatoes]
ref|XP_009611793.1|  PREDICTED: protein translation factor SUI1 h...    144   5e-41   Nicotiana tomentosiformis
ref|XP_009771770.1|  PREDICTED: protein translation factor SUI1 h...    144   6e-41   Nicotiana sylvestris
gb|EPS74118.1|  hypothetical protein M569_00639                         143   7e-41   Genlisea aurea
ref|XP_010105571.1|  Protein translation factor SUI1-1-like protein     147   7e-41   
ref|XP_011097918.1|  PREDICTED: protein translation factor SUI1 h...    143   7e-41   Sesamum indicum [beniseed]
ref|XP_010694233.1|  PREDICTED: protein translation factor SUI1 h...    143   8e-41   Beta vulgaris subsp. vulgaris [field beet]
gb|EYU19220.1|  hypothetical protein MIMGU_mgv1a016636mg                143   9e-41   Erythranthe guttata [common monkey flower]
ref|XP_008803218.1|  PREDICTED: protein translation factor SUI1 h...    143   9e-41   Phoenix dactylifera
ref|XP_010240920.1|  PREDICTED: protein translation factor SUI1 h...    143   1e-40   Nelumbo nucifera [Indian lotus]
gb|AFW78548.1|  LOW QUALITY PROTEIN: protein translation factor SUI1    145   1e-40   
gb|EEC79466.1|  hypothetical protein OsI_20483                          145   2e-40   Oryza sativa Indica Group [Indian rice]
gb|KHG06771.1|  hypothetical protein F383_09792                         142   2e-40   Gossypium arboreum [tree cotton]
ref|XP_008341842.1|  PREDICTED: protein translation factor SUI1 h...    142   2e-40   Malus domestica [apple tree]
ref|XP_010267759.1|  PREDICTED: protein translation factor SUI1 h...    142   2e-40   Nelumbo nucifera [Indian lotus]
ref|XP_009774027.1|  PREDICTED: protein translation factor SUI1 h...    142   2e-40   Nicotiana sylvestris
ref|XP_002281872.1|  PREDICTED: protein translation factor SUI1 h...    142   2e-40   Vitis vinifera
ref|XP_009594373.1|  PREDICTED: protein translation factor SUI1 h...    142   3e-40   Nicotiana tomentosiformis
ref|XP_004304159.1|  PREDICTED: protein translation factor SUI1 h...    142   3e-40   Fragaria vesca subsp. vesca
ref|XP_006447521.1|  hypothetical protein CICLE_v10017243mg             141   4e-40   Citrus clementina [clementine]
ref|XP_009624686.1|  PREDICTED: protein translation factor SUI1 h...    141   5e-40   
ref|XP_004487600.1|  PREDICTED: protein translation factor SUI1 h...    141   5e-40   
ref|XP_004234488.1|  PREDICTED: protein translation factor SUI1 h...    141   7e-40   Solanum lycopersicum
ref|XP_009624679.1|  PREDICTED: protein translation factor SUI1 h...    140   8e-40   Nicotiana tomentosiformis
ref|XP_004487599.1|  PREDICTED: protein translation factor SUI1 h...    141   9e-40   
gb|KJB45591.1|  hypothetical protein B456_007G314200                    139   1e-39   Gossypium raimondii
gb|KJB13596.1|  hypothetical protein B456_002G083300                    140   1e-39   Gossypium raimondii
gb|KHG30632.1|  hypothetical protein F383_00215                         140   1e-39   Gossypium arboreum [tree cotton]
gb|KJB13597.1|  hypothetical protein B456_002G083300                    140   1e-39   Gossypium raimondii
gb|KHG23747.1|  hypothetical protein F383_10557                         140   1e-39   Gossypium arboreum [tree cotton]
ref|XP_007215170.1|  hypothetical protein PRUPE_ppa013601mg             140   1e-39   Prunus persica
ref|XP_007213988.1|  hypothetical protein PRUPE_ppa013607mg             140   1e-39   Prunus persica
ref|XP_007021023.1|  Translation initiation factor SUI1 family pr...    142   1e-39   
ref|XP_008244365.1|  PREDICTED: protein translation factor SUI1 h...    140   1e-39   Prunus mume [ume]
gb|EEE55519.1|  hypothetical protein OsJ_03741                          142   2e-39   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010930963.1|  PREDICTED: protein translation factor SUI1 h...    140   2e-39   Elaeis guineensis
ref|XP_009397784.1|  PREDICTED: protein translation factor SUI1 h...    140   2e-39   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABQ42058.1|  putative translation factor                             140   2e-39   Sonneratia caseolaris
ref|XP_002522857.1|  translation factor sui1, putative                  140   2e-39   
gb|ABY75806.1|  SUI1 A protein                                          139   2e-39   Opuntia streptacantha
ref|XP_011096112.1|  PREDICTED: protein translation factor SUI1 h...    139   2e-39   Sesamum indicum [beniseed]
gb|KHG12156.1|  hypothetical protein F383_20129                         139   2e-39   Gossypium arboreum [tree cotton]
gb|ABQ42057.1|  putative translation factor                             139   2e-39   Sonneratia alba
gb|KJB13598.1|  hypothetical protein B456_002G083300                    139   2e-39   Gossypium raimondii
gb|KJB62619.1|  hypothetical protein B456_009G426400                    142   2e-39   Gossypium raimondii
gb|KJB78392.1|  hypothetical protein B456_013G163400                    139   3e-39   Gossypium raimondii
ref|XP_010062975.1|  PREDICTED: protein translation factor SUI1 h...    139   3e-39   Eucalyptus grandis [rose gum]
gb|KCW46999.1|  hypothetical protein EUGRSUZ_K00804                     139   3e-39   Eucalyptus grandis [rose gum]
ref|XP_009388867.1|  PREDICTED: protein translation factor SUI1 h...    139   3e-39   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010035571.1|  PREDICTED: protein translation factor SUI1 h...    139   3e-39   Eucalyptus grandis [rose gum]
ref|XP_003564393.1|  PREDICTED: protein translation factor SUI1 h...    139   3e-39   Brachypodium distachyon [annual false brome]
gb|ADV04054.1|  eukaryotic translation initiation factor 3              139   4e-39   Hevea brasiliensis [jebe]
ref|XP_004159225.1|  PREDICTED: protein translation factor SUI1 h...    141   4e-39   
ref|XP_004294347.1|  PREDICTED: protein translation factor SUI1 h...    139   4e-39   Fragaria vesca subsp. vesca
ref|XP_009603077.1|  PREDICTED: protein translation factor SUI1 h...    139   4e-39   Nicotiana tomentosiformis
ref|XP_009412007.1|  PREDICTED: protein translation factor SUI1 h...    139   4e-39   Musa acuminata subsp. malaccensis [pisang utan]
gb|EEE67305.1|  hypothetical protein OsJ_24532                          142   5e-39   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009408662.1|  PREDICTED: protein translation factor SUI1 h...    139   5e-39   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG06773.1|  hypothetical protein F383_09794                         138   6e-39   Gossypium arboreum [tree cotton]
ref|NP_001274850.1|  uncharacterized protein LOC102577437               138   6e-39   Solanum tuberosum [potatoes]
ref|XP_010931827.1|  PREDICTED: protein translation factor SUI1 h...    138   6e-39   Elaeis guineensis
ref|XP_009417250.1|  PREDICTED: protein translation factor SUI1 h...    138   6e-39   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010539284.1|  PREDICTED: protein translation factor SUI1 h...    138   7e-39   Tarenaya hassleriana [spider flower]
emb|CDP05794.1|  unnamed protein product                                138   7e-39   Coffea canephora [robusta coffee]
ref|XP_008809850.1|  PREDICTED: protein translation factor SUI1 h...    138   7e-39   Phoenix dactylifera
ref|XP_008365631.1|  PREDICTED: protein translation factor SUI1 h...    138   7e-39   Malus domestica [apple tree]
ref|XP_009378877.1|  PREDICTED: protein translation factor SUI1 h...    138   8e-39   Pyrus x bretschneideri [bai li]
ref|XP_008784556.1|  PREDICTED: protein translation factor SUI1 h...    138   8e-39   Phoenix dactylifera
ref|XP_007132952.1|  hypothetical protein PHAVU_011G138900g             138   8e-39   Phaseolus vulgaris [French bean]
ref|XP_006475204.1|  PREDICTED: protein translation factor SUI1 h...    138   8e-39   
ref|XP_007132953.1|  hypothetical protein PHAVU_011G139000g             138   9e-39   Phaseolus vulgaris [French bean]
ref|XP_002458630.1|  hypothetical protein SORBIDRAFT_03g036990          138   9e-39   Sorghum bicolor [broomcorn]
emb|CDO99708.1|  unnamed protein product                                138   9e-39   Coffea canephora [robusta coffee]
emb|CAD58629.1|  SUI1 protein                                           138   9e-39   Coffea arabica [arabica coffee]
ref|NP_001044504.2|  Os01g0794500                                       138   9e-39   
gb|KJB62621.1|  hypothetical protein B456_009G426500                    137   9e-39   Gossypium raimondii
ref|XP_010542418.1|  PREDICTED: protein translation factor SUI1 h...    138   1e-38   Tarenaya hassleriana [spider flower]
gb|KDP39065.1|  hypothetical protein JCGZ_00822                         138   1e-38   Jatropha curcas
gb|EPS65463.1|  hypothetical protein M569_09315                         138   1e-38   Genlisea aurea
ref|NP_001150984.1|  GOS2 homolog                                       138   1e-38   
gb|ADV04053.1|  eukaryotic translation initiation factor 2              138   1e-38   Hevea brasiliensis [jebe]
ref|XP_006475205.1|  PREDICTED: protein translation factor SUI1 h...    138   1e-38   Citrus sinensis [apfelsine]
gb|KJB62620.1|  hypothetical protein B456_009G426500                    137   1e-38   Gossypium raimondii
ref|XP_009800522.1|  PREDICTED: protein translation factor SUI1 h...    137   1e-38   Nicotiana sylvestris
emb|CAD58628.1|  SUI1 protein                                           137   1e-38   Coffea arabica [arabica coffee]
ref|XP_004961617.1|  PREDICTED: protein translation factor SUI1 h...    138   1e-38   
ref|XP_011048301.1|  PREDICTED: protein translation factor SUI1 h...    137   1e-38   Populus euphratica
emb|CAC84489.1|  putative translation factor                            137   1e-38   Pinus pinaster [cluster pine]
ref|NP_001152681.1|  LOC100286322                                       137   2e-38   Zea mays [maize]
ref|XP_007021029.1|  Translation initiation factor SUI1 family pr...    137   2e-38   
ref|XP_010923943.1|  PREDICTED: protein translation factor SUI1 h...    137   2e-38   Elaeis guineensis
ref|XP_004287929.1|  PREDICTED: protein translation factor SUI1 h...    137   2e-38   Fragaria vesca subsp. vesca
ref|XP_006370639.1|  hypothetical protein POPTR_0001s44450g             137   2e-38   Populus trichocarpa [western balsam poplar]
ref|XP_008341979.1|  PREDICTED: protein translation factor SUI1 h...    137   2e-38   Malus domestica [apple tree]
ref|XP_010545205.1|  PREDICTED: protein translation factor SUI1 h...    137   2e-38   Tarenaya hassleriana [spider flower]
ref|XP_004970238.1|  PREDICTED: protein translation factor SUI1 h...    137   2e-38   Setaria italica
ref|XP_002316980.1|  hypothetical protein POPTR_0011s13810g             137   2e-38   Populus trichocarpa [western balsam poplar]
gb|AFW78550.1|  hypothetical protein ZEAMMB73_586492                    137   2e-38   
ref|XP_006370638.1|  hypothetical protein POPTR_0001s44450g             137   3e-38   Populus trichocarpa [western balsam poplar]
ref|XP_004970237.1|  PREDICTED: protein translation factor SUI1 h...    137   3e-38   
ref|XP_006377837.1|  hypothetical protein POPTR_0011s13810g             135   3e-38   
gb|AFW78551.1|  hypothetical protein ZEAMMB73_586492                    137   3e-38   
emb|CDX92777.1|  BnaC07g40350D                                          139   3e-38   
ref|XP_002280157.1|  PREDICTED: protein translation factor SUI1 h...    136   4e-38   
ref|NP_001055949.1|  Os05g0498400                                       136   4e-38   
gb|EYU27827.1|  hypothetical protein MIMGU_mgv1a016640mg                136   4e-38   Erythranthe guttata [common monkey flower]
ref|XP_006644837.1|  PREDICTED: protein translation factor SUI1 h...    136   5e-38   Oryza brachyantha
ref|NP_001059843.1|  Os07g0529800                                       136   5e-38   
ref|XP_011030847.1|  PREDICTED: protein translation factor SUI1 h...    136   5e-38   Populus euphratica
gb|KHN46541.1|  Protein translation factor SUI1 like 1                  137   6e-38   Glycine soja [wild soybean]
emb|CDY46663.1|  BnaA03g48450D                                          139   6e-38   Brassica napus [oilseed rape]
gb|AFW75026.1|  hypothetical protein ZEAMMB73_109319                    135   6e-38   
ref|XP_004144491.1|  PREDICTED: protein translation factor SUI1 h...    135   6e-38   
gb|KHG11307.1|  hypothetical protein F383_12372                         136   6e-38   Gossypium arboreum [tree cotton]
ref|NP_175831.1|  protein translation factor SUI1-2                     136   7e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007216425.1|  hypothetical protein PRUPE_ppa022105mg             137   7e-38   
gb|ABI48954.1|  putative protein translation factor Sui1                135   8e-38   Viola baoshanensis
tpg|DAA62968.1|  TPA: translation initiation factor1                    135   8e-38   
ref|XP_004144489.1|  PREDICTED: protein translation factor SUI1 h...    135   9e-38   Cucumis sativus [cucumbers]
ref|XP_009342251.1|  PREDICTED: protein translation factor SUI1 h...    135   1e-37   Pyrus x bretschneideri [bai li]
ref|NP_001238017.1|  uncharacterized protein LOC100306129               135   1e-37   Glycine max [soybeans]
ref|XP_008230087.1|  PREDICTED: protein translation factor SUI1 h...    135   1e-37   Prunus mume [ume]
ref|NP_001236633.1|  uncharacterized protein LOC100499833               135   1e-37   Glycine max [soybeans]
ref|XP_008650268.1|  PREDICTED: protein translation factor SUI1 h...    134   1e-37   Zea mays [maize]
ref|XP_009401666.1|  PREDICTED: protein translation factor SUI1 h...    135   1e-37   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006304318.1|  hypothetical protein CARUB_v10010698mg             135   1e-37   Capsella rubella
ref|XP_004515084.1|  PREDICTED: protein translation factor SUI1 h...    135   2e-37   Cicer arietinum [garbanzo]
ref|XP_006413104.1|  hypothetical protein EUTSA_v10026037mg             139   2e-37   
gb|KJB39025.1|  hypothetical protein B456_007G314400                    135   2e-37   Gossypium raimondii
ref|XP_006591819.1|  PREDICTED: uncharacterized protein LOC100306...    135   2e-37   
sp|Q9SM41.1|SUI1_SPOST  RecName: Full=Protein translation factor ...    135   2e-37   Sporobolus stapfianus [resurrection grass]
ref|XP_002310461.1|  SUI1 family protein                                135   2e-37   Populus trichocarpa [western balsam poplar]
gb|ABO15891.1|  translation initiation factor eIF1                      134   2e-37   synthetic construct
ref|XP_002310460.1|  hypothetical protein POPTR_0007s02520g             134   2e-37   Populus trichocarpa [western balsam poplar]
ref|XP_002867520.1|  hypothetical protein ARALYDRAFT_492082             134   3e-37   
ref|XP_003568176.1|  PREDICTED: protein translation factor SUI1 h...    134   3e-37   Brachypodium distachyon [annual false brome]
gb|KEH38847.1|  eukaryotic translation initiation factor SUI1           134   3e-37   Medicago truncatula
ref|NP_001104887.1|  protein translation factor SUI1 homolog            134   3e-37   Zea mays [maize]
ref|XP_004515083.1|  PREDICTED: protein translation factor SUI1 h...    134   3e-37   
sp|Q9SQF4.1|SUI1_BRAOL  RecName: Full=Protein translation factor ...    134   3e-37   Brassica oleracea
ref|NP_194443.1|  protein translation factor SUI1-1                     134   3e-37   Arabidopsis thaliana [mouse-ear cress]
gb|KEH38845.1|  eukaryotic translation initiation factor SUI1           134   3e-37   Medicago truncatula
ref|XP_004957905.1|  PREDICTED: protein translation factor SUI1 h...    134   3e-37   
gb|KJB39023.1|  hypothetical protein B456_007G314400                    134   3e-37   Gossypium raimondii
ref|XP_003527319.1|  PREDICTED: protein translation factor SUI1 h...    134   4e-37   Glycine max [soybeans]
gb|KEH29652.1|  eukaryotic translation initiation factor SUI1           134   4e-37   Medicago truncatula
ref|XP_003596650.1|  Translation factor Sui1-like protein               134   4e-37   Medicago truncatula
ref|XP_010501111.1|  PREDICTED: protein translation factor SUI1 h...    134   4e-37   Camelina sativa [gold-of-pleasure]
gb|AFC01199.1|  eukaryotic translation initiation factor                134   4e-37   Ammopiptanthus mongolicus
gb|AFK35113.1|  unknown                                                 134   5e-37   Lotus japonicus
ref|XP_010909791.1|  PREDICTED: protein translation factor SUI1 h...    133   5e-37   Elaeis guineensis
gb|KEH38846.1|  eukaryotic translation initiation factor SUI1           133   7e-37   Medicago truncatula
ref|XP_010448172.1|  PREDICTED: protein translation factor SUI1 h...    133   7e-37   Camelina sativa [gold-of-pleasure]
gb|AFK43238.1|  unknown                                                 133   8e-37   Medicago truncatula
sp|O48650.1|SUI1_SALBA  RecName: Full=Protein translation factor ...    133   9e-37   Salix bakko [Japanese willow]
ref|XP_006284788.1|  hypothetical protein CARUB_v10006056mg             133   1e-36   
gb|AGT16828.1|  protein translation factor SUI1                         133   1e-36   Saccharum hybrid cultivar R570
ref|XP_006284787.1|  hypothetical protein CARUB_v10006056mg             132   1e-36   
gb|KDP20792.1|  hypothetical protein JCGZ_21263                         132   1e-36   Jatropha curcas
ref|NP_200287.1|  translation initiation factor SUI1 family protein     132   1e-36   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001239651.1|  uncharacterized protein LOC100784390               132   2e-36   Glycine max [soybeans]
gb|AFK48465.1|  unknown                                                 132   2e-36   Lotus japonicus
ref|XP_009137639.1|  PREDICTED: protein translation factor SUI1 h...    132   2e-36   Brassica rapa
ref|XP_007132567.1|  hypothetical protein PHAVU_011G105700g             132   3e-36   Phaseolus vulgaris [French bean]
ref|XP_009109147.1|  PREDICTED: protein translation factor SUI1 h...    132   3e-36   Brassica rapa
gb|AFK48865.1|  unknown                                                 131   4e-36   Lotus japonicus
gb|EEC82174.1|  hypothetical protein OsI_26284                          141   7e-36   Oryza sativa Indica Group [Indian rice]
ref|XP_003527483.1|  PREDICTED: protein translation factor SUI1 h...    130   8e-36   Glycine max [soybeans]
gb|ACG24808.1|  protein translation factor SUI1                         130   8e-36   Zea mays [maize]
gb|KHN41202.1|  Protein translation factor SUI1 like                    130   8e-36   Glycine soja [wild soybean]
ref|XP_002985789.1|  hypothetical protein SELMODRAFT_234882             130   9e-36   Selaginella moellendorffii
ref|XP_006279715.1|  hypothetical protein CARUB_v10027405mg             130   1e-35   Capsella rubella
ref|XP_010272070.1|  PREDICTED: protein translation factor SUI1 h...    130   1e-35   Nelumbo nucifera [Indian lotus]
ref|XP_009138116.1|  PREDICTED: probable phenylalanine--tRNA liga...    133   1e-35   Brassica rapa
ref|XP_009106912.1|  PREDICTED: protein translation factor SUI1 h...    130   1e-35   Brassica rapa
emb|CDY10602.1|  BnaC03g70120D                                          130   1e-35   Brassica napus [oilseed rape]
ref|XP_006827315.1|  hypothetical protein AMTR_s00010p00266770          131   2e-35   
ref|XP_008810164.1|  PREDICTED: protein translation factor SUI1 h...    131   3e-35   
emb|CDY26128.1|  BnaC06g10680D                                          129   3e-35   Brassica napus [oilseed rape]
emb|CDP20340.1|  unnamed protein product                                129   4e-35   Coffea canephora [robusta coffee]
gb|ACS68685.1|  putative translation factor                             127   1e-34   Sonneratia alba
ref|XP_002976303.1|  hypothetical protein SELMODRAFT_232756             127   3e-34   Selaginella moellendorffii
dbj|BAN10326.1|  translation initiation factor SUI1 family protein      124   1e-33   Buxus microphylla var. japonica
emb|CDY02665.1|  BnaC02g07700D                                          130   1e-33   
ref|XP_002960838.1|  hypothetical protein SELMODRAFT_437304             124   2e-33   Selaginella moellendorffii
dbj|BAN10309.1|  eukaryotic translation initiation factor SUI1          123   3e-33   Chamaecyparis obtusa
gb|ACN30624.1|  unknown                                                 122   2e-32   Zea mays [maize]
ref|XP_009398183.1|  PREDICTED: protein translation factor SUI1 h...    121   4e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011097879.1|  PREDICTED: protein translation factor SUI1 h...    121   4e-32   Sesamum indicum [beniseed]
ref|WP_041515161.1|  hypothetical protein                               119   1e-31   
ref|XP_001756581.1|  predicted protein                                  120   1e-31   
ref|XP_004244116.1|  PREDICTED: protein translation factor SUI1 h...    120   1e-31   Solanum lycopersicum
gb|KHN02839.1|  Protein translation factor SUI1 like 2                  120   1e-31   Glycine soja [wild soybean]
ref|XP_006346213.1|  PREDICTED: protein translation factor SUI1 h...    119   1e-31   Solanum tuberosum [potatoes]
ref|XP_011095399.1|  PREDICTED: protein translation factor SUI1 h...    119   2e-31   Sesamum indicum [beniseed]
gb|KIO47718.1|  hypothetical protein SQ11_15790                         118   2e-31   Nitrosospira sp. NpAV
ref|XP_006602202.1|  PREDICTED: protein translation factor SUI1 h...    119   2e-31   Glycine max [soybeans]
ref|XP_008647990.1|  PREDICTED: LOC100286322 isoform X2                 119   4e-31   Zea mays [maize]
ref|XP_008351221.1|  PREDICTED: protein translation factor SUI1 h...    119   4e-31   
gb|AAM77753.1|AF521961_1  translation initiation factor B04             118   4e-31   Helianthus annuus
ref|XP_009628718.1|  PREDICTED: protein translation factor SUI1 h...    118   4e-31   Nicotiana tomentosiformis
ref|XP_002280065.1|  PREDICTED: protein translation factor SUI1 h...    118   5e-31   Vitis vinifera
ref|XP_006586085.1|  PREDICTED: protein translation factor SUI1 h...    119   5e-31   Glycine max [soybeans]
gb|KEH38844.1|  eukaryotic translation initiation factor SUI1           118   6e-31   Medicago truncatula
gb|ACN30667.1|  unknown                                                 118   7e-31   Zea mays [maize]
ref|XP_006833020.1|  hypothetical protein AMTR_s00094p00033760          117   9e-31   
gb|EMS63057.1|  Protein translation factor SUI1-like protein            117   1e-30   Triticum urartu
gb|ADJ67174.1|  hypothetical protein                                    117   1e-30   Jatropha curcas
ref|XP_008776100.1|  PREDICTED: protein translation factor SUI1 h...    118   1e-30   Phoenix dactylifera
gb|ADJ67213.1|  hypothetical protein                                    117   1e-30   Jatropha curcas
gb|ABK24036.1|  unknown                                                 116   2e-30   Picea sitchensis
ref|XP_010276095.1|  PREDICTED: protein translation factor SUI1 h...    116   2e-30   Nelumbo nucifera [Indian lotus]
ref|XP_003617548.1|  Translation factor SUI1-like protein               116   3e-30   Medicago truncatula
sp|O82569.1|SUI1_PIMBR  RecName: Full=Protein translation factor ...    116   4e-30   Spuriopimpinella brachycarpa
gb|EMT19520.1|  Protein translation factor SUI1-like protein            117   4e-30   
ref|XP_004500068.1|  PREDICTED: protein translation factor SUI1 h...    115   4e-30   Cicer arietinum [garbanzo]
gb|EMT21575.1|  Protein translation factor SUI1-like protein            115   6e-30   
gb|EMS51805.1|  Protein translation factor SUI1-like protein            117   7e-30   Triticum urartu
gb|KJB39022.1|  hypothetical protein B456_007G314400                    114   7e-30   Gossypium raimondii
gb|AFK38938.1|  unknown                                                 115   7e-30   Lotus japonicus
gb|KCW70138.1|  hypothetical protein EUGRSUZ_F03432                     117   8e-30   Eucalyptus grandis [rose gum]
ref|XP_010545223.1|  PREDICTED: protein translation factor SUI1 h...    115   9e-30   Tarenaya hassleriana [spider flower]
gb|AAM34279.1|AF508969_1  translation initiation factor                 115   9e-30   Triticum aestivum [Canadian hard winter wheat]
ref|XP_003562997.1|  PREDICTED: protein translation factor SUI1 h...    115   1e-29   Brachypodium distachyon [annual false brome]
ref|XP_010278682.1|  PREDICTED: protein translation factor SUI1 h...    115   1e-29   Nelumbo nucifera [Indian lotus]
ref|XP_004152930.1|  PREDICTED: protein translation factor SUI1 h...    115   1e-29   
gb|EYU33643.1|  hypothetical protein MIMGU_mgv1a016664mg                114   1e-29   Erythranthe guttata [common monkey flower]
ref|XP_004491401.1|  PREDICTED: protein translation factor SUI1 h...    114   2e-29   Cicer arietinum [garbanzo]
emb|CDY52575.1|  BnaC03g71830D                                          115   2e-29   Brassica napus [oilseed rape]
gb|ADU56181.1|  hypothetical protein                                    114   2e-29   Jatropha curcas
gb|AGS78110.1|  translation factor SUI1                                 114   2e-29   Aeschynomene filosa
gb|AGS78105.1|  translation factor SUI1                                 114   2e-29   Aeschynomene indica
gb|AFY13590.1|  translation factor SUI1                                 114   2e-29   Aeschynomene evenia
gb|ADK79108.1|  putative eukaryotic translation initiation factor...    114   2e-29   Catharanthus roseus [chatas]
ref|XP_007146479.1|  hypothetical protein PHAVU_006G043900g             114   2e-29   Phaseolus vulgaris [French bean]
ref|XP_010675717.1|  PREDICTED: protein translation factor SUI1 h...    114   3e-29   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010448878.1|  PREDICTED: protein translation factor SUI1 h...    114   3e-29   Camelina sativa [gold-of-pleasure]
gb|EMT13356.1|  Protein translation factor SUI1-like protein            114   4e-29   
ref|XP_006372949.1|  hypothetical protein POPTR_0017s06480g             113   4e-29   
emb|CDY43020.1|  BnaA03g11670D                                          113   5e-29   Brassica napus [oilseed rape]
ref|XP_010109526.1|  Protein translation factor SUI1-1-like protein     114   5e-29   
ref|XP_007212250.1|  hypothetical protein PRUPE_ppa013625mg             113   5e-29   Prunus persica
ref|XP_003600096.1|  Translation factor SUI1-like protein               113   6e-29   Medicago truncatula
gb|ADB85107.1|  translation initiation factor-like protein              112   7e-29   Jatropha curcas
ref|XP_004171416.1|  PREDICTED: protein translation factor SUI1 h...    112   7e-29   
ref|XP_010092161.1|  Protein translation factor SUI1-2-like protein     112   7e-29   Morus notabilis
ref|XP_004139787.1|  PREDICTED: protein translation factor SUI1 h...    112   1e-28   Cucumis sativus [cucumbers]
ref|XP_006401506.1|  hypothetical protein EUTSA_v10015063mg             112   1e-28   Eutrema salsugineum [saltwater cress]
gb|AFY13584.1|  translation factor SUI1                                 112   1e-28   Aeschynomene evenia
gb|ACV50429.1|  eukaryotic translation initiation factor SUI1           112   1e-28   Jatropha curcas
gb|EPS65465.1|  hypothetical protein M569_09317                         112   2e-28   Genlisea aurea
gb|KJB81730.1|  hypothetical protein B456_013G159400                    112   2e-28   Gossypium raimondii
gb|KJB11840.1|  hypothetical protein B456_002G088900                    111   2e-28   Gossypium raimondii
emb|CDP05760.1|  unnamed protein product                                111   2e-28   Coffea canephora [robusta coffee]
ref|XP_009338696.1|  PREDICTED: protein translation factor SUI1 h...    111   2e-28   Pyrus x bretschneideri [bai li]
ref|XP_008359266.1|  PREDICTED: protein translation factor SUI1 h...    111   3e-28   
gb|ACJ85979.1|  unknown                                                 111   3e-28   Medicago truncatula
ref|XP_009132417.1|  PREDICTED: protein translation factor SUI1 h...    111   3e-28   Brassica rapa
emb|CDY08751.1|  BnaA06g24730D                                          110   6e-28   Brassica napus [oilseed rape]
ref|XP_009360995.1|  PREDICTED: protein translation factor SUI1 h...    110   6e-28   Pyrus x bretschneideri [bai li]
ref|XP_009120023.1|  PREDICTED: protein translation factor SUI1 h...    110   8e-28   
ref|XP_002866067.1|  hypothetical protein ARALYDRAFT_918633             110   9e-28   Arabidopsis lyrata subsp. lyrata
ref|XP_010060345.1|  PREDICTED: protein translation factor SUI1 h...    109   1e-27   Eucalyptus grandis [rose gum]
gb|KHG17081.1|  Protein translation factor SUI1                         111   1e-27   Gossypium arboreum [tree cotton]
gb|KCW66993.1|  hypothetical protein EUGRSUZ_F00759                     113   2e-27   Eucalyptus grandis [rose gum]
gb|KCW66994.1|  hypothetical protein EUGRSUZ_F00759                     113   2e-27   Eucalyptus grandis [rose gum]
emb|CDY17292.1|  BnaA10g09260D                                          112   2e-27   Brassica napus [oilseed rape]
ref|NP_568818.1|  translation initiation factor SUI1 family protein     108   2e-27   Arabidopsis thaliana [mouse-ear cress]
gb|KHN11920.1|  Protein translation factor SUI1-like protein            108   3e-27   Glycine soja [wild soybean]
ref|XP_006281351.1|  hypothetical protein CARUB_v10027407mg             108   3e-27   
ref|XP_008349901.1|  PREDICTED: protein translation factor SUI1 h...    108   3e-27   
ref|XP_010482910.1|  PREDICTED: protein translation factor SUI1 h...    108   3e-27   Camelina sativa [gold-of-pleasure]
gb|AFD22856.1|  eukaryotic translation initiation factor SUI1-lik...    108   5e-27   Tamarix androssowii
ref|XP_001752498.1|  predicted protein                                  107   8e-27   
ref|XP_004294387.1|  PREDICTED: protein translation factor SUI1 h...    107   1e-26   
gb|ABY75807.1|  SUI1 B protein                                          106   2e-26   
emb|CDY28684.1|  BnaCnng05700D                                          111   3e-26   
ref|XP_006352509.1|  PREDICTED: protein translation factor SUI1 h...    106   3e-26   
ref|XP_008365050.1|  PREDICTED: protein translation factor SUI1 h...    106   3e-26   
ref|XP_007020819.1|  Translation initiation factor SUI1 family pr...    106   3e-26   
ref|XP_011011189.1|  PREDICTED: protein translation factor SUI1 h...    104   1e-25   
gb|KHN38274.1|  Protein translation factor SUI1 like                    103   2e-25   
ref|XP_002532561.1|  translation factor sui1, putative                  102   5e-25   
emb|CDP05492.1|  unnamed protein product                                100   1e-24   
ref|XP_006452372.1|  hypothetical protein CICLE_v10009975mg             101   1e-24   
ref|XP_007142286.1|  hypothetical protein PHAVU_008G267800g             100   3e-24   
emb|CAB56294.1|  putative protein translation factor                  99.8    6e-24   
ref|XP_002316065.1|  hypothetical protein POPTR_0010s16160g           99.8    7e-24   
emb|CDP00312.1|  unnamed protein product                                102   7e-24   
emb|CDP11099.1|  unnamed protein product                              97.8    6e-23   
dbj|BAM75528.1|  putative eukaryotic translation initiation facto...  94.4    2e-22   
ref|XP_002949286.1|  hypothetical protein VOLCADRAFT_109710           95.1    6e-22   
ref|XP_005645489.1|  translation initiation factor SU                 94.7    8e-22   
ref|XP_001691459.1|  translation initiation protein                   94.4    1e-21   
gb|ADM67806.1|  putative eukaryotic translation initiation factor...  92.4    1e-21   
ref|XP_010533344.1|  PREDICTED: protein translation factor SUI1 h...  92.8    2e-21   
gb|ADM67808.1|  putative eukaryotic translation initiation factor...  91.3    5e-21   
ref|XP_010327265.1|  PREDICTED: protein translation factor SUI1 h...  90.9    3e-20   
gb|KIZ01467.1|  putative Protein translation factor SUI1 like pro...  92.8    3e-20   
ref|XP_010092162.1|  Protein translation factor SUI1-like protein     89.4    1e-19   
ref|XP_964345.2|  translation factor sui1                             88.2    3e-19   
gb|KDD75795.1|  hypothetical protein H632_c495p1                      87.4    5e-19   
dbj|BAF63490.1|  translational initiation factor eIF1                 85.5    1e-18   
gb|EIE79257.1|  translation initiation factor SUI1                    84.7    4e-18   
ref|XP_005847583.1|  hypothetical protein CHLNCDRAFT_133842           84.0    1e-17   
gb|KIY68625.1|  eukaryotic translation initiation factor SUI1         83.6    2e-17   
gb|KIY50999.1|  eukaryotic translation initiation factor 1            83.2    2e-17   
ref|XP_001902992.1|  hypothetical protein                             83.6    2e-17   
ref|XP_007338565.1|  eukaryotic translation initiation factor 1       82.8    3e-17   
ref|XP_007799176.1|  putative translation initiation factor protein   82.8    3e-17   
ref|XP_007286334.1|  translation initiation factor                    82.4    3e-17   
ref|XP_009025362.1|  hypothetical protein HELRODRAFT_163156           82.4    4e-17   
gb|ELU11301.1|  hypothetical protein CAPTEDRAFT_160473                82.0    4e-17   
gb|KDQ60757.1|  hypothetical protein JAAARDRAFT_31728                 82.0    5e-17   
ref|XP_009217014.1|  eukaryotic translation initiation factor eIF-1   82.0    5e-17   
ref|XP_003651368.1|  hypothetical protein THITE_126353                82.4    5e-17   
ref|XP_001878593.1|  predicted protein                                82.0    5e-17   
gb|EFQ29558.1|  translation initiation factor SUI1                    82.0    6e-17   
emb|CCF41479.1|  eukaryotic translation initiation factor eIF-1       82.0    6e-17   
gb|ERZ95524.1|  hypothetical protein GLOINDRAFT_341178                81.6    7e-17   
ref|XP_007300579.1|  eukaryotic translation initiation factor 1       81.6    8e-17   
ref|XP_005539321.1|  probable eukaryotic translation initiation f...  81.6    8e-17   
gb|EQB58948.1|  hypothetical protein CGLO_00736                       81.6    8e-17   
ref|XP_006691717.1|  hypothetical protein CTHT_0011990                81.6    8e-17   
gb|KIM24002.1|  hypothetical protein M408DRAFT_332058                 81.3    1e-16   
ref|XP_002395015.1|  hypothetical protein MPER_05004                  80.9    1e-16   
ref|XP_001833664.2|  eukaryotic translation initiation factor 1       80.9    1e-16   
ref|XP_003035163.1|  hypothetical protein SCHCODRAFT_81353            80.9    1e-16   
gb|ENH77587.1|  translation initiation factor                         80.9    1e-16   
gb|KII88592.1|  hypothetical protein PLICRDRAFT_111559                80.9    1e-16   
ref|XP_001222661.1|  conserved hypothetical protein                   81.3    1e-16   
gb|KIK06524.1|  hypothetical protein K443DRAFT_129804                 80.9    1e-16   
ref|XP_005707772.1|  protein translation factor                       80.9    1e-16   
gb|EUC62160.1|  eukaryotic translation initiation factor SUI1         80.5    2e-16   
emb|CCF52891.1|  probable translation initiation factor SUI1          80.5    2e-16   
ref|XP_011423571.1|  PREDICTED: eukaryotic translation initiation...  80.5    2e-16   
emb|CEG82542.1|  Putative Translation initiation factor SUI1          80.5    2e-16   
emb|CEJ03608.1|  Putative Translation initiation factor SUI1          80.5    2e-16   
dbj|BAK05450.1|  predicted protein                                    80.5    2e-16   
emb|CCO28058.1|  Protein translation factor SUI1                      80.1    2e-16   
ref|XP_007763994.1|  eukaryotic translation initiation factor SUI1    79.7    3e-16   
gb|KDR81774.1|  hypothetical protein GALMADRAFT_239964                79.7    4e-16   
gb|KJA27496.1|  hypothetical protein HYPSUDRAFT_35413                 79.7    4e-16   
gb|ELQ38364.1|  translation factor SUI1                               80.5    4e-16   
gb|KEQ95419.1|  hypothetical protein AUEXF2481DRAFT_5024              79.7    4e-16   
gb|KEQ66269.1|  putative translation initiation factor SUI1           79.7    5e-16   
emb|CEG78008.1|  Putative Translation initiation factor SUI1          79.3    5e-16   
gb|KIY98436.1|  putative Protein translation factor SUI1 like pro...  79.3    5e-16   
ref|XP_007385723.1|  eukaryotic translation initiation factor 1       79.3    6e-16   
emb|CDH49154.1|  eukaryotic translation initiation factor 1           79.3    6e-16   
gb|KEQ72568.1|  putative translation initiation factor SUI1           79.7    6e-16   
dbj|GAN03056.1|  eukaryotic translation initiation factor SUI1        79.0    6e-16   
ref|XP_003716163.1|  eukaryotic translation initiation factor eIF-1   79.0    7e-16   
ref|XP_007321854.1|  hypothetical protein SERLADRAFT_475242           79.0    7e-16   
gb|EJU05625.1|  eukaryotic translation initiation factor 1            79.0    7e-16   
gb|EPB81403.1|  hypothetical protein HMPREF1544_11892                 79.0    7e-16   
ref|XP_007590547.1|  dioxygenase                                      83.2    8e-16   
gb|AAA53420.1|  ORF                                                   78.2    8e-16   
gb|KIM87020.1|  hypothetical protein PILCRDRAFT_815455                79.0    8e-16   
emb|CBQ73048.1|  probable translation initiation factor SUI1          79.0    9e-16   
dbj|GAC71792.1|  translation initiation factor 1                      79.0    9e-16   
gb|ERT03110.1|  translation initiation factor SUI1                    79.0    9e-16   
gb|EPE08281.1|  translation initiation factor                         79.0    9e-16   
emb|CDI53525.1|  probable translation initiation factor SUI1          79.0    9e-16   
ref|XP_003580602.2|  PREDICTED: splicing factor, proline- and glu...  81.3    1e-15   
ref|XP_008382302.1|  PREDICTED: protein translation factor SUI1 h...  79.0    1e-15   
emb|CCA69219.1|  probable translation initiation factor SUI1          78.6    1e-15   
gb|EIE77311.1|  translation initiation factor SUI1                    78.6    1e-15   
gb|ELU44743.1|  SUI1 domain-containing protein                        80.5    1e-15   
ref|XP_005834881.1|  translation initiation factor 1                  78.2    1e-15   
gb|KIK49310.1|  hypothetical protein CY34DRAFT_7608                   78.2    1e-15   
gb|EST05525.1|  translation initiation factor 1                       78.6    1e-15   
ref|XP_011389050.1|  putative translation initiation factor eIF1      78.2    1e-15   
emb|CDJ37258.1|  translation initiation factor SUI1, putative         79.7    2e-15   
gb|KIM49411.1|  hypothetical protein M413DRAFT_438590                 77.8    2e-15   
gb|KGB79584.1|  Sui1 protein                                          78.6    2e-15   
ref|XP_004706531.1|  PREDICTED: eukaryotic translation initiation...  77.8    2e-15   
ref|XP_011122353.1|  hypothetical protein AOL_s00079g176              77.4    3e-15   
ref|XP_006675909.1|  hypothetical protein BATDEDRAFT_84447            77.4    3e-15   
ref|XP_011396751.1|  Translation factor SUI1-like protein 1           78.2    3e-15   
ref|XP_569282.1|  suppressor of initiator codon mutations             78.2    3e-15   
dbj|BAD97168.1|  translation factor sui1 homolog                      77.4    3e-15   
ref|XP_452335.1|  hypothetical protein                                77.0    3e-15   
gb|EFX04119.1|  translation initiation factor                         77.4    3e-15   
emb|CDO92794.1|  unnamed protein product                              77.0    3e-15   
gb|KHK00035.1|  Translation initiation factor SUI1                    77.4    3e-15   
ref|XP_006041882.1|  PREDICTED: eukaryotic translation initiation...  77.0    4e-15   
ref|XP_009172778.1|  hypothetical protein T265_08648                  77.4    4e-15   
ref|XP_004194644.1|  Piso0_005151                                     77.0    4e-15   
gb|ETS64770.1|  hypothetical protein PaG_00729                        79.0    5e-15   
ref|XP_003957154.1|  hypothetical protein KAFR_0D03710                76.6    5e-15   
ref|XP_007843726.1|  eukaryotic translation initiation factor 1       76.6    6e-15   
gb|ACD99647.1|  translation initiation factor                         78.6    6e-15   
ref|XP_002497891.1|  ZYRO0F15884p                                     76.3    6e-15   
gb|ESW98385.1|  Eukaryotic translation initiation factor eIF-1        76.3    6e-15   
emb|CDS29728.1|  protein translation factor sui1                      76.3    6e-15   
ref|XP_003673034.1|  hypothetical protein NCAS_0A00830                76.3    6e-15   
gb|EFX82803.1|  hypothetical protein DAPPUDRAFT_302358                76.3    6e-15   
ref|XP_003680684.1|  hypothetical protein TDEL_0C05840                76.3    7e-15   
ref|XP_003670956.1|  hypothetical protein NDAI_0F03950                76.3    7e-15   
ref|XP_004195741.1|  Piso0_005151                                     76.3    7e-15   
gb|KIO26221.1|  hypothetical protein M407DRAFT_243788                 76.3    7e-15   
gb|EAY95661.1|  hypothetical protein OsI_17527                        78.2    7e-15   
emb|CCK70740.1|  hypothetical protein KNAG_0F00710                    76.3    8e-15   
ref|XP_003881674.1|  hypothetical protein NCLIV_014350                76.3    8e-15   
emb|CDJ53436.1|  translation initiation factor SUI1, putative         76.3    8e-15   
ref|XP_007007858.1|  hypothetical protein TREMEDRAFT_74789            77.4    8e-15   
ref|XP_004895335.1|  PREDICTED: eukaryotic translation initiation...  76.3    8e-15   
emb|CDI82568.1|  translation initiation factor SUI1, putative         77.0    8e-15   
emb|CDF91750.1|  ZYBA0S14-00166g1_1                                   75.9    9e-15   
gb|KFH67692.1|  protein translation factor sui1                       75.9    9e-15   
gb|ABV44713.1|  translation initiation factor 1-like protein          75.9    1e-14   
ref|XP_002448570.1|  hypothetical protein SORBIDRAFT_06g029340        78.2    1e-14   
emb|CAJ86367.1|  OSIGBa0117N13.11                                     77.8    1e-14   
ref|XP_005717422.1|  Translation initiation factor eIF1               75.9    1e-14   
ref|XP_448041.1|  hypothetical protein                                75.9    1e-14   
gb|KIJ69226.1|  hypothetical protein HYDPIDRAFT_145043                75.9    1e-14   
ref|NP_983701.1|  ADL395Cp                                            75.9    1e-14   
gb|KIK59823.1|  hypothetical protein GYMLUDRAFT_59941                 75.9    1e-14   
gb|KIL68601.1|  hypothetical protein M378DRAFT_120853                 76.3    1e-14   
gb|ENN73110.1|  hypothetical protein YQE_10251                        75.9    1e-14   
emb|CCX04933.1|  Similar to Eukaryotic translation initiation fac...  77.4    1e-14   
emb|CEP64385.1|  LALA0S11e02872g1_1                                   75.5    1e-14   
ref|XP_011056576.1|  PREDICTED: protein translation factor SUI1 h...  77.4    1e-14   
ref|XP_002554352.1|  KLTH0F03234p                                     75.5    1e-14   
ref|XP_501559.1|  YALI0C07524p                                        75.5    1e-14   
gb|EKG12568.1|  Translation initiation factor SUI1                    75.9    1e-14   
ref|XP_002838067.1|  hypothetical protein                             75.9    1e-14   
emb|CCX32951.1|  Similar to Eukaryotic translation initiation fac...  75.9    1e-14   
ref|XP_011257191.1|  PREDICTED: LOW QUALITY PROTEIN: protein tran...  77.4    1e-14   
ref|NP_001037082.1|  protein translation factor SUI1 homolog          75.5    1e-14   
emb|CCG84468.1|  protein of unknown function                          75.1    1e-14   
gb|EPE06938.1|  translation initiation factor                         77.4    2e-14   
ref|XP_003684518.1|  hypothetical protein TPHA_0B04140                75.5    2e-14   
ref|XP_004177891.1|  hypothetical protein TBLA_0A05790                75.5    2e-14   
ref|XP_001646920.1|  hypothetical protein Kpol_2000p26                75.5    2e-14   
ref|NP_014155.1|  translation initiation factor eIF1                  75.1    2e-14   
ref|XP_011105142.1|  sui1p                                            75.1    2e-14   
gb|AJT06393.1|  Sui1p                                                 75.1    2e-14   
gb|EPX75032.1|  translation initiation factor eIF1                    75.1    2e-14   
ref|XP_002369246.1|  translation initiation factor SUI1, putative     75.5    2e-14   
dbj|GAA25864.1|  K7_Sui1p                                             75.1    2e-14   
ref|XP_002130503.1|  PREDICTED: eukaryotic translation initiation...  75.1    2e-14   
dbj|BAF63625.1|  Sui1 translation initiation factor                   73.9    2e-14   
dbj|BAN20281.1|  conserved hypothetical protein                       75.1    2e-14   
ref|XP_004477759.1|  PREDICTED: eukaryotic translation initiation...  75.1    2e-14   
gb|ADB54840.1|  eukaryotic translation initiation factor 1            75.1    2e-14   
ref|XP_002019643.1|  GL12102                                          75.1    2e-14   
ref|XP_008551957.1|  PREDICTED: protein translation factor SUI1 h...  75.1    2e-14   
ref|XP_003486256.1|  PREDICTED: protein translation factor SUI1 h...  75.1    2e-14   
ref|XP_002172371.1|  translation initiation factor eIF1               74.7    2e-14   
ref|XP_005187256.1|  PREDICTED: protein translation factor SUI1 h...  74.7    2e-14   
gb|EPY49607.1|  translation initiation factor eIF1                    74.7    2e-14   
ref|XP_007585493.1|  putative translation initiation factor protein   75.1    2e-14   
ref|NP_595863.1|  translation initiation factor eIF1                  74.7    2e-14   
ref|XP_004519899.1|  PREDICTED: protein translation factor SUI1 h...  74.7    3e-14   
ref|XP_002066294.1|  GK18213                                          74.7    3e-14   
emb|CCJ30544.1|  unnamed protein product                              74.7    3e-14   
emb|CDR41170.1|  CYFA0S06e03092g1_1                                   75.5    3e-14   
emb|CDJ28170.1|  translation initiation factor SUI1, putative         74.7    3e-14   
ref|XP_001731784.1|  hypothetical protein MGL_1052                    74.7    3e-14   
ref|XP_008328667.1|  PREDICTED: eukaryotic translation initiation...  74.3    3e-14   
gb|ETN67045.1|  sui1                                                  74.3    4e-14   
ref|XP_002432016.1|  translation factor sui1, putative                74.3    4e-14   
gb|AGM32795.1|  eukaryotic initiation factor 1                        74.3    4e-14   
ref|XP_001661080.1|  AAEL010843-PA                                    74.3    4e-14   
ref|XP_972771.1|  PREDICTED: protein translation factor SUI1 homolog  74.3    4e-14   
ref|XP_005344888.1|  PREDICTED: eukaryotic translation initiation...  74.3    4e-14   
gb|ABR27954.1|  translation initiation factor 1                       73.9    5e-14   
ref|XP_009268812.1|  Protein translation factor SUI1                  74.3    5e-14   
emb|CDJ57493.1|  translation initiation factor SUI1, putative         74.3    5e-14   
ref|XP_006959410.1|  eukaryotic translation initiation factor SUI1    74.3    5e-14   
ref|NP_001155788.1|  eukaryotic translation initiation factor 1       73.9    5e-14   
ref|XP_001863733.1|  sui1                                             73.9    5e-14   
emb|CDK25787.1|  unnamed protein product                              73.9    5e-14   
ref|NP_647792.1|  CG17737                                             73.6    6e-14   
gb|ESZ90543.1|  translation initiation factor 3                       75.1    7e-14   
ref|XP_007418771.1|  hypothetical protein MELLADRAFT_84135            73.6    7e-14   
ref|XP_316499.2|  AGAP006459-PA                                       73.6    7e-14   
dbj|BAA74836.1|  SUI1 homologue                                       73.2    7e-14   
ref|XP_007267881.1|  eukaryotic translation initiation factor SUI1    73.6    9e-14   
emb|CDJ79841.1|  eukaryotic translation initiation factor 1           73.2    9e-14   
dbj|GAA57591.1|  translation initiation factor 1                      73.6    1e-13   
ref|XP_003319710.1|  hypothetical protein PGTG_01884                  73.2    1e-13   
ref|XP_004334397.1|  protein translation factor, putative             73.2    1e-13   
gb|KIM62075.1|  hypothetical protein SCLCIDRAFT_15919                 73.2    1e-13   
gb|KHO00973.1|  eukaryotic translation initiation factor eIF-1        73.9    1e-13   
emb|CCU98100.1|  unnamed protein product                              73.2    1e-13   
ref|XP_007916229.1|  putative translation initiation factor protein   73.2    1e-13   
ref|XP_002907417.1|  eukaryotic translation initiation factor 1b,...  72.8    1e-13   
ref|XP_002140813.1|  translation initiation factor SUI1               72.8    1e-13   
ref|XP_001804771.1|  hypothetical protein SNOG_14589                  72.8    1e-13   
ref|XP_004712205.1|  PREDICTED: eukaryotic translation initiation...  72.8    1e-13   
gb|AFM87132.1|  translation factor sui1-like protein                  72.8    2e-13   
ref|XP_009517834.1|  hypothetical protein PHYSODRAFT_471024           72.8    2e-13   



>gb|EYU33614.1| hypothetical protein MIMGU_mgv1a016641mg [Erythranthe guttata]
Length=113

 Score =   146 bits (368),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 67/72 (93%), Positives = 71/72 (99%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MSDLD+QIP+TFDPFA+ NAENSGAG+KDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL
Sbjct  1    MSDLDIQIPTTFDPFADANAENSGAGTKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>ref|XP_010232448.1| PREDICTED: protein translation factor SUI1 homolog 2-like isoform 
X1 [Brachypodium distachyon]
Length=143

 Score =   147 bits (370),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 74/92 (80%), Positives = 80/92 (87%), Gaps = 4/92 (4%)
 Frame = +3

Query  144  SSGDLFVCVAPFSYQPIFMSDLDLQIPSTFDPFAEGNAENS--GAGSKDYVHIRVQQRNG  317
            SS DLF   A  + QP FMSDLD+Q+PS FDPFAE NAE+S  GAGSKDYVH+RVQQRNG
Sbjct  13   SSLDLFG--ANQTQQPSFMSDLDVQLPSAFDPFAEANAEDSSAGAGSKDYVHVRVQQRNG  70

Query  318  RKSLTTVQGLKKEFSYNKILKDLKKEFCCNGT  413
            RKSLTTVQGLKKE+SYNKILKDLKKEFCCNGT
Sbjct  71   RKSLTTVQGLKKEYSYNKILKDLKKEFCCNGT  102



>ref|XP_006363526.1| PREDICTED: protein translation factor SUI1 homolog 2-like [Solanum 
tuberosum]
Length=113

 Score =   145 bits (367),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MSDLDLQ+P+ FDPFAE NAENSGAG+KDYVHIR+QQRNGRKSLTTVQGLKKEFSYNKIL
Sbjct  1    MSDLDLQVPNAFDPFAEANAENSGAGTKDYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>ref|XP_004244151.1| PREDICTED: protein translation factor SUI1 homolog [Solanum lycopersicum]
 ref|XP_004244152.1| PREDICTED: protein translation factor SUI1 homolog [Solanum lycopersicum]
Length=113

 Score =   144 bits (364),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MSDLD+QIP+ FDPFAE NA+NSGAGSKDYVHIR+QQRNGRKSLTTVQGLKKEFSYNKIL
Sbjct  1    MSDLDVQIPTAFDPFAEANADNSGAGSKDYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>ref|XP_004248369.1| PREDICTED: protein translation factor SUI1 homolog [Solanum lycopersicum]
Length=113

 Score =   144 bits (363),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MSDLDLQ+P+ FDPFAE NA+NSGAG+KDYVHIR+QQRNGRKSLTTVQGLKKEFSYNKIL
Sbjct  1    MSDLDLQVPAAFDPFAEANADNSGAGTKDYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>ref|XP_006352492.1| PREDICTED: protein translation factor SUI1 homolog [Solanum tuberosum]
Length=113

 Score =   144 bits (363),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MSDLDLQ+P+ FDPFAE NA+NSGAG+KDYVHIR+QQRNGRKSLTTVQGLKKEFSYNKIL
Sbjct  1    MSDLDLQVPAAFDPFAEANADNSGAGTKDYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>ref|XP_009611793.1| PREDICTED: protein translation factor SUI1 homolog [Nicotiana 
tomentosiformis]
 ref|XP_009792850.1| PREDICTED: protein translation factor SUI1 homolog [Nicotiana 
sylvestris]
 ref|XP_009792852.1| PREDICTED: protein translation factor SUI1 homolog [Nicotiana 
sylvestris]
Length=113

 Score =   144 bits (362),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MS+LDLQ+P+ FDPFAE NA+NSGAGSKDYVHIR+QQRNGRKSLTTVQGLKKEFSYNKIL
Sbjct  1    MSELDLQVPTAFDPFAEANADNSGAGSKDYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>ref|XP_009771770.1| PREDICTED: protein translation factor SUI1 homolog [Nicotiana 
sylvestris]
 ref|XP_009771771.1| PREDICTED: protein translation factor SUI1 homolog [Nicotiana 
sylvestris]
Length=113

 Score =   144 bits (362),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MSDLDLQ+P+ FDPFAE NA+NSGAG+KDYVHIR+QQRNGRKSLTTVQGLKKEFSYNKIL
Sbjct  1    MSDLDLQVPNAFDPFAEANADNSGAGTKDYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>gb|EPS74118.1| hypothetical protein M569_00639 [Genlisea aurea]
Length=113

 Score =   143 bits (361),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MSD D+QIP+TFDPFA+ NAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL
Sbjct  1    MSDFDVQIPTTFDPFADANAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKK+FCCNGT
Sbjct  61   KDLKKDFCCNGT  72



>ref|XP_010105571.1| Protein translation factor SUI1-1-like protein [Morus notabilis]
 gb|EXC05100.1| Protein translation factor SUI1-1-like protein [Morus notabilis]
Length=222

 Score =   147 bits (370),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 70/88 (80%), Positives = 77/88 (88%), Gaps = 2/88 (2%)
 Frame = +3

Query  156  LFVCVAPFSY--QPIFMSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSL  329
            L + V  FS   QP FMS++D QIP+ FDPFAE NAE+SGAGSK+YVHIR+QQRNGRKSL
Sbjct  98   LSILVVRFSLINQPRFMSEIDDQIPTAFDPFAEANAEDSGAGSKEYVHIRIQQRNGRKSL  157

Query  330  TTVQGLKKEFSYNKILKDLKKEFCCNGT  413
            TTVQGLKKEFSYNKILKDLKKEFCCNGT
Sbjct  158  TTVQGLKKEFSYNKILKDLKKEFCCNGT  185



>ref|XP_011097918.1| PREDICTED: protein translation factor SUI1 homolog [Sesamum indicum]
Length=113

 Score =   143 bits (361),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 64/72 (89%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MSDLD+Q+P+ FDPFA+ NAENSGAG+KDYVHIR+QQRNGRKSLTTVQGLKKEFSYNKIL
Sbjct  1    MSDLDIQVPTAFDPFADANAENSGAGAKDYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>ref|XP_010694233.1| PREDICTED: protein translation factor SUI1 homolog [Beta vulgaris 
subsp. vulgaris]
Length=113

 Score =   143 bits (361),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MSD+D+QIP+ +DPFA+ NAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL
Sbjct  1    MSDIDVQIPAAYDPFADANAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>gb|EYU19220.1| hypothetical protein MIMGU_mgv1a016636mg [Erythranthe guttata]
Length=113

 Score =   143 bits (361),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MS+LD+Q+PS +DPFA+ NAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL
Sbjct  1    MSELDIQVPSAYDPFADANAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>ref|XP_008803218.1| PREDICTED: protein translation factor SUI1 homolog [Phoenix dactylifera]
Length=113

 Score =   143 bits (360),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 64/72 (89%), Positives = 71/72 (99%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MSDLD+QIP+TFDPFAE NAE+SGAG+K+YVH+R+QQRNGRKSLTTVQGLKKEFSYNKIL
Sbjct  1    MSDLDVQIPTTFDPFAEANAEDSGAGAKEYVHVRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>ref|XP_010240920.1| PREDICTED: protein translation factor SUI1 homolog [Nelumbo nucifera]
Length=113

 Score =   143 bits (360),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 64/72 (89%), Positives = 71/72 (99%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MS+LD+QIP+TFDPFAE NAE+SGAGSK+YVH+R+QQRNGRKSLTTVQGLKKEFSYNKIL
Sbjct  1    MSELDIQIPTTFDPFAEANAEDSGAGSKEYVHVRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>gb|AFW78548.1| LOW QUALITY PROTEIN: protein translation factor SUI1 [Zea mays]
Length=185

 Score =   145 bits (365),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 69/88 (78%), Positives = 75/88 (85%), Gaps = 2/88 (2%)
 Frame = +3

Query  156  LFVCVAPFSYQPIFMSDLDLQIPSTFDPFAEGNAENSGAG--SKDYVHIRVQQRNGRKSL  329
            L   V     QP FMSDLD+Q+PS FDPFAE NAE+SGAG  +KDYVH+R+QQRNGRKSL
Sbjct  57   LISSVPTKPQQPSFMSDLDVQLPSAFDPFAEANAEDSGAGPGTKDYVHVRIQQRNGRKSL  116

Query  330  TTVQGLKKEFSYNKILKDLKKEFCCNGT  413
            TTVQGLKKEFSYNKILKDLKKEFCCNGT
Sbjct  117  TTVQGLKKEFSYNKILKDLKKEFCCNGT  144



>gb|EEC79466.1| hypothetical protein OsI_20483 [Oryza sativa Indica Group]
 gb|EEE64240.1| hypothetical protein OsJ_19073 [Oryza sativa Japonica Group]
Length=213

 Score =   145 bits (367),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 76/87 (87%), Gaps = 2/87 (2%)
 Frame = +3

Query  159  FVCVAPFSYQPIFMSDLDLQIPSTFDPFAEGNAENSGAG--SKDYVHIRVQQRNGRKSLT  332
             +C  P + Q  FMSDLD+Q+PS FDPFAE NAE+SGAG  +KDYVH+R+QQRNGRKSLT
Sbjct  86   LICPVPTNQQTSFMSDLDVQLPSAFDPFAEANAEDSGAGPGAKDYVHVRIQQRNGRKSLT  145

Query  333  TVQGLKKEFSYNKILKDLKKEFCCNGT  413
            TVQGLKKE+SYNKILKDLKKEFCCNGT
Sbjct  146  TVQGLKKEYSYNKILKDLKKEFCCNGT  172



>gb|KHG06771.1| hypothetical protein F383_09792 [Gossypium arboreum]
 gb|KJB11988.1| hypothetical protein B456_002G083600 [Gossypium raimondii]
Length=113

 Score =   142 bits (359),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MSDLD+QIP+ FDPFA+ NAE+SGAG+KDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL
Sbjct  1    MSDLDVQIPTAFDPFADANAEDSGAGAKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>ref|XP_008341842.1| PREDICTED: protein translation factor SUI1 homolog [Malus domestica]
 ref|XP_009371031.1| PREDICTED: protein translation factor SUI1 homolog [Pyrus x bretschneideri]
 ref|XP_009373712.1| PREDICTED: protein translation factor SUI1 homolog [Pyrus x bretschneideri]
Length=113

 Score =   142 bits (359),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MS+LD+QIP+ FDPFAE NAE+SGAG+KDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL
Sbjct  1    MSELDVQIPTAFDPFAEANAEDSGAGTKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>ref|XP_010267759.1| PREDICTED: protein translation factor SUI1 homolog [Nelumbo nucifera]
Length=113

 Score =   142 bits (358),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 63/72 (88%), Positives = 71/72 (99%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MS+LD+QIP+TFDPFAE NAE+SGAGSK+YVH+R+QQRNGRKSLTTVQGL+KEFSYNKIL
Sbjct  1    MSELDIQIPTTFDPFAEANAEDSGAGSKEYVHVRIQQRNGRKSLTTVQGLRKEFSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>ref|XP_009774027.1| PREDICTED: protein translation factor SUI1 homolog [Nicotiana 
sylvestris]
 ref|XP_009774028.1| PREDICTED: protein translation factor SUI1 homolog [Nicotiana 
sylvestris]
Length=113

 Score =   142 bits (358),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MSDLD QIP+ FDPFAE NA+NSGAGSKDYVHIR+QQRNGRKSLTTVQGLKKEFSYNKIL
Sbjct  1    MSDLDAQIPTAFDPFAEANADNSGAGSKDYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKK+FCCNGT
Sbjct  61   KDLKKDFCCNGT  72



>ref|XP_002281872.1| PREDICTED: protein translation factor SUI1 homolog [Vitis vinifera]
 emb|CBI23936.3| unnamed protein product [Vitis vinifera]
Length=113

 Score =   142 bits (358),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 64/72 (89%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MS+LD+QIP+ FDPFAE NAE+SGAGSKDYVHIR+QQRNGRKSLTTVQGL+KEFSYNKIL
Sbjct  1    MSELDIQIPTAFDPFAEANAEDSGAGSKDYVHIRIQQRNGRKSLTTVQGLRKEFSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>ref|XP_009594373.1| PREDICTED: protein translation factor SUI1 homolog [Nicotiana 
tomentosiformis]
 ref|XP_009594374.1| PREDICTED: protein translation factor SUI1 homolog [Nicotiana 
tomentosiformis]
Length=113

 Score =   142 bits (358),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MSDLD QIP+ FDPFAE NA+NSGAGSKDYVHIR+QQRNGRKSLTTVQGLKKEFSYNKIL
Sbjct  1    MSDLDAQIPTAFDPFAEANADNSGAGSKDYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKK+FCCNGT
Sbjct  61   KDLKKDFCCNGT  72



>ref|XP_004304159.1| PREDICTED: protein translation factor SUI1 homolog [Fragaria 
vesca subsp. vesca]
Length=113

 Score =   142 bits (357),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 64/72 (89%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MS+LD+QIP+ FDPFAE NAE+SGAG+KDYVHIR+QQRNGRKSLTTVQGLKKEFSYNKIL
Sbjct  1    MSELDVQIPTAFDPFAEANAEDSGAGTKDYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>ref|XP_006447521.1| hypothetical protein CICLE_v10017243mg [Citrus clementina]
 ref|XP_006469705.1| PREDICTED: protein translation factor SUI1 homolog [Citrus sinensis]
 gb|ESR60761.1| hypothetical protein CICLE_v10017243mg [Citrus clementina]
 gb|KDO59835.1| hypothetical protein CISIN_1g039810mg [Citrus sinensis]
Length=113

 Score =   141 bits (356),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MS+ D QIPS FDPFAE NAE+SGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL
Sbjct  1    MSEFDTQIPSAFDPFAEANAEDSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>ref|XP_009624686.1| PREDICTED: protein translation factor SUI1 homolog isoform X2 
[Nicotiana tomentosiformis]
Length=102

 Score =   141 bits (355),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 64/72 (89%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MSDLDL +P+ FDPFAE NA+NSGAG+KDYVHIR+QQRNGRKSLTTVQGLKKEFSYNKIL
Sbjct  1    MSDLDLLVPNAFDPFAEANADNSGAGTKDYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>ref|XP_004487600.1| PREDICTED: protein translation factor SUI1 homolog 1-like isoform 
X2 [Cicer arietinum]
Length=113

 Score =   141 bits (355),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 64/72 (89%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MS+LD QIP+TFDPFAE NAE+SGAG+K+YVHIR+QQRNGRKSLTTVQGLKKEFSYNKIL
Sbjct  1    MSELDAQIPTTFDPFAEANAEDSGAGTKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>ref|XP_004234488.1| PREDICTED: protein translation factor SUI1 homolog 1 [Solanum 
lycopersicum]
 ref|XP_006343300.1| PREDICTED: protein translation factor SUI1 homolog 1-like [Solanum 
tuberosum]
Length=113

 Score =   141 bits (355),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 63/72 (88%), Positives = 71/72 (99%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MS+LD+Q+P+TFDPFA+ NA+NSGAG+K+YVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL
Sbjct  1    MSELDIQVPTTFDPFADANAQNSGAGAKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>ref|XP_009624679.1| PREDICTED: protein translation factor SUI1 homolog isoform X1 
[Nicotiana tomentosiformis]
Length=113

 Score =   140 bits (354),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 64/72 (89%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MSDLDL +P+ FDPFAE NA+NSGAG+KDYVHIR+QQRNGRKSLTTVQGLKKEFSYNKIL
Sbjct  1    MSDLDLLVPNAFDPFAEANADNSGAGTKDYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>ref|XP_004487599.1| PREDICTED: protein translation factor SUI1 homolog 1-like isoform 
X1 [Cicer arietinum]
Length=125

 Score =   141 bits (355),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 64/72 (89%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MS+LD QIP+TFDPFAE NAE+SGAG+K+YVHIR+QQRNGRKSLTTVQGLKKEFSYNKIL
Sbjct  1    MSELDAQIPTTFDPFAEANAEDSGAGTKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>gb|KJB45591.1| hypothetical protein B456_007G314200 [Gossypium raimondii]
Length=84

 Score =   139 bits (351),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 63/72 (88%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MSDLD+QIP+ FDPFA+ NAE+SGAG+K+YVHIR+QQRNGRKSLTTVQGLKKEFSYNKIL
Sbjct  1    MSDLDVQIPTAFDPFADANAEDSGAGAKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>gb|KJB13596.1| hypothetical protein B456_002G083300 [Gossypium raimondii]
Length=113

 Score =   140 bits (353),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 63/72 (88%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MSDLD+QIP+ FDPFA+ NAE+SGAG+K+YVHIR+QQRNGRKSLTTVQGLKKEFSYNKIL
Sbjct  1    MSDLDIQIPTAFDPFADANAEDSGAGAKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>gb|KHG30632.1| hypothetical protein F383_00215 [Gossypium arboreum]
Length=113

 Score =   140 bits (353),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 63/72 (88%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MSDLD+Q+P+ FDPFA+ NAE+SGAG+K+YVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL
Sbjct  1    MSDLDVQVPTAFDPFADANAEDSGAGAKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>gb|KJB13597.1| hypothetical protein B456_002G083300 [Gossypium raimondii]
Length=103

 Score =   140 bits (352),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 63/72 (88%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MSDLD+QIP+ FDPFA+ NAE+SGAG+K+YVHIR+QQRNGRKSLTTVQGLKKEFSYNKIL
Sbjct  1    MSDLDIQIPTAFDPFADANAEDSGAGAKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>gb|KHG23747.1| hypothetical protein F383_10557 [Gossypium arboreum]
 gb|KJB45588.1| hypothetical protein B456_007G314200 [Gossypium raimondii]
 gb|KJB45589.1| hypothetical protein B456_007G314200 [Gossypium raimondii]
 gb|KJB45590.1| hypothetical protein B456_007G314200 [Gossypium raimondii]
 gb|KJB78391.1| hypothetical protein B456_013G163400 [Gossypium raimondii]
Length=113

 Score =   140 bits (353),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 63/72 (88%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MSDLD+QIP+ FDPFA+ NAE+SGAG+K+YVHIR+QQRNGRKSLTTVQGLKKEFSYNKIL
Sbjct  1    MSDLDVQIPTAFDPFADANAEDSGAGAKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>ref|XP_007215170.1| hypothetical protein PRUPE_ppa013601mg [Prunus persica]
 ref|XP_008230362.1| PREDICTED: protein translation factor SUI1 homolog 2-like [Prunus 
mume]
 gb|EMJ16369.1| hypothetical protein PRUPE_ppa013601mg [Prunus persica]
Length=113

 Score =   140 bits (353),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 63/72 (88%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MS+LD+QIP+ FDPFAE NAE+SGAG+K+YVHIR+QQRNGRKSLTTVQGLKKEFSYNKIL
Sbjct  1    MSELDVQIPTAFDPFAEANAEDSGAGTKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>ref|XP_007213988.1| hypothetical protein PRUPE_ppa013607mg [Prunus persica]
 gb|EMJ15187.1| hypothetical protein PRUPE_ppa013607mg [Prunus persica]
Length=113

 Score =   140 bits (353),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 63/72 (88%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MS+LD+QIP+ FDPFAE NAE+SGAG+K+YVHIR+QQRNGRKSLTTVQGLKKEFSYNKIL
Sbjct  1    MSELDVQIPTAFDPFAEANAEDSGAGTKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>ref|XP_007021023.1| Translation initiation factor SUI1 family protein, putative [Theobroma 
cacao]
 gb|EOY12548.1| Translation initiation factor SUI1 family protein, putative [Theobroma 
cacao]
Length=163

 Score =   142 bits (357),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 64/72 (89%), Positives = 71/72 (99%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MSDLD+QIP+TFDPFA+ NAE+SGAG+K+YVHIR+QQRNGRKSLTTVQGLKKEFSYNKIL
Sbjct  1    MSDLDVQIPTTFDPFADANAEDSGAGAKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>ref|XP_008244365.1| PREDICTED: protein translation factor SUI1 homolog 2 [Prunus 
mume]
Length=113

 Score =   140 bits (353),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 63/72 (88%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MS+LD+QIP+ FDPFAE NAE+SGAG+K+YVHIR+QQRNGRKSLTTVQGLKKEFSYNKIL
Sbjct  1    MSELDVQIPTAFDPFAEANAEDSGAGTKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>gb|EEE55519.1| hypothetical protein OsJ_03741 [Oryza sativa Japonica Group]
Length=165

 Score =   142 bits (357),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 67/88 (76%), Positives = 76/88 (86%), Gaps = 3/88 (3%)
 Frame = +3

Query  159  FVCVAPFSYQPI-FMSDLDLQIPSTFDPFAEGNAENS--GAGSKDYVHIRVQQRNGRKSL  329
            F+C+ P   +   F SDLD+Q+PS FDPFAE NAE+S  GAGSKDYVH+R+QQRNGRKSL
Sbjct  37   FICLRPIKLKLANFRSDLDVQLPSAFDPFAEANAEDSSVGAGSKDYVHVRIQQRNGRKSL  96

Query  330  TTVQGLKKEFSYNKILKDLKKEFCCNGT  413
            TTVQGLKKE+SYNKILKDLKKEFCCNGT
Sbjct  97   TTVQGLKKEYSYNKILKDLKKEFCCNGT  124



>ref|XP_010930963.1| PREDICTED: protein translation factor SUI1 homolog [Elaeis guineensis]
Length=113

 Score =   140 bits (352),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MSDLD+QIP+ FDPFAE NA++SGAG+K+YVH+R+QQRNGRKSLTTVQGLKKEFSYNKIL
Sbjct  1    MSDLDVQIPTAFDPFAEANADDSGAGAKEYVHVRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>ref|XP_009397784.1| PREDICTED: protein translation factor SUI1 homolog 2 [Musa acuminata 
subsp. malaccensis]
Length=113

 Score =   140 bits (352),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 63/72 (88%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MSDL++QIP+ FDPFA+ NAE+SGAG+KDYVHIR+QQRNGRKSLTTVQGLKKEFSYNKIL
Sbjct  1    MSDLNVQIPTAFDPFADANAEDSGAGTKDYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>gb|ABQ42058.1| putative translation factor [Sonneratia caseolaris]
Length=114

 Score =   140 bits (352),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 63/73 (86%), Positives = 69/73 (95%), Gaps = 0/73 (0%)
 Frame = +3

Query  195  FMSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKI  374
            FM DLD Q+P+ FDPFA+ NAE+SGAG+K+YVHIRVQQRNGRKSLTTVQGLKKEFSYNKI
Sbjct  1    FMVDLDAQVPTAFDPFADANAEDSGAGAKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKI  60

Query  375  LKDLKKEFCCNGT  413
            LKDLKKEFCCNGT
Sbjct  61   LKDLKKEFCCNGT  73



>ref|XP_002522857.1| translation factor sui1, putative [Ricinus communis]
 gb|EEF39555.1| translation factor sui1, putative [Ricinus communis]
Length=138

 Score =   140 bits (354),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 65/79 (82%), Positives = 74/79 (94%), Gaps = 0/79 (0%)
 Frame = +3

Query  177  FSYQPIFMSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKE  356
            F+ Q  FMS+L+ QIP+TFDPFA+ NAE+SGAG+K+YVHIR+QQRNGRKSLTTVQGLKKE
Sbjct  19   FTDQLSFMSELESQIPTTFDPFADANAEDSGAGAKEYVHIRIQQRNGRKSLTTVQGLKKE  78

Query  357  FSYNKILKDLKKEFCCNGT  413
            FSYNKILKDLKKEFCCNGT
Sbjct  79   FSYNKILKDLKKEFCCNGT  97



>gb|ABY75806.1| SUI1 A protein [Opuntia streptacantha]
Length=113

 Score =   139 bits (351),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MSDLD+Q+P+ +DPFA+ NAENSGAG+KDYVHIRVQQRNGRKSLTTVQGL K+FSYNKIL
Sbjct  1    MSDLDIQVPAAYDPFADANAENSGAGAKDYVHIRVQQRNGRKSLTTVQGLNKQFSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>ref|XP_011096112.1| PREDICTED: protein translation factor SUI1 homolog [Sesamum indicum]
 ref|XP_011096113.1| PREDICTED: protein translation factor SUI1 homolog [Sesamum indicum]
Length=113

 Score =   139 bits (351),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 64/72 (89%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MSD D+QIPS FDPFAE  AE+SGAG+K+YVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL
Sbjct  1    MSDFDVQIPSAFDPFAEAKAEDSGAGAKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>gb|KHG12156.1| hypothetical protein F383_20129 [Gossypium arboreum]
Length=113

 Score =   139 bits (351),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MSDLD+QIP+ FDPFA+ NAE++GAG+K+YVHIR+QQRNGRKSLTTVQGLKKEFSYNKIL
Sbjct  1    MSDLDIQIPTAFDPFADANAEDAGAGAKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>gb|ABQ42057.1| putative translation factor [Sonneratia alba]
 gb|ABQ42059.1| putative translation factor [Sonneratia ovata]
 gb|ABQ42060.1| putative translation factor [Sonneratia apetala]
Length=114

 Score =   139 bits (351),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 63/73 (86%), Positives = 69/73 (95%), Gaps = 0/73 (0%)
 Frame = +3

Query  195  FMSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKI  374
            FM DLD Q+P+ FDPFA+ NAE+SGAG+K+YVHIRVQQRNGRKSLTTVQGLKKEFSYNKI
Sbjct  1    FMVDLDAQVPTAFDPFADANAEDSGAGAKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKI  60

Query  375  LKDLKKEFCCNGT  413
            LKDLKKEFCCNGT
Sbjct  61   LKDLKKEFCCNGT  73



>gb|KJB13598.1| hypothetical protein B456_002G083300 [Gossypium raimondii]
Length=107

 Score =   139 bits (351),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 63/72 (88%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MSDLD+QIP+ FDPFA+ NAE+SGAG+K+YVHIR+QQRNGRKSLTTVQGLKKEFSYNKIL
Sbjct  1    MSDLDIQIPTAFDPFADANAEDSGAGAKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>gb|KJB62619.1| hypothetical protein B456_009G426400 [Gossypium raimondii]
Length=213

 Score =   142 bits (359),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 64/73 (88%), Positives = 71/73 (97%), Gaps = 0/73 (0%)
 Frame = +3

Query  195  FMSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKI  374
            FMSDLD+Q+P+ FDPFA+ NAE+SGAG+K+YVHIRVQQRNGRKSLTTVQGLKKEFSYNKI
Sbjct  100  FMSDLDVQVPTAFDPFADANAEDSGAGAKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKI  159

Query  375  LKDLKKEFCCNGT  413
            LKDLKKEFCCNGT
Sbjct  160  LKDLKKEFCCNGT  172



>gb|KJB78392.1| hypothetical protein B456_013G163400 [Gossypium raimondii]
 gb|KJB78393.1| hypothetical protein B456_013G163400 [Gossypium raimondii]
Length=99

 Score =   139 bits (350),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 63/72 (88%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MSDLD+QIP+ FDPFA+ NAE+SGAG+K+YVHIR+QQRNGRKSLTTVQGLKKEFSYNKIL
Sbjct  1    MSDLDVQIPTAFDPFADANAEDSGAGAKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>ref|XP_010062975.1| PREDICTED: protein translation factor SUI1 homolog 2 [Eucalyptus 
grandis]
Length=113

 Score =   139 bits (351),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 63/72 (88%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MSDLD Q+P+ FDPFA+ NAE+SGAG+K+YVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL
Sbjct  1    MSDLDAQVPTAFDPFADANAEDSGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>gb|KCW46999.1| hypothetical protein EUGRSUZ_K00804 [Eucalyptus grandis]
Length=114

 Score =   139 bits (351),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 63/72 (88%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MS+LD+Q+P+TFDPFA+  AE+SGAGSK+YVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL
Sbjct  1    MSELDVQVPTTFDPFADAKAEDSGAGSKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>ref|XP_009388867.1| PREDICTED: protein translation factor SUI1 homolog [Musa acuminata 
subsp. malaccensis]
Length=113

 Score =   139 bits (351),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 71/72 (99%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MSDLD+QIP+TFDPFA+ NA++SGAG+K+YVHIR+QQRNGRKSLTTVQGLKKEFSYNKIL
Sbjct  1    MSDLDVQIPTTFDPFADANADDSGAGAKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLK+EFCCNGT
Sbjct  61   KDLKREFCCNGT  72



>ref|XP_010035571.1| PREDICTED: protein translation factor SUI1 homolog 2-like [Eucalyptus 
grandis]
 ref|XP_010035572.1| PREDICTED: protein translation factor SUI1 homolog 2-like [Eucalyptus 
grandis]
 gb|KCW46998.1| hypothetical protein EUGRSUZ_K00804 [Eucalyptus grandis]
Length=113

 Score =   139 bits (350),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 63/72 (88%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MS+LD+Q+P+TFDPFA+  AE+SGAGSK+YVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL
Sbjct  1    MSELDVQVPTTFDPFADAKAEDSGAGSKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>ref|XP_003564393.1| PREDICTED: protein translation factor SUI1 homolog isoform X2 
[Brachypodium distachyon]
Length=115

 Score =   139 bits (350),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 65/74 (88%), Positives = 70/74 (95%), Gaps = 2/74 (3%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENS--GAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNK  371
            MSDLD+Q+PS FDPFAE NAE+S  GAGSKDYVH+RVQQRNGRKSLTTVQGLKKE+SYNK
Sbjct  1    MSDLDVQLPSAFDPFAEANAEDSSAGAGSKDYVHVRVQQRNGRKSLTTVQGLKKEYSYNK  60

Query  372  ILKDLKKEFCCNGT  413
            ILKDLKKEFCCNGT
Sbjct  61   ILKDLKKEFCCNGT  74



>gb|ADV04054.1| eukaryotic translation initiation factor 3 [Hevea brasiliensis]
Length=113

 Score =   139 bits (350),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 63/72 (88%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MS+L+ QIPSTFDPFA+ NAE+SGAG+K+YVHIR+QQRNGRKSLTTVQGLKKEFSYNKIL
Sbjct  1    MSELETQIPSTFDPFADANAEDSGAGAKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>ref|XP_004159225.1| PREDICTED: protein translation factor SUI1 homolog [Cucumis sativus]
Length=177

 Score =   141 bits (355),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 66/85 (78%), Positives = 75/85 (88%), Gaps = 2/85 (2%)
 Frame = +3

Query  165  CVAPFSY--QPIFMSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTV  338
            C  P SY  QP FMS+ ++QIPS FDPFA+ NAE+SGAG+K+YVH+R+QQRNGRKS TTV
Sbjct  52   CWLPVSYSGQPSFMSEFNVQIPSAFDPFADANAEDSGAGAKEYVHVRIQQRNGRKSPTTV  111

Query  339  QGLKKEFSYNKILKDLKKEFCCNGT  413
            QGLKKEFSYNKILKDLKKEFCCNGT
Sbjct  112  QGLKKEFSYNKILKDLKKEFCCNGT  136



>ref|XP_004294347.1| PREDICTED: protein translation factor SUI1 homolog [Fragaria 
vesca subsp. vesca]
Length=113

 Score =   139 bits (350),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 63/72 (88%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MS+LD+QIP+ FDPFAE NAE+SGAG+K+YVHIRVQQRNGRKSLTTVQGLKK+FSYNKIL
Sbjct  1    MSELDVQIPTAFDPFAEANAEDSGAGTKEYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>ref|XP_009603077.1| PREDICTED: protein translation factor SUI1 homolog 2-like [Nicotiana 
tomentosiformis]
Length=113

 Score =   139 bits (349),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 63/72 (88%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MS+ D+QIP+TFDPFA+ NA+NSGAG+K+YVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL
Sbjct  1    MSEHDVQIPTTFDPFADANAQNSGAGAKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>ref|XP_009412007.1| PREDICTED: protein translation factor SUI1 homolog [Musa acuminata 
subsp. malaccensis]
 ref|XP_009412008.1| PREDICTED: protein translation factor SUI1 homolog [Musa acuminata 
subsp. malaccensis]
Length=113

 Score =   139 bits (349),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MSDLD+Q+P+ FDPFAE NA++SGAG+K+YVH+RVQQRNGRKSLTTVQGLKKEFSYNKIL
Sbjct  1    MSDLDVQLPTAFDPFAEANADDSGAGAKEYVHVRVQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>gb|EEE67305.1| hypothetical protein OsJ_24532 [Oryza sativa Japonica Group]
Length=230

 Score =   142 bits (358),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 71/97 (73%), Positives = 81/97 (84%), Gaps = 5/97 (5%)
 Frame = +3

Query  138  KISSGDL---FVCVAPFSYQPIFMSDLDLQIPSTFDPFAEGNAENSGA--GSKDYVHIRV  302
            K+++G L    + VA   +Q  FMSDLD+QIP+ FDPFAE NA +SGA  GSKDYVH+R+
Sbjct  93   KVNAGGLDWGVLGVACHFHQQSFMSDLDIQIPTAFDPFAEANAGDSGAAAGSKDYVHVRI  152

Query  303  QQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCNGT  413
            QQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCNGT
Sbjct  153  QQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCNGT  189



>ref|XP_009408662.1| PREDICTED: protein translation factor SUI1 homolog [Musa acuminata 
subsp. malaccensis]
 ref|XP_009408663.1| PREDICTED: protein translation factor SUI1 homolog [Musa acuminata 
subsp. malaccensis]
Length=113

 Score =   139 bits (349),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 63/72 (88%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MSDL+ QIPS FDPFA+ NA++SGAG+KDYVHIR+QQRNGRKSLTTVQGLKKEFSYNKIL
Sbjct  1    MSDLEAQIPSAFDPFADANADDSGAGTKDYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>gb|KHG06773.1| hypothetical protein F383_09794 [Gossypium arboreum]
Length=113

 Score =   138 bits (348),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MSDLD+QIP+ F+PFA+ NAE+SGAG+K+YVHIR+QQRNGRKSLTTVQGLKKEFSYNKIL
Sbjct  1    MSDLDIQIPTAFNPFADANAEDSGAGAKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>ref|NP_001274850.1| uncharacterized protein LOC102577437 [Solanum tuberosum]
 gb|ABB02649.1| unknown [Solanum tuberosum]
Length=113

 Score =   138 bits (348),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 64/72 (89%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MSDLD+QI + FDPFAE NA+N GAGSKDYVHIR+QQRNGRKSLTTVQGLKKEFSYNKIL
Sbjct  1    MSDLDIQIRTAFDPFAEANADNFGAGSKDYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>ref|XP_010931827.1| PREDICTED: protein translation factor SUI1 homolog [Elaeis guineensis]
Length=113

 Score =   138 bits (348),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 61/72 (85%), Positives = 71/72 (99%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MSDL++Q+P+TFDPFAE NA++SGAG+K+YVH+R+QQRNGRKSLTTVQGLKKEFSYNKIL
Sbjct  1    MSDLNVQLPTTFDPFAEANADDSGAGAKEYVHVRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>ref|XP_009417250.1| PREDICTED: protein translation factor SUI1 homolog 2-like [Musa 
acuminata subsp. malaccensis]
Length=113

 Score =   138 bits (348),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MSDLD+ IP+ FDPFA+ NAE+SGAG+K+YVHIR+QQRNGRKSLTTVQGLKKEFSYNKIL
Sbjct  1    MSDLDVHIPTAFDPFADANAEDSGAGAKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>ref|XP_010539284.1| PREDICTED: protein translation factor SUI1 homolog 2-like [Tarenaya 
hassleriana]
 ref|XP_010539285.1| PREDICTED: protein translation factor SUI1 homolog 2-like [Tarenaya 
hassleriana]
Length=113

 Score =   138 bits (348),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 63/72 (88%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MSDLD Q+P+TFDPFA+ NAE+SGAGSK+YVHIRVQQRNGRKSLTTVQGLKKE+SY+KIL
Sbjct  1    MSDLDTQLPTTFDPFADANAEDSGAGSKEYVHIRVQQRNGRKSLTTVQGLKKEYSYSKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>emb|CDP05794.1| unnamed protein product [Coffea canephora]
Length=113

 Score =   138 bits (348),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 63/72 (88%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MS+ DLQ P+ FDPFAE NA+NSGAGSKDYVHIR+QQRNGRKSLTTVQGL KEFSYNKIL
Sbjct  1    MSEFDLQTPAAFDPFAEANADNSGAGSKDYVHIRIQQRNGRKSLTTVQGLNKEFSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>ref|XP_008809850.1| PREDICTED: protein translation factor SUI1 homolog [Phoenix dactylifera]
Length=113

 Score =   138 bits (348),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MSDLD+QIP+ +DPFAE NA +SGAGSK+YVH+R+QQRNGRKSLTTVQGLKKEFSYNKIL
Sbjct  1    MSDLDVQIPTAYDPFAEANAGDSGAGSKEYVHVRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>ref|XP_008365631.1| PREDICTED: protein translation factor SUI1 homolog 2 [Malus domestica]
 ref|XP_009358111.1| PREDICTED: protein translation factor SUI1 homolog 2 [Pyrus x 
bretschneideri]
 ref|XP_009345194.1| PREDICTED: protein translation factor SUI1 homolog 2 [Pyrus x 
bretschneideri]
Length=113

 Score =   138 bits (348),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MSD+D+Q+P+ FDPFAE  AE+SGAG+K+YVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL
Sbjct  1    MSDIDVQLPTAFDPFAEATAEDSGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>ref|XP_009378877.1| PREDICTED: protein translation factor SUI1 homolog 2-like [Pyrus 
x bretschneideri]
Length=113

 Score =   138 bits (348),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MSD+D+Q+P+ FDPFAE  AE+SGAG+K+YVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL
Sbjct  1    MSDIDVQLPTAFDPFAEATAEDSGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>ref|XP_008784556.1| PREDICTED: protein translation factor SUI1 homolog 2-like [Phoenix 
dactylifera]
Length=113

 Score =   138 bits (348),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MSDL+ Q+P+TFDPFAE NAE+SGAG+K+YVH+R QQRNGRKSLTTVQGLKKEFSYNKIL
Sbjct  1    MSDLNAQLPTTFDPFAEANAEDSGAGAKEYVHVRTQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>ref|XP_007132952.1| hypothetical protein PHAVU_011G138900g [Phaseolus vulgaris]
 gb|ESW04946.1| hypothetical protein PHAVU_011G138900g [Phaseolus vulgaris]
Length=113

 Score =   138 bits (348),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 63/72 (88%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MS+LD QIP+ FDPFAE NA++SGAGSK+YVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL
Sbjct  1    MSELDAQIPTAFDPFAEANADDSGAGSKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KD+KKEFCCNGT
Sbjct  61   KDVKKEFCCNGT  72



>ref|XP_006475204.1| PREDICTED: protein translation factor SUI1 homolog 2-like isoform 
X1 [Citrus sinensis]
Length=115

 Score =   138 bits (348),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MSD D+Q+P+ FDPFA+  AE+SGAGSK+YVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL
Sbjct  1    MSDFDIQVPAAFDPFADAKAEDSGAGSKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>ref|XP_007132953.1| hypothetical protein PHAVU_011G139000g [Phaseolus vulgaris]
 gb|ESW04947.1| hypothetical protein PHAVU_011G139000g [Phaseolus vulgaris]
Length=113

 Score =   138 bits (347),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 63/72 (88%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MS+LD QIP+ FDPFAE NA++SGAGSK+YVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL
Sbjct  1    MSELDAQIPTAFDPFAEANADDSGAGSKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KD+KKEFCCNGT
Sbjct  61   KDVKKEFCCNGT  72



>ref|XP_002458630.1| hypothetical protein SORBIDRAFT_03g036990 [Sorghum bicolor]
 gb|EES03750.1| hypothetical protein SORBIDRAFT_03g036990 [Sorghum bicolor]
Length=115

 Score =   138 bits (348),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 64/74 (86%), Positives = 70/74 (95%), Gaps = 2/74 (3%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENS--GAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNK  371
            MSDLD+Q+PS FDPFAE NAE+S  GAGSKDYVH+R+QQRNGRKSLTTVQGLKKE+SYNK
Sbjct  1    MSDLDVQLPSAFDPFAEANAEDSSAGAGSKDYVHVRIQQRNGRKSLTTVQGLKKEYSYNK  60

Query  372  ILKDLKKEFCCNGT  413
            ILKDLKKEFCCNGT
Sbjct  61   ILKDLKKEFCCNGT  74



>emb|CDO99708.1| unnamed protein product [Coffea canephora]
Length=113

 Score =   138 bits (347),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MS+LD+QIP+TFDPFA+ NA+NS AGSK+YVHIR+QQRNGRKSLTTVQGLKKEFSYNKIL
Sbjct  1    MSELDIQIPTTFDPFADANADNSSAGSKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKK+FCCNGT
Sbjct  61   KDLKKDFCCNGT  72



>emb|CAD58629.1| SUI1 protein [Coffea arabica]
Length=113

 Score =   138 bits (347),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 63/72 (88%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MS+ DLQ P+ FDPFAE NA+NSGAGSKDYVHIR+QQRNGRKSLTTVQGL KEFSYNKIL
Sbjct  1    MSEFDLQTPAAFDPFAEANADNSGAGSKDYVHIRIQQRNGRKSLTTVQGLNKEFSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>ref|NP_001044504.2| Os01g0794500 [Oryza sativa Japonica Group]
 dbj|BAD53005.1| putative translation initiation factor [Oryza sativa Japonica 
Group]
 gb|EEC71629.1| hypothetical protein OsI_04056 [Oryza sativa Indica Group]
 dbj|BAF06418.2| Os01g0794500 [Oryza sativa Japonica Group]
Length=115

 Score =   138 bits (347),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 64/74 (86%), Positives = 70/74 (95%), Gaps = 2/74 (3%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENS--GAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNK  371
            MSDLD+Q+PS FDPFAE NAE+S  GAGSKDYVH+R+QQRNGRKSLTTVQGLKKE+SYNK
Sbjct  1    MSDLDVQLPSAFDPFAEANAEDSSVGAGSKDYVHVRIQQRNGRKSLTTVQGLKKEYSYNK  60

Query  372  ILKDLKKEFCCNGT  413
            ILKDLKKEFCCNGT
Sbjct  61   ILKDLKKEFCCNGT  74



>gb|KJB62621.1| hypothetical protein B456_009G426500 [Gossypium raimondii]
Length=84

 Score =   137 bits (345),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 61/72 (85%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MSDLD+ IP+ FDPFA+ NAE++GAG+K+YVHIR+QQRNGRKSLTTVQGLKKEFSYNKIL
Sbjct  1    MSDLDIHIPTAFDPFADANAEDAGAGAKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>ref|XP_010542418.1| PREDICTED: protein translation factor SUI1 homolog 1 [Tarenaya 
hassleriana]
Length=113

 Score =   138 bits (347),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 63/72 (88%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MSDLD QIP+TFDPFA+ NAE+SGAG+K+YVHIRVQQRNGRKSLTTVQGLKKE+SY+KIL
Sbjct  1    MSDLDSQIPTTFDPFADANAEDSGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEYSYSKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>gb|KDP39065.1| hypothetical protein JCGZ_00822 [Jatropha curcas]
Length=113

 Score =   138 bits (347),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MS+L+ QIP+TFDPFA+ NAE+SGAG+K+YVHIR+QQRNGRKSLTTVQGLKKEFSYNKIL
Sbjct  1    MSELEAQIPTTFDPFADANAEDSGAGAKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>gb|EPS65463.1| hypothetical protein M569_09315 [Genlisea aurea]
Length=113

 Score =   138 bits (347),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 63/72 (88%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MSDLD++ P +FDPFA+ NAENSG GSKDY+HIRVQQRNGRKSLTTVQGLKKEFSYNKIL
Sbjct  1    MSDLDIETPISFDPFADANAENSGPGSKDYIHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>ref|NP_001150984.1| GOS2 homolog [Zea mays]
 gb|ACG41169.1| protein translation factor SUI1 [Zea mays]
 gb|ACG48501.1| protein translation factor SUI1 [Zea mays]
 tpg|DAA57283.1| TPA: protein translation factor SUI1 isoform 1 [Zea mays]
 tpg|DAA57284.1| TPA: protein translation factor SUI1 isoform 2 [Zea mays]
Length=115

 Score =   138 bits (347),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 64/74 (86%), Positives = 70/74 (95%), Gaps = 2/74 (3%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENS--GAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNK  371
            MSDLD+Q+PS FDPFAE NAE+S  GAGSKDYVH+R+QQRNGRKSLTTVQGLKKE+SYNK
Sbjct  1    MSDLDVQLPSAFDPFAEANAEDSSAGAGSKDYVHVRIQQRNGRKSLTTVQGLKKEYSYNK  60

Query  372  ILKDLKKEFCCNGT  413
            ILKDLKKEFCCNGT
Sbjct  61   ILKDLKKEFCCNGT  74



>gb|ADV04053.1| eukaryotic translation initiation factor 2 [Hevea brasiliensis]
Length=113

 Score =   138 bits (347),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MS+L+ QIP+TFDPFA+ NAE+SGAG+K+YVHIR+QQRNGRKSLTTVQGLKKEFSYNKIL
Sbjct  1    MSELETQIPTTFDPFADANAEDSGAGAKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>ref|XP_006475205.1| PREDICTED: protein translation factor SUI1 homolog 2-like isoform 
X2 [Citrus sinensis]
 gb|KDO52967.1| hypothetical protein CISIN_1g033711mg [Citrus sinensis]
Length=113

 Score =   138 bits (347),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MSD D+Q+P+ FDPFA+  AE+SGAGSK+YVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL
Sbjct  1    MSDFDIQVPAAFDPFADAKAEDSGAGSKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>gb|KJB62620.1| hypothetical protein B456_009G426500 [Gossypium raimondii]
 gb|KJB62622.1| hypothetical protein B456_009G426500 [Gossypium raimondii]
Length=113

 Score =   137 bits (346),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 61/72 (85%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MSDLD+ IP+ FDPFA+ NAE++GAG+K+YVHIR+QQRNGRKSLTTVQGLKKEFSYNKIL
Sbjct  1    MSDLDIHIPTAFDPFADANAEDAGAGAKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>ref|XP_009800522.1| PREDICTED: protein translation factor SUI1 homolog 2 [Nicotiana 
sylvestris]
Length=113

 Score =   137 bits (346),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 61/72 (85%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MS++D+QIP+ FDPFA+ NA+NSGAG+K+YVHIRVQQRNGRKSLTTVQGLK+EFSYNKIL
Sbjct  1    MSEIDVQIPTNFDPFADANAQNSGAGAKEYVHIRVQQRNGRKSLTTVQGLKREFSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>emb|CAD58628.1| SUI1 protein [Coffea arabica]
Length=113

 Score =   137 bits (346),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 63/72 (88%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MS+ DLQ P+ FDPFAE NA+NSG GSKDYVHIR+QQRNGRKSLTTVQGLKKEFSYNKIL
Sbjct  1    MSEFDLQTPAAFDPFAEANADNSGDGSKDYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>ref|XP_004961617.1| PREDICTED: protein translation factor SUI1 homolog isoform X1 
[Setaria italica]
Length=120

 Score =   138 bits (347),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 64/74 (86%), Positives = 70/74 (95%), Gaps = 2/74 (3%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAG--SKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNK  371
            MSDLD+Q+PS FDPFAE NAE+SGAG  +KDYVH+R+QQRNGRKSLTTVQGLKKEFSYNK
Sbjct  1    MSDLDVQLPSAFDPFAEANAEDSGAGPGTKDYVHVRIQQRNGRKSLTTVQGLKKEFSYNK  60

Query  372  ILKDLKKEFCCNGT  413
            ILKDLKKEFCCNGT
Sbjct  61   ILKDLKKEFCCNGT  74



>ref|XP_011048301.1| PREDICTED: protein translation factor SUI1 homolog 2 [Populus 
euphratica]
Length=113

 Score =   137 bits (346),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MSDLD+Q P+ FDPFA+ NAE+SGAG+K+YVHIR QQRNGRKSLTTVQGLKKEFSYNKIL
Sbjct  1    MSDLDIQTPTAFDPFADANAEDSGAGAKEYVHIRTQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>emb|CAC84489.1| putative translation factor [Pinus pinaster]
 gb|ABK20970.1| unknown [Picea sitchensis]
 gb|ABK22220.1| unknown [Picea sitchensis]
 gb|ABK23355.1| unknown [Picea sitchensis]
 gb|ABK26752.1| unknown [Picea sitchensis]
 gb|ABR16497.1| unknown [Picea sitchensis]
 gb|ABR18467.1| unknown [Picea sitchensis]
 gb|ACN39759.1| unknown [Picea sitchensis]
 gb|ACN40001.1| unknown [Picea sitchensis]
 gb|ACN40379.1| unknown [Picea sitchensis]
 gb|ACN40927.1| unknown [Picea sitchensis]
Length=113

 Score =   137 bits (346),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 61/72 (85%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MSDLD+QIP  +DPFA+ NAE+SGAGSK+YVH+R+QQRNGRKSLTTVQGL+KEFSYNKIL
Sbjct  1    MSDLDVQIPGAYDPFADANAEDSGAGSKEYVHVRIQQRNGRKSLTTVQGLRKEFSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>ref|NP_001152681.1| LOC100286322 [Zea mays]
 ref|XP_002440017.1| hypothetical protein SORBIDRAFT_09g024530 [Sorghum bicolor]
 ref|XP_004961618.1| PREDICTED: protein translation factor SUI1 homolog isoform X2 
[Setaria italica]
 ref|XP_008647991.1| PREDICTED: LOC100286322 isoform X1 [Zea mays]
 gb|ACF83099.1| unknown [Zea mays]
 gb|ACG26980.1| protein translation factor SUI1 [Zea mays]
 gb|ACG32428.1| protein translation factor SUI1 [Zea mays]
 gb|ACG47286.1| protein translation factor SUI1 [Zea mays]
 gb|ACG48899.1| protein translation factor SUI1 [Zea mays]
 gb|ACN35402.1| unknown [Zea mays]
 gb|EES18447.1| hypothetical protein SORBIDRAFT_09g024530 [Sorghum bicolor]
 gb|AFW78549.1| protein translation factor SUI1 [Zea mays]
Length=115

 Score =   137 bits (346),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 64/74 (86%), Positives = 70/74 (95%), Gaps = 2/74 (3%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAG--SKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNK  371
            MSDLD+Q+PS FDPFAE NAE+SGAG  +KDYVH+R+QQRNGRKSLTTVQGLKKEFSYNK
Sbjct  1    MSDLDVQLPSAFDPFAEANAEDSGAGPGTKDYVHVRIQQRNGRKSLTTVQGLKKEFSYNK  60

Query  372  ILKDLKKEFCCNGT  413
            ILKDLKKEFCCNGT
Sbjct  61   ILKDLKKEFCCNGT  74



>ref|XP_007021029.1| Translation initiation factor SUI1 family protein [Theobroma 
cacao]
 gb|EOY12554.1| Translation initiation factor SUI1 family protein [Theobroma 
cacao]
Length=113

 Score =   137 bits (345),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MSDLD+QIP+ FDPFA+ NAE+SGAG+K+YVHIR+QQRNGRKSLTTVQGLKKEFSYNKIL
Sbjct  1    MSDLDVQIPTAFDPFADANAEDSGAGAKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKK FCCNGT
Sbjct  61   KDLKKVFCCNGT  72



>ref|XP_010923943.1| PREDICTED: protein translation factor SUI1 homolog [Elaeis guineensis]
Length=113

 Score =   137 bits (345),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 60/72 (83%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MS LD+Q+P+ +DPFAE NAE+SGAG+K+YVH+R+QQRNGRKSLTTVQGLKKEFSYNKIL
Sbjct  1    MSGLDIQVPTAYDPFAEANAEDSGAGAKEYVHVRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>ref|XP_004287929.1| PREDICTED: protein translation factor SUI1 homolog 2-like [Fragaria 
vesca subsp. vesca]
Length=113

 Score =   137 bits (345),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 61/72 (85%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MS+L+ Q+PSTFDPFA+ NAE+SGAG+K+YVH+RVQQRNGRKSLTTVQGLKKE+SYNKIL
Sbjct  1    MSELETQVPSTFDPFADANAEDSGAGTKEYVHVRVQQRNGRKSLTTVQGLKKEYSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>ref|XP_006370639.1| hypothetical protein POPTR_0001s44450g [Populus trichocarpa]
 ref|XP_006370640.1| Protein translation factor SUI1 1 family protein [Populus trichocarpa]
 gb|ABK94414.1| unknown [Populus trichocarpa]
 gb|ERP67208.1| hypothetical protein POPTR_0001s44450g [Populus trichocarpa]
 gb|ERP67209.1| Protein translation factor SUI1 1 family protein [Populus trichocarpa]
Length=113

 Score =   137 bits (345),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MSDLD+Q P+ FDPFA+ NAE+SGAG+K+YVHIR QQRNGRKSLTTVQGLKKEFSYNKIL
Sbjct  1    MSDLDVQTPTAFDPFADANAEDSGAGAKEYVHIRTQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>ref|XP_008341979.1| PREDICTED: protein translation factor SUI1 homolog [Malus domestica]
Length=113

 Score =   137 bits (345),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 61/72 (85%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MS+ D Q+PS FDPFA+ NAENSGAG+K+YVH+RVQQRNGRKSLTTVQGLKKE+SYNKIL
Sbjct  1    MSEFDTQVPSAFDPFADANAENSGAGTKEYVHVRVQQRNGRKSLTTVQGLKKEYSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>ref|XP_010545205.1| PREDICTED: protein translation factor SUI1 homolog 1-like [Tarenaya 
hassleriana]
 ref|XP_010545206.1| PREDICTED: protein translation factor SUI1 homolog 1-like [Tarenaya 
hassleriana]
Length=113

 Score =   137 bits (345),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MS++D QIP+TFDPFA+ NAE+SGAGSK+YVHIRVQQRNGRKSLTTVQGLKKE+SY+KIL
Sbjct  1    MSEIDTQIPTTFDPFADANAEDSGAGSKEYVHIRVQQRNGRKSLTTVQGLKKEYSYSKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>ref|XP_004970238.1| PREDICTED: protein translation factor SUI1 homolog isoform X2 
[Setaria italica]
Length=115

 Score =   137 bits (345),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 64/74 (86%), Positives = 70/74 (95%), Gaps = 2/74 (3%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENS--GAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNK  371
            MSDLD+Q+PS FDPFAE NAE+S  GAGSK+YVH+RVQQRNGRKSLTTVQGLKKE+SYNK
Sbjct  1    MSDLDVQLPSAFDPFAEANAEDSSAGAGSKEYVHVRVQQRNGRKSLTTVQGLKKEYSYNK  60

Query  372  ILKDLKKEFCCNGT  413
            ILKDLKKEFCCNGT
Sbjct  61   ILKDLKKEFCCNGT  74



>ref|XP_002316980.1| hypothetical protein POPTR_0011s13810g [Populus trichocarpa]
 ref|XP_006377838.1| hypothetical protein POPTR_0011s13810g [Populus trichocarpa]
 gb|ABK93182.1| unknown [Populus trichocarpa]
 gb|ABK93949.1| unknown [Populus trichocarpa]
 gb|EEE97592.1| hypothetical protein POPTR_0011s13810g [Populus trichocarpa]
 gb|ERP55635.1| hypothetical protein POPTR_0011s13810g [Populus trichocarpa]
Length=113

 Score =   137 bits (345),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MSD D Q PS +DPFA+ NAE+SGAG+KDYVHIR+QQRNGRKSLTTVQGLKKEFSYNKIL
Sbjct  1    MSDFDAQTPSAYDPFADANAEDSGAGTKDYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>gb|AFW78550.1| hypothetical protein ZEAMMB73_586492 [Zea mays]
Length=118

 Score =   137 bits (345),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 64/74 (86%), Positives = 70/74 (95%), Gaps = 2/74 (3%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAG--SKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNK  371
            MSDLD+Q+PS FDPFAE NAE+SGAG  +KDYVH+R+QQRNGRKSLTTVQGLKKEFSYNK
Sbjct  1    MSDLDVQLPSAFDPFAEANAEDSGAGPGTKDYVHVRIQQRNGRKSLTTVQGLKKEFSYNK  60

Query  372  ILKDLKKEFCCNGT  413
            ILKDLKKEFCCNGT
Sbjct  61   ILKDLKKEFCCNGT  74



>ref|XP_006370638.1| hypothetical protein POPTR_0001s44450g [Populus trichocarpa]
 gb|ABK95287.1| unknown [Populus trichocarpa]
 gb|ERP67207.1| hypothetical protein POPTR_0001s44450g [Populus trichocarpa]
Length=125

 Score =   137 bits (345),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MSDLD+Q P+ FDPFA+ NAE+SGAG+K+YVHIR QQRNGRKSLTTVQGLKKEFSYNKIL
Sbjct  1    MSDLDVQTPTAFDPFADANAEDSGAGAKEYVHIRTQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>ref|XP_004970237.1| PREDICTED: protein translation factor SUI1 homolog isoform X1 
[Setaria italica]
Length=118

 Score =   137 bits (344),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 64/74 (86%), Positives = 70/74 (95%), Gaps = 2/74 (3%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENS--GAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNK  371
            MSDLD+Q+PS FDPFAE NAE+S  GAGSK+YVH+RVQQRNGRKSLTTVQGLKKE+SYNK
Sbjct  1    MSDLDVQLPSAFDPFAEANAEDSSAGAGSKEYVHVRVQQRNGRKSLTTVQGLKKEYSYNK  60

Query  372  ILKDLKKEFCCNGT  413
            ILKDLKKEFCCNGT
Sbjct  61   ILKDLKKEFCCNGT  74



>ref|XP_006377837.1| hypothetical protein POPTR_0011s13810g [Populus trichocarpa]
 gb|ERP55634.1| hypothetical protein POPTR_0011s13810g [Populus trichocarpa]
Length=76

 Score =   135 bits (341),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MSD D Q PS +DPFA+ NAE+SGAG+KDYVHIR+QQRNGRKSLTTVQGLKKEFSYNKIL
Sbjct  1    MSDFDAQTPSAYDPFADANAEDSGAGTKDYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  378  KDLKKEFCCNG  410
            KDLKKEFCCNG
Sbjct  61   KDLKKEFCCNG  71



>gb|AFW78551.1| hypothetical protein ZEAMMB73_586492 [Zea mays]
Length=117

 Score =   137 bits (344),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 64/74 (86%), Positives = 70/74 (95%), Gaps = 2/74 (3%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAG--SKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNK  371
            MSDLD+Q+PS FDPFAE NAE+SGAG  +KDYVH+R+QQRNGRKSLTTVQGLKKEFSYNK
Sbjct  1    MSDLDVQLPSAFDPFAEANAEDSGAGPGTKDYVHVRIQQRNGRKSLTTVQGLKKEFSYNK  60

Query  372  ILKDLKKEFCCNGT  413
            ILKDLKKEFCCNGT
Sbjct  61   ILKDLKKEFCCNGT  74



>emb|CDX92777.1| BnaC07g40350D [Brassica napus]
Length=203

 Score =   139 bits (351),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 77/89 (87%), Gaps = 1/89 (1%)
 Frame = +3

Query  147  SGDLFVCVAPFSYQPIFMSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKS  326
            SG  F  V P S Q  FMS+LD Q+P+ FDPFA+ NAE+SGAG+K+YVHIRVQQRNGRKS
Sbjct  75   SGVSFCVVCP-SDQQSFMSELDSQVPTAFDPFADANAEDSGAGTKEYVHIRVQQRNGRKS  133

Query  327  LTTVQGLKKEFSYNKILKDLKKEFCCNGT  413
            LTTVQGLKKE+SY+KILKDLKKEFCCNGT
Sbjct  134  LTTVQGLKKEYSYSKILKDLKKEFCCNGT  162



>ref|XP_002280157.1| PREDICTED: protein translation factor SUI1 homolog 1 [Vitis vinifera]
 ref|XP_003633291.1| PREDICTED: protein translation factor SUI1 homolog 1 [Vitis vinifera]
 emb|CBI28951.3| unnamed protein product [Vitis vinifera]
Length=113

 Score =   136 bits (343),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 61/72 (85%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MS+LD  IP+TFDPFA+ NAE+SGAG+K+YVH+R+QQRNGRKSLTTVQGLKKEFSYNKIL
Sbjct  1    MSELDANIPTTFDPFADANAEDSGAGTKEYVHVRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>ref|NP_001055949.1| Os05g0498400 [Oryza sativa Japonica Group]
 ref|XP_006654596.1| PREDICTED: protein translation factor SUI1 homolog [Oryza brachyantha]
 gb|AAT44286.1| putative protein translation factor Sui1 [Oryza sativa Japonica 
Group]
 dbj|BAF17863.1| Os05g0498400 [Oryza sativa Japonica Group]
 dbj|BAG91879.1| unnamed protein product [Oryza sativa Japonica Group]
Length=115

 Score =   136 bits (343),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 70/74 (95%), Gaps = 2/74 (3%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAG--SKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNK  371
            MSDLD+Q+PS FDPFAE NAE+SGAG  +KDYVH+R+QQRNGRKSLTTVQGLKKE+SYNK
Sbjct  1    MSDLDVQLPSAFDPFAEANAEDSGAGPGAKDYVHVRIQQRNGRKSLTTVQGLKKEYSYNK  60

Query  372  ILKDLKKEFCCNGT  413
            ILKDLKKEFCCNGT
Sbjct  61   ILKDLKKEFCCNGT  74



>gb|EYU27827.1| hypothetical protein MIMGU_mgv1a016640mg [Erythranthe guttata]
Length=113

 Score =   136 bits (343),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 63/72 (88%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MSDLD QIPS FDPFAE  AE+SG GSK+YVHIR+QQRNGRKSLTTVQGLKKEFSY KIL
Sbjct  1    MSDLDTQIPSPFDPFAEAKAEDSGVGSKEYVHIRIQQRNGRKSLTTVQGLKKEFSYTKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>ref|XP_006644837.1| PREDICTED: protein translation factor SUI1 homolog [Oryza brachyantha]
Length=115

 Score =   136 bits (342),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 69/74 (93%), Gaps = 2/74 (3%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENS--GAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNK  371
            MSDLD+Q+PS FDPFAE NAE+S  G GSKDYVH+R+QQRNGRKSLTTVQGLKKE+SYNK
Sbjct  1    MSDLDVQLPSAFDPFAEANAEDSSVGTGSKDYVHVRIQQRNGRKSLTTVQGLKKEYSYNK  60

Query  372  ILKDLKKEFCCNGT  413
            ILKDLKKEFCCNGT
Sbjct  61   ILKDLKKEFCCNGT  74



>ref|NP_001059843.1| Os07g0529800 [Oryza sativa Japonica Group]
 sp|Q0D5W6.1|SUI1_ORYSJ RecName: Full=Protein translation factor SUI1 homolog; AltName: 
Full=Protein GOS2; AltName: Full=Protein eIF1; AltName: Full=Translation 
initiation factor 1 [Oryza sativa Japonica Group]
 sp|A6MZM2.1|SUI1_ORYSI RecName: Full=Protein translation factor SUI1 homolog; AltName: 
Full=Protein GOS2; AltName: Full=Protein eIF1; AltName: Full=Translation 
initiation factor 1 [Oryza sativa Indica Group]
 gb|AAK56324.1|AF380357_1 translational initiation factor eIF1 [Oryza coarctata]
 emb|CAA36190.1| GOS2 [Oryza sativa Indica Group]
 gb|AAC67556.1| translation initiation factor [Oryza sativa Japonica Group]
 dbj|BAC45143.1| translational initiation factor eIF1 [Oryza sativa Japonica Group]
 dbj|BAF21757.1| Os07g0529800 [Oryza sativa Japonica Group]
 gb|ABR25442.1| putative protein translation factor sui1 [Oryza sativa Indica 
Group]
 gb|ABR26117.1| protein translation factor sui1 [Oryza sativa Indica Group]
 gb|ACJ09228.1| translation initiation factor eIF1 [Oryza sativa Indica Group]
 dbj|BAH00131.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AFI71284.1| protein translation factor SUI 1 [Oryza sativa Japonica Group]
Length=115

 Score =   136 bits (342),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 64/74 (86%), Positives = 69/74 (93%), Gaps = 2/74 (3%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGA--GSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNK  371
            MSDLD+QIP+ FDPFAE NA +SGA  GSKDYVH+R+QQRNGRKSLTTVQGLKKEFSYNK
Sbjct  1    MSDLDIQIPTAFDPFAEANAGDSGAAAGSKDYVHVRIQQRNGRKSLTTVQGLKKEFSYNK  60

Query  372  ILKDLKKEFCCNGT  413
            ILKDLKKEFCCNGT
Sbjct  61   ILKDLKKEFCCNGT  74



>ref|XP_011030847.1| PREDICTED: protein translation factor SUI1 homolog [Populus euphratica]
Length=113

 Score =   136 bits (342),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 61/72 (85%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MSD D Q P+ +DPFA+ NAE+SGAG+KDYVHIR+QQRNGRKSLTTVQGLKKEFSYNKIL
Sbjct  1    MSDFDAQTPTAYDPFADANAEDSGAGTKDYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>gb|KHN46541.1| Protein translation factor SUI1 like 1 [Glycine soja]
Length=155

 Score =   137 bits (345),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 63/73 (86%), Positives = 70/73 (96%), Gaps = 0/73 (0%)
 Frame = +3

Query  195  FMSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKI  374
            FMS+LD QIP+ FDPFA+ NA++SGAGSK+YVHIRVQQRNGRKSLTTVQGLKKEFSYNKI
Sbjct  42   FMSELDDQIPTAFDPFADANADDSGAGSKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKI  101

Query  375  LKDLKKEFCCNGT  413
            LKD+KKEFCCNGT
Sbjct  102  LKDVKKEFCCNGT  114



>emb|CDY46663.1| BnaA03g48450D [Brassica napus]
Length=196

 Score =   139 bits (349),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 69/94 (73%), Positives = 79/94 (84%), Gaps = 3/94 (3%)
 Frame = +3

Query  132  ESKISSGDLFVCVAPFSYQPIFMSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQR  311
            ES I S  +  C  P S Q  FMS+LD Q+P+ FDPFA+ NAE+SGAG+K+YVHIRVQQR
Sbjct  65   ESGIVSASVSFC--P-SDQQSFMSELDSQVPTAFDPFADANAEDSGAGTKEYVHIRVQQR  121

Query  312  NGRKSLTTVQGLKKEFSYNKILKDLKKEFCCNGT  413
            NGRKSLTTVQGLKKE+SY+KILKDLKKEFCCNGT
Sbjct  122  NGRKSLTTVQGLKKEYSYSKILKDLKKEFCCNGT  155



>gb|AFW75026.1| hypothetical protein ZEAMMB73_109319 [Zea mays]
Length=84

 Score =   135 bits (340),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 69/74 (93%), Gaps = 2/74 (3%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGA--GSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNK  371
            MSDLD+QIP+ FDPFAE NA +SGA  GSKDYVH+R+QQRNGRKSLTTVQGLKKEFSY+K
Sbjct  1    MSDLDIQIPTAFDPFAEANARDSGAAAGSKDYVHVRIQQRNGRKSLTTVQGLKKEFSYSK  60

Query  372  ILKDLKKEFCCNGT  413
            ILKDLKKEFCCNGT
Sbjct  61   ILKDLKKEFCCNGT  74



>ref|XP_004144491.1| PREDICTED: protein translation factor SUI1 homolog 2-like isoform 
3 [Cucumis sativus]
Length=105

 Score =   135 bits (341),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 60/72 (83%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MS+ ++QIPS FDPFA+ NAE+SGAG+K+YVH+R+QQRNGRKSLTTVQGLKKEFSYNKIL
Sbjct  1    MSEFNVQIPSAFDPFADANAEDSGAGAKEYVHVRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>gb|KHG11307.1| hypothetical protein F383_12372 [Gossypium arboreum]
Length=113

 Score =   136 bits (342),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MSDLD+ IP+ FDPFA+ NAE+SGAG+K+YVHIR+QQRNGRKSLTTVQGLKKEFSYNKIL
Sbjct  1    MSDLDILIPTAFDPFADANAEDSGAGTKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  378  KDLKKEFCCNG  410
            KDLKKEFCCNG
Sbjct  61   KDLKKEFCCNG  71



>ref|NP_175831.1| protein translation factor SUI1-2 [Arabidopsis thaliana]
 ref|XP_002894486.1| hypothetical protein ARALYDRAFT_474560 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_006392693.1| hypothetical protein EUTSA_v10011880mg [Eutrema salsugineum]
 sp|Q94JV4.1|SUI12_ARATH RecName: Full=Protein translation factor SUI1 homolog 2 [Arabidopsis 
thaliana]
 gb|AAD25609.1|AC005287_11 translation initiation factor [Arabidopsis thaliana]
 gb|AAK49626.1|AF372910_1 At1g54290/F20D21_53 [Arabidopsis thaliana]
 gb|AAN18215.1| At1g54290/F20D21_53 [Arabidopsis thaliana]
 gb|EFH70745.1| hypothetical protein ARALYDRAFT_474560 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AEE33076.1| protein translation factor SUI1-2 [Arabidopsis thaliana]
 gb|ESQ29979.1| hypothetical protein EUTSA_v10011880mg [Eutrema salsugineum]
Length=113

 Score =   136 bits (342),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 60/72 (83%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MSDL++Q+P+ FDPFA+ NAE+SGAG+K+YVHIRVQQRNGRKSLTTVQGLKKE+SY+KIL
Sbjct  1    MSDLEVQVPTAFDPFADANAEDSGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEYSYSKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>ref|XP_007216425.1| hypothetical protein PRUPE_ppa022105mg, partial [Prunus persica]
 gb|EMJ17624.1| hypothetical protein PRUPE_ppa022105mg, partial [Prunus persica]
Length=170

 Score =   137 bits (346),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 63/79 (80%), Positives = 71/79 (90%), Gaps = 0/79 (0%)
 Frame = +3

Query  177  FSYQPIFMSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKE  356
            F  Q  FMS+ D Q+PS FDPFA+ NAE+SGAG+K+YVH+RVQQRNGRKSLTTVQGLKKE
Sbjct  51   FLQQSSFMSEFDTQVPSAFDPFADANAEDSGAGTKEYVHVRVQQRNGRKSLTTVQGLKKE  110

Query  357  FSYNKILKDLKKEFCCNGT  413
            +SYNKILKDLKKEFCCNGT
Sbjct  111  YSYNKILKDLKKEFCCNGT  129



>gb|ABI48954.1| putative protein translation factor Sui1 [Viola baoshanensis]
Length=113

 Score =   135 bits (341),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 61/72 (85%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MSDLD+QIPS FDPFA+ + E+SGAG+KDYVHIR+QQRNGRKSLTTVQGLKK+FSYNKIL
Sbjct  1    MSDLDIQIPSAFDPFADASTEDSGAGTKDYVHIRIQQRNGRKSLTTVQGLKKDFSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KD KKEFCCNGT
Sbjct  61   KDXKKEFCCNGT  72



>tpg|DAA62968.1| TPA: translation initiation factor1 [Zea mays]
Length=109

 Score =   135 bits (341),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 69/74 (93%), Gaps = 2/74 (3%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGA--GSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNK  371
            MSDLD+QIP+ FDPFAE NA +SGA  GSKDYVH+R+QQRNGRKSLTTVQGLKKEFSY+K
Sbjct  1    MSDLDIQIPTAFDPFAEANAGDSGAAAGSKDYVHVRIQQRNGRKSLTTVQGLKKEFSYSK  60

Query  372  ILKDLKKEFCCNGT  413
            ILKDLKKEFCCNGT
Sbjct  61   ILKDLKKEFCCNGT  74



>ref|XP_004144489.1| PREDICTED: protein translation factor SUI1 homolog 2-like isoform 
1 [Cucumis sativus]
 ref|XP_004144490.1| PREDICTED: protein translation factor SUI1 homolog 2-like isoform 
2 [Cucumis sativus]
 ref|XP_008455418.1| PREDICTED: protein translation factor SUI1 homolog [Cucumis melo]
 ref|XP_008455419.1| PREDICTED: protein translation factor SUI1 homolog [Cucumis melo]
 ref|XP_008455420.1| PREDICTED: protein translation factor SUI1 homolog [Cucumis melo]
 gb|KGN43535.1| hypothetical protein Csa_7G044260 [Cucumis sativus]
Length=113

 Score =   135 bits (341),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 60/72 (83%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MS+ ++QIPS FDPFA+ NAE+SGAG+K+YVH+R+QQRNGRKSLTTVQGLKKEFSYNKIL
Sbjct  1    MSEFNVQIPSAFDPFADANAEDSGAGAKEYVHVRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>ref|XP_009342251.1| PREDICTED: protein translation factor SUI1 homolog [Pyrus x bretschneideri]
Length=113

 Score =   135 bits (340),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 60/72 (83%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MS+ D Q+PS FDPF + NAENSGAG+K+YVH+RVQQRNGRKSLTTVQGLKKE+SYNKIL
Sbjct  1    MSEFDTQVPSAFDPFTDANAENSGAGTKEYVHVRVQQRNGRKSLTTVQGLKKEYSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>ref|NP_001238017.1| uncharacterized protein LOC100306129 [Glycine max]
 gb|ACU14161.1| unknown [Glycine max]
 gb|KHN47859.1| Protein translation factor SUI1 like 1 [Glycine soja]
Length=113

 Score =   135 bits (340),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MS+LD QIP+ FDPFA+ NA++SGAGSK+YVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL
Sbjct  1    MSELDDQIPTAFDPFADANADDSGAGSKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KD+KKEFCCNGT
Sbjct  61   KDVKKEFCCNGT  72



>ref|XP_008230087.1| PREDICTED: protein translation factor SUI1 homolog [Prunus mume]
 ref|XP_008230088.1| PREDICTED: protein translation factor SUI1 homolog [Prunus mume]
Length=113

 Score =   135 bits (340),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 60/72 (83%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MS+ D Q+PS FDPFA+ NAE+SGAG+K+YVH+RVQQRNGRKSLTTVQGLKKE+SYNKIL
Sbjct  1    MSEFDTQVPSAFDPFADANAEDSGAGTKEYVHVRVQQRNGRKSLTTVQGLKKEYSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>ref|NP_001236633.1| uncharacterized protein LOC100499833 [Glycine max]
 gb|ACU13849.1| unknown [Glycine max]
Length=113

 Score =   135 bits (340),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MS+LD QIP+ FDPFA+ NA++SGAGSK+YVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL
Sbjct  1    MSELDDQIPTAFDPFADANADDSGAGSKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KD+KKEFCCNGT
Sbjct  61   KDVKKEFCCNGT  72



>ref|XP_008650268.1| PREDICTED: protein translation factor SUI1 homolog [Zea mays]
 gb|AFW75027.1| hypothetical protein ZEAMMB73_109319 [Zea mays]
Length=91

 Score =   134 bits (338),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 69/74 (93%), Gaps = 2/74 (3%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGA--GSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNK  371
            MSDLD+QIP+ FDPFAE NA +SGA  GSKDYVH+R+QQRNGRKSLTTVQGLKKEFSY+K
Sbjct  1    MSDLDIQIPTAFDPFAEANARDSGAAAGSKDYVHVRIQQRNGRKSLTTVQGLKKEFSYSK  60

Query  372  ILKDLKKEFCCNGT  413
            ILKDLKKEFCCNGT
Sbjct  61   ILKDLKKEFCCNGT  74



>ref|XP_009401666.1| PREDICTED: protein translation factor SUI1 homolog [Musa acuminata 
subsp. malaccensis]
Length=113

 Score =   135 bits (340),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 60/72 (83%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MSDLD+Q+P+ FDPFAE NA++SG G+K+YVH+RVQQRNGRK LTTVQGLKKEFSYNKIL
Sbjct  1    MSDLDVQLPTAFDPFAEANADDSGVGAKEYVHVRVQQRNGRKCLTTVQGLKKEFSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>ref|XP_006304318.1| hypothetical protein CARUB_v10010698mg [Capsella rubella]
 ref|XP_010462345.1| PREDICTED: protein translation factor SUI1 homolog 2 [Camelina 
sativa]
 ref|XP_010480023.1| PREDICTED: protein translation factor SUI1 homolog 2 [Camelina 
sativa]
 gb|EOA37216.1| hypothetical protein CARUB_v10010698mg [Capsella rubella]
Length=113

 Score =   135 bits (339),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 59/72 (82%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MSDL++Q+P+ FDPFA+ NAE++GAG+K+YVHIRVQQRNGRKSLTTVQGLKKE+SY+KIL
Sbjct  1    MSDLEVQVPTAFDPFADANAEDAGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEYSYSKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>ref|XP_004515084.1| PREDICTED: protein translation factor SUI1 homolog isoform X2 
[Cicer arietinum]
Length=113

 Score =   135 bits (339),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 61/72 (85%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MS+ D  IPSTFDPFAE NAE+SGAG+K+YVH+RVQQRNGRKSLTTVQGLKKE+SY+KIL
Sbjct  1    MSEFDTNIPSTFDPFAEANAEDSGAGTKEYVHVRVQQRNGRKSLTTVQGLKKEYSYSKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>ref|XP_006413104.1| hypothetical protein EUTSA_v10026037mg [Eutrema salsugineum]
 gb|ESQ54557.1| hypothetical protein EUTSA_v10026037mg [Eutrema salsugineum]
Length=256

 Score =   139 bits (350),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 77/89 (87%), Gaps = 1/89 (1%)
 Frame = +3

Query  147  SGDLFVCVAPFSYQPIFMSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKS  326
            SG  F  V P S Q  FMS+LD Q+P+ FDPFA+ NAE+SGAG+K+YVHIRVQQRNGRKS
Sbjct  128  SGLSFSVVCP-SDQQSFMSELDSQVPTAFDPFADANAEDSGAGTKEYVHIRVQQRNGRKS  186

Query  327  LTTVQGLKKEFSYNKILKDLKKEFCCNGT  413
            LTTVQGLKKE+SY+KILKDLKKEFCCNGT
Sbjct  187  LTTVQGLKKEYSYSKILKDLKKEFCCNGT  215



>gb|KJB39025.1| hypothetical protein B456_007G314400 [Gossypium raimondii]
Length=111

 Score =   135 bits (339),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 69/72 (96%), Gaps = 1/72 (1%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MSDLD+QIP+ FDPFA+ NAE+SGAG+K+YVHIR+QQRNGRKSLTTVQGLKKEFSYNKIL
Sbjct  1    MSDLDIQIPTAFDPFADANAEDSGAGTKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KDL KEFCCNGT
Sbjct  61   KDL-KEFCCNGT  71



>ref|XP_006591819.1| PREDICTED: uncharacterized protein LOC100306129 isoform X1 [Glycine 
max]
Length=114

 Score =   135 bits (339),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MS+LD QIP+ FDPFA+ NA++SGAGSK+YVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL
Sbjct  1    MSELDDQIPTAFDPFADANADDSGAGSKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KD+KKEFCCNGT
Sbjct  61   KDVKKEFCCNGT  72



>sp|Q9SM41.1|SUI1_SPOST RecName: Full=Protein translation factor SUI1 homolog [Sporobolus 
stapfianus]
 emb|CAB61837.1| putative translation initiation factor eIF-1 [Sporobolus stapfianus]
Length=115

 Score =   135 bits (339),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 69/74 (93%), Gaps = 2/74 (3%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGA--GSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNK  371
            MSDLD+QIP+ FDPF+E NA +SGA  GSKDYVH+R+QQRNGRKSLTTVQGLKKEFSYNK
Sbjct  1    MSDLDIQIPTAFDPFSEANAGDSGAAAGSKDYVHVRIQQRNGRKSLTTVQGLKKEFSYNK  60

Query  372  ILKDLKKEFCCNGT  413
            ILKDLKKEFCCNGT
Sbjct  61   ILKDLKKEFCCNGT  74



>ref|XP_002310461.1| SUI1 family protein [Populus trichocarpa]
 gb|EEE90911.1| SUI1 family protein [Populus trichocarpa]
Length=113

 Score =   135 bits (339),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 61/72 (85%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MS+ D  IP+ FDPFAE NAE+SGAG+KDYVH+RVQQRNGRKSLTTVQGLKKE+SYNKIL
Sbjct  1    MSEFDNAIPTAFDPFAEANAEDSGAGTKDYVHVRVQQRNGRKSLTTVQGLKKEYSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>gb|ABO15891.1| translation initiation factor eIF1 [synthetic construct]
 gb|ABX61094.1| putative translation initiation factor [Triticum aestivum]
 gb|ADD62702.1| eukaryotic translation initiation factor 1 [Leymus chinensis]
 emb|CDM84532.1| unnamed protein product [Triticum aestivum]
Length=115

 Score =   134 bits (338),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 70/74 (95%), Gaps = 2/74 (3%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAG--SKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNK  371
            MSDLD+Q+P+ FDPFAE NAE+SGAG  SK+YVH+RVQQRNGRKSLTTVQGLKK++SYNK
Sbjct  1    MSDLDVQVPTAFDPFAEANAEDSGAGAGSKNYVHVRVQQRNGRKSLTTVQGLKKDYSYNK  60

Query  372  ILKDLKKEFCCNGT  413
            ILKDLKKEFCCNGT
Sbjct  61   ILKDLKKEFCCNGT  74



>ref|XP_002310460.1| hypothetical protein POPTR_0007s02520g [Populus trichocarpa]
 ref|XP_006380311.1| SUI1 family protein [Populus trichocarpa]
 ref|XP_006380312.1| hypothetical protein POPTR_0007s02520g [Populus trichocarpa]
 ref|XP_011026342.1| PREDICTED: protein translation factor SUI1 homolog [Populus euphratica]
 ref|XP_011026343.1| PREDICTED: protein translation factor SUI1 homolog [Populus euphratica]
 gb|ABK95531.1| unknown [Populus trichocarpa]
 gb|EEE90910.1| hypothetical protein POPTR_0007s02520g [Populus trichocarpa]
 gb|ERP58108.1| SUI1 family protein [Populus trichocarpa]
 gb|ERP58109.1| hypothetical protein POPTR_0007s02520g [Populus trichocarpa]
Length=113

 Score =   134 bits (338),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 61/72 (85%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MS+ D  IP+ FDPFAE NAE+SGAG+KDYVH+RVQQRNGRKSLTTVQGLKKE+SYNKIL
Sbjct  1    MSEFDNAIPTAFDPFAEANAEDSGAGTKDYVHVRVQQRNGRKSLTTVQGLKKEYSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>ref|XP_002867520.1| hypothetical protein ARALYDRAFT_492082 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_009143120.1| PREDICTED: protein translation factor SUI1 homolog 1 [Brassica 
rapa]
 gb|EFH43779.1| hypothetical protein ARALYDRAFT_492082 [Arabidopsis lyrata subsp. 
lyrata]
 emb|CDY29277.1| BnaC01g19290D [Brassica napus]
 emb|CDX89276.1| BnaA01g16170D [Brassica napus]
Length=113

 Score =   134 bits (338),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 60/72 (83%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MS+LD Q+P+ FDPFA+ NAE+SGAG+K+YVHIRVQQRNGRKSLTTVQGLKKE+SY+KIL
Sbjct  1    MSELDSQVPTAFDPFADANAEDSGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEYSYSKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>ref|XP_003568176.1| PREDICTED: protein translation factor SUI1 homolog [Brachypodium 
distachyon]
Length=115

 Score =   134 bits (338),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 69/74 (93%), Gaps = 2/74 (3%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAG--SKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNK  371
            MSDLD+ +PS FDPFAE NAE++GAG  +KDYVH+R+QQRNGRKSLTTVQGLKKEFSYNK
Sbjct  1    MSDLDVTLPSAFDPFAEANAEDAGAGPGAKDYVHVRIQQRNGRKSLTTVQGLKKEFSYNK  60

Query  372  ILKDLKKEFCCNGT  413
            ILKDLKKEFCCNGT
Sbjct  61   ILKDLKKEFCCNGT  74



>gb|KEH38847.1| eukaryotic translation initiation factor SUI1 [Medicago truncatula]
Length=110

 Score =   134 bits (337),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 62/73 (85%), Positives = 69/73 (95%), Gaps = 1/73 (1%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGS-KDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKI  374
            MS+LD QIP+ +DPFAE NAE++GAGS K+YVHIR+QQRNGRKSLTTVQGLKKEFSYNKI
Sbjct  1    MSELDAQIPTAYDPFAEANAEDAGAGSSKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKI  60

Query  375  LKDLKKEFCCNGT  413
            LKDLKKEFCCNGT
Sbjct  61   LKDLKKEFCCNGT  73



>ref|NP_001104887.1| protein translation factor SUI1 homolog [Zea mays]
 ref|XP_006657782.1| PREDICTED: protein translation factor SUI1 homolog [Oryza brachyantha]
 ref|XP_006659299.1| PREDICTED: protein translation factor SUI1 homolog [Oryza brachyantha]
 sp|P56330.1|SUI1_MAIZE RecName: Full=Protein translation factor SUI1 homolog; AltName: 
Full=Protein GOS2 [Zea mays]
 gb|AAB88615.1| translation initiation factor [Zea mays]
 gb|ACF80856.1| unknown [Zea mays]
 gb|ACG27240.1| protein translation factor SUI1 [Zea mays]
 gb|ACG28108.1| protein translation factor SUI1 [Zea mays]
 gb|ACG30000.1| protein translation factor SUI1 [Zea mays]
 gb|ACG30907.1| protein translation factor SUI1 [Zea mays]
 gb|ACG37835.1| protein translation factor SUI1 [Zea mays]
 tpg|DAA62967.1| TPA: translation initiation factor1 [Zea mays]
Length=115

 Score =   134 bits (338),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 69/74 (93%), Gaps = 2/74 (3%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGA--GSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNK  371
            MSDLD+QIP+ FDPFAE NA +SGA  GSKDYVH+R+QQRNGRKSLTTVQGLKKEFSY+K
Sbjct  1    MSDLDIQIPTAFDPFAEANAGDSGAAAGSKDYVHVRIQQRNGRKSLTTVQGLKKEFSYSK  60

Query  372  ILKDLKKEFCCNGT  413
            ILKDLKKEFCCNGT
Sbjct  61   ILKDLKKEFCCNGT  74



>ref|XP_004515083.1| PREDICTED: protein translation factor SUI1 homolog isoform X1 
[Cicer arietinum]
Length=123

 Score =   134 bits (338),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 61/72 (85%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MS+ D  IPSTFDPFAE NAE+SGAG+K+YVH+RVQQRNGRKSLTTVQGLKKE+SY+KIL
Sbjct  1    MSEFDTNIPSTFDPFAEANAEDSGAGTKEYVHVRVQQRNGRKSLTTVQGLKKEYSYSKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>sp|Q9SQF4.1|SUI1_BRAOL RecName: Full=Protein translation factor SUI1 homolog; AltName: 
Full=Translation initiation factor nps45 [Brassica oleracea]
 gb|AAF04624.1|AF098672_1 translation initiation factor nps45 [Brassica oleracea]
Length=113

 Score =   134 bits (337),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 60/72 (83%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MS+LD Q+P+ FDPFA+ NAE+SGAG+K+YVHIRVQQRNGRKSLTTVQGLKKE+SY KIL
Sbjct  1    MSELDSQVPTAFDPFADANAEDSGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEYSYTKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>ref|NP_194443.1| protein translation factor SUI1-1 [Arabidopsis thaliana]
 ref|XP_010448590.1| PREDICTED: protein translation factor SUI1 homolog 1 [Camelina 
sativa]
 ref|XP_010443052.1| PREDICTED: protein translation factor SUI1 homolog 1 [Camelina 
sativa]
 ref|XP_010482884.1| PREDICTED: protein translation factor SUI1 homolog 1 [Camelina 
sativa]
 sp|P41568.2|SUI11_ARATH RecName: Full=Protein translation factor SUI1 homolog 1 [Arabidopsis 
thaliana]
 gb|AAB68033.1| translation initiation factor [Arabidopsis thaliana]
 emb|CAB38843.1| translation initiation factor [Arabidopsis thaliana]
 emb|CAB79568.1| translation initiation factor [Arabidopsis thaliana]
 gb|AAK59834.1| AT4g27130/T24A18_80 [Arabidopsis thaliana]
 gb|AAL31168.1| AT4g27130/T24A18_80 [Arabidopsis thaliana]
 gb|AAM65827.1| translation initiation factor [Arabidopsis thaliana]
 gb|AEE85305.1| protein translation factor SUI1-1 [Arabidopsis thaliana]
 emb|CDY14282.1| BnaA08g14130D [Brassica napus]
 emb|CDX97378.1| BnaC08g12430D [Brassica napus]
Length=113

 Score =   134 bits (337),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 60/72 (83%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MS+LD Q+P+ FDPFA+ NAE+SGAG+K+YVHIRVQQRNGRKSLTTVQGLKKE+SY KIL
Sbjct  1    MSELDSQVPTAFDPFADANAEDSGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEYSYTKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>gb|KEH38845.1| eukaryotic translation initiation factor SUI1 [Medicago truncatula]
Length=115

 Score =   134 bits (337),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 62/73 (85%), Positives = 69/73 (95%), Gaps = 1/73 (1%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGS-KDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKI  374
            MS+LD QIP+ +DPFAE NAE++GAGS K+YVHIR+QQRNGRKSLTTVQGLKKEFSYNKI
Sbjct  1    MSELDAQIPTAYDPFAEANAEDAGAGSSKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKI  60

Query  375  LKDLKKEFCCNGT  413
            LKDLKKEFCCNGT
Sbjct  61   LKDLKKEFCCNGT  73



>ref|XP_004957905.1| PREDICTED: protein translation factor SUI1 homolog isoform X1 
[Setaria italica]
 ref|XP_004957906.1| PREDICTED: protein translation factor SUI1 homolog isoform X2 
[Setaria italica]
Length=115

 Score =   134 bits (337),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 69/74 (93%), Gaps = 2/74 (3%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGA--GSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNK  371
            MSDLD+QIP+ FDPFAE NA +SGA  GSKDYVH+R+QQRNGRKSLTTVQGLKKEFSY+K
Sbjct  1    MSDLDVQIPTAFDPFAEANAGDSGAAAGSKDYVHVRIQQRNGRKSLTTVQGLKKEFSYSK  60

Query  372  ILKDLKKEFCCNGT  413
            ILKDLKKEFCCNGT
Sbjct  61   ILKDLKKEFCCNGT  74



>gb|KJB39023.1| hypothetical protein B456_007G314400 [Gossypium raimondii]
 gb|KJB39024.1| hypothetical protein B456_007G314400 [Gossypium raimondii]
 gb|KJB39026.1| hypothetical protein B456_007G314400 [Gossypium raimondii]
 gb|KJB39027.1| hypothetical protein B456_007G314400 [Gossypium raimondii]
Length=111

 Score =   134 bits (337),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 69/72 (96%), Gaps = 1/72 (1%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MSDLD+QIP+ FDPFA+ NAE+SGAG+K+YVHIR+QQRNGRKSLTTVQGLKKEFSYNKIL
Sbjct  1    MSDLDIQIPTAFDPFADANAEDSGAGTKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KDL KEFCCNGT
Sbjct  61   KDL-KEFCCNGT  71



>ref|XP_003527319.1| PREDICTED: protein translation factor SUI1 homolog 1 [Glycine 
max]
 gb|KHN46542.1| Protein translation factor SUI1 like 1 [Glycine soja]
Length=113

 Score =   134 bits (337),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MS LD QIP+ FDPFA+ NA++SGAGSK+YVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL
Sbjct  1    MSGLDDQIPTAFDPFADANADDSGAGSKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KD+KKEFCCNGT
Sbjct  61   KDVKKEFCCNGT  72



>gb|KEH29652.1| eukaryotic translation initiation factor SUI1 [Medicago truncatula]
Length=113

 Score =   134 bits (337),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 60/72 (83%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MS+ D  IP+T+DPFAE NAE+SGAG+K+YVH+RVQQRNGRKSLTTVQGLKKEFSY+KIL
Sbjct  1    MSEFDTNIPTTYDPFAEANAEDSGAGTKEYVHVRVQQRNGRKSLTTVQGLKKEFSYSKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>ref|XP_003596650.1| Translation factor Sui1-like protein [Medicago truncatula]
 gb|AES66901.1| eukaryotic translation initiation factor SUI1 [Medicago truncatula]
 gb|AFK43860.1| unknown [Medicago truncatula]
Length=114

 Score =   134 bits (337),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 62/73 (85%), Positives = 69/73 (95%), Gaps = 1/73 (1%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGS-KDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKI  374
            MS+LD QIP+ +DPFAE NAE++GAGS K+YVHIR+QQRNGRKSLTTVQGLKKEFSYNKI
Sbjct  1    MSELDAQIPTAYDPFAEANAEDAGAGSSKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKI  60

Query  375  LKDLKKEFCCNGT  413
            LKDLKKEFCCNGT
Sbjct  61   LKDLKKEFCCNGT  73



>ref|XP_010501111.1| PREDICTED: protein translation factor SUI1 homolog 2-like [Camelina 
sativa]
Length=113

 Score =   134 bits (336),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 59/72 (82%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MSDL++Q+P+ FDPFA+ NAE+ GAG+K+YVHIRVQQRNGRKSLTTVQGLKKE+SY+KIL
Sbjct  1    MSDLEVQVPTAFDPFADANAEDVGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEYSYSKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>gb|AFC01199.1| eukaryotic translation initiation factor [Ammopiptanthus mongolicus]
Length=113

 Score =   134 bits (336),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 60/72 (83%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MS+ D  IP+TFDPFAE NAE+SGAG+K+YVH+RVQQRNGRKSLTTVQGLKKE+SY KIL
Sbjct  1    MSEFDTNIPTTFDPFAEANAEDSGAGTKEYVHVRVQQRNGRKSLTTVQGLKKEYSYTKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>gb|AFK35113.1| unknown [Lotus japonicus]
 gb|AFK48780.1| unknown [Lotus japonicus]
Length=114

 Score =   134 bits (336),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 63/73 (86%), Positives = 68/73 (93%), Gaps = 1/73 (1%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGS-KDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKI  374
            MS+LD  IP+ FDPFAE NAE+SGAGS K+YVHIR+QQRNGRKSLTTVQGLKKEFSYNKI
Sbjct  1    MSELDAAIPTAFDPFAEANAEDSGAGSSKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKI  60

Query  375  LKDLKKEFCCNGT  413
            LKDLKKEFCCNGT
Sbjct  61   LKDLKKEFCCNGT  73



>ref|XP_010909791.1| PREDICTED: protein translation factor SUI1 homolog [Elaeis guineensis]
Length=113

 Score =   133 bits (335),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 59/72 (82%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MSDL++Q+P+ FD FAE NAE+SGAG+K+YVH+R+QQRNGRKSLTTVQGLKKEFSY+KIL
Sbjct  1    MSDLNVQLPTAFDSFAEANAEDSGAGAKEYVHVRIQQRNGRKSLTTVQGLKKEFSYSKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>gb|KEH38846.1| eukaryotic translation initiation factor SUI1 [Medicago truncatula]
Length=101

 Score =   133 bits (334),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 62/73 (85%), Positives = 69/73 (95%), Gaps = 1/73 (1%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGS-KDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKI  374
            MS+LD QIP+ +DPFAE NAE++GAGS K+YVHIR+QQRNGRKSLTTVQGLKKEFSYNKI
Sbjct  1    MSELDAQIPTAYDPFAEANAEDAGAGSSKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKI  60

Query  375  LKDLKKEFCCNGT  413
            LKDLKKEFCCNGT
Sbjct  61   LKDLKKEFCCNGT  73



>ref|XP_010448172.1| PREDICTED: protein translation factor SUI1 homolog 1-like [Camelina 
sativa]
Length=113

 Score =   133 bits (335),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 59/72 (82%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MS+LD Q+P+ FDPFA+ NAE++GAG+K+YVHIRVQQRNGRKSLTTVQGLKKE+SY KIL
Sbjct  1    MSELDSQVPTAFDPFADANAEDAGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEYSYTKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>gb|AFK43238.1| unknown [Medicago truncatula]
Length=113

 Score =   133 bits (334),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 59/72 (82%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MS+ D  IP+T+DPFAE NAE+SGAG+K+YVH+RVQQRNGR+SLTTVQGLKKEFSY+KIL
Sbjct  1    MSEFDTNIPTTYDPFAEANAEDSGAGTKEYVHVRVQQRNGRRSLTTVQGLKKEFSYSKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>sp|O48650.1|SUI1_SALBA RecName: Full=Protein translation factor SUI1 homolog [Salix 
bakko]
 dbj|BAA24697.1| SUI1 homolog [Salix bakko]
Length=113

 Score =   133 bits (334),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 60/72 (83%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MS+ D  IP+ FDPFAE NAE+SGAG+KDYVH+RVQQRNGRKSLTTVQGLKK++SYNKIL
Sbjct  1    MSEFDNAIPTAFDPFAEANAEDSGAGTKDYVHVRVQQRNGRKSLTTVQGLKKDYSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>ref|XP_006284788.1| hypothetical protein CARUB_v10006056mg [Capsella rubella]
 gb|EOA17686.1| hypothetical protein CARUB_v10006056mg [Capsella rubella]
Length=115

 Score =   133 bits (334),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 59/72 (82%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MS+LD Q+P+ FDPFA+ N E+SGAG+K+YVHIRVQQRNGRKSLTTVQGLKKE+SY KIL
Sbjct  1    MSELDSQVPTAFDPFADANVEDSGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEYSYTKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>gb|AGT16828.1| protein translation factor SUI1 [Saccharum hybrid cultivar R570]
Length=116

 Score =   133 bits (334),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/75 (87%), Positives = 69/75 (92%), Gaps = 3/75 (4%)
 Frame = +3

Query  198  MSDLDLQ-IPSTFDPFAEGNAENS--GAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYN  368
            MSDLDLQ +PS FDPFAE NAE+S  GAGSKDYVH+R QQRNGRKSLTTVQGLKKE+SYN
Sbjct  1    MSDLDLQQLPSAFDPFAEANAEDSSAGAGSKDYVHVRSQQRNGRKSLTTVQGLKKEYSYN  60

Query  369  KILKDLKKEFCCNGT  413
            KILKDLKKEFCCNGT
Sbjct  61   KILKDLKKEFCCNGT  75



>ref|XP_006284787.1| hypothetical protein CARUB_v10006056mg [Capsella rubella]
 gb|EOA17685.1| hypothetical protein CARUB_v10006056mg [Capsella rubella]
Length=113

 Score =   132 bits (333),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 59/72 (82%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MS+LD Q+P+ FDPFA+ N E+SGAG+K+YVHIRVQQRNGRKSLTTVQGLKKE+SY KIL
Sbjct  1    MSELDSQVPTAFDPFADANVEDSGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEYSYTKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>gb|KDP20792.1| hypothetical protein JCGZ_21263 [Jatropha curcas]
Length=113

 Score =   132 bits (333),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 60/72 (83%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MS+ D+QIP+ FDP AE NA +SGAG+K+YVHIRVQQRNGRKSLTTVQGLKKEFSYN IL
Sbjct  1    MSERDIQIPTAFDPLAEANAADSGAGAKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNMIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>ref|NP_200287.1| translation initiation factor SUI1 family protein [Arabidopsis 
thaliana]
 ref|NP_001119436.1| translation initiation factor SUI1 family protein [Arabidopsis 
thaliana]
 ref|NP_001190540.1| translation initiation factor SUI1 family protein [Arabidopsis 
thaliana]
 ref|XP_002864353.1| hypothetical protein ARALYDRAFT_495556 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_010433396.1| PREDICTED: protein translation factor SUI1 homolog 1-like [Camelina 
sativa]
 ref|XP_010438654.1| PREDICTED: protein translation factor SUI1 homolog 1-like [Camelina 
sativa]
 dbj|BAB08755.1| protein translation factor Sui1 homolog [Arabidopsis thaliana]
 gb|AAO64771.1| At5g54760 [Arabidopsis thaliana]
 gb|EFH40612.1| hypothetical protein ARALYDRAFT_495556 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AED96536.1| translation initiation factor SUI1 family protein [Arabidopsis 
thaliana]
 gb|AED96537.1| translation initiation factor SUI1 family protein [Arabidopsis 
thaliana]
 gb|AED96538.1| translation initiation factor SUI1 family protein [Arabidopsis 
thaliana]
Length=113

 Score =   132 bits (333),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 59/72 (82%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MS+LD Q+P+ FDPFA+ N E+SGAG+K+YVHIRVQQRNGRKSLTTVQGLKKE+SY KIL
Sbjct  1    MSELDSQVPTAFDPFADANVEDSGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEYSYTKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>ref|NP_001239651.1| uncharacterized protein LOC100784390 [Glycine max]
 ref|XP_006591863.1| PREDICTED: uncharacterized protein LOC100784390 isoform X1 [Glycine 
max]
 gb|ACU18971.1| unknown [Glycine max]
 gb|KHN22844.1| Protein translation factor SUI1 like [Glycine soja]
Length=113

 Score =   132 bits (332),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 59/72 (82%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MS+ D  IP+ FDPFAE NAE+SGAG+K+YVH+RVQQRNGRKSLTTVQGLKKE+SY+KIL
Sbjct  1    MSEFDTNIPTAFDPFAEANAEDSGAGTKEYVHVRVQQRNGRKSLTTVQGLKKEYSYSKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>gb|AFK48465.1| unknown [Lotus japonicus]
Length=116

 Score =   132 bits (332),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/75 (84%), Positives = 67/75 (89%), Gaps = 3/75 (4%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAG---SKDYVHIRVQQRNGRKSLTTVQGLKKEFSYN  368
            MS+LD QIP+ FDPFAE N + SGAG   +KDYVHIRVQQRNGRKSLTTVQGLKKEFSYN
Sbjct  1    MSELDAQIPTAFDPFAEANVDESGAGGAGTKDYVHIRVQQRNGRKSLTTVQGLKKEFSYN  60

Query  369  KILKDLKKEFCCNGT  413
            KILKDLKKEFCCNGT
Sbjct  61   KILKDLKKEFCCNGT  75



>ref|XP_009137639.1| PREDICTED: protein translation factor SUI1 homolog 1-like [Brassica 
rapa]
Length=113

 Score =   132 bits (331),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 59/72 (82%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MS+LD Q+P+ FDPFA+ NAE+SGAG K+YVHIRVQQRNGRKSLTTV+GLKKE+SY+KIL
Sbjct  1    MSELDSQVPTAFDPFADANAEDSGAGKKEYVHIRVQQRNGRKSLTTVKGLKKEYSYSKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>ref|XP_007132567.1| hypothetical protein PHAVU_011G105700g [Phaseolus vulgaris]
 gb|ESW04561.1| hypothetical protein PHAVU_011G105700g [Phaseolus vulgaris]
Length=113

 Score =   132 bits (331),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 59/72 (82%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MS+ +  IPS FDPFAE NAE+SGAG+K+YVH+RVQQRNGRKSLTTVQGLKKE+SY+KIL
Sbjct  1    MSEFETNIPSAFDPFAEANAEDSGAGTKEYVHVRVQQRNGRKSLTTVQGLKKEYSYSKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>ref|XP_009109147.1| PREDICTED: protein translation factor SUI1 homolog 1-like [Brassica 
rapa]
Length=113

 Score =   132 bits (331),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 59/72 (82%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MS+LD Q+P+ FDPFA+ NAE+SGAG K+YVHIRVQQRNGRKSLTTVQGLKK++SY KIL
Sbjct  1    MSELDSQVPTAFDPFADANAEDSGAGKKEYVHIRVQQRNGRKSLTTVQGLKKDYSYTKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>gb|AFK48865.1| unknown [Lotus japonicus]
Length=116

 Score =   131 bits (330),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 63/75 (84%), Positives = 66/75 (88%), Gaps = 3/75 (4%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGS---KDYVHIRVQQRNGRKSLTTVQGLKKEFSYN  368
            MS+LD QIP+ FDPFAE N + SGAG    KDYVHIRVQQRNGRKSLTTVQGLKKEFSYN
Sbjct  1    MSELDAQIPTAFDPFAEANVDESGAGGAGIKDYVHIRVQQRNGRKSLTTVQGLKKEFSYN  60

Query  369  KILKDLKKEFCCNGT  413
            KILKDLKKEFCCNGT
Sbjct  61   KILKDLKKEFCCNGT  75



>gb|EEC82174.1| hypothetical protein OsI_26284 [Oryza sativa Indica Group]
Length=843

 Score =   141 bits (355),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 68/84 (81%), Positives = 74/84 (88%), Gaps = 2/84 (2%)
 Frame = +3

Query  168  VAPFSYQPIFMSDLDLQIPSTFDPFAEGNAENSGA--GSKDYVHIRVQQRNGRKSLTTVQ  341
            VA   +Q  FMSDLD+QIP+ FDPFAE NA +SGA  GSKDYVH+R+QQRNGRKSLTTVQ
Sbjct  719  VACHFHQQSFMSDLDIQIPTAFDPFAEANAGDSGAAAGSKDYVHVRIQQRNGRKSLTTVQ  778

Query  342  GLKKEFSYNKILKDLKKEFCCNGT  413
            GLKKEFSYNKILKDLKKEFCCNGT
Sbjct  779  GLKKEFSYNKILKDLKKEFCCNGT  802



>ref|XP_003527483.1| PREDICTED: protein translation factor SUI1 homolog isoform 1 
[Glycine max]
 ref|XP_003527484.1| PREDICTED: protein translation factor SUI1 homolog isoform 2 
[Glycine max]
Length=113

 Score =   130 bits (328),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 58/72 (81%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MS+ D  IP+ FDPFA+ NAE+SGAG+K+YVH+RVQQRNGRKSLTTVQGLKKE+SY+KIL
Sbjct  1    MSEFDTNIPTAFDPFADANAEDSGAGTKEYVHVRVQQRNGRKSLTTVQGLKKEYSYSKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>gb|ACG24808.1| protein translation factor SUI1 [Zea mays]
Length=115

 Score =   130 bits (328),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 68/74 (92%), Gaps = 2/74 (3%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGA--GSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNK  371
            MSDLD+QIP+ FDPFAE NA +SGA  GSKDYVH+R+QQRNGRKSLTTVQGLKKEFSY+K
Sbjct  1    MSDLDIQIPTAFDPFAEANAGDSGAAAGSKDYVHVRIQQRNGRKSLTTVQGLKKEFSYSK  60

Query  372  ILKDLKKEFCCNGT  413
            ILKDLKKEF CNGT
Sbjct  61   ILKDLKKEFYCNGT  74



>gb|KHN41202.1| Protein translation factor SUI1 like [Glycine soja]
Length=113

 Score =   130 bits (328),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 58/72 (81%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MS+ D  IP+ FDPFA+ NAE+SGAG+K+YVH+RVQQRNGRKSLTTVQGLKKE+SY+KIL
Sbjct  1    MSEFDTNIPTAFDPFADANAEDSGAGTKEYVHVRVQQRNGRKSLTTVQGLKKEYSYSKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>ref|XP_002985789.1| hypothetical protein SELMODRAFT_234882 [Selaginella moellendorffii]
 gb|EFJ12966.1| hypothetical protein SELMODRAFT_234882 [Selaginella moellendorffii]
Length=113

 Score =   130 bits (327),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 56/72 (78%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MSD D+QIP  FDPFAE N ++ GAGSK+YVH+R+QQRNGRKSLTTVQGLKKEF+YN+IL
Sbjct  1    MSDFDIQIPGAFDPFAEANVDDQGAGSKEYVHVRIQQRNGRKSLTTVQGLKKEFNYNRIL  60

Query  378  KDLKKEFCCNGT  413
            KD K+EFCCNGT
Sbjct  61   KDFKREFCCNGT  72



>ref|XP_006279715.1| hypothetical protein CARUB_v10027405mg [Capsella rubella]
 gb|EOA12613.1| hypothetical protein CARUB_v10027405mg [Capsella rubella]
Length=113

 Score =   130 bits (327),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 58/72 (81%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MS+LD Q+P+ FDPFA+ N E+S AG+K+YVHIRVQQRNGRKSLTTVQGLKKE+SY KIL
Sbjct  1    MSELDSQVPTAFDPFADANVEDSSAGTKEYVHIRVQQRNGRKSLTTVQGLKKEYSYTKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>ref|XP_010272070.1| PREDICTED: protein translation factor SUI1 homolog [Nelumbo nucifera]
 ref|XP_010272071.1| PREDICTED: protein translation factor SUI1 homolog [Nelumbo nucifera]
 ref|XP_010272072.1| PREDICTED: protein translation factor SUI1 homolog [Nelumbo nucifera]
Length=112

 Score =   130 bits (327),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 60/72 (83%), Positives = 66/72 (92%), Gaps = 1/72 (1%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MSDLD+QIP+ FDPFAE NAE+SGAGSK+YVH+R+QQRNGRKSLTTVQGL KEFSY KIL
Sbjct  1    MSDLDVQIPTAFDPFAEANAEDSGAGSKEYVHVRIQQRNGRKSLTTVQGLTKEFSYTKIL  60

Query  378  KDLKKEFCCNGT  413
            KDL KE CCNGT
Sbjct  61   KDL-KELCCNGT  71



>ref|XP_009138116.1| PREDICTED: probable phenylalanine--tRNA ligase alpha subunit 
[Brassica rapa]
Length=207

 Score =   133 bits (334),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +3

Query  180  SYQPIFMSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEF  359
            S Q  FMS+LD Q+P+ FDPFA+ NAE+SGAG+K+YVHIRVQQRNGRKSLTTVQGLKKE+
Sbjct  116  SDQQSFMSELDSQVPTAFDPFADANAEDSGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEY  175

Query  360  SYNKILKDLKKEFCCNGT  413
             Y+ ILKDLKKEFCCNGT
Sbjct  176  IYSNILKDLKKEFCCNGT  193



>ref|XP_009106912.1| PREDICTED: protein translation factor SUI1 homolog 2-like [Brassica 
rapa]
 ref|XP_009107080.1| PREDICTED: protein translation factor SUI1 homolog 2-like [Brassica 
rapa]
 emb|CDY08224.1| BnaA05g13950D [Brassica napus]
Length=115

 Score =   130 bits (326),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 69/74 (93%), Gaps = 2/74 (3%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGS--KDYVHIRVQQRNGRKSLTTVQGLKKEFSYNK  371
            MSDL++Q+P+ FDPFA+ NAE++GAG+  K+YVHIRVQQRNGRKSLTTVQGLKKE+SY K
Sbjct  1    MSDLEVQVPTAFDPFADANAEDAGAGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEYSYTK  60

Query  372  ILKDLKKEFCCNGT  413
            ILKDLKKEFCCNGT
Sbjct  61   ILKDLKKEFCCNGT  74



>emb|CDY10602.1| BnaC03g70120D [Brassica napus]
 emb|CDY02466.1| BnaA08g00730D [Brassica napus]
Length=116

 Score =   130 bits (326),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 69/74 (93%), Gaps = 2/74 (3%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGS--KDYVHIRVQQRNGRKSLTTVQGLKKEFSYNK  371
            MSDL++Q+P+ FDPFA+ NAE++GAG+  K+YVHIRVQQRNGRKSLTTVQGLKKE+SY K
Sbjct  1    MSDLEVQVPTAFDPFADANAEDAGAGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEYSYTK  60

Query  372  ILKDLKKEFCCNGT  413
            ILKDLKKEFCCNGT
Sbjct  61   ILKDLKKEFCCNGT  74



>ref|XP_006827315.1| hypothetical protein AMTR_s00010p00266770 [Amborella trichopoda]
 gb|ERM94552.1| hypothetical protein AMTR_s00010p00266770 [Amborella trichopoda]
Length=177

 Score =   131 bits (330),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 58/73 (79%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = +3

Query  195  FMSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKI  374
            FMSDLD+Q+P  FDPFA+   E+SGAG+KDYVH+RVQQRNGRK LTTVQG+KKEF+YNKI
Sbjct  64   FMSDLDIQVPGVFDPFADALGEDSGAGTKDYVHVRVQQRNGRKCLTTVQGVKKEFNYNKI  123

Query  375  LKDLKKEFCCNGT  413
            LKD KKEFCCNGT
Sbjct  124  LKDFKKEFCCNGT  136



>ref|XP_008810164.1| PREDICTED: protein translation factor SUI1 homolog 2-like [Phoenix 
dactylifera]
Length=180

 Score =   131 bits (329),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 59/72 (82%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MSDLD+Q+P++FDPFAE NAE+S AG+K+YVH+R+QQRNGRK LTTVQGLKKEFS NKIL
Sbjct  1    MSDLDVQLPTSFDPFAEANAEDSDAGAKEYVHVRIQQRNGRKCLTTVQGLKKEFSCNKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>emb|CDY26128.1| BnaC06g10680D [Brassica napus]
 emb|CDY08222.1| BnaA05g13970D [Brassica napus]
Length=115

 Score =   129 bits (324),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 69/74 (93%), Gaps = 2/74 (3%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGS--KDYVHIRVQQRNGRKSLTTVQGLKKEFSYNK  371
            MSDL++Q+P+ FDPFA+ NAE++GAG+  K+YVHIRVQQRNGRKSLTTVQG+KKE+SY K
Sbjct  1    MSDLEVQVPTAFDPFADANAEDAGAGAGTKEYVHIRVQQRNGRKSLTTVQGIKKEYSYTK  60

Query  372  ILKDLKKEFCCNGT  413
            ILKDLKKEFCCNGT
Sbjct  61   ILKDLKKEFCCNGT  74



>emb|CDP20340.1| unnamed protein product [Coffea canephora]
Length=113

 Score =   129 bits (323),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 56/72 (78%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MS+ D+Q P+TFDPFA+  A++SGAG+K+YVH+RVQQRNGRKSLTTVQGL+KE+SYNKIL
Sbjct  1    MSEHDIQTPTTFDPFADATADDSGAGAKEYVHVRVQQRNGRKSLTTVQGLRKEYSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKK+FCCNGT
Sbjct  61   KDLKKDFCCNGT  72



>gb|ACS68685.1| putative translation factor [Sonneratia alba]
 gb|ACS68756.1| putative translation factor, partial [Sonneratia alba]
Length=102

 Score =   127 bits (319),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 56/66 (85%), Positives = 64/66 (97%), Gaps = 0/66 (0%)
 Frame = +3

Query  216  QIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDLKKE  395
            Q+P+ FDPFA+ NAE+SGAG+K+YVHIR+QQRNGRKSLTTVQGLKKEFSY+KILKDLKKE
Sbjct  2    QVPTAFDPFADANAEDSGAGAKEYVHIRIQQRNGRKSLTTVQGLKKEFSYSKILKDLKKE  61

Query  396  FCCNGT  413
            FCCNGT
Sbjct  62   FCCNGT  67



>ref|XP_002976303.1| hypothetical protein SELMODRAFT_232756 [Selaginella moellendorffii]
 gb|EFJ22563.1| hypothetical protein SELMODRAFT_232756 [Selaginella moellendorffii]
Length=114

 Score =   127 bits (318),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 57/73 (78%), Positives = 65/73 (89%), Gaps = 1/73 (1%)
 Frame = +3

Query  198  MSDLDLQIPSTF-DPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKI  374
            MSD D+QIP  F DPFAE N ++ GAGSK+YVH+R+QQRNGRKSLTTVQGLKKEF+YNKI
Sbjct  1    MSDFDIQIPGAFADPFAEANVDDQGAGSKEYVHVRIQQRNGRKSLTTVQGLKKEFNYNKI  60

Query  375  LKDLKKEFCCNGT  413
            LKD K+EFCCNGT
Sbjct  61   LKDFKREFCCNGT  73



>dbj|BAN10326.1| translation initiation factor SUI1 family protein, partial [Buxus 
microphylla var. japonica]
Length=91

 Score =   124 bits (312),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 57/63 (90%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = +3

Query  225  STFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCC  404
            S FDPFA+ NAE+SGAGSK+YVH+RVQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCC
Sbjct  1    SAFDPFADANAEDSGAGSKEYVHVRVQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCC  60

Query  405  NGT  413
            NGT
Sbjct  61   NGT  63



>emb|CDY02665.1| BnaC02g07700D [Brassica napus]
Length=327

 Score =   130 bits (328),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/76 (78%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = +3

Query  186  QPIFMSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSY  365
            Q  FMS LD Q+P+ FDPFA+ NAE+SGAG+K+YVHIRVQQRNGRKSLTTVQGLKKE+ Y
Sbjct  216  QQSFMSVLDSQVPTAFDPFADANAEDSGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEYIY  275

Query  366  NKILKDLKKEFCCNGT  413
            + I KDLKKEFCCNGT
Sbjct  276  SNIFKDLKKEFCCNGT  291



>ref|XP_002960838.1| hypothetical protein SELMODRAFT_437304 [Selaginella moellendorffii]
 ref|XP_002983834.1| hypothetical protein SELMODRAFT_268797 [Selaginella moellendorffii]
 gb|EFJ14846.1| hypothetical protein SELMODRAFT_268797 [Selaginella moellendorffii]
 gb|EFJ38377.1| hypothetical protein SELMODRAFT_437304 [Selaginella moellendorffii]
Length=114

 Score =   124 bits (312),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 57/73 (78%), Positives = 64/73 (88%), Gaps = 1/73 (1%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGA-GSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKI  374
            MS+ D+QIP  +DPFAE NAE SG  GS +YVH+RVQQRNGRKSLTTVQGL+KEF+YNKI
Sbjct  1    MSEADIQIPGAYDPFAEANAEESGGVGSAEYVHVRVQQRNGRKSLTTVQGLRKEFNYNKI  60

Query  375  LKDLKKEFCCNGT  413
            LKD KKEFCCNGT
Sbjct  61   LKDFKKEFCCNGT  73



>dbj|BAN10309.1| eukaryotic translation initiation factor SUI1, partial [Chamaecyparis 
obtusa]
Length=90

 Score =   123 bits (308),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 56/62 (90%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = +3

Query  228  TFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCN  407
             FDPFAE NAE+SGAGSK+YVH+R+QQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCN
Sbjct  2    AFDPFAEANAEDSGAGSKEYVHVRIQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCN  61

Query  408  GT  413
            GT
Sbjct  62   GT  63



>gb|ACN30624.1| unknown [Zea mays]
Length=110

 Score =   122 bits (305),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/69 (83%), Positives = 63/69 (91%), Gaps = 2/69 (3%)
 Frame = +3

Query  213  LQIPSTFDPFAEGNAENSGA--GSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDL  386
            + IP+ FDPFAE NA +SGA  GSKDYVH+R+QQRNGRKSLTTVQGLKKEFSY+KILKDL
Sbjct  1    MWIPTAFDPFAEANAGDSGAAAGSKDYVHVRIQQRNGRKSLTTVQGLKKEFSYSKILKDL  60

Query  387  KKEFCCNGT  413
            KKEFCCNGT
Sbjct  61   KKEFCCNGT  69



>ref|XP_009398183.1| PREDICTED: protein translation factor SUI1 homolog 2-like [Musa 
acuminata subsp. malaccensis]
Length=113

 Score =   121 bits (303),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 61/72 (85%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MSDLD QIP+ FDPFA+ NA++S AG+K+YVHIR+QQRNGRKSLTTVQGLKKEFSYNKIL
Sbjct  1    MSDLDAQIPTAFDPFADANADDSDAGTKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>ref|XP_011097879.1| PREDICTED: protein translation factor SUI1 homolog [Sesamum indicum]
Length=112

 Score =   121 bits (303),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 58/73 (79%), Positives = 67/73 (92%), Gaps = 3/73 (4%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGA-GSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKI  374
            M ++DLQIPS FDPFAE  A++SGA G+K+YVHIR+QQRNG+KSLTTVQGL+KEFSY KI
Sbjct  1    MVEVDLQIPSAFDPFAE--AKDSGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEFSYEKI  58

Query  375  LKDLKKEFCCNGT  413
            LKDLKKEFCCNGT
Sbjct  59   LKDLKKEFCCNGT  71



>ref|WP_041515161.1| hypothetical protein, partial [Nitrosospira sp. NpAV]
Length=74

 Score =   119 bits (297),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = +3

Query  195  FMSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKI  374
            FMSDLD+QIP+ FDPFA+ NAE+SGAG+K+YVHIR+QQRNGRKSLTTVQGLKKEFSYNKI
Sbjct  12   FMSDLDVQIPTAFDPFADANAEDSGAGAKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKI  71

Query  375  LK  380
            LK
Sbjct  72   LK  73



>ref|XP_001756581.1| predicted protein [Physcomitrella patens]
 ref|XP_001781716.1| predicted protein [Physcomitrella patens]
 gb|EDQ53445.1| predicted protein [Physcomitrella patens]
 gb|EDQ78535.1| predicted protein [Physcomitrella patens]
Length=116

 Score =   120 bits (300),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 56/70 (80%), Positives = 62/70 (89%), Gaps = 2/70 (3%)
 Frame = +3

Query  210  DLQIPSTFDPFAEGNAENSGAGSKD--YVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKD  383
            D +IP++FDPFAE N E+SG GSK   YVH+RVQQRNGRKSLTTVQGLKKEF+YNKILKD
Sbjct  6    DTEIPASFDPFAEANVEDSGVGSKGSGYVHVRVQQRNGRKSLTTVQGLKKEFNYNKILKD  65

Query  384  LKKEFCCNGT  413
            LKKEFCCNG 
Sbjct  66   LKKEFCCNGV  75



>ref|XP_004244116.1| PREDICTED: protein translation factor SUI1 homolog [Solanum lycopersicum]
Length=112

 Score =   120 bits (300),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/72 (79%), Positives = 66/72 (92%), Gaps = 3/72 (4%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGA-GSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKI  374
            M D+D+QIPS FDPFAE  A++SGA G+K+YVHIR+QQRNG+KSLTTVQGL+KEFSY KI
Sbjct  1    MVDIDIQIPSAFDPFAE--AKDSGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEFSYEKI  58

Query  375  LKDLKKEFCCNG  410
            LKDLKKEFCCNG
Sbjct  59   LKDLKKEFCCNG  70



>gb|KHN02839.1| Protein translation factor SUI1 like 2 [Glycine soja]
Length=141

 Score =   120 bits (302),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 63/72 (88%), Gaps = 1/72 (1%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            M DL++Q+P+ FDPFAE   E+   G+K+YVHIR+QQRNG+KSLTTVQGLKKEFSY KIL
Sbjct  1    MVDLEIQVPTPFDPFAEAR-ESDAPGAKEYVHIRIQQRNGKKSLTTVQGLKKEFSYEKIL  59

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  60   KDLKKEFCCNGT  71



>ref|XP_006346213.1| PREDICTED: protein translation factor SUI1 homolog [Solanum tuberosum]
Length=112

 Score =   119 bits (299),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/72 (79%), Positives = 66/72 (92%), Gaps = 3/72 (4%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGA-GSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKI  374
            M D+D+QIPS FDPFAE  A++SGA G+K+YVHIR+QQRNG+KSLTTVQGL+KEFSY KI
Sbjct  1    MVDIDVQIPSAFDPFAE--AKDSGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEFSYEKI  58

Query  375  LKDLKKEFCCNG  410
            LKDLKKEFCCNG
Sbjct  59   LKDLKKEFCCNG  70



>ref|XP_011095399.1| PREDICTED: protein translation factor SUI1 homolog [Sesamum indicum]
 ref|XP_011095400.1| PREDICTED: protein translation factor SUI1 homolog [Sesamum indicum]
Length=112

 Score =   119 bits (299),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 57/72 (79%), Positives = 66/72 (92%), Gaps = 3/72 (4%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGA-GSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKI  374
            M DLDLQIP+ FDPFAE  A++SGA G+K+YVHIR+QQRNG+KSLTTVQGL+KEFSY KI
Sbjct  1    MVDLDLQIPTAFDPFAE--AKDSGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEFSYEKI  58

Query  375  LKDLKKEFCCNG  410
            LKD+KKEFCCNG
Sbjct  59   LKDVKKEFCCNG  70



>gb|KIO47718.1| hypothetical protein SQ11_15790, partial [Nitrosospira sp. NpAV]
Length=80

 Score =   118 bits (296),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = +3

Query  195  FMSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKI  374
            FMSDLD+QIP+ FDPFA+ NAE+SGAG+K+YVHIR+QQRNGRKSLTTVQGLKKEFSYNKI
Sbjct  18   FMSDLDVQIPTAFDPFADANAEDSGAGAKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKI  77

Query  375  LK  380
            LK
Sbjct  78   LK  79



>ref|XP_006602202.1| PREDICTED: protein translation factor SUI1 homolog 2-like isoform 
X1 [Glycine max]
 ref|XP_006602203.1| PREDICTED: protein translation factor SUI1 homolog 2-like isoform 
X2 [Glycine max]
Length=112

 Score =   119 bits (298),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 63/72 (88%), Gaps = 1/72 (1%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            M DL++Q+P+ FDPFAE   E+   G+K+YVHIR+QQRNG+KSLTTVQGLKKEFSY KIL
Sbjct  1    MVDLEIQVPTPFDPFAEAR-ESDAPGAKEYVHIRIQQRNGKKSLTTVQGLKKEFSYEKIL  59

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  60   KDLKKEFCCNGT  71



>ref|XP_008647990.1| PREDICTED: LOC100286322 isoform X2 [Zea mays]
Length=120

 Score =   119 bits (297),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 60/65 (92%), Gaps = 2/65 (3%)
 Frame = +3

Query  225  STFDPFAEGNAENSGAG--SKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEF  398
            S  DPFAE NAE+SGAG  +KDYVH+R+QQRNGRKSLTTVQGLKKEFSYNKILKDLKKEF
Sbjct  15   SLIDPFAEANAEDSGAGPGTKDYVHVRIQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEF  74

Query  399  CCNGT  413
            CCNGT
Sbjct  75   CCNGT  79



>ref|XP_008351221.1| PREDICTED: protein translation factor SUI1 homolog 2-like, partial 
[Malus domestica]
Length=124

 Score =   119 bits (297),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 55/60 (92%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +3

Query  234  DPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCNGT  413
            DPFAE  AE+SGAG+K+YVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCNGT
Sbjct  7    DPFAEATAEDSGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCNGT  66



>gb|AAM77753.1|AF521961_1 translation initiation factor B04 [Helianthus annuus]
Length=114

 Score =   118 bits (296),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 55/73 (75%), Positives = 64/73 (88%), Gaps = 1/73 (1%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSG-AGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKI  374
            M D+++QIPS FDPFA+   ++ G AG K+YVHIR+QQRNGRKSLTTVQGLKKE SY+KI
Sbjct  1    MVDIEVQIPSAFDPFADVEQDSGGGAGVKEYVHIRIQQRNGRKSLTTVQGLKKELSYDKI  60

Query  375  LKDLKKEFCCNGT  413
            LKDLKKEFCCNGT
Sbjct  61   LKDLKKEFCCNGT  73



>ref|XP_009628718.1| PREDICTED: protein translation factor SUI1 homolog [Nicotiana 
tomentosiformis]
 ref|XP_009778004.1| PREDICTED: protein translation factor SUI1 homolog [Nicotiana 
sylvestris]
Length=112

 Score =   118 bits (296),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 56/72 (78%), Positives = 66/72 (92%), Gaps = 3/72 (4%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGA-GSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKI  374
            M D+D+QIPS FDPFAE  A++SGA G+K+YVHIR+QQRNG+KSLTTVQGL+K+FSY KI
Sbjct  1    MVDIDVQIPSAFDPFAE--AKDSGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKQFSYEKI  58

Query  375  LKDLKKEFCCNG  410
            LKDLKKEFCCNG
Sbjct  59   LKDLKKEFCCNG  70



>ref|XP_002280065.1| PREDICTED: protein translation factor SUI1 homolog [Vitis vinifera]
 emb|CBI26638.3| unnamed protein product [Vitis vinifera]
Length=112

 Score =   118 bits (296),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 57/72 (79%), Positives = 66/72 (92%), Gaps = 3/72 (4%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGA-GSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKI  374
            M +LDLQIPS FDPFAE  A++SGA G+K+YVHIR+QQRNG+KSLTTVQGLKK++SY KI
Sbjct  1    MVELDLQIPSAFDPFAE--AKDSGAPGAKEYVHIRIQQRNGKKSLTTVQGLKKDYSYEKI  58

Query  375  LKDLKKEFCCNG  410
            LKDLKKEFCCNG
Sbjct  59   LKDLKKEFCCNG  70



>ref|XP_006586085.1| PREDICTED: protein translation factor SUI1 homolog 2 [Glycine 
max]
 gb|KHM99561.1| Protein translation factor SUI1 like 2 [Glycine soja]
Length=157

 Score =   119 bits (299),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 66/80 (83%), Gaps = 1/80 (1%)
 Frame = +3

Query  174  PFSYQPIFMSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKK  353
            P   Q  +M DL++Q+PS FDPFAE   E+   G+K+YVHIR+QQRNG+KSLTTVQGLKK
Sbjct  38   PSLQQAKYMVDLEIQVPSAFDPFAEAR-ESDAPGAKEYVHIRIQQRNGKKSLTTVQGLKK  96

Query  354  EFSYNKILKDLKKEFCCNGT  413
            EFSY KILKDLKK+FCCNGT
Sbjct  97   EFSYEKILKDLKKDFCCNGT  116



>gb|KEH38844.1| eukaryotic translation initiation factor SUI1 [Medicago truncatula]
Length=116

 Score =   118 bits (296),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 55/66 (83%), Positives = 61/66 (92%), Gaps = 1/66 (2%)
 Frame = +3

Query  219  IPSTFDPFAEGNAENSGAGS-KDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDLKKE  395
            + +  DPFAE NAE++GAGS K+YVHIR+QQRNGRKSLTTVQGLKKEFSYNKILKDLKKE
Sbjct  10   VATILDPFAEANAEDAGAGSSKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKILKDLKKE  69

Query  396  FCCNGT  413
            FCCNGT
Sbjct  70   FCCNGT  75



>gb|ACN30667.1| unknown [Zea mays]
 gb|AFW78552.1| hypothetical protein ZEAMMB73_586492 [Zea mays]
Length=122

 Score =   118 bits (296),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 60/65 (92%), Gaps = 2/65 (3%)
 Frame = +3

Query  225  STFDPFAEGNAENSGAG--SKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEF  398
            S  DPFAE NAE+SGAG  +KDYVH+R+QQRNGRKSLTTVQGLKKEFSYNKILKDLKKEF
Sbjct  15   SLIDPFAEANAEDSGAGPGTKDYVHVRIQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEF  74

Query  399  CCNGT  413
            CCNGT
Sbjct  75   CCNGT  79



>ref|XP_006833020.1| hypothetical protein AMTR_s00094p00033760, partial [Amborella 
trichopoda]
 gb|ERM98298.1| hypothetical protein AMTR_s00094p00033760, partial [Amborella 
trichopoda]
Length=100

 Score =   117 bits (293),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 53/59 (90%), Positives = 58/59 (98%), Gaps = 0/59 (0%)
 Frame = +3

Query  237  PFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCNGT  413
            PFAE NAE+SGAGSK+YVH+R+QQRNGRKSLTTVQGLKKEFSY+KILKDLKKEFCCNGT
Sbjct  1    PFAEANAEDSGAGSKEYVHVRIQQRNGRKSLTTVQGLKKEFSYSKILKDLKKEFCCNGT  59



>gb|EMS63057.1| Protein translation factor SUI1-like protein [Triticum urartu]
Length=119

 Score =   117 bits (294),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 57/72 (79%), Positives = 63/72 (88%), Gaps = 2/72 (3%)
 Frame = +3

Query  204  DLDLQIPSTFDPFAEGNAENSGAG--SKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            +L L  P   DPFAE NAE+SGAG  SK+YVH+RVQQRNGRKSLTTVQGLKK++SYNKIL
Sbjct  7    ELLLTFPRGTDPFAEANAEDSGAGAGSKNYVHVRVQQRNGRKSLTTVQGLKKDYSYNKIL  66

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  67   KDLKKEFCCNGT  78



>gb|ADJ67174.1| hypothetical protein [Jatropha curcas]
Length=100

 Score =   117 bits (292),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 53/59 (90%), Positives = 58/59 (98%), Gaps = 0/59 (0%)
 Frame = +3

Query  237  PFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCNGT  413
            PFA+ NAE+SGAG+K+YVHIR+QQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCNGT
Sbjct  1    PFADANAEDSGAGAKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCNGT  59



>ref|XP_008776100.1| PREDICTED: protein translation factor SUI1 homolog 2-like [Phoenix 
dactylifera]
Length=146

 Score =   118 bits (296),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 63/72 (88%), Gaps = 5/72 (7%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MS LD+Q+P+ F      NAE+SGAG+K+YVH+R+QQ NGRKSLTTVQGLKKEFSYNKIL
Sbjct  1    MSGLDVQLPAAF-----ANAEDSGAGAKEYVHVRIQQWNGRKSLTTVQGLKKEFSYNKIL  55

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  56   KDLKKEFCCNGT  67



>gb|ADJ67213.1| hypothetical protein [Jatropha curcas]
Length=100

 Score =   117 bits (292),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 53/59 (90%), Positives = 58/59 (98%), Gaps = 0/59 (0%)
 Frame = +3

Query  237  PFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCNGT  413
            PFA+ NAE+SGAG+K+YVHIR+QQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCNGT
Sbjct  1    PFADANAEDSGAGAKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCNGT  59



>gb|ABK24036.1| unknown [Picea sitchensis]
Length=112

 Score =   116 bits (291),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 64/72 (89%), Gaps = 1/72 (1%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MSD D+QIP TFDPF +  A+++G G+KDYVH+R+QQRNGRK LTT+QGL+K+++YNKIL
Sbjct  1    MSDQDIQIP-TFDPFKDSEADDAGPGTKDYVHVRIQQRNGRKCLTTIQGLRKDYNYNKIL  59

Query  378  KDLKKEFCCNGT  413
            KD KKEFCCNGT
Sbjct  60   KDFKKEFCCNGT  71



>ref|XP_010276095.1| PREDICTED: protein translation factor SUI1 homolog [Nelumbo nucifera]
Length=113

 Score =   116 bits (291),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/73 (78%), Positives = 65/73 (89%), Gaps = 3/73 (4%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGA-GSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKI  374
            M +LD+QIPS FDPF E  A++SGA G+K+YVHIR+QQRNG+KSLTTVQGLKK FSY KI
Sbjct  1    MVELDIQIPSAFDPFFE--AKDSGAPGAKEYVHIRIQQRNGKKSLTTVQGLKKTFSYEKI  58

Query  375  LKDLKKEFCCNGT  413
            LKDLKKEFCCNGT
Sbjct  59   LKDLKKEFCCNGT  71



>ref|XP_003617548.1| Translation factor SUI1-like protein [Medicago truncatula]
 gb|AET00507.1| eukaryotic translation initiation factor SUI1 [Medicago truncatula]
 gb|AFK47392.1| unknown [Medicago truncatula]
Length=110

 Score =   116 bits (291),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 61/68 (90%), Gaps = 1/68 (1%)
 Frame = +3

Query  207  LDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDL  386
            +D+QIPSTFDPFAE   E+   G+K+YVHIR+QQRNG+KSLTTVQGLKKEFSY KILKDL
Sbjct  2    VDIQIPSTFDPFAEAK-ESDAPGAKEYVHIRIQQRNGKKSLTTVQGLKKEFSYEKILKDL  60

Query  387  KKEFCCNG  410
            KKEFCCNG
Sbjct  61   KKEFCCNG  68



>sp|O82569.1|SUI1_PIMBR RecName: Full=Protein translation factor SUI1 homolog [Spuriopimpinella 
brachycarpa]
 gb|AAC61599.1| protein translation factor SUI1 homolog [Spuriopimpinella brachycarpa]
Length=113

 Score =   116 bits (290),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            M D D+QIP++FDPFAE    ++   +K+YVHIR+QQRNGRKSLTTVQGLKKE SY+KIL
Sbjct  1    MVDSDIQIPTSFDPFAEAEITDATGSTKEYVHIRIQQRNGRKSLTTVQGLKKELSYDKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKK  CCNGT
Sbjct  61   KDLKKALCCNGT  72



>gb|EMT19520.1| Protein translation factor SUI1-like protein [Aegilops tauschii]
Length=175

 Score =   117 bits (294),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 62/75 (83%), Positives = 69/75 (92%), Gaps = 2/75 (3%)
 Frame = +3

Query  195  FMSDLDLQIPSTFDPFAEGNAENSGAG--SKDYVHIRVQQRNGRKSLTTVQGLKKEFSYN  368
            FMSDLD+QIP+ FDPFAE NA ++GA   SKDYVH+R+QQRNGRKSLTTVQGLKKEFSY+
Sbjct  14   FMSDLDVQIPTAFDPFAEANAGDAGAAAGSKDYVHVRIQQRNGRKSLTTVQGLKKEFSYS  73

Query  369  KILKDLKKEFCCNGT  413
            KILKDLKKEFCCNGT
Sbjct  74   KILKDLKKEFCCNGT  88



>ref|XP_004500068.1| PREDICTED: protein translation factor SUI1 homolog 2-like [Cicer 
arietinum]
Length=112

 Score =   115 bits (289),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 62/71 (87%), Gaps = 1/71 (1%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            M +L++Q+P+ FDPFAE   E+   G+K+YVHIR+QQRNG+KSLTTVQGLKKEFSY KIL
Sbjct  1    MVELEIQVPTPFDPFAEAK-ESDAPGAKEYVHIRIQQRNGKKSLTTVQGLKKEFSYEKIL  59

Query  378  KDLKKEFCCNG  410
            KDLKKEFCCNG
Sbjct  60   KDLKKEFCCNG  70



>gb|EMT21575.1| Protein translation factor SUI1-like protein [Aegilops tauschii]
Length=124

 Score =   115 bits (289),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 66/80 (83%), Gaps = 4/80 (5%)
 Frame = +3

Query  180  SYQPIFMSDLDLQIPSTFDPFAEGNAENSGAG--SKDYVHIRVQQRNGRKSLTTVQGLKK  353
            S  P  +S L +  P   DPFAE NAE++GAG  +KDYVH+R+QQRNGRKSLTTVQGLKK
Sbjct  6    SRNPRRVSSLFICPPG--DPFAEANAEDAGAGPGAKDYVHVRIQQRNGRKSLTTVQGLKK  63

Query  354  EFSYNKILKDLKKEFCCNGT  413
            EFSYNKILKDLKKEFCCNGT
Sbjct  64   EFSYNKILKDLKKEFCCNGT  83



>gb|EMS51805.1| Protein translation factor SUI1-like protein [Triticum urartu]
Length=163

 Score =   117 bits (292),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 62/75 (83%), Positives = 69/75 (92%), Gaps = 2/75 (3%)
 Frame = +3

Query  195  FMSDLDLQIPSTFDPFAEGNAENSGAG--SKDYVHIRVQQRNGRKSLTTVQGLKKEFSYN  368
            FMSDLD+QIP+ FDPFAE NA ++GA   SKDYVH+R+QQRNGRKSLTTVQGLKKEFSY+
Sbjct  48   FMSDLDVQIPTAFDPFAEANAGDAGAAAGSKDYVHVRIQQRNGRKSLTTVQGLKKEFSYS  107

Query  369  KILKDLKKEFCCNGT  413
            KILKDLKKEFCCNGT
Sbjct  108  KILKDLKKEFCCNGT  122



>gb|KJB39022.1| hypothetical protein B456_007G314400 [Gossypium raimondii]
Length=78

 Score =   114 bits (285),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 54/62 (87%), Positives = 59/62 (95%), Gaps = 1/62 (2%)
 Frame = +3

Query  228  TFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCN  407
            T DPFA+ NAE+SGAG+K+YVHIR+QQRNGRKSLTTVQGLKKEFSYNKILKDL KEFCCN
Sbjct  6    TLDPFADANAEDSGAGTKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKILKDL-KEFCCN  64

Query  408  GT  413
            GT
Sbjct  65   GT  66



>gb|AFK38938.1| unknown [Lotus japonicus]
Length=112

 Score =   115 bits (288),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 53/71 (75%), Positives = 61/71 (86%), Gaps = 1/71 (1%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            M DL++QIP+ FDPFAE   E+   G K+YVH+R+QQRNG+KSLTTVQGLKKEFSY KIL
Sbjct  1    MVDLEIQIPNRFDPFAEAK-ESDAPGVKEYVHVRIQQRNGKKSLTTVQGLKKEFSYEKIL  59

Query  378  KDLKKEFCCNG  410
            KDLKKEFCCNG
Sbjct  60   KDLKKEFCCNG  70



>gb|KCW70138.1| hypothetical protein EUGRSUZ_F03432 [Eucalyptus grandis]
Length=180

 Score =   117 bits (293),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 54/59 (92%), Positives = 58/59 (98%), Gaps = 0/59 (0%)
 Frame = +3

Query  237  PFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCNGT  413
            PFA+ NAE+SGAG+K+YVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCNGT
Sbjct  81   PFADANAEDSGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCNGT  139



>ref|XP_010545223.1| PREDICTED: protein translation factor SUI1 homolog [Tarenaya 
hassleriana]
Length=112

 Score =   115 bits (287),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 51/71 (72%), Positives = 62/71 (87%), Gaps = 1/71 (1%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            M DLD+QIP+ FDPFAE   ++   G+K+Y+HIR+QQRNG+KSLTTVQGLKKE+SY +IL
Sbjct  1    MVDLDIQIPTAFDPFAEAR-DSDAPGAKEYIHIRIQQRNGKKSLTTVQGLKKEYSYERIL  59

Query  378  KDLKKEFCCNG  410
            KDLKKEFCCNG
Sbjct  60   KDLKKEFCCNG  70



>gb|AAM34279.1|AF508969_1 translation initiation factor [Triticum aestivum]
Length=115

 Score =   115 bits (287),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 61/74 (82%), Positives = 68/74 (92%), Gaps = 2/74 (3%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAG--SKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNK  371
            MSDLD+QIP+ FDPFAE NA ++GA   SKDYVH+R+QQRNGRKSLTTVQGLKKEFSY+K
Sbjct  1    MSDLDVQIPTAFDPFAEANAGDAGAAAGSKDYVHVRIQQRNGRKSLTTVQGLKKEFSYSK  60

Query  372  ILKDLKKEFCCNGT  413
            ILKDLKKEFCCNGT
Sbjct  61   ILKDLKKEFCCNGT  74



>ref|XP_003562997.1| PREDICTED: protein translation factor SUI1 homolog [Brachypodium 
distachyon]
Length=115

 Score =   115 bits (287),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/74 (82%), Positives = 67/74 (91%), Gaps = 2/74 (3%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAG--SKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNK  371
            MSDLD+QIP+ FDPFAE NA  +GA   SKDYVH+R+QQRNGRKSLTTVQGLKKEFSY+K
Sbjct  1    MSDLDIQIPTAFDPFAEANAGEAGAAAGSKDYVHVRIQQRNGRKSLTTVQGLKKEFSYSK  60

Query  372  ILKDLKKEFCCNGT  413
            ILKDLKKEFCCNGT
Sbjct  61   ILKDLKKEFCCNGT  74



>ref|XP_010278682.1| PREDICTED: protein translation factor SUI1 homolog [Nelumbo nucifera]
 ref|XP_010278683.1| PREDICTED: protein translation factor SUI1 homolog [Nelumbo nucifera]
 ref|XP_010278684.1| PREDICTED: protein translation factor SUI1 homolog [Nelumbo nucifera]
Length=113

 Score =   115 bits (287),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/73 (77%), Positives = 64/73 (88%), Gaps = 3/73 (4%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGA-GSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKI  374
            M +LD+QIPS FDPFAE  A++SG  G K+YVHIR+QQRNG+K LTTVQGLKKEFSY KI
Sbjct  1    MVELDVQIPSAFDPFAE--AKDSGVPGVKEYVHIRIQQRNGKKCLTTVQGLKKEFSYEKI  58

Query  375  LKDLKKEFCCNGT  413
            LK+LKKEFCCNGT
Sbjct  59   LKNLKKEFCCNGT  71



>ref|XP_004152930.1| PREDICTED: protein translation factor SUI1 homolog 2-like [Cucumis 
sativus]
 ref|XP_004168731.1| PREDICTED: protein translation factor SUI1 homolog 2-like [Cucumis 
sativus]
 ref|XP_008463414.1| PREDICTED: protein translation factor SUI1 homolog 2 [Cucumis 
melo]
 gb|KGN56126.1| hypothetical protein Csa_3G077610 [Cucumis sativus]
Length=112

 Score =   115 bits (287),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 53/71 (75%), Positives = 62/71 (87%), Gaps = 1/71 (1%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            M DLD+QIPS FDPFA+   ++   G+K+YVHIRVQQRNG+K LTTVQGLKKEFSY+KIL
Sbjct  1    MVDLDVQIPSAFDPFADAK-DSDAPGTKEYVHIRVQQRNGKKCLTTVQGLKKEFSYDKIL  59

Query  378  KDLKKEFCCNG  410
            KDLKK+FCCNG
Sbjct  60   KDLKKDFCCNG  70



>gb|EYU33643.1| hypothetical protein MIMGU_mgv1a016664mg [Erythranthe guttata]
Length=112

 Score =   114 bits (286),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 65/72 (90%), Gaps = 3/72 (4%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGA-GSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKI  374
            M +LD+QIPS FDPFA+  AE+ GA G+K+YVHIR+QQRNG+KSLTTVQGLKKEF+Y KI
Sbjct  1    MVELDIQIPSAFDPFAD--AEDLGAIGAKEYVHIRIQQRNGKKSLTTVQGLKKEFNYEKI  58

Query  375  LKDLKKEFCCNG  410
            LK+LKKEFCCNG
Sbjct  59   LKNLKKEFCCNG  70



>ref|XP_004491401.1| PREDICTED: protein translation factor SUI1 homolog [Cicer arietinum]
Length=110

 Score =   114 bits (285),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 61/68 (90%), Gaps = 1/68 (1%)
 Frame = +3

Query  207  LDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDL  386
            +D+QIP+TFDPF+E   E+   G+K+YVHIR+QQRNG+KSLTTVQGLKKEFSY KILKDL
Sbjct  2    VDIQIPTTFDPFSEAK-ESDAPGAKEYVHIRIQQRNGKKSLTTVQGLKKEFSYEKILKDL  60

Query  387  KKEFCCNG  410
            KKEFCCNG
Sbjct  61   KKEFCCNG  68



>emb|CDY52575.1| BnaC03g71830D, partial [Brassica napus]
Length=158

 Score =   115 bits (288),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 51/77 (66%), Positives = 64/77 (83%), Gaps = 1/77 (1%)
 Frame = +3

Query  180  SYQPIFMSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEF  359
            S Q  +M +LD+Q+PS FDPFAE   E+   G+K+Y+H+R+QQRNG+KSLTTVQGLKK +
Sbjct  41   SNQVYYMVELDIQVPSAFDPFAEAQ-ESDAPGTKEYIHVRIQQRNGKKSLTTVQGLKKAY  99

Query  360  SYNKILKDLKKEFCCNG  410
            SY KILKDLKK+FCCNG
Sbjct  100  SYEKILKDLKKDFCCNG  116



>gb|ADU56181.1| hypothetical protein [Jatropha curcas]
Length=100

 Score =   114 bits (284),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 52/58 (90%), Positives = 57/58 (98%), Gaps = 0/58 (0%)
 Frame = +3

Query  240  FAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCNGT  413
            FA+ NAE+SGAG+K+YVHIR+QQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCNGT
Sbjct  2    FADANAEDSGAGAKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCNGT  59



>gb|AGS78110.1| translation factor SUI1 [Aeschynomene filosa]
Length=112

 Score =   114 bits (284),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 61/71 (86%), Gaps = 1/71 (1%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            M DL++Q P+ FDPFAE   E+   G+K+YVHIR+QQRNG+KSLTTVQGLKK+FSY KIL
Sbjct  1    MVDLEIQFPTPFDPFAEAK-ESDAPGAKEYVHIRIQQRNGKKSLTTVQGLKKDFSYEKIL  59

Query  378  KDLKKEFCCNG  410
            KDLKKEFCCNG
Sbjct  60   KDLKKEFCCNG  70



>gb|AGS78105.1| translation factor SUI1 [Aeschynomene indica]
Length=112

 Score =   114 bits (284),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/71 (76%), Positives = 60/71 (85%), Gaps = 1/71 (1%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            M DL++Q PS FDPFAE   E+   G+K+YVHIRVQQRNG+KSLTTVQGLKK FSY KIL
Sbjct  1    MVDLEIQFPSPFDPFAEAK-ESDAPGAKEYVHIRVQQRNGKKSLTTVQGLKKGFSYEKIL  59

Query  378  KDLKKEFCCNG  410
            KDLKKEFCCNG
Sbjct  60   KDLKKEFCCNG  70



>gb|AFY13590.1| translation factor SUI1 [Aeschynomene evenia]
 gb|AFY13591.1| translation factor SUI1 [Aeschynomene evenia]
 gb|AFY13592.1| translation factor SUI1 [Aeschynomene evenia]
 gb|AFY13593.1| translation factor SUI1 [Aeschynomene evenia]
 gb|AFY13594.1| translation factor SUI1 [Aeschynomene evenia]
 gb|AFY13595.1| translation factor SUI1 [Aeschynomene evenia]
 gb|AFY13596.1| translation factor SUI1 [Aeschynomene denticulata]
 gb|AGC95066.1| translation factor SUI1 [Aeschynomene evenia]
 gb|AGC95067.1| translation factor SUI1 [Aeschynomene evenia]
 gb|AGC95068.1| translation factor SUI1 [Aeschynomene ciliata]
 gb|AGS78101.1| translation factor SUI1 [Aeschynomene indica]
 gb|AGS78102.1| translation factor SUI1 [Aeschynomene indica]
 gb|AGS78103.1| translation factor SUI1 [Aeschynomene indica]
 gb|AGS78104.1| translation factor SUI1 [Aeschynomene indica]
 gb|AGS78106.1| translation factor SUI1 [Aeschynomene scabra]
 gb|AGS78107.1| translation factor SUI1 [Aeschynomene rudis]
 gb|AGS78108.1| translation factor SUI1 [Aeschynomene sensitiva]
 gb|AGS78109.1| translation factor SUI1 [Aeschynomene sp. CPI104040]
 gb|AGS78111.1| translation factor SUI1 [Aeschynomene tambacoundensis]
 gb|AGS78112.1| translation factor SUI1 [Aeschynomene deamii]
 gb|AGS78114.1| translation factor SUI1 [Aeschynomene pratensis]
 gb|AGS78115.1| translation factor SUI1 [Aeschynomene virginica]
 gb|AGS78116.1| translation factor SUI1 [Aeschynomene virginica]
Length=112

 Score =   114 bits (284),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 61/71 (86%), Gaps = 1/71 (1%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            M DL++Q P+ FDPFAE   E+   G+K+YVHIR+QQRNG+KSLTTVQGLKK+FSY KIL
Sbjct  1    MVDLEIQFPTPFDPFAEAK-ESDAPGAKEYVHIRIQQRNGKKSLTTVQGLKKDFSYEKIL  59

Query  378  KDLKKEFCCNG  410
            KDLKKEFCCNG
Sbjct  60   KDLKKEFCCNG  70



>gb|ADK79108.1| putative eukaryotic translation initiation factor SUI1 [Catharanthus 
roseus]
Length=112

 Score =   114 bits (284),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 64/72 (89%), Gaps = 3/72 (4%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGA-GSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKI  374
            M DLD+QIP+ FDPFAE  A++SGA G+K+YVHIRVQQRNG+K LTT+QGLKKEFS  KI
Sbjct  1    MVDLDIQIPTAFDPFAE--AKDSGAPGAKEYVHIRVQQRNGKKCLTTIQGLKKEFSLEKI  58

Query  375  LKDLKKEFCCNG  410
            LKDLKK+FCCNG
Sbjct  59   LKDLKKDFCCNG  70



>ref|XP_007146479.1| hypothetical protein PHAVU_006G043900g [Phaseolus vulgaris]
 gb|ESW18473.1| hypothetical protein PHAVU_006G043900g [Phaseolus vulgaris]
Length=112

 Score =   114 bits (284),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 51/71 (72%), Positives = 62/71 (87%), Gaps = 1/71 (1%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            M +L++Q+P+ FDPFAE   E+   G+K+YVHIR+QQRNG+KSLTTVQGLKKEFSY KIL
Sbjct  1    MVELEIQVPTPFDPFAEAR-ESDAPGAKEYVHIRIQQRNGKKSLTTVQGLKKEFSYEKIL  59

Query  378  KDLKKEFCCNG  410
            KDLKK+FCCNG
Sbjct  60   KDLKKDFCCNG  70



>ref|XP_010675717.1| PREDICTED: protein translation factor SUI1 homolog [Beta vulgaris 
subsp. vulgaris]
Length=111

 Score =   114 bits (284),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 60/71 (85%), Gaps = 2/71 (3%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            M D+D QIP+  DPFAE  AE+   G K+YVHIR+QQRNG+KSLTTVQGLKK++SY KIL
Sbjct  1    MVDIDFQIPAALDPFAE--AESGAPGVKEYVHIRIQQRNGKKSLTTVQGLKKDYSYEKIL  58

Query  378  KDLKKEFCCNG  410
            KDLKKEFCCNG
Sbjct  59   KDLKKEFCCNG  69



>ref|XP_010448878.1| PREDICTED: protein translation factor SUI1 homolog [Camelina 
sativa]
 ref|XP_010443083.1| PREDICTED: protein translation factor SUI1 homolog [Camelina 
sativa]
Length=112

 Score =   114 bits (284),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 62/71 (87%), Gaps = 1/71 (1%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            M +LD+Q+PS +DPFAE   ++   G+KDY+HIR+QQRNG+KSLTTVQGLKKE+SY +IL
Sbjct  1    MVELDIQVPSAYDPFAEAK-DSDAPGAKDYIHIRIQQRNGKKSLTTVQGLKKEYSYERIL  59

Query  378  KDLKKEFCCNG  410
            KDLKK+FCCNG
Sbjct  60   KDLKKDFCCNG  70



>gb|EMT13356.1| Protein translation factor SUI1-like protein [Aegilops tauschii]
Length=120

 Score =   114 bits (284),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 54/62 (87%), Positives = 59/62 (95%), Gaps = 2/62 (3%)
 Frame = +3

Query  234  DPFAEGNAENSGAG--SKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCN  407
            DPFAE NAE+SGAG  SK+YVH+RVQQRNGRKSLTTVQGLKK++SYNKILKDLKKEFCCN
Sbjct  18   DPFAEANAEDSGAGAGSKNYVHVRVQQRNGRKSLTTVQGLKKDYSYNKILKDLKKEFCCN  77

Query  408  GT  413
            GT
Sbjct  78   GT  79



>ref|XP_006372949.1| hypothetical protein POPTR_0017s06480g, partial [Populus trichocarpa]
 gb|ERP50746.1| hypothetical protein POPTR_0017s06480g, partial [Populus trichocarpa]
Length=100

 Score =   113 bits (282),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 51/59 (86%), Positives = 57/59 (97%), Gaps = 0/59 (0%)
 Frame = +3

Query  237  PFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCNGT  413
            PFAE NA++SGAG+KDYVH+RVQQRNGRKSLTTVQGLKKE+SY+KI KDLKKEFCCNGT
Sbjct  1    PFAEANADDSGAGAKDYVHVRVQQRNGRKSLTTVQGLKKEYSYSKIQKDLKKEFCCNGT  59



>emb|CDY43020.1| BnaA03g11670D [Brassica napus]
Length=112

 Score =   113 bits (282),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 61/71 (86%), Gaps = 1/71 (1%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            M +LD+Q+PS FDPFAE   E+   G+K+Y+H+R+QQRNG+KSLTTVQGLKK +SY KIL
Sbjct  1    MVELDIQVPSAFDPFAEAQ-ESDAPGTKEYIHVRIQQRNGKKSLTTVQGLKKAYSYEKIL  59

Query  378  KDLKKEFCCNG  410
            KDLKK+FCCNG
Sbjct  60   KDLKKDFCCNG  70



>ref|XP_010109526.1| Protein translation factor SUI1-1-like protein [Morus notabilis]
 gb|EXC23130.1| Protein translation factor SUI1-1-like protein [Morus notabilis]
Length=149

 Score =   114 bits (285),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 56/72 (78%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            MS+LD Q+PS FDPFA+ +A++S AG K+YVH+RVQQRNGRKSLTTVQGLKK++SY+KIL
Sbjct  1    MSELDQQLPSAFDPFADASADDSSAGGKEYVHVRVQQRNGRKSLTTVQGLKKQYSYSKIL  60

Query  378  KDLKKEFCCNGT  413
            KDLKKEFCCNGT
Sbjct  61   KDLKKEFCCNGT  72



>ref|XP_007212250.1| hypothetical protein PRUPE_ppa013625mg [Prunus persica]
 ref|XP_007212251.1| hypothetical protein PRUPE_ppa013625mg [Prunus persica]
 ref|XP_008226898.1| PREDICTED: protein translation factor SUI1 homolog [Prunus mume]
 ref|XP_008226900.1| PREDICTED: protein translation factor SUI1 homolog [Prunus mume]
 gb|EMJ13449.1| hypothetical protein PRUPE_ppa013625mg [Prunus persica]
 gb|EMJ13450.1| hypothetical protein PRUPE_ppa013625mg [Prunus persica]
Length=112

 Score =   113 bits (282),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 60/71 (85%), Gaps = 1/71 (1%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            M +LD+QIP+ FDPFAE   +    G+K+YVHIRVQQRNG+K LTTVQGLKK+FSY KIL
Sbjct  1    MVELDVQIPTAFDPFAEAK-DADAPGAKEYVHIRVQQRNGKKCLTTVQGLKKDFSYEKIL  59

Query  378  KDLKKEFCCNG  410
            KDLKKEFCCNG
Sbjct  60   KDLKKEFCCNG  70



>ref|XP_003600096.1| Translation factor SUI1-like protein [Medicago truncatula]
 gb|AES70347.1| eukaryotic translation initiation factor SUI1 [Medicago truncatula]
 gb|AFK42757.1| unknown [Medicago truncatula]
Length=112

 Score =   113 bits (282),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 51/71 (72%), Positives = 61/71 (86%), Gaps = 1/71 (1%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            M +LD+QIP+ FDPFA+   E+   G K+YVHIR+QQRNG+KSLTTVQGLKK++SY KIL
Sbjct  1    MVELDIQIPTAFDPFADA-IESDAPGGKEYVHIRIQQRNGKKSLTTVQGLKKDYSYEKIL  59

Query  378  KDLKKEFCCNG  410
            KDLKKEFCCNG
Sbjct  60   KDLKKEFCCNG  70



>gb|ADB85107.1| translation initiation factor-like protein [Jatropha curcas]
 gb|KDP39133.1| hypothetical protein JCGZ_00890 [Jatropha curcas]
Length=112

 Score =   112 bits (281),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 53/72 (74%), Positives = 64/72 (89%), Gaps = 3/72 (4%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGA-GSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKI  374
            M DL++Q+P+ FDPF+E  A++SGA G+K+YVHIR+QQRNGRKSLTTVQGL KEFSY KI
Sbjct  1    MVDLEIQVPAAFDPFSE--AKDSGAPGAKEYVHIRIQQRNGRKSLTTVQGLPKEFSYEKI  58

Query  375  LKDLKKEFCCNG  410
            +K LKKEFCCNG
Sbjct  59   VKALKKEFCCNG  70



>ref|XP_004171416.1| PREDICTED: protein translation factor SUI1 homolog 1-like, partial 
[Cucumis sativus]
Length=110

 Score =   112 bits (281),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 60/71 (85%), Gaps = 1/71 (1%)
 Frame = +3

Query  198  MSDLDLQIPSTFDPFAEGNAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  377
            M +LD QIPS FDPFA+   ++   G+K+YVHIRVQQRNG+K LTTVQGLKKEFSY KIL
Sbjct  1    MVELDFQIPSAFDPFADAK-DSDAPGTKEYVHIRVQQRNGKKCLTTVQGLKKEFSYEKIL  59

Query  378  KDLKKEFCCNG  410
            KD+KKEFCCNG
Sbjct  60   KDVKKEFCCNG  70



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 562275868875