BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002B22

Length=317
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011097013.1|  PREDICTED: actin-related protein 4 isoform X2      136   3e-36   
ref|XP_009612119.1|  PREDICTED: actin-related protein 4 isoform X2      132   4e-36   Nicotiana tomentosiformis
ref|XP_011097012.1|  PREDICTED: actin-related protein 4 isoform X1      137   6e-36   Sesamum indicum [beniseed]
emb|CDP10197.1|  unnamed protein product                                136   1e-35   Coffea canephora [robusta coffee]
emb|CDO98459.1|  unnamed protein product                                132   2e-35   Coffea canephora [robusta coffee]
ref|XP_004294179.1|  PREDICTED: actin-related protein 4-like            135   2e-35   Fragaria vesca subsp. vesca
gb|KCW83834.1|  hypothetical protein EUGRSUZ_B007041                    127   7e-35   Eucalyptus grandis [rose gum]
ref|XP_006362361.1|  PREDICTED: actin-related protein 4-like            133   1e-34   Solanum tuberosum [potatoes]
ref|XP_009612118.1|  PREDICTED: actin-related protein 4 isoform X1      133   2e-34   Nicotiana tomentosiformis
ref|XP_004252241.1|  PREDICTED: actin-related protein 4                 133   2e-34   Solanum lycopersicum
emb|CBI15427.3|  unnamed protein product                                126   6e-34   Vitis vinifera
ref|XP_010094706.1|  hypothetical protein L484_003014                   126   8e-34   
gb|KHN01603.1|  Actin-related protein 4                                 127   2e-33   Glycine soja [wild soybean]
ref|XP_006584852.1|  PREDICTED: actin-related protein 4 isoform X2      126   3e-33   
ref|XP_008226362.1|  PREDICTED: actin-related protein 4                 130   3e-33   Prunus mume [ume]
ref|XP_009344621.1|  PREDICTED: actin-related protein 4-like            129   3e-33   Pyrus x bretschneideri [bai li]
ref|XP_009796964.1|  PREDICTED: actin-related protein 4A-like           123   5e-33   Nicotiana sylvestris
ref|XP_002511960.1|  protein binding protein, putative                  129   7e-33   Ricinus communis
ref|XP_011014466.1|  PREDICTED: actin-related protein 4-like            128   8e-33   Populus euphratica
ref|XP_002317939.1|  Actin-related family protein                       128   8e-33   
ref|XP_003521054.1|  PREDICTED: actin-related protein 4-like            128   9e-33   Glycine max [soybeans]
ref|XP_006485767.1|  PREDICTED: actin-related protein 4-like            128   1e-32   Citrus sinensis [apfelsine]
ref|XP_008386419.1|  PREDICTED: actin-related protein 4-like            127   1e-32   
gb|KDP20102.1|  hypothetical protein JCGZ_05871                         127   1e-32   Jatropha curcas
ref|XP_002275561.2|  PREDICTED: actin-related protein 4                 127   2e-32   Vitis vinifera
ref|XP_003529017.1|  PREDICTED: actin-related protein 4-like            127   2e-32   Glycine max [soybeans]
ref|XP_009339362.1|  PREDICTED: actin-related protein 4-like            127   3e-32   Pyrus x bretschneideri [bai li]
ref|XP_008368454.1|  PREDICTED: actin-related protein 4                 127   4e-32   
ref|XP_010031801.1|  PREDICTED: actin-related protein 4                 126   4e-32   Eucalyptus grandis [rose gum]
ref|XP_003530654.1|  PREDICTED: actin-related protein 4 isoform X1      126   5e-32   Glycine max [soybeans]
ref|XP_007014880.1|  Actin-related protein 4 isoform 1                  126   6e-32   
ref|XP_010260462.1|  PREDICTED: actin-related protein 4                 125   7e-32   Nelumbo nucifera [Indian lotus]
ref|NP_177531.1|  actin-related protein 4A                              120   1e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004510131.1|  PREDICTED: actin-related protein 4-like            124   1e-31   
gb|KJB83475.1|  hypothetical protein B456_013G249800                    124   2e-31   Gossypium raimondii
gb|ACJ85865.1|  unknown                                                 122   3e-31   Medicago truncatula
ref|XP_004515316.1|  PREDICTED: actin-related protein 4-like isof...    124   3e-31   Cicer arietinum [garbanzo]
gb|KHG07777.1|  Actin-related 4 -like protein                           124   3e-31   Gossypium arboreum [tree cotton]
ref|XP_004515315.1|  PREDICTED: actin-related protein 4-like isof...    124   3e-31   Cicer arietinum [garbanzo]
gb|KJB83478.1|  hypothetical protein B456_013G249800                    124   4e-31   Gossypium raimondii
gb|KJB83474.1|  hypothetical protein B456_013G249800                    124   4e-31   Gossypium raimondii
ref|XP_008811208.1|  PREDICTED: actin-related protein 4                 123   5e-31   Phoenix dactylifera
gb|AAM53245.1|AF507913_1  actin-related protein 4A                      117   9e-31   Arabidopsis thaliana [mouse-ear cress]
gb|KEH19612.1|  actin-related protein ARP4                              122   1e-30   Medicago truncatula
ref|XP_010539996.1|  PREDICTED: actin-related protein 4                 122   1e-30   Tarenaya hassleriana [spider flower]
ref|XP_008453382.1|  PREDICTED: actin-related protein 4                 122   1e-30   Cucumis melo [Oriental melon]
ref|XP_004138236.1|  PREDICTED: actin-related protein 4-like            122   2e-30   Cucumis sativus [cucumbers]
gb|AES98265.2|  actin-related protein ARP4                              122   2e-30   Medicago truncatula
ref|XP_003615306.1|  Actin-related protein                              122   2e-30   
gb|ACJ85813.1|  unknown                                                 122   2e-30   Medicago truncatula
gb|AES98264.2|  actin-related protein ARP4                              122   2e-30   Medicago truncatula
gb|KEH28123.1|  actin-related protein ARP4                              122   2e-30   Medicago truncatula
ref|XP_010677969.1|  PREDICTED: actin-related protein 4                 122   2e-30   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006305904.1|  hypothetical protein CARUB_v10011098mg             119   5e-30   
ref|XP_009110344.1|  PREDICTED: actin-related protein 4 isoform X1      120   5e-30   Brassica rapa
ref|XP_009110345.1|  PREDICTED: actin-related protein 4 isoform X2      120   5e-30   Brassica rapa
emb|CDX96721.1|  BnaA08g22640D                                          120   5e-30   
ref|XP_006390493.1|  hypothetical protein EUTSA_v10018569mg             120   6e-30   Eutrema salsugineum [saltwater cress]
ref|XP_010940353.1|  PREDICTED: actin-related protein 4                 120   6e-30   Elaeis guineensis
ref|XP_006859060.1|  hypothetical protein AMTR_s00068p00196840          117   6e-30   
ref|XP_010459462.1|  PREDICTED: actin-related protein 4-like            119   1e-29   Camelina sativa [gold-of-pleasure]
gb|EYU44127.1|  hypothetical protein MIMGU_mgv1a006688mg                119   1e-29   Erythranthe guttata [common monkey flower]
ref|XP_010498232.1|  PREDICTED: actin-related protein 4-like            119   1e-29   Camelina sativa [gold-of-pleasure]
ref|XP_003615307.1|  Actin-related protein                              119   1e-29   
gb|AAW81736.1|  Putative Acttin-related protein 4 (ARP4)                119   2e-29   Brassica oleracea
ref|XP_006307538.1|  hypothetical protein CARUB_v10009163mg             119   2e-29   Capsella rubella
emb|CDY19213.1|  BnaC05g14140D                                          119   2e-29   Brassica napus [oilseed rape]
ref|XP_006416603.1|  hypothetical protein EUTSA_v10007641mg             119   2e-29   Eutrema salsugineum [saltwater cress]
ref|XP_007134394.1|  hypothetical protein PHAVU_010G044300g             119   2e-29   Phaseolus vulgaris [French bean]
ref|XP_002890276.1|  hypothetical protein ARALYDRAFT_472063             119   2e-29   
gb|AAM65324.1|  unknown                                                 118   3e-29   Arabidopsis thaliana [mouse-ear cress]
gb|KFK44003.1|  hypothetical protein AALP_AA1G202200                    118   3e-29   Arabis alpina [alpine rockcress]
ref|XP_011013153.1|  PREDICTED: actin-related protein 4-like isof...    118   4e-29   Populus euphratica
ref|XP_011013152.1|  PREDICTED: actin-related protein 4-like isof...    118   4e-29   Populus euphratica
emb|CDY26159.1|  BnaA06g12580D                                          118   5e-29   Brassica napus [oilseed rape]
ref|XP_010477023.1|  PREDICTED: actin-related protein 4                 118   5e-29   Camelina sativa [gold-of-pleasure]
emb|CDX83847.1|  BnaC08g17980D                                          116   1e-28   
ref|NP_564051.1|  actin-related protein 4                               116   2e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006837032.1|  hypothetical protein AMTR_s00110p00032330          115   4e-28   Amborella trichopoda
gb|KFK41829.1|  hypothetical protein AALP_AA2G176800                    114   1e-27   Arabis alpina [alpine rockcress]
gb|AAM53244.1|AF507912_1  actin-related protein 4                       114   1e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003526079.1|  PREDICTED: actin-related protein 4A-like           109   2e-27   Glycine max [soybeans]
ref|XP_006302448.1|  hypothetical protein CARUB_v10020534mg             112   5e-27   
gb|EPS72646.1|  hypothetical protein M569_02110                         111   9e-27   Genlisea aurea
ref|XP_010474325.1|  PREDICTED: LOW QUALITY PROTEIN: actin-relate...    107   2e-26   
ref|XP_009149328.1|  PREDICTED: actin-related protein 4-like            108   1e-25   Brassica rapa
ref|XP_009413467.1|  PREDICTED: actin-related protein 4                 107   3e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010428343.1|  PREDICTED: actin-related protein 4-like            106   8e-25   
tpg|DAA42880.1|  TPA: hypothetical protein ZEAMMB73_922428              102   1e-24   
ref|XP_010935666.1|  PREDICTED: actin-related protein 4                 102   4e-24   
ref|XP_004986029.1|  PREDICTED: actin-related protein 4-like            102   2e-23   Setaria italica
ref|XP_002466003.1|  hypothetical protein SORBIDRAFT_01g049880          101   4e-23   Sorghum bicolor [broomcorn]
gb|ACG40489.1|  actin-like protein 6A                                   101   4e-23   Zea mays [maize]
ref|XP_008672855.1|  PREDICTED: uncharacterized protein LOC100279...    101   4e-23   
ref|NP_001060954.1|  Os08g0137200                                     99.4    3e-22   
dbj|BAK04027.1|  predicted protein                                    99.0    4e-22   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT14913.1|  Actin-related protein 4                               99.0    6e-22   
ref|XP_006659807.1|  PREDICTED: actin-related protein 4-like          97.8    1e-21   Oryza brachyantha
ref|XP_003559002.1|  PREDICTED: actin-related protein 4               95.9    6e-21   Brachypodium distachyon [annual false brome]
ref|XP_001764145.1|  actin-related protein Arp4                       95.9    6e-21   
ref|XP_004304616.1|  PREDICTED: actin-related protein 4-like          95.5    8e-21   Fragaria vesca subsp. vesca
gb|EMT08634.1|  Actin-related protein 4                               95.5    2e-20   
gb|EEE68011.1|  hypothetical protein OsJ_25972                        92.0    1e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002966143.1|  hypothetical protein SELMODRAFT_266988           91.3    2e-19   Selaginella moellendorffii
ref|XP_002982148.1|  hypothetical protein SELMODRAFT_268538           89.7    8e-19   Selaginella moellendorffii
ref|XP_005651985.1|  putative Acttin-related protein 4                87.0    7e-18   Coccomyxa subellipsoidea C-169
ref|XP_005848141.1|  hypothetical protein CHLNCDRAFT_145481           82.0    3e-17   Chlorella variabilis
gb|EMS61463.1|  hypothetical protein TRIUR3_27205                     85.9    8e-17   Triticum urartu
ref|XP_001778436.1|  actin-related protein ARP4                       84.3    1e-16   
gb|KEH17933.1|  actin-related protein 4A                              79.0    2e-16   Medicago truncatula
gb|KDO64535.1|  hypothetical protein CISIN_1g0374701mg                74.7    2e-15   Citrus sinensis [apfelsine]
gb|KIZ06768.1|  Actin-related protein 4                               76.3    9e-15   Monoraphidium neglectum
gb|KEH28122.1|  UDP-glucosyltransferase family protein                73.9    8e-14   Medicago truncatula
ref|XP_002504876.1|  actin superfamily                                75.5    1e-13   Micromonas commoda
ref|XP_640964.1|  actin-like protein 6A                               74.7    3e-13   Dictyostelium discoideum AX4
gb|EKD04608.1|  53 kda brg1-associated factor b                       75.1    3e-13   Trichosporon asahii var. asahii CBS 8904
gb|ADI46900.1|  ARP4m                                                 72.0    3e-12   Volvox carteri f. nagariensis
gb|ADI46834.1|  ARP4f                                                 72.0    3e-12   Volvox carteri f. nagariensis
ref|XP_003060727.1|  actin superfamily                                71.6    3e-12   Micromonas pusilla CCMP1545
ref|XP_003289725.1|  hypothetical protein DICPUDRAFT_48789            69.7    2e-11   Dictyostelium purpureum
ref|XP_005838967.1|  hypothetical protein GUITHDRAFT_102601           66.6    2e-10   Guillardia theta CCMP2712
ref|XP_001417251.1|  predicted protein                                66.6    2e-10   Ostreococcus lucimarinus CCE9901
ref|XP_009286399.1|  PREDICTED: actin-like protein 6A                 62.4    6e-10   Aptenodytes forsteri
gb|EMD40548.1|  hypothetical protein CERSUDRAFT_111146                65.1    7e-10   Gelatoporia subvermispora B
ref|XP_005525127.1|  PREDICTED: actin-like protein 6A                 64.7    8e-10   Pseudopodoces humilis [Tibetan ground-jay]
emb|CDQ80464.1|  unnamed protein product                              62.0    1e-09   Oncorhynchus mykiss
dbj|GAM25133.1|  hypothetical protein SAMD00019534_083080             63.9    1e-09   Acytostelium subglobosum LB1
gb|EJY78936.1|  Actin-related protein 4                               64.7    1e-09   Oxytricha trifallax
gb|KDE08803.1|  hypothetical protein MVLG_00908                       63.9    2e-09   Microbotryum lychnidis-dioicae p1A1 Lamole
ref|XP_004365527.2|  BAF53b                                           63.9    2e-09   Capsaspora owczarzaki ATCC 30864
ref|XP_003078795.1|  Actin-related protein Arp2/3 complex, subuni...  63.5    2e-09   Ostreococcus tauri
emb|CDQ58638.1|  unnamed protein product                              63.2    3e-09   Oncorhynchus mykiss
ref|XP_010869611.1|  PREDICTED: actin-like protein 6A isoform X2      63.2    3e-09   Esox lucius
ref|XP_010869610.1|  PREDICTED: actin-like protein 6A isoform X1      63.2    3e-09   Esox lucius
ref|XP_008140546.1|  PREDICTED: actin-like protein 6A                 62.8    4e-09   Eptesicus fuscus
sp|Q4R333.1|ACL6A_MACFA  RecName: Full=Actin-like protein 6A; Alt...  62.8    4e-09   Macaca fascicularis [crab eating macaque]
gb|ERE88632.1|  actin-like protein 6A                                 62.0    4e-09   Cricetulus griseus [Chinese hamsters]
emb|CEG80912.1|  hypothetical protein RMATCC62417_15175               62.0    4e-09   Rhizopus microsporus
ref|XP_003218152.1|  PREDICTED: actin-like protein 6A                 62.8    4e-09   Anolis carolinensis [Carolina anole]
ref|NP_001133252.1|  Actin-like protein 6B                            62.8    5e-09   Salmo salar
gb|ABN14926.1|  cytoskeletal actin 2                                  60.1    5e-09   Taenia asiatica [Asian tapeworm]
ref|XP_002958261.1|  actin-related protein Arp4                       62.4    5e-09   Volvox carteri f. nagariensis
emb|CEG67675.1|  hypothetical protein RMATCC62417_04071               61.6    5e-09   Rhizopus microsporus
ref|XP_002115616.1|  hypothetical protein TRIADDRAFT_29808            62.4    6e-09   Trichoplax adhaerens
ref|XP_002679390.1|  actin related protein                            62.4    6e-09   Naegleria gruberi strain NEG-M
ref|XP_005069713.1|  PREDICTED: actin-like protein 6A                 62.0    6e-09   
ref|XP_006867761.1|  PREDICTED: actin-like protein 6A isoform X1      62.4    6e-09   Chrysochloris asiatica
ref|XP_003509127.1|  PREDICTED: actin-like protein 6A isoform X1      62.4    6e-09   Cricetulus griseus [Chinese hamsters]
ref|XP_002590506.1|  hypothetical protein BRAFLDRAFT_59623            62.4    6e-09   Branchiostoma floridae
emb|CAB66543.1|  hypothetical protein                                 62.4    6e-09   Homo sapiens [man]
ref|NP_004292.1|  actin-like protein 6A isoform 1                     62.4    6e-09   Homo sapiens [man]
ref|NP_062647.2|  actin-like protein 6A                               62.4    6e-09   Mus musculus [mouse]
gb|AAC94992.1|  BAF53a                                                62.0    7e-09   Mus musculus [mouse]
dbj|BAE41036.1|  unnamed protein product                              62.0    7e-09   Mus musculus [mouse]
ref|XP_005883069.1|  PREDICTED: actin-like protein 6A                 62.0    7e-09   Myotis brandtii
emb|CEI91007.1|  hypothetical protein RMCBS344292_05311               62.0    7e-09   Rhizopus microsporus
ref|XP_008836882.1|  PREDICTED: actin-like protein 6A isoform X1      62.0    7e-09   Nannospalax galili
ref|XP_003467569.1|  PREDICTED: actin-like protein 6A                 62.0    7e-09   Cavia porcellus [guinea pig]
ref|XP_005343823.1|  PREDICTED: actin-like protein 6A                 62.0    7e-09   Microtus ochrogaster [prairie voles]
ref|XP_006084957.1|  PREDICTED: LOW QUALITY PROTEIN: actin-like p...  62.0    7e-09   Myotis lucifugus
ref|XP_002716488.1|  PREDICTED: actin-like protein 6A                 62.0    7e-09   Oryctolagus cuniculus [domestic rabbit]
ref|XP_422784.3|  PREDICTED: actin-like 6A                            62.0    7e-09   Gallus gallus [bantam]
ref|XP_010571227.1|  PREDICTED: actin-like protein 6A                 62.0    7e-09   Haliaeetus leucocephalus
ref|XP_005484852.1|  PREDICTED: actin-like protein 6A                 62.0    7e-09   Zonotrichia albicollis
ref|XP_005146975.1|  PREDICTED: actin-like protein 6A                 62.0    7e-09   Melopsittacus undulatus
ref|XP_004337370.1|  actin, putative                                  59.3    7e-09   Acanthamoeba castellanii str. Neff
ref|XP_005383099.1|  PREDICTED: actin-like protein 6A isoform X2      62.0    8e-09   Chinchilla lanigera
gb|KFM13458.1|  Actin-like 6A                                         61.6    8e-09   Aptenodytes forsteri
ref|XP_004901945.1|  PREDICTED: actin-like protein 6A isoform X1      62.0    8e-09   
ref|XP_006276038.1|  PREDICTED: actin-like protein 6A                 62.0    8e-09   Alligator mississippiensis
ref|XP_005286018.1|  PREDICTED: actin-like protein 6A                 62.0    8e-09   Chrysemys picta bellii
ref|XP_004647347.1|  PREDICTED: actin-like protein 6A isoform X1      62.0    8e-09   Octodon degus
ref|XP_007302894.1|  brg1-associated factor b                         62.0    8e-09   Stereum hirsutum FP-91666 SS1
ref|XP_003256548.1|  PREDICTED: actin-like protein 6A isoform 1       62.0    8e-09   Nomascus leucogenys [White-cheeked Gibbon]
gb|ABD83882.1|  cytoskeletal beta actin                               58.2    8e-09   Ictalurus punctatus
ref|XP_007512384.1|  unknown                                          62.0    8e-09   Bathycoccus prasinos
ref|XP_004335590.1|  actin-1, putative                                59.3    9e-09   Acanthamoeba castellanii str. Neff
gb|ADK94900.1|  beta-actin                                            58.9    9e-09   Hyriopsis cumingii
gb|KHJ74840.1|  hypothetical protein OESDEN_25544                     57.8    1e-08   Oesophagostomum dentatum [nodule worm]
ref|XP_003747100.1|  PREDICTED: actin-like protein 6B                 61.6    1e-08   Galendromus occidentalis
ref|XP_008291929.1|  PREDICTED: actin-like protein 6A isoform X2      61.6    1e-08   Stegastes partitus
ref|XP_004570293.1|  PREDICTED: actin-like protein 6A-like isofor...  61.6    1e-08   Maylandia zebra
ref|XP_003439834.1|  PREDICTED: actin-like protein 6A-like isoform 1  61.6    1e-08   Oreochromis niloticus
ref|XP_008291928.1|  PREDICTED: actin-like protein 6A isoform X1      61.6    1e-08   Stegastes partitus
ref|XP_004257596.1|  actin 2 protein, putative                        57.8    1e-08   Entamoeba invadens IP1
emb|CEL58128.1|  Actin-related protein 4 OS=Emericella nidulans (...  61.6    1e-08   Rhizoctonia solani AG-1 IB
ref|XP_004708658.1|  PREDICTED: actin-like protein 6A isoform X1      61.6    1e-08   Echinops telfairi [lesser hedgehog tenrec]
gb|ESA10096.1|  hypothetical protein GLOINDRAFT_199267                61.6    1e-08   
ref|XP_007946463.1|  PREDICTED: actin-like protein 6A isoform X1      61.6    1e-08   Orycteropus afer afer
ref|XP_002406965.1|  actin, putative                                  60.1    1e-08   Ixodes scapularis [blacklegged tick]
gb|EFA84276.1|  actin-like protein 6A                                 61.6    1e-08   Heterostelium album PN500
gb|KIH49298.1|  hypothetical protein ANCDUO_20628                     57.8    1e-08   Ancylostoma duodenale
ref|XP_010745346.1|  PREDICTED: actin-like protein 6A                 61.6    1e-08   
gb|AAS55431.1|  beta-actin                                            57.0    1e-08   Labeo rohita [Jayanti rohu]
ref|XP_009544018.1|  actin-related protein 4                          61.2    1e-08   Heterobasidion irregulare TC 32-1
ref|XP_004652131.1|  PREDICTED: actin-like protein 6A                 61.2    1e-08   
ref|XP_004332908.1|  actin subfamily protein                          59.3    1e-08   Acanthamoeba castellanii str. Neff
gb|EDM01200.1|  rCG41530, isoform CRA_b                               61.2    1e-08   Rattus norvegicus [brown rat]
emb|CEG67674.1|  hypothetical protein RMATCC62417_04071               61.2    1e-08   Rhizopus microsporus
ref|XP_002124021.1|  PREDICTED: actin-like protein 6B isoform X1      61.2    1e-08   Ciona intestinalis [sea vase]
emb|CEI97204.1|  hypothetical protein RMCBS344292_11340               61.2    1e-08   Rhizopus microsporus
ref|XP_008122944.1|  PREDICTED: actin-like protein 6B                 61.2    1e-08   
ref|NP_989337.1|  actin-like 6A                                       61.2    1e-08   Xenopus tropicalis [western clawed frog]
ref|XP_006884086.1|  PREDICTED: actin-like protein 6A isoform X1      61.2    1e-08   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|NP_001080451.1|  actin-like 6A                                    61.2    1e-08   Xenopus laevis [clawed frog]
ref|NP_001034122.1|  actin-like protein 6A                            61.2    2e-08   Rattus norvegicus [brown rat]
ref|XP_004225706.1|  PREDICTED: actin-like protein 6A isoform X2      60.8    2e-08   
emb|CCA69498.1|  related to ACT1-actin                                60.8    2e-08   Serendipita indica DSM 11827
ref|XP_007422848.1|  PREDICTED: actin-like protein 6A                 60.8    2e-08   Python bivittatus
ref|XP_005778501.1|  putative actin                                   57.4    2e-08   Emiliania huxleyi CCMP1516
gb|ACF32688.1|  actin                                                 57.8    2e-08   Amphidinium carterae
gb|AAA27887.1|  actin                                                 57.4    2e-08   Caenorhabditis elegans [roundworm]
ref|XP_002039673.1|  GM15786                                          57.4    2e-08   Drosophila sechellia
gb|EGU13103.1|  hypothetical protein RTG_00629                        61.6    2e-08   Rhodotorula toruloides ATCC 204091
ref|XP_003728392.1|  PREDICTED: actin-like protein 6A                 60.8    2e-08   
ref|XP_001696669.1|  actin-related protein                            60.8    2e-08   Chlamydomonas reinhardtii
gb|EMD44848.1|  actin 2, putative                                     57.0    2e-08   Entamoeba histolytica KU27
gb|EGT30044.1|  hypothetical protein CAEBREN_16354                    57.4    2e-08   Caenorhabditis brenneri
ref|XP_003974271.1|  PREDICTED: actin-like protein 6A-like isoform 2  60.5    2e-08   
gb|EPB85937.1|  hypothetical protein HMPREF1544_07269                 60.8    2e-08   Mucor circinelloides f. circinelloides 1006PhL
gb|EMD45516.1|  actin 2, putative                                     57.0    2e-08   Entamoeba histolytica KU27
emb|CDI96496.1|  actin                                                56.6    2e-08   
dbj|BAJ14767.1|  beta actin                                           57.8    2e-08   Eptatretus atami [brown hagfish]
emb|CAG08066.1|  unnamed protein product                              60.5    2e-08   Tetraodon nigroviridis
emb|CAB55738.1|  actin                                                60.5    2e-08   Artemia franciscana
emb|CAB55752.1|  actin                                                60.5    2e-08   Artemia franciscana
ref|XP_003974270.1|  PREDICTED: actin-like protein 6A-like isoform 1  60.5    2e-08   Takifugu rubripes [tiger puffer]
gb|EYB83185.1|  hypothetical protein Y032_0340g2971                   57.8    3e-08   Ancylostoma ceylanicum
ref|XP_002838337.1|  hypothetical protein                             56.6    3e-08   Tuber melanosporum Mel28
gb|ADT79250.1|  non-muscle actin I                                    56.2    3e-08   Hydractinia echinata
gb|AEH04532.1|  beta-actin                                            57.8    3e-08   Haplochromis burtoni
ref|XP_008328111.1|  PREDICTED: actin-like protein 6A                 60.5    3e-08   Cynoglossus semilaevis [half-smooth tongue sole]
dbj|BAJ07368.1|  actin                                                58.2    3e-08   Hydatigera taeniaeformis
gb|ADX01224.1|  beta actin                                            57.8    3e-08   Ixodes ricinus
emb|CDJ93107.1|  Actin actin domain containing protein                57.4    3e-08   Haemonchus contortus [red stomach worm]
gb|EMS23789.1|  actin-related protein Arp4p                           60.5    3e-08   Rhodotorula toruloides NP11
ref|XP_004382380.1|  PREDICTED: actin-like protein 6A isoform 2       60.5    3e-08   Trichechus manatus latirostris
ref|XP_003412917.1|  PREDICTED: actin-like protein 6A isoform X1      60.5    3e-08   Loxodonta africana [African bush elephant]
ref|NP_001279710.1|  actin-like 6A                                    60.5    3e-08   Callorhinchus milii [Australian ghost shark]
dbj|BAJ07367.1|  beta-actin                                           58.2    3e-08   Hydatigera taeniaeformis
gb|AEL89389.1|  beta-actin                                            57.8    3e-08   Poecilia reticulata
ref|XP_005800552.1|  PREDICTED: actin-like protein 6A-like            60.5    3e-08   Xiphophorus maculatus
ref|XP_006637533.1|  PREDICTED: actin-like protein 6A-like            60.8    3e-08   
ref|XP_006007853.1|  PREDICTED: actin-3-like isoform X2               59.7    3e-08   
ref|XP_008406236.1|  PREDICTED: actin-like protein 6A                 60.5    3e-08   Poecilia reticulata
gb|AAC32808.1|  beta actin                                            57.8    3e-08   
gb|AAC32809.1|  beta actin                                            57.4    3e-08   Pseudopleuronectes americanus
gb|EMD49430.1|  actin, putative                                       57.4    3e-08   Entamoeba histolytica KU27
gb|KIK66854.1|  hypothetical protein GYMLUDRAFT_218271                60.1    3e-08   Gymnopus luxurians FD-317 M1
gb|ACF32733.1|  actin                                                 56.6    3e-08   Karlodinium veneficum
gb|AIE58484.1|  beta-actin                                            57.8    3e-08   Clarias gariepinus [sharptooth catfish]
ref|XP_007887354.1|  PREDICTED: actin-like protein 6A isoform X2      60.1    3e-08   Callorhinchus milii [Australian ghost shark]
gb|AFE55711.1|  beta-actin                                            57.8    3e-08   Rhodeus uyekii [Korean rose bitterling]
gb|ELK13629.1|  Actin-like protein 6A                                 59.7    3e-08   Pteropus alecto
gb|KHJ93825.1|  Actin                                                 58.2    3e-08   Oesophagostomum dentatum [nodule worm]
gb|ADU24831.1|  actin                                                 60.1    3e-08   Dinophysis caudata
gb|ADU24822.1|  actin                                                 60.1    3e-08   Dinophysis caudata
gb|ACN22489.1|  beta-actin                                            58.2    3e-08   Portunus trituberculatus [Japanese blue crab]
gb|ADU24820.1|  actin                                                 60.1    3e-08   Dinophysis caudata
ref|XP_005165974.1|  PREDICTED: actin-like protein 6A isoform X1      60.1    3e-08   Danio rerio [leopard danio]
ref|XP_003699173.1|  PREDICTED: actin-2, muscle-specific-like         58.2    3e-08   Apis florea [dwarf honeybee]
ref|XP_001642052.1|  predicted protein                                60.1    3e-08   Nematostella vectensis
gb|EMD48368.1|  actin, putative                                       56.6    3e-08   Entamoeba histolytica KU27
emb|CAA50205.1|  actin                                                57.4    3e-08   Entamoeba histolytica
gb|ABO16472.1|  actin                                                 57.8    3e-08   Moniliophthora perniciosa
gb|AAH45889.1|  Actin-like 6A                                         60.1    3e-08   Danio rerio [leopard danio]
gb|ADU24827.1|  actin                                                 59.7    3e-08   Dinophysis caudata
gb|AIW62511.1|  actin                                                 57.8    3e-08   Scytodes thoracica
gb|ADU24824.1|  actin                                                 59.7    3e-08   Dinophysis caudata
ref|XP_010357625.1|  PREDICTED: actin                                 57.8    4e-08   Rhinopithecus roxellana
ref|XP_001914397.1|  actin 2 protein                                  56.6    4e-08   Entamoeba histolytica HM-1:IMSS
gb|AIW62509.1|  actin                                                 57.8    4e-08   Scytodes thoracica
gb|AIW62557.1|  actin                                                 58.2    4e-08   Scytodes thoracica
emb|CBY24908.1|  unnamed protein product                              57.0    4e-08   Oikopleura dioica
gb|AAC38982.1|  actin 2                                               56.6    4e-08   Schmidtea polychroa
gb|AAQ94585.1|  BAF53                                                 60.1    4e-08   Danio rerio [leopard danio]
ref|XP_004337269.1|  actin-1, putative                                59.7    4e-08   Acanthamoeba castellanii str. Neff
gb|ACF32666.1|  actin                                                 57.0    4e-08   Amphidinium carterae
ref|XP_004337366.1|  Actin subfamily protein                          59.3    4e-08   Acanthamoeba castellanii str. Neff
dbj|BAD35130.1|  cytoplasmic actin                                    55.8    4e-08   
gb|AAC38983.1|  actin 3                                               56.6    4e-08   
gb|AAP34631.1|  ubiquitin/actin fusion protein 1                      58.2    4e-08   
ref|XP_004335674.1|  Actin1                                           59.7    4e-08   
ref|XP_004336648.1|  Actin1                                           59.7    4e-08   
ref|XP_006007852.1|  PREDICTED: actin-3-like isoform X1               59.7    4e-08   
gb|AAP20162.1|  beta-actin                                            57.8    4e-08   
ref|XP_002742865.2|  PREDICTED: actin-1                               57.0    4e-08   
ref|XP_004067770.1|  PREDICTED: actin-like protein 6A                 59.7    4e-08   
prf||1002250A  actin                                                  59.7    4e-08
gb|AII97690.1|  BLTX302                                               57.0    4e-08   
gb|ACD86945.1|  actin                                                 58.2    4e-08   
gb|EPQ15604.1|  Actin, cytoplasmic 1                                  59.7    4e-08   
ref|XP_004253592.1|  actin, putative                                  59.7    4e-08   
gb|EMD48231.1|  actin, putative                                       57.0    4e-08   
ref|XP_006127376.1|  PREDICTED: actin, alpha skeletal muscle-like     55.8    4e-08   
gb|AAL61814.1|AF457916_1  putative actin                              57.4    4e-08   
gb|EPZ36618.1|  Actin domain-containing protein                       59.7    4e-08   
ref|XP_003118003.1|  hypothetical protein CRE_00823                   57.4    4e-08   
gb|EJW78609.1|  hypothetical protein WUBG_10483                       55.8    4e-08   
ref|XP_010946115.1|  PREDICTED: actin-like protein 6A                 59.7    5e-08   
emb|CAA23484.1|  unnamed protein product                              55.8    5e-08   
gb|EMD44045.1|  actin, putative                                       56.6    5e-08   
gb|AIW62558.1|  actin                                                 58.2    5e-08   
emb|CAA23482.1|  unnamed protein product                              56.2    5e-08   
gb|EFX88198.1|  hypothetical protein DAPPUDRAFT_192057                59.7    5e-08   
dbj|BAG84577.1|  cytoplasmic actin Cp-Ac445                           56.6    5e-08   
ref|XP_004424765.1|  PREDICTED: actin-like protein 6A isoform 1       59.7    5e-08   
ref|XP_003132593.1|  PREDICTED: actin-like 6A isoformX1               59.7    5e-08   
ref|XP_011477985.1|  PREDICTED: actin, cytoplasmic 3-like             59.3    5e-08   
ref|NP_001098505.1|  actin-like protein 6A                            59.7    5e-08   
gb|AHG94980.1|  beta actin                                            58.2    5e-08   
gb|KHJ98396.1|  Actin                                                 57.4    5e-08   
gb|EJU05989.1|  actin 1                                               59.3    5e-08   
gb|AAA33151.1|  actin 5                                               55.5    5e-08   
gb|AAL17609.1|AF422795_1  cytoplasmic actin                           55.5    5e-08   
ref|XP_004675046.1|  PREDICTED: actin-like protein 6A isoform X1      59.7    5e-08   
ref|XP_004254367.1|  actin, putative                                  59.3    5e-08   
gb|AAA27888.1|  actin                                                 56.2    5e-08   
ref|XP_006910938.1|  PREDICTED: actin-like protein 6A-like            59.3    5e-08   
emb|CCF36289.1|  actin-like protein 4                                 59.7    6e-08   
emb|CDS26183.1|  actin, cytoplasmic type 5                            60.1    6e-08   
gb|ADG26659.1|  beta-actin                                            59.3    6e-08   
gb|AAA27890.1|  actin                                                 56.2    6e-08   
ref|XP_007843238.1|  actin                                            59.3    6e-08   
dbj|BAN38814.1|  actin, putative                                      59.3    6e-08   
ref|XP_005812012.1|  PREDICTED: actin, cytoplasmic 2-like isoform X1  59.3    6e-08   
ref|XP_001642535.1|  hypothetical protein Kpol_282p4                  59.7    6e-08   
gb|KFM67516.1|  Actin-like protein 6A                                 59.3    6e-08   
gb|AAA98513.1|  beta-actin                                            56.2    6e-08   
ref|XP_008122081.1|  PREDICTED: actin-like                            56.2    6e-08   
gb|AEJ91673.1|  actin                                                 55.5    6e-08   
ref|XP_006459877.1|  hypothetical protein AGABI2DRAFT_191675          59.3    6e-08   
gb|AEJ91676.1|  actin                                                 55.5    6e-08   
gb|EJW81717.1|  hypothetical protein WUBG_07375                       55.8    6e-08   
ref|XP_007862502.1|  actin-like protein Arp4p                         59.3    6e-08   
gb|ACF28604.1|  truncated actin                                       56.2    6e-08   
gb|ADD38432.1|  Actin                                                 58.9    6e-08   
ref|XP_004992156.1|  hypothetical protein PTSG_12481                  59.3    6e-08   
emb|CCG58596.1|  Protein CBG29119                                     58.2    7e-08   
emb|CEP18346.1|  hypothetical protein                                 59.3    7e-08   
ref|XP_005991979.1|  PREDICTED: actin-like protein 6A                 59.3    7e-08   
gb|ACF32713.1|  actin                                                 55.8    7e-08   
ref|XP_007329635.1|  hypothetical protein AGABI1DRAFT_113677          59.3    7e-08   
ref|XP_007392257.1|  hypothetical protein PHACADRAFT_205920           59.3    7e-08   
ref|XP_001628180.1|  predicted protein                                58.9    7e-08   
gb|AAL36694.1|AF323409_1  actin                                       55.1    7e-08   
ref|XP_011432968.1|  PREDICTED: actin, cytoplasmic-like               58.9    7e-08   
ref|XP_008334696.1|  PREDICTED: actin, cytoplasmic 2-like             58.2    7e-08   
ref|XP_005809780.1|  PREDICTED: actin, cytoplasmic 1-like             58.9    8e-08   
gb|EUB56832.1|  Actin, cytoplasmic 2                                  58.9    8e-08   
ref|XP_005533822.1|  PREDICTED: actin-like protein 6B-like            58.9    8e-08   
gb|AEJ91708.1|  actin                                                 55.1    8e-08   
gb|AGB06352.1|  actin                                                 58.2    8e-08   
ref|XP_001966285.1|  GF22077                                          56.6    8e-08   
ref|XP_011448618.1|  PREDICTED: actin-85C-like                        58.9    8e-08   
ref|XP_011381850.1|  PREDICTED: actin-like protein 6A                 58.5    8e-08   
ref|XP_011336418.1|  PREDICTED: actin-85C-like                        58.9    8e-08   
ref|XP_002025523.1|  GL15240                                          55.8    8e-08   
emb|CAA29681.1|  unnamed protein product                              55.8    8e-08   
gb|ACF32720.1|  actin                                                 55.8    8e-08   
gb|ABZ91668.1|  actin                                                 58.2    8e-08   
ref|XP_007364293.1|  brg1-associated factor b                         58.9    8e-08   
ref|XP_007305464.1|  actin 2                                          58.9    8e-08   
gb|ACF32717.1|  actin                                                 55.8    8e-08   
ref|XP_003977330.1|  PREDICTED: actin, cytoplasmic 3-like             57.0    8e-08   
gb|KHJ84747.1|  Actin                                                 56.2    8e-08   
gb|KIJ06587.1|  hypothetical protein PAXINDRAFT_20222                 58.2    8e-08   
gb|KDN64549.1|  putative actin                                        58.9    9e-08   
gb|KIH48654.1|  Actin                                                 56.6    9e-08   
gb|EZA62929.1|  Actin, muscle                                         58.9    9e-08   
ref|XP_006572507.1|  PREDICTED: actin-2-like                          56.2    9e-08   
gb|ABF72904.1|  muscle-specific actin-like                            56.6    9e-08   
gb|KHJ79541.1|  Actin                                                 56.2    9e-08   
gb|ABI81603.1|  actin                                                 57.0    9e-08   
ref|XP_007518200.1|  PREDICTED: actin-like protein 6A isoform X1      58.9    9e-08   
ref|XP_006627413.1|  PREDICTED: actin-like protein 6B-like            58.9    9e-08   
ref|XP_003139727.1|  hypothetical protein LOAG_04142                  55.8    9e-08   
gb|EUB59337.1|  Actin                                                 58.9    9e-08   
gb|ABZ91666.1|  actin                                                 58.2    9e-08   
emb|CDJ95122.1|  Actin actin domain containing protein                58.9    9e-08   
gb|ACF32718.1|  actin                                                 55.8    9e-08   
gb|AFY09914.1|  actin                                                 58.5    9e-08   
gb|EGT55281.1|  hypothetical protein CAEBREN_32825                    58.5    9e-08   
gb|AAP31127.1|  beta-actin                                            55.8    9e-08   
gb|AAR82845.1|  actin D                                               58.2    9e-08   
ref|XP_009048498.1|  hypothetical protein LOTGIDRAFT_225683           58.9    9e-08   
ref|NP_001091149.1|  uncharacterized protein LOC100036902             58.5    9e-08   
gb|AAG39692.1|  actin                                                 54.7    9e-08   
gb|ACF32706.1|  actin                                                 55.8    9e-08   
gb|EAW87342.1|  hCG15971, isoform CRA_b                               56.2    9e-08   
gb|EJW72694.1|  actin-2                                               56.2    1e-07   
gb|AAK69438.1|  actin                                                 55.1    1e-07   
gb|AAG39690.1|  actin                                                 54.7    1e-07   
ref|XP_001741006.1|  actin                                            57.8    1e-07   
gb|ACF32709.1|  actin                                                 55.5    1e-07   
gb|AGS11964.1|  beta-actin                                            58.5    1e-07   
gb|ACC85688.1|  actin                                                 58.5    1e-07   
ref|XP_003382885.1|  PREDICTED: actin, cytoplasmic 1                  56.6    1e-07   
ref|XP_008996445.1|  PREDICTED: actin-1-like                          55.8    1e-07   
emb|CAA23479.1|  unnamed protein product                              54.7    1e-07   
dbj|BAN38348.1|  actin, putative                                      58.5    1e-07   
emb|CAP33054.2|  Protein CBG14574                                     58.2    1e-07   
ref|XP_007382183.1|  actin-like protein Arp4p                         58.9    1e-07   
gb|AEA00103.1|  actin                                                 54.7    1e-07   
dbj|BAN38150.1|  actin, putative                                      58.5    1e-07   
gb|AAV65947.1|  beta-actin                                            56.2    1e-07   
dbj|BAN39796.1|  actin, putative                                      58.5    1e-07   
dbj|BAN38786.1|  actin, putative                                      58.5    1e-07   
gb|AFN69081.1|  beta-actin                                            56.6    1e-07   
emb|CCD80390.1|  unnamed protein product                              56.6    1e-07   
gb|ACF32700.1|  actin                                                 55.8    1e-07   
emb|CAQ52661.1|  actin                                                58.5    1e-07   
emb|CAQ52654.1|  actin                                                58.5    1e-07   
emb|CAQ52652.1|  actin                                                58.5    1e-07   
dbj|BAN39334.1|  actin, putative                                      58.5    1e-07   
gb|AII97751.1|  BLTX369                                               58.2    1e-07   
gb|AII97790.1|  BLTX415                                               56.2    1e-07   
emb|CAQ52653.1|  actin                                                58.5    1e-07   
dbj|BAF96732.1|  actin2                                               58.5    1e-07   
emb|CAX83136.1|  Actin-2                                              55.5    1e-07   
gb|ACF32724.1|  actin                                                 55.8    1e-07   
gb|AAD11530.1|  actin                                                 58.5    1e-07   
ref|XP_002154462.1|  PREDICTED: actin, non-muscle 6.2-like            58.5    1e-07   
ref|XP_001747496.1|  hypothetical protein                             58.5    1e-07   
gb|AII01233.1|  actin                                                 54.7    1e-07   
ref|XP_001386952.1|  Actin                                            58.5    1e-07   
gb|AAK27412.1|  actin                                                 58.5    1e-07   
gb|ACD99707.1|  actin                                                 58.5    1e-07   
emb|CBY36739.1|  unnamed protein product                              58.5    1e-07   
emb|CBY36144.1|  unnamed protein product                              58.5    1e-07   
ref|XP_001637076.1|  predicted protein                                58.5    1e-07   
dbj|BAN38768.1|  actin, putative                                      58.5    1e-07   
gb|ACF32680.1|  actin                                                 55.8    1e-07   
ref|XP_005108061.1|  PREDICTED: actin-like protein 6A-like            58.5    1e-07   
prf||1101351C  actin                                                  58.5    1e-07
ref|XP_011303563.1|  PREDICTED: actin, clone 211-like                 56.2    1e-07   
dbj|BAA86216.1|  cytoplasmic actin                                    58.5    1e-07   
gb|KFM71572.1|  Actin, cytoplasmic A3a                                58.5    1e-07   
gb|ACI23573.1|  cytoplasmic type actin 1                              58.5    1e-07   
ref|XP_009060604.1|  hypothetical protein LOTGIDRAFT_193218           58.5    1e-07   
gb|AGT42327.1|  cytoplasmic actin                                     58.5    1e-07   
ref|XP_011438050.1|  PREDICTED: actin, adductor muscle                58.5    1e-07   
ref|XP_003869147.1|  Act1 actin                                       58.5    1e-07   
gb|ABI34073.1|  beta actin                                            58.5    1e-07   
emb|CAG62943.1|  actin                                                58.5    1e-07   
gb|AAT01072.1|  putative cytoplasmic actin A3a1                       58.5    1e-07   
ref|XP_010745526.1|  PREDICTED: LOW QUALITY PROTEIN: actin, cytop...  58.2    1e-07   
gb|AEI71572.1|  cytoplasmic actin                                     56.6    1e-07   
gb|ABV60390.1|  actin                                                 56.6    1e-07   
sp|Q26065.1|ACT_PLAMG  RecName: Full=Actin, adductor muscle; Flag...  58.5    1e-07   
gb|ACF32678.1|  actin                                                 55.5    1e-07   
gb|ACF32658.1|  actin                                                 55.5    1e-07   
gb|ACF32682.1|  actin                                                 55.8    1e-07   
ref|XP_005788759.1|  actin/actin-like protein alternative             58.5    1e-07   
gb|ADG45308.1|  actin                                                 58.5    1e-07   
ref|XP_007375872.1|  hypothetical protein SPAPADRAFT_61664            58.5    1e-07   
gb|ADU52999.1|  beta actin                                            56.2    1e-07   
gb|KEP47302.1|  actin-2                                               58.2    1e-07   
ref|XP_007388498.1|  actin 1                                          58.2    1e-07   
gb|KGB38965.1|  Actin-2                                               56.2    1e-07   
dbj|BAN38510.1|  actin, putative                                      58.2    1e-07   
dbj|BAN38042.1|  actin, putative                                      58.2    1e-07   
dbj|BAI44437.1|  actin                                                55.5    1e-07   
gb|ACI23574.1|  cytoplasmic type actin 2                              58.2    1e-07   
sp|P41340.1|ACT3_LIMPO  RecName: Full=Actin-3; Flags: Precursor       58.2    1e-07   
gb|AFL56351.1|  beta-actin                                            58.2    1e-07   
gb|EFQ25505.1|  actin                                                 58.5    1e-07   
gb|KJA24495.1|  hypothetical protein HYPSUDRAFT_200384                58.5    1e-07   
gb|ACF32655.1|  actin                                                 55.5    1e-07   
pdb|1D4X|A  Chain A, Crystal Structure Of Caenorhabditis Elegans ...  58.2    1e-07   
gb|EYB83187.1|  hypothetical protein Y032_0340g2972                   58.2    1e-07   
gb|ADU19852.1|  actin                                                 58.2    1e-07   
gb|ABX82966.1|  actin variant 1                                       58.2    1e-07   
emb|CAX82635.1|  Actin 5C                                             56.2    1e-07   
gb|ACF32704.1|  actin                                                 55.5    1e-07   
ref|NP_505817.1|  Protein ACT-3                                       58.2    1e-07   
ref|NP_508841.1|  Protein ACT-4, isoform a                            58.2    1e-07   
dbj|BAN39143.1|  actin, putative                                      58.2    1e-07   
dbj|BAN39089.1|  actin, putative                                      58.2    1e-07   
dbj|BAN38200.1|  actin, putative                                      58.2    1e-07   
dbj|BAN38142.1|  actin                                                58.2    1e-07   
dbj|BAN37629.1|  actin, putative                                      58.2    1e-07   
gb|AFX73037.1|  beta-actin                                            58.2    1e-07   
gb|EFX88224.1|  cytoplasmatic actin                                   58.2    1e-07   
dbj|BAF98180.1|  actin                                                58.2    1e-07   
gb|EJW70277.1|  actin                                                 55.8    1e-07   
dbj|BAN40986.1|  actin, putative                                      58.2    1e-07   
ref|XP_007391592.1|  hypothetical protein PHACADRAFT_249164           58.2    1e-07   
gb|AAK69436.1|  actin                                                 54.7    1e-07   
gb|ADG45298.1|  actin                                                 58.2    1e-07   
gb|AGZ87937.1|  actin                                                 58.2    1e-07   
dbj|BAN38540.1|  actin, putative                                      58.2    1e-07   
dbj|BAN37734.1|  actin, putative                                      58.2    1e-07   
sp|P53464.1|ACTM_HELTB  RecName: Full=Actin, cytoskeletal; AltNam...  58.2    1e-07   
gb|EFX69146.1|  cytoplasmatic actin                                   58.2    1e-07   
gb|ADH43622.1|  beta actin                                            58.2    1e-07   
ref|XP_007388499.1|  actin 2                                          58.2    1e-07   
ref|XP_001884444.1|  actin-1                                          58.2    1e-07   
gb|EDL35009.1|  actin-like 6A, isoform CRA_d                          58.5    1e-07   
gb|ADG45307.1|  actin                                                 58.2    1e-07   



>ref|XP_011097013.1| PREDICTED: actin-related protein 4 isoform X2 [Sesamum indicum]
Length=335

 Score =   136 bits (343),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 77/87 (89%), Positives = 81/87 (93%), Gaps = 0/87 (0%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsapd  236
            MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPS+VGSIDQME+D+ DN D NSGS P+
Sbjct  1    MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSVVGSIDQMEIDDADNSDKNSGSGPE  60

Query  237  sKSKGKRKLYVGSQSLGFRRDHMEALS  317
            SKSKGKRKLYVGSQ LGFRRDHME LS
Sbjct  61   SKSKGKRKLYVGSQDLGFRRDHMEVLS  87



>ref|XP_009612119.1| PREDICTED: actin-related protein 4 isoform X2 [Nicotiana tomentosiformis]
Length=192

 Score =   132 bits (333),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 78/87 (90%), Positives = 84/87 (97%), Gaps = 0/87 (0%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsapd  236
            MYGGDEVSAIV+DLGSHTCKAGYAGEDAPKAVFPSIVGS+DQMEVD PDNP++NSGSAPD
Sbjct  1    MYGGDEVSAIVIDLGSHTCKAGYAGEDAPKAVFPSIVGSVDQMEVDYPDNPEDNSGSAPD  60

Query  237  sKSKGKRKLYVGSQSLGFRRDHMEALS  317
            SKSKGKR+LYVGSQ+LGFRRD ME LS
Sbjct  61   SKSKGKRRLYVGSQALGFRRDLMEVLS  87



>ref|XP_011097012.1| PREDICTED: actin-related protein 4 isoform X1 [Sesamum indicum]
Length=435

 Score =   137 bits (345),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 77/87 (89%), Positives = 81/87 (93%), Gaps = 0/87 (0%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsapd  236
            MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPS+VGSIDQME+D+ DN D NSGS P+
Sbjct  1    MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSVVGSIDQMEIDDADNSDKNSGSGPE  60

Query  237  sKSKGKRKLYVGSQSLGFRRDHMEALS  317
            SKSKGKRKLYVGSQ LGFRRDHME LS
Sbjct  61   SKSKGKRKLYVGSQDLGFRRDHMEVLS  87



>emb|CDP10197.1| unnamed protein product [Coffea canephora]
Length=435

 Score =   136 bits (343),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 80/87 (92%), Positives = 82/87 (94%), Gaps = 0/87 (0%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsapd  236
            MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPS+VGSIDQMEVD PDNPD NSGS PD
Sbjct  1    MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSVVGSIDQMEVDEPDNPDKNSGSVPD  60

Query  237  sKSKGKRKLYVGSQSLGFRRDHMEALS  317
            SKSK KRKLYVGSQ+LGFRRDHME LS
Sbjct  61   SKSKAKRKLYVGSQALGFRRDHMEVLS  87



>emb|CDO98459.1| unnamed protein product [Coffea canephora]
Length=225

 Score =   132 bits (331),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 75/91 (82%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = +3

Query  45   SSSIMYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsg  224
            S + MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPS++GSIDQMEVD  DNP  NSG
Sbjct  86   SPATMYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSVIGSIDQMEVDELDNPYKNSG  145

Query  225  sapdsKSKGKRKLYVGSQSLGFRRDHMEALS  317
            S PDSKSK KRKLY+GSQ+LGFR DH+E LS
Sbjct  146  SVPDSKSKAKRKLYIGSQALGFRWDHVEVLS  176



>ref|XP_004294179.1| PREDICTED: actin-related protein 4-like [Fragaria vesca subsp. 
vesca]
Length=435

 Score =   135 bits (341),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/87 (78%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsapd  236
            MYGGDEVSAIV+DLGSHTCKAGYAGEDAPKAVFPS+VGSIDQMEVD  DN  +    +  
Sbjct  1    MYGGDEVSAIVIDLGSHTCKAGYAGEDAPKAVFPSVVGSIDQMEVDETDNSGSADPKSDS  60

Query  237  sKSKGKRKLYVGSQSLGFRRDHMEALS  317
             K+KGKRKLYVGSQ+LG+RRDHME LS
Sbjct  61   EKAKGKRKLYVGSQALGYRRDHMEVLS  87



>gb|KCW83834.1| hypothetical protein EUGRSUZ_B007041, partial [Eucalyptus grandis]
Length=118

 Score =   127 bits (319),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 72/97 (74%), Positives = 81/97 (84%), Gaps = 10/97 (10%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsapd  236
            MYGGDEVSAIV+DLGSHTCKAGYAGEDAPKAVFPS+VGSIDQMEVD+  N D NSG+A D
Sbjct  1    MYGGDEVSAIVIDLGSHTCKAGYAGEDAPKAVFPSVVGSIDQMEVDDAANTDTNSGAAMD  60

Query  237  sKS----------KGKRKLYVGSQSLGFRRDHMEALS  317
            +KS          KGKRKLYVGSQ+LG+RRD+ME +S
Sbjct  61   AKSNAKTPDSDKTKGKRKLYVGSQALGYRRDNMEVIS  97



>ref|XP_006362361.1| PREDICTED: actin-related protein 4-like [Solanum tuberosum]
Length=435

 Score =   133 bits (335),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 76/87 (87%), Positives = 83/87 (95%), Gaps = 0/87 (0%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsapd  236
            MYGGDEVSAIV+DLGSHTCKAGYAGEDAPKAVFPS VGS+D+MEVDNPDNP++NSGS PD
Sbjct  1    MYGGDEVSAIVIDLGSHTCKAGYAGEDAPKAVFPSAVGSVDEMEVDNPDNPEDNSGSTPD  60

Query  237  sKSKGKRKLYVGSQSLGFRRDHMEALS  317
             KSKGKRKLYVGSQ+LGFRRDHME +S
Sbjct  61   LKSKGKRKLYVGSQALGFRRDHMEVIS  87



>ref|XP_009612118.1| PREDICTED: actin-related protein 4 isoform X1 [Nicotiana tomentosiformis]
Length=435

 Score =   133 bits (334),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 78/87 (90%), Positives = 84/87 (97%), Gaps = 0/87 (0%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsapd  236
            MYGGDEVSAIV+DLGSHTCKAGYAGEDAPKAVFPSIVGS+DQMEVD PDNP++NSGSAPD
Sbjct  1    MYGGDEVSAIVIDLGSHTCKAGYAGEDAPKAVFPSIVGSVDQMEVDYPDNPEDNSGSAPD  60

Query  237  sKSKGKRKLYVGSQSLGFRRDHMEALS  317
            SKSKGKR+LYVGSQ+LGFRRD ME LS
Sbjct  61   SKSKGKRRLYVGSQALGFRRDLMEVLS  87



>ref|XP_004252241.1| PREDICTED: actin-related protein 4 [Solanum lycopersicum]
Length=435

 Score =   133 bits (334),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 77/87 (89%), Positives = 84/87 (97%), Gaps = 0/87 (0%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsapd  236
            MYGGDEVSAIV+DLGSHTCKAGYAGEDAPKAVFPS VGS+D+MEVDNPDNP++NSGSAPD
Sbjct  1    MYGGDEVSAIVIDLGSHTCKAGYAGEDAPKAVFPSAVGSVDEMEVDNPDNPEDNSGSAPD  60

Query  237  sKSKGKRKLYVGSQSLGFRRDHMEALS  317
             KSKGKRKLYVGSQ+LGFRRDHME +S
Sbjct  61   LKSKGKRKLYVGSQALGFRRDHMEVIS  87



>emb|CBI15427.3| unnamed protein product [Vitis vinifera]
Length=176

 Score =   126 bits (317),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 70/96 (73%), Positives = 76/96 (79%), Gaps = 9/96 (9%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsa--  230
            MYGGDEVSAIV+DLGSHTCKAGYAGEDAPKAVFPS+VGSIDQMEVD+P N +N+      
Sbjct  1    MYGGDEVSAIVIDLGSHTCKAGYAGEDAPKAVFPSVVGSIDQMEVDDPANTENSGSGNDS  60

Query  231  -------pdsKSKGKRKLYVGSQSLGFRRDHMEALS  317
                      KSKGKRKLYVGSQ+LG RRDHME LS
Sbjct  61   KNTGRPFDSEKSKGKRKLYVGSQALGHRRDHMEVLS  96



>ref|XP_010094706.1| hypothetical protein L484_003014 [Morus notabilis]
 gb|EXB56752.1| hypothetical protein L484_003014 [Morus notabilis]
Length=171

 Score =   126 bits (316),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 72/97 (74%), Positives = 80/97 (82%), Gaps = 10/97 (10%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsapd  236
            MYGGDEVSAIV+DLGSHTCKAGYAGEDAPKAVFPS+VGSIDQMEVD+  N + NSGSA +
Sbjct  1    MYGGDEVSAIVIDLGSHTCKAGYAGEDAPKAVFPSVVGSIDQMEVDDSANAEKNSGSAVE  60

Query  237  sKS----------KGKRKLYVGSQSLGFRRDHMEALS  317
            SK+          KG RKLYVGSQ+LGFRRD+ME LS
Sbjct  61   SKNNAKAGDSEKPKGSRKLYVGSQALGFRRDYMEVLS  97



>gb|KHN01603.1| Actin-related protein 4 [Glycine soja]
Length=247

 Score =   127 bits (318),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 78/98 (80%), Gaps = 11/98 (11%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEV-----------dnpd  203
            MYGGDEVSAIV+DLGSHTCKAGYAGEDAPKAVFPS+VG+IDQM+V             P+
Sbjct  1    MYGGDEVSAIVIDLGSHTCKAGYAGEDAPKAVFPSVVGAIDQMDVDEADNGEKNPGSAPE  60

Query  204  npdnnsgsapdsKSKGKRKLYVGSQSLGFRRDHMEALS  317
            + +NN  +A   K+KGKRKLYVGSQSLG+RRDHME LS
Sbjct  61   SNNNNVRNADSDKAKGKRKLYVGSQSLGYRRDHMEVLS  98



>ref|XP_006584852.1| PREDICTED: actin-related protein 4 isoform X2 [Glycine max]
Length=232

 Score =   126 bits (317),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 71/87 (82%), Gaps = 4/87 (5%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsapd  236
            MYGGDEVSAIV+DLGSHTCKAGYAGEDAPKAVFPS+VG+IDQM++    +   +      
Sbjct  1    MYGGDEVSAIVIDLGSHTCKAGYAGEDAPKAVFPSVVGAIDQMDI----DGTADINDENS  56

Query  237  sKSKGKRKLYVGSQSLGFRRDHMEALS  317
             K+KGK KLYVGSQSLG+RRDHME LS
Sbjct  57   DKTKGKCKLYVGSQSLGYRRDHMEVLS  83



>ref|XP_008226362.1| PREDICTED: actin-related protein 4 [Prunus mume]
Length=442

 Score =   130 bits (326),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 76/95 (80%), Gaps = 8/95 (8%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpd--------  212
            MYGGDEVSAIV+DLGSHTCKAGYAGEDAPKAVFPS+VGSIDQMEV+     +        
Sbjct  1    MYGGDEVSAIVLDLGSHTCKAGYAGEDAPKAVFPSVVGSIDQMEVETETENNSGPAVDPK  60

Query  213  nnsgsapdsKSKGKRKLYVGSQSLGFRRDHMEALS  317
            +NS S    K+KGKRKLYVGSQ+LG+RRDHME LS
Sbjct  61   SNSKSLDSDKAKGKRKLYVGSQALGYRRDHMEVLS  95



>ref|XP_009344621.1| PREDICTED: actin-related protein 4-like [Pyrus x bretschneideri]
Length=444

 Score =   129 bits (325),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 71/96 (74%), Positives = 77/96 (80%), Gaps = 9/96 (9%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpd--------  212
            MYGGDEVSAIV+DLGSHTCKAGYAGEDAPKAVFPS+VGSIDQMEVD  +  +        
Sbjct  1    MYGGDEVSAIVLDLGSHTCKAGYAGEDAPKAVFPSVVGSIDQMEVDATEMENNSGSAVDP  60

Query  213  -nnsgsapdsKSKGKRKLYVGSQSLGFRRDHMEALS  317
             NNS S    K+KGKRKLYVGSQSLG+RRDHME LS
Sbjct  61   KNNSKSLDSDKAKGKRKLYVGSQSLGYRRDHMEVLS  96



>ref|XP_009796964.1| PREDICTED: actin-related protein 4A-like [Nicotiana sylvestris]
Length=141

 Score =   123 bits (308),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 73/82 (89%), Positives = 81/82 (99%), Gaps = 0/82 (0%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsapd  236
            MYGGDEVSAIV+DLGSHTCKAGYAGEDAPKAVFPS+VGS+DQ+EVDNPDNP++NSGSAPD
Sbjct  1    MYGGDEVSAIVIDLGSHTCKAGYAGEDAPKAVFPSVVGSVDQVEVDNPDNPEDNSGSAPD  60

Query  237  sKSKGKRKLYVGSQSLGFRRDH  302
            SKSKGKR+LYVGSQ+LGFRR H
Sbjct  61   SKSKGKRRLYVGSQALGFRRSH  82



>ref|XP_002511960.1| protein binding protein, putative [Ricinus communis]
 gb|EEF50629.1| protein binding protein, putative [Ricinus communis]
Length=442

 Score =   129 bits (323),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 67/94 (71%), Positives = 76/94 (81%), Gaps = 7/94 (7%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsapd  236
            MYGGDEVSAIV+DLGSHTCKAGYAGEDAPKAVFPS+VGSIDQME+D+  N + N  +   
Sbjct  1    MYGGDEVSAIVIDLGSHTCKAGYAGEDAPKAVFPSVVGSIDQMELDDTTNNEKNPSADSK  60

Query  237  s-------KSKGKRKLYVGSQSLGFRRDHMEALS  317
            +       K KGKRKLYVGSQ++GFRRDHME LS
Sbjct  61   NNNGKDSEKGKGKRKLYVGSQAVGFRRDHMEVLS  94



>ref|XP_011014466.1| PREDICTED: actin-related protein 4-like [Populus euphratica]
Length=441

 Score =   128 bits (322),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 66/93 (71%), Positives = 76/93 (82%), Gaps = 6/93 (6%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsapd  236
            MYGGDEVSAIV+DLGSHTCKAGYAGEDAPKAVFPS+VGSIDQM+VD+  + + N+     
Sbjct  1    MYGGDEVSAIVIDLGSHTCKAGYAGEDAPKAVFPSVVGSIDQMDVDDMTSNEKNAAVDSK  60

Query  237  s------KSKGKRKLYVGSQSLGFRRDHMEALS  317
            +      K KGKRKL+VGSQ+LGFRRDHME LS
Sbjct  61   NNVKDSEKGKGKRKLFVGSQALGFRRDHMEVLS  93



>ref|XP_002317939.1| Actin-related family protein [Populus trichocarpa]
 gb|EEE96159.1| Actin-related family protein [Populus trichocarpa]
Length=441

 Score =   128 bits (322),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 66/93 (71%), Positives = 76/93 (82%), Gaps = 6/93 (6%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsapd  236
            MYGGDEVSAIV+DLGSHTCKAGYAGEDAPKAVFPS+VGSIDQM+VD+  + + N+     
Sbjct  1    MYGGDEVSAIVIDLGSHTCKAGYAGEDAPKAVFPSVVGSIDQMDVDDMTSNEKNAAVDSK  60

Query  237  s------KSKGKRKLYVGSQSLGFRRDHMEALS  317
            +      K KGKRKL+VGSQ+LGFRRDHME LS
Sbjct  61   NNVKDSEKGKGKRKLFVGSQALGFRRDHMEVLS  93



>ref|XP_003521054.1| PREDICTED: actin-related protein 4-like [Glycine max]
 gb|KHN31101.1| Actin-related protein 4 [Glycine soja]
Length=445

 Score =   128 bits (322),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 68/97 (70%), Positives = 76/97 (78%), Gaps = 10/97 (10%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEV----------dnpdn  206
            MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPS+VG+IDQM+V           +   
Sbjct  1    MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSVVGAIDQMDVDEADNGENNSASAPE  60

Query  207  pdnnsgsapdsKSKGKRKLYVGSQSLGFRRDHMEALS  317
             +NN  +A   K+KGKRKLYVGSQSLG+RRDHME LS
Sbjct  61   SNNNVRNADSDKTKGKRKLYVGSQSLGYRRDHMEVLS  97



>ref|XP_006485767.1| PREDICTED: actin-related protein 4-like [Citrus sinensis]
Length=441

 Score =   128 bits (322),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 72/94 (77%), Positives = 81/94 (86%), Gaps = 7/94 (7%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsapd  236
            MYGGDEVSAIV+DLGSHTCKAGYAGEDAPKAVFPS+VG+IDQM++D+  N + NSGSA D
Sbjct  1    MYGGDEVSAIVIDLGSHTCKAGYAGEDAPKAVFPSVVGAIDQMDIDDSANAERNSGSAID  60

Query  237  sKS-------KGKRKLYVGSQSLGFRRDHMEALS  317
            SK+       KGKRKLYVG+QSLGFRRDHME LS
Sbjct  61   SKNNVDSNKGKGKRKLYVGTQSLGFRRDHMEVLS  94



>ref|XP_008386419.1| PREDICTED: actin-related protein 4-like [Malus domestica]
Length=349

 Score =   127 bits (318),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 68/96 (71%), Positives = 76/96 (79%), Gaps = 9/96 (9%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpd--------  212
            MYGGDEVSAI++DLGSHTCKAGYAGED PKAVFPS+VGSIDQMEVD  +  +        
Sbjct  1    MYGGDEVSAIILDLGSHTCKAGYAGEDVPKAVFPSVVGSIDQMEVDATEMENNSGPAVEP  60

Query  213  -nnsgsapdsKSKGKRKLYVGSQSLGFRRDHMEALS  317
             NNS S    K+KGKRKLYVGSQ+LG+RRDHME LS
Sbjct  61   KNNSKSLDSDKAKGKRKLYVGSQALGYRRDHMEVLS  96



>gb|KDP20102.1| hypothetical protein JCGZ_05871 [Jatropha curcas]
Length=441

 Score =   127 bits (320),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 73/93 (78%), Gaps = 6/93 (6%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnn------  218
            MYGGDEVSAIV+DLGSHTCKAGYAGEDAPKAVFPS+VGSIDQMEVD+  N D        
Sbjct  1    MYGGDEVSAIVIDLGSHTCKAGYAGEDAPKAVFPSVVGSIDQMEVDDTANNDKTSSIDSK  60

Query  219  sgsapdsKSKGKRKLYVGSQSLGFRRDHMEALS  317
            +      K K KRKLYVGSQ++GFRRDHME LS
Sbjct  61   NNIKDSEKGKAKRKLYVGSQAVGFRRDHMEVLS  93



>ref|XP_002275561.2| PREDICTED: actin-related protein 4 [Vitis vinifera]
Length=444

 Score =   127 bits (320),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/96 (73%), Positives = 76/96 (79%), Gaps = 9/96 (9%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsa--  230
            MYGGDEVSAIV+DLGSHTCKAGYAGEDAPKAVFPS+VGSIDQMEVD+P N +N+      
Sbjct  1    MYGGDEVSAIVIDLGSHTCKAGYAGEDAPKAVFPSVVGSIDQMEVDDPANTENSGSGNDS  60

Query  231  -------pdsKSKGKRKLYVGSQSLGFRRDHMEALS  317
                      KSKGKRKLYVGSQ+LG RRDHME LS
Sbjct  61   KNTGRPFDSEKSKGKRKLYVGSQALGHRRDHMEVLS  96



>ref|XP_003529017.1| PREDICTED: actin-related protein 4-like [Glycine max]
Length=446

 Score =   127 bits (319),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 78/98 (80%), Gaps = 11/98 (11%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEV-----------dnpd  203
            MYGGDEVSAIV+DLGSHTCKAGYAGEDAPKAVFPS+VG+IDQM+V             P+
Sbjct  1    MYGGDEVSAIVIDLGSHTCKAGYAGEDAPKAVFPSVVGAIDQMDVDEADNGEKNPGSAPE  60

Query  204  npdnnsgsapdsKSKGKRKLYVGSQSLGFRRDHMEALS  317
            + +NN  +A   K+KGKRKLYVGSQSLG+RRDHME LS
Sbjct  61   SNNNNVRNADSDKAKGKRKLYVGSQSLGYRRDHMEVLS  98



>ref|XP_009339362.1| PREDICTED: actin-related protein 4-like [Pyrus x bretschneideri]
 ref|XP_009339363.1| PREDICTED: actin-related protein 4-like [Pyrus x bretschneideri]
Length=444

 Score =   127 bits (319),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 69/96 (72%), Positives = 77/96 (80%), Gaps = 9/96 (9%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpd--------  212
            MYGGDEVSAIV+DLGSHTCKAGYAGEDAPKAVFPS+VGSIDQMEVD  +  +        
Sbjct  1    MYGGDEVSAIVLDLGSHTCKAGYAGEDAPKAVFPSVVGSIDQMEVDATEMENNSGPAVDP  60

Query  213  -nnsgsapdsKSKGKRKLYVGSQSLGFRRDHMEALS  317
             NNS S    K+KGKRKL+VGSQ+LG+RRDHME LS
Sbjct  61   KNNSKSLDSDKAKGKRKLFVGSQALGYRRDHMEVLS  96



>ref|XP_008368454.1| PREDICTED: actin-related protein 4 [Malus domestica]
Length=444

 Score =   127 bits (318),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 70/96 (73%), Positives = 76/96 (79%), Gaps = 9/96 (9%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpd--------  212
            MYGGDEVSAIV+DLGSHTCKAGYAGE APKAVFPS+VGSIDQMEVD  +  +        
Sbjct  1    MYGGDEVSAIVLDLGSHTCKAGYAGEXAPKAVFPSVVGSIDQMEVDATEXENNSGSAVDP  60

Query  213  -nnsgsapdsKSKGKRKLYVGSQSLGFRRDHMEALS  317
             NNS S    K+KGKRKLYVGSQSLG+RRDHME LS
Sbjct  61   KNNSKSLDXDKAKGKRKLYVGSQSLGYRRDHMEVLS  96



>ref|XP_010031801.1| PREDICTED: actin-related protein 4 [Eucalyptus grandis]
Length=445

 Score =   126 bits (317),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 72/97 (74%), Positives = 81/97 (84%), Gaps = 10/97 (10%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsapd  236
            MYGGDEVSAIV+DLGSHTCKAGYAGEDAPKAVFPS+VGSIDQMEVD+  N D NSG+A D
Sbjct  1    MYGGDEVSAIVIDLGSHTCKAGYAGEDAPKAVFPSVVGSIDQMEVDDAANTDTNSGAAMD  60

Query  237  sKS----------KGKRKLYVGSQSLGFRRDHMEALS  317
            +KS          KGKRKLYVGSQ+LG+RRD+ME +S
Sbjct  61   AKSNAKTPDSDKTKGKRKLYVGSQALGYRRDNMEVIS  97



>ref|XP_003530654.1| PREDICTED: actin-related protein 4 isoform X1 [Glycine max]
 gb|KHN16587.1| Actin-related protein 4 [Glycine soja]
Length=431

 Score =   126 bits (316),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 71/87 (82%), Gaps = 4/87 (5%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsapd  236
            MYGGDEVSAIV+DLGSHTCKAGYAGEDAPKAVFPS+VG+IDQM++    +   +      
Sbjct  1    MYGGDEVSAIVIDLGSHTCKAGYAGEDAPKAVFPSVVGAIDQMDI----DGTADINDENS  56

Query  237  sKSKGKRKLYVGSQSLGFRRDHMEALS  317
             K+KGK KLYVGSQSLG+RRDHME LS
Sbjct  57   DKTKGKCKLYVGSQSLGYRRDHMEVLS  83



>ref|XP_007014880.1| Actin-related protein 4 isoform 1 [Theobroma cacao]
 gb|EOY32499.1| Actin-related protein 4 isoform 1 [Theobroma cacao]
Length=438

 Score =   126 bits (316),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 74/90 (82%), Gaps = 3/90 (3%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEV---dnpdnpdnnsgs  227
            MYGGDEVSAIV+DLGSHTCKAGYAGEDAPKAVFPS+VGSIDQM+    +  +    N+ +
Sbjct  1    MYGGDEVSAIVIDLGSHTCKAGYAGEDAPKAVFPSVVGSIDQMDADDDNENNGSKTNNNN  60

Query  228  apdsKSKGKRKLYVGSQSLGFRRDHMEALS  317
               +K +GKR+LYVGSQ+LGFRRDHME LS
Sbjct  61   VDSNKPRGKRRLYVGSQALGFRRDHMEVLS  90



>ref|XP_010260462.1| PREDICTED: actin-related protein 4 [Nelumbo nucifera]
Length=445

 Score =   125 bits (315),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 66/97 (68%), Positives = 73/97 (75%), Gaps = 10/97 (10%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVd----------npdn  206
            MYGGDEVSAIV+DLGSHTCKAGYAGEDAPKAVFPS+VGSIDQMEVD             +
Sbjct  1    MYGGDEVSAIVIDLGSHTCKAGYAGEDAPKAVFPSVVGSIDQMEVDDAVKSERDSGTAPD  60

Query  207  pdnnsgsapdsKSKGKRKLYVGSQSLGFRRDHMEALS  317
              N   +    K+K KRKLYVGSQ+LG+RRDHME LS
Sbjct  61   SKNIVKTFDSDKTKTKRKLYVGSQALGYRRDHMEVLS  97



>ref|NP_177531.1| actin-related protein 4A [Arabidopsis thaliana]
 sp|Q9C9B2.1|ARP4A_ARATH RecName: Full=Actin-related protein 4A; AltName: Full=Actin-related 
protein 5 [Arabidopsis thaliana]
 gb|AAG52523.1|AC016662_17 putative actin; 83885-82991 [Arabidopsis thaliana]
 tpg|DAA00029.1| TPA_exp: actin-related protein 4a; AtARP4a [Arabidopsis thaliana]
 gb|ABK32130.1| At1g73910 [Arabidopsis thaliana]
 gb|AEE35523.1| actin-related protein 4A [Arabidopsis thaliana]
Length=145

 Score =   120 bits (300),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/87 (70%), Positives = 67/87 (77%), Gaps = 0/87 (0%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsapd  236
            MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPS+VG+ID   +D  D  +    +   
Sbjct  1    MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSVVGAIDGNGMDIDDAANTTEDAKES  60

Query  237  sKSKGKRKLYVGSQSLGFRRDHMEALS  317
             K KGKRKLY GSQ+L FRRD ME LS
Sbjct  61   DKEKGKRKLYTGSQALNFRRDQMEILS  87



>ref|XP_004510131.1| PREDICTED: actin-related protein 4-like [Cicer arietinum]
Length=338

 Score =   124 bits (310),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 68/96 (71%), Positives = 76/96 (79%), Gaps = 9/96 (9%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpd---------np  209
            MYGGDEVSAIV+DLGSHTCKAGYAGEDAPKAVFPS+VG+IDQM+VD  D           
Sbjct  1    MYGGDEVSAIVIDLGSHTCKAGYAGEDAPKAVFPSVVGAIDQMDVDESDDAEKNSGSGES  60

Query  210  dnnsgsapdsKSKGKRKLYVGSQSLGFRRDHMEALS  317
             NN+ +A   K+KGKRKLYVGSQSLG+RRD ME LS
Sbjct  61   RNNNRNADGDKAKGKRKLYVGSQSLGYRRDFMEVLS  96



>gb|KJB83475.1| hypothetical protein B456_013G249800 [Gossypium raimondii]
Length=405

 Score =   124 bits (312),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/90 (69%), Positives = 74/90 (82%), Gaps = 3/90 (3%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEV---dnpdnpdnnsgs  227
            MYGGDEVSAIV+DLGSHTCKAGYAGEDAPKAVFPS+VG IDQM+       ++ + N+ +
Sbjct  1    MYGGDEVSAIVIDLGSHTCKAGYAGEDAPKAVFPSVVGCIDQMDADDDKENNDSETNNNN  60

Query  228  apdsKSKGKRKLYVGSQSLGFRRDHMEALS  317
               +K KGKR+LYVGSQ+LGFRRDHME +S
Sbjct  61   VDSNKPKGKRRLYVGSQALGFRRDHMEVVS  90



>gb|ACJ85865.1| unknown [Medicago truncatula]
Length=298

 Score =   122 bits (306),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 76/96 (79%), Gaps = 9/96 (9%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnns-----  221
            MYGGDEVSAIV+DLGSHTCKAGYAGEDAPKAVFPS+VG+IDQM+VD  DN + NS     
Sbjct  1    MYGGDEVSAIVIDLGSHTCKAGYAGEDAPKAVFPSVVGAIDQMDVDESDNAEKNSGSGES  60

Query  222  ----gsapdsKSKGKRKLYVGSQSLGFRRDHMEALS  317
                 +    K+KGKRKLYVGSQSLG+RRD ME +S
Sbjct  61   KNNIRNVDGDKAKGKRKLYVGSQSLGYRRDFMEVVS  96



>ref|XP_004515316.1| PREDICTED: actin-related protein 4-like isoform X2 [Cicer arietinum]
Length=444

 Score =   124 bits (311),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 68/96 (71%), Positives = 76/96 (79%), Gaps = 9/96 (9%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpd---------np  209
            MYGGDEVSAIV+DLGSHTCKAGYAGEDAPKAVFPS+VG+IDQM+VD  D           
Sbjct  1    MYGGDEVSAIVIDLGSHTCKAGYAGEDAPKAVFPSVVGAIDQMDVDESDDAEKNSGSGES  60

Query  210  dnnsgsapdsKSKGKRKLYVGSQSLGFRRDHMEALS  317
             NN+ +A   K+KGKRKLYVGSQSLG+RRD ME LS
Sbjct  61   KNNNRNADGDKAKGKRKLYVGSQSLGYRRDFMEVLS  96



>gb|KHG07777.1| Actin-related 4 -like protein [Gossypium arboreum]
Length=421

 Score =   124 bits (310),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 62/90 (69%), Positives = 74/90 (82%), Gaps = 3/90 (3%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEV---dnpdnpdnnsgs  227
            MYGGDEVSAIV+DLGSHTCKAGYAGEDAPKAVFPS+VG IDQM+       ++ + N+ +
Sbjct  1    MYGGDEVSAIVIDLGSHTCKAGYAGEDAPKAVFPSVVGCIDQMDADDDKENNDSETNNNN  60

Query  228  apdsKSKGKRKLYVGSQSLGFRRDHMEALS  317
               +K KGKR+LYVGSQ+LGFRRDHME +S
Sbjct  61   VDSNKPKGKRRLYVGSQALGFRRDHMEVVS  90



>ref|XP_004515315.1| PREDICTED: actin-related protein 4-like isoform X1 [Cicer arietinum]
Length=445

 Score =   124 bits (311),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 68/96 (71%), Positives = 76/96 (79%), Gaps = 9/96 (9%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpd---------np  209
            MYGGDEVSAIV+DLGSHTCKAGYAGEDAPKAVFPS+VG+IDQM+VD  D           
Sbjct  1    MYGGDEVSAIVIDLGSHTCKAGYAGEDAPKAVFPSVVGAIDQMDVDESDDAEKNSGSGES  60

Query  210  dnnsgsapdsKSKGKRKLYVGSQSLGFRRDHMEALS  317
             NN+ +A   K+KGKRKLYVGSQSLG+RRD ME LS
Sbjct  61   KNNNRNADGDKAKGKRKLYVGSQSLGYRRDFMEVLS  96



>gb|KJB83478.1| hypothetical protein B456_013G249800 [Gossypium raimondii]
Length=439

 Score =   124 bits (310),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 62/90 (69%), Positives = 74/90 (82%), Gaps = 3/90 (3%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEV---dnpdnpdnnsgs  227
            MYGGDEVSAIV+DLGSHTCKAGYAGEDAPKAVFPS+VG IDQM+       ++ + N+ +
Sbjct  1    MYGGDEVSAIVIDLGSHTCKAGYAGEDAPKAVFPSVVGCIDQMDADDDKENNDSETNNNN  60

Query  228  apdsKSKGKRKLYVGSQSLGFRRDHMEALS  317
               +K KGKR+LYVGSQ+LGFRRDHME +S
Sbjct  61   VDSNKPKGKRRLYVGSQALGFRRDHMEVVS  90



>gb|KJB83474.1| hypothetical protein B456_013G249800 [Gossypium raimondii]
 gb|KJB83477.1| hypothetical protein B456_013G249800 [Gossypium raimondii]
Length=438

 Score =   124 bits (310),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 62/90 (69%), Positives = 74/90 (82%), Gaps = 3/90 (3%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEV---dnpdnpdnnsgs  227
            MYGGDEVSAIV+DLGSHTCKAGYAGEDAPKAVFPS+VG IDQM+       ++ + N+ +
Sbjct  1    MYGGDEVSAIVIDLGSHTCKAGYAGEDAPKAVFPSVVGCIDQMDADDDKENNDSETNNNN  60

Query  228  apdsKSKGKRKLYVGSQSLGFRRDHMEALS  317
               +K KGKR+LYVGSQ+LGFRRDHME +S
Sbjct  61   VDSNKPKGKRRLYVGSQALGFRRDHMEVVS  90



>ref|XP_008811208.1| PREDICTED: actin-related protein 4 [Phoenix dactylifera]
Length=445

 Score =   123 bits (309),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 65/97 (67%), Positives = 73/97 (75%), Gaps = 10/97 (10%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsap-  233
            MYGGDEVSAIV+DLGSHTCKAGYAGEDAPKAVFPS+VGSIDQ+E +N    +  S  A  
Sbjct  1    MYGGDEVSAIVIDLGSHTCKAGYAGEDAPKAVFPSVVGSIDQVEANNDVKSEKESEPASD  60

Query  234  ---------dsKSKGKRKLYVGSQSLGFRRDHMEALS  317
                       KSK KRKLYVGSQ+LG+RRDHME +S
Sbjct  61   SKNGVKPLDSDKSKAKRKLYVGSQALGYRRDHMEVMS  97



>gb|AAM53245.1|AF507913_1 actin-related protein 4A [Arabidopsis thaliana]
Length=146

 Score =   117 bits (293),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 66/86 (77%), Gaps = 0/86 (0%)
 Frame = +3

Query  60   YGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsapds  239
            YGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPS+VG+ID   +D  D  +    +    
Sbjct  3    YGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSVVGAIDGNGMDIDDAANTTEDAKESD  62

Query  240  KSKGKRKLYVGSQSLGFRRDHMEALS  317
            K KGKRKLY GSQ+L FRRD ME LS
Sbjct  63   KEKGKRKLYTGSQALNFRRDQMEILS  88



>gb|KEH19612.1| actin-related protein ARP4, partial [Medicago truncatula]
Length=429

 Score =   122 bits (307),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 69/96 (72%), Positives = 77/96 (80%), Gaps = 9/96 (9%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsapd  236
            MYGGDEVSAIV+DLGSHTCKAGYAGEDAPKAVFPS+VG+IDQM+VD  DN + NSGS   
Sbjct  1    MYGGDEVSAIVIDLGSHTCKAGYAGEDAPKAVFPSVVGAIDQMDVDESDNAEKNSGSGES  60

Query  237  s---------KSKGKRKLYVGSQSLGFRRDHMEALS  317
                      K+KGKRKLYVGSQSLG+RRD ME +S
Sbjct  61   KNNIRNVDGDKAKGKRKLYVGSQSLGYRRDFMEVVS  96



>ref|XP_010539996.1| PREDICTED: actin-related protein 4 [Tarenaya hassleriana]
Length=441

 Score =   122 bits (306),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 66/93 (71%), Positives = 78/93 (84%), Gaps = 6/93 (6%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsapd  236
            MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPS+VG+ID+M++D+    ++N+  + +
Sbjct  1    MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSVVGAIDRMDIDDATKANSNTEDSKN  60

Query  237  s-----KSK-GKRKLYVGSQSLGFRRDHMEALS  317
            S     K K GKRKLYVGSQ+LGFRRDHME LS
Sbjct  61   SAVDSDKGKGGKRKLYVGSQALGFRRDHMEILS  93



>ref|XP_008453382.1| PREDICTED: actin-related protein 4 [Cucumis melo]
Length=445

 Score =   122 bits (306),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 68/97 (70%), Positives = 79/97 (81%), Gaps = 10/97 (10%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsapd  236
            MYGGDEVSAIV+DLGSHTCKAGYAGEDAPKAVFPS+VG  D+M+VD+  + + NSGSA +
Sbjct  1    MYGGDEVSAIVIDLGSHTCKAGYAGEDAPKAVFPSVVGCTDEMDVDDTTSTEKNSGSAGE  60

Query  237  sKS----------KGKRKLYVGSQSLGFRRDHMEALS  317
            +KS          KGKRKLYVGSQ+LGFRRD+ME LS
Sbjct  61   AKSNAKTLDSDKGKGKRKLYVGSQALGFRRDNMEVLS  97



>ref|XP_004138236.1| PREDICTED: actin-related protein 4-like [Cucumis sativus]
 ref|XP_004154920.1| PREDICTED: actin-related protein 4-like [Cucumis sativus]
 gb|KGN63807.1| hypothetical protein Csa_1G021970 [Cucumis sativus]
Length=445

 Score =   122 bits (306),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 69/97 (71%), Positives = 79/97 (81%), Gaps = 10/97 (10%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsapd  236
            MYGGDEVSAIV+DLGSHTCKAGYAGEDAPKAVFPS+VG  D+M+VD+  + + NSGSA +
Sbjct  1    MYGGDEVSAIVIDLGSHTCKAGYAGEDAPKAVFPSVVGCTDEMDVDDTTSTEKNSGSAGE  60

Query  237  sKS----------KGKRKLYVGSQSLGFRRDHMEALS  317
            SKS          KGKRKLYVGSQ+LGFRRD+ME LS
Sbjct  61   SKSNAKTLDSDKGKGKRKLYVGSQALGFRRDNMEVLS  97



>gb|AES98265.2| actin-related protein ARP4 [Medicago truncatula]
Length=445

 Score =   122 bits (306),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 74/96 (77%), Gaps = 9/96 (9%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpd---------np  209
            MYGGDEVSAIV+DLGSHTCKAGYAGEDAPKAVFPS+VG+IDQM+VD  D           
Sbjct  1    MYGGDEVSAIVIDLGSHTCKAGYAGEDAPKAVFPSVVGAIDQMDVDESDDAEKNSGSGES  60

Query  210  dnnsgsapdsKSKGKRKLYVGSQSLGFRRDHMEALS  317
             NN  +    K+KGKRKLYVGSQSLG+RRD ME +S
Sbjct  61   KNNIRNVDGDKAKGKRKLYVGSQSLGYRRDFMEVVS  96



>ref|XP_003615306.1| Actin-related protein [Medicago truncatula]
Length=444

 Score =   122 bits (306),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 74/96 (77%), Gaps = 9/96 (9%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpd---------np  209
            MYGGDEVSAIV+DLGSHTCKAGYAGEDAPKAVFPS+VG+IDQM+VD  D           
Sbjct  1    MYGGDEVSAIVIDLGSHTCKAGYAGEDAPKAVFPSVVGAIDQMDVDESDDAEKNSGSGES  60

Query  210  dnnsgsapdsKSKGKRKLYVGSQSLGFRRDHMEALS  317
             NN  +    K+KGKRKLYVGSQSLG+RRD ME +S
Sbjct  61   KNNIRNVDGDKAKGKRKLYVGSQSLGYRRDFMEVVS  96



>gb|ACJ85813.1| unknown [Medicago truncatula]
 gb|AFK47724.1| unknown [Medicago truncatula]
Length=445

 Score =   122 bits (306),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 74/96 (77%), Gaps = 9/96 (9%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpd---------np  209
            MYGGDEVSAIV+DLGSHTCKAGYAGEDAPKAVFPS+VG+IDQM+VD  D           
Sbjct  1    MYGGDEVSAIVIDLGSHTCKAGYAGEDAPKAVFPSVVGAIDQMDVDESDDAEKNSGSGES  60

Query  210  dnnsgsapdsKSKGKRKLYVGSQSLGFRRDHMEALS  317
             NN  +    K+KGKRKLYVGSQSLG+RRD ME +S
Sbjct  61   KNNIRNVDGDKAKGKRKLYVGSQSLGYRRDFMEVVS  96



>gb|AES98264.2| actin-related protein ARP4 [Medicago truncatula]
Length=419

 Score =   122 bits (305),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 74/96 (77%), Gaps = 9/96 (9%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpd---------np  209
            MYGGDEVSAIV+DLGSHTCKAGYAGEDAPKAVFPS+VG+IDQM+VD  D           
Sbjct  1    MYGGDEVSAIVIDLGSHTCKAGYAGEDAPKAVFPSVVGAIDQMDVDESDDAEKNSGSGES  60

Query  210  dnnsgsapdsKSKGKRKLYVGSQSLGFRRDHMEALS  317
             NN  +    K+KGKRKLYVGSQSLG+RRD ME +S
Sbjct  61   KNNIRNVDGDKAKGKRKLYVGSQSLGYRRDFMEVVS  96



>gb|KEH28123.1| actin-related protein ARP4 [Medicago truncatula]
Length=417

 Score =   122 bits (305),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 74/96 (77%), Gaps = 9/96 (9%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpd---------np  209
            MYGGDEVSAIV+DLGSHTCKAGYAGEDAPKAVFPS+VG+IDQM+VD  D           
Sbjct  1    MYGGDEVSAIVIDLGSHTCKAGYAGEDAPKAVFPSVVGAIDQMDVDESDDAEKNSGSGES  60

Query  210  dnnsgsapdsKSKGKRKLYVGSQSLGFRRDHMEALS  317
             NN  +    K+KGKRKLYVGSQSLG+RRD ME +S
Sbjct  61   KNNIRNVDGDKAKGKRKLYVGSQSLGYRRDFMEVVS  96



>ref|XP_010677969.1| PREDICTED: actin-related protein 4 [Beta vulgaris subsp. vulgaris]
Length=445

 Score =   122 bits (305),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 63/97 (65%), Positives = 72/97 (74%), Gaps = 10/97 (10%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVd----------npdn  206
            MYGGDEVSAIV+DLGSHTCKAGYAGEDAPKAVFPS+VG+IDQMEVD             +
Sbjct  1    MYGGDEVSAIVIDLGSHTCKAGYAGEDAPKAVFPSVVGAIDQMEVDIPDNPEKNTGPAPD  60

Query  207  pdnnsgsapdsKSKGKRKLYVGSQSLGFRRDHMEALS  317
             ++   +    K K KRK YVGSQSLG+RRD+ME LS
Sbjct  61   SNSTVKTFESEKEKSKRKFYVGSQSLGYRRDNMEVLS  97



>ref|XP_006305904.1| hypothetical protein CARUB_v10011098mg, partial [Capsella rubella]
 gb|EOA38802.1| hypothetical protein CARUB_v10011098mg, partial [Capsella rubella]
Length=296

 Score =   119 bits (298),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 70/93 (75%), Gaps = 6/93 (6%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEV------dnpdnpdnn  218
            MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPS++G++D +E           N ++ 
Sbjct  1    MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSVIGAVDGVEAMDVDVDSTKTNSNSE  60

Query  219  sgsapdsKSKGKRKLYVGSQSLGFRRDHMEALS  317
               A   K KGKRKLYVGSQ+L +RRDHME LS
Sbjct  61   DSKAESEKDKGKRKLYVGSQALSYRRDHMEVLS  93



>ref|XP_009110344.1| PREDICTED: actin-related protein 4 isoform X1 [Brassica rapa]
Length=439

 Score =   120 bits (302),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 70/90 (78%), Gaps = 3/90 (3%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSID---QMEVdnpdnpdnnsgs  227
            MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPS+VG++D    MEVD      N++  
Sbjct  1    MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSVVGAVDGVEAMEVDVDSAKTNSNSE  60

Query  228  apdsKSKGKRKLYVGSQSLGFRRDHMEALS  317
                K KGKRKL VGSQ+L +RRDHME LS
Sbjct  61   DKSEKDKGKRKLCVGSQALNYRRDHMEILS  90



>ref|XP_009110345.1| PREDICTED: actin-related protein 4 isoform X2 [Brassica rapa]
Length=438

 Score =   120 bits (302),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 70/90 (78%), Gaps = 3/90 (3%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSID---QMEVdnpdnpdnnsgs  227
            MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPS+VG++D    MEVD      N++  
Sbjct  1    MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSVVGAVDGVEAMEVDVDSAKTNSNSE  60

Query  228  apdsKSKGKRKLYVGSQSLGFRRDHMEALS  317
                K KGKRKL VGSQ+L +RRDHME LS
Sbjct  61   DKSEKDKGKRKLCVGSQALNYRRDHMEILS  90



>emb|CDX96721.1| BnaA08g22640D [Brassica napus]
Length=438

 Score =   120 bits (302),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 70/90 (78%), Gaps = 3/90 (3%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSID---QMEVdnpdnpdnnsgs  227
            MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPS+VG++D    MEVD      N++  
Sbjct  1    MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSVVGAVDGVEAMEVDVDSAKTNSNSE  60

Query  228  apdsKSKGKRKLYVGSQSLGFRRDHMEALS  317
                K KGKRKL VGSQ+L +RRDHME LS
Sbjct  61   DKSEKDKGKRKLCVGSQALNYRRDHMEILS  90



>ref|XP_006390493.1| hypothetical protein EUTSA_v10018569mg [Eutrema salsugineum]
 gb|ESQ27779.1| hypothetical protein EUTSA_v10018569mg [Eutrema salsugineum]
Length=440

 Score =   120 bits (302),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 76/92 (83%), Gaps = 5/92 (5%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsapd  236
            MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPS+VG+ID M++D+  N ++N+  A +
Sbjct  1    MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSVVGTIDGMDIDDAANANSNTEDANN  60

Query  237  s-----KSKGKRKLYVGSQSLGFRRDHMEALS  317
            +     K KGKRKL+VGSQ+L FRRD ME LS
Sbjct  61   NVVEPDKQKGKRKLFVGSQALNFRRDQMEILS  92



>ref|XP_010940353.1| PREDICTED: actin-related protein 4 [Elaeis guineensis]
Length=445

 Score =   120 bits (301),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 66/97 (68%), Positives = 75/97 (77%), Gaps = 10/97 (10%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsapd  236
            MYGGDEVSAIV+DLGSHTCKAGYAGEDAPKAVFPS+VGSID +E +N    +  S SA D
Sbjct  1    MYGGDEVSAIVIDLGSHTCKAGYAGEDAPKAVFPSVVGSIDHIEANNDVKSEKESESASD  60

Query  237  sKS----------KGKRKLYVGSQSLGFRRDHMEALS  317
            SK+          K KRKLYVGSQ+LG+RRDHME +S
Sbjct  61   SKNGVKPLDSDKPKAKRKLYVGSQALGYRRDHMEVIS  97



>ref|XP_006859060.1| hypothetical protein AMTR_s00068p00196840 [Amborella trichopoda]
 gb|ERN20527.1| hypothetical protein AMTR_s00068p00196840 [Amborella trichopoda]
Length=206

 Score =   117 bits (292),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 62/97 (64%), Positives = 72/97 (74%), Gaps = 10/97 (10%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQ----------MEVdnpdn  206
            MYGGDEVSAIV+DLGSHTCKAGYAGEDAPKAVFPS+VGSI+Q           E ++   
Sbjct  1    MYGGDEVSAIVLDLGSHTCKAGYAGEDAPKAVFPSVVGSIEQSGLDDALKVEKESESVSE  60

Query  207  pdnnsgsapdsKSKGKRKLYVGSQSLGFRRDHMEALS  317
              N   ++   KSK KRKLYVGSQ+LG+RRD+ME LS
Sbjct  61   AKNGIKTSDSDKSKAKRKLYVGSQALGYRRDYMEVLS  97



>ref|XP_010459462.1| PREDICTED: actin-related protein 4-like [Camelina sativa]
Length=439

 Score =   119 bits (299),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 69/91 (76%), Gaps = 4/91 (4%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVd----npdnpdnnsg  224
            MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPS++G++D +E      +    ++   
Sbjct  1    MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSVIGAVDGVEAMDMDVDSTKANSEDS  60

Query  225  sapdsKSKGKRKLYVGSQSLGFRRDHMEALS  317
                 K KGKRKLYVGSQ+L +RRDHME LS
Sbjct  61   KTESEKEKGKRKLYVGSQALSYRRDHMEVLS  91



>gb|EYU44127.1| hypothetical protein MIMGU_mgv1a006688mg [Erythranthe guttata]
Length=435

 Score =   119 bits (299),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 74/87 (85%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsapd  236
            MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPS++GSID+MEVD+ DN D NSG+A D
Sbjct  1    MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSVLGSIDEMEVDDADNSDKNSGTASD  60

Query  237  sKSKGKRKLYVGSQSLGFRRDHMEALS  317
            SKSK KRKLYVG+Q LGFRRDHME LS
Sbjct  61   SKSKSKRKLYVGTQDLGFRRDHMEVLS  87



>ref|XP_010498232.1| PREDICTED: actin-related protein 4-like [Camelina sativa]
Length=439

 Score =   119 bits (299),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 69/91 (76%), Gaps = 4/91 (4%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVd----npdnpdnnsg  224
            MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPS++G++D +E      +    ++   
Sbjct  1    MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSVIGAVDGVEAMDMDVDSTKANSEDS  60

Query  225  sapdsKSKGKRKLYVGSQSLGFRRDHMEALS  317
                 K KGKRKLYVGSQ+L +RRDHME LS
Sbjct  61   KTESEKEKGKRKLYVGSQALSYRRDHMEVLS  91



>ref|XP_003615307.1| Actin-related protein [Medicago truncatula]
Length=445

 Score =   119 bits (299),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 65/96 (68%), Positives = 73/96 (76%), Gaps = 9/96 (9%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpd---------np  209
            MY GDEVSAIV+DLGSHTCKAGYAGEDAPKAVFPS+VG+IDQM+VD  D           
Sbjct  1    MYDGDEVSAIVIDLGSHTCKAGYAGEDAPKAVFPSVVGAIDQMDVDESDDAEKNSGSGES  60

Query  210  dnnsgsapdsKSKGKRKLYVGSQSLGFRRDHMEALS  317
             NN  +    K+KGKRKLYVGSQSLG+RRD ME +S
Sbjct  61   KNNIRNVDGDKAKGKRKLYVGSQSLGYRRDFMEVVS  96



>gb|AAW81736.1| Putative Acttin-related protein 4 (ARP4) [Brassica oleracea]
Length=442

 Score =   119 bits (298),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 71/94 (76%), Gaps = 7/94 (7%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEV-------dnpdnpdn  215
            MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPS+VG++D +E           ++   
Sbjct  1    MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSVVGAVDGVEAMDVDADSAKNNSNSE  60

Query  216  nsgsapdsKSKGKRKLYVGSQSLGFRRDHMEALS  317
            +S +    K KGKRKLYVGSQ+L +RRDHME LS
Sbjct  61   DSKTNESDKEKGKRKLYVGSQALNYRRDHMEILS  94



>ref|XP_006307538.1| hypothetical protein CARUB_v10009163mg [Capsella rubella]
 gb|EOA40436.1| hypothetical protein CARUB_v10009163mg [Capsella rubella]
Length=441

 Score =   119 bits (297),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 70/93 (75%), Gaps = 6/93 (6%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEV------dnpdnpdnn  218
            MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPS++G++D +E           N ++ 
Sbjct  1    MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSVIGAVDGVEAMDVDVDSTKTNSNSE  60

Query  219  sgsapdsKSKGKRKLYVGSQSLGFRRDHMEALS  317
               A   K KGKRKLYVGSQ+L +RRDHME LS
Sbjct  61   DSKAESEKDKGKRKLYVGSQALSYRRDHMEVLS  93



>emb|CDY19213.1| BnaC05g14140D [Brassica napus]
Length=442

 Score =   119 bits (297),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 71/94 (76%), Gaps = 7/94 (7%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEV-------dnpdnpdn  215
            MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPS+VG++D +E           ++   
Sbjct  1    MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSVVGAVDGVEAMDVDADSAKNNSNSE  60

Query  216  nsgsapdsKSKGKRKLYVGSQSLGFRRDHMEALS  317
            +S +    K KGKRKLYVGSQ+L +RRDHME LS
Sbjct  61   DSKTNESDKEKGKRKLYVGSQALNYRRDHMEILS  94



>ref|XP_006416603.1| hypothetical protein EUTSA_v10007641mg [Eutrema salsugineum]
 dbj|BAJ34096.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ34956.1| hypothetical protein EUTSA_v10007641mg [Eutrema salsugineum]
Length=443

 Score =   119 bits (297),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/95 (64%), Positives = 71/95 (75%), Gaps = 8/95 (8%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEV--------dnpdnpd  212
            MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPS+VG++D +E            ++  
Sbjct  1    MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSVVGAVDGIEAMDVDVDSSTKTNSNS  60

Query  213  nnsgsapdsKSKGKRKLYVGSQSLGFRRDHMEALS  317
             +S +    K KGKRKLYVGSQ+L +RRDHME LS
Sbjct  61   EDSKTNEPEKEKGKRKLYVGSQALSYRRDHMEILS  95



>ref|XP_007134394.1| hypothetical protein PHAVU_010G044300g [Phaseolus vulgaris]
 gb|ESW06388.1| hypothetical protein PHAVU_010G044300g [Phaseolus vulgaris]
Length=446

 Score =   119 bits (297),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 75/98 (77%), Gaps = 11/98 (11%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpd-----------  203
            MYGGDEVSAIV DLGSHTCKAGYAGEDAPKAVFPS+VG+IDQM+VD  D           
Sbjct  1    MYGGDEVSAIVFDLGSHTCKAGYAGEDAPKAVFPSVVGAIDQMDVDEADDDAEKNSASVG  60

Query  204  npdnnsgsapdsKSKGKRKLYVGSQSLGFRRDHMEALS  317
               NN  +A   K+KGKRKL+VGSQSLG+RRD+ME LS
Sbjct  61   ESKNNLRNADSDKAKGKRKLFVGSQSLGYRRDYMEVLS  98



>ref|XP_002890276.1| hypothetical protein ARALYDRAFT_472063 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66535.1| hypothetical protein ARALYDRAFT_472063 [Arabidopsis lyrata subsp. 
lyrata]
Length=441

 Score =   119 bits (297),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 69/93 (74%), Gaps = 6/93 (6%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEV------dnpdnpdnn  218
            MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPS++G++D +E           N ++ 
Sbjct  1    MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSVIGAVDGIEAMDVDADSTKTNSNSE  60

Query  219  sgsapdsKSKGKRKLYVGSQSLGFRRDHMEALS  317
                   K KGKRKLYVGSQ++ +RRDHME LS
Sbjct  61   DSKTESEKEKGKRKLYVGSQAMSYRRDHMEVLS  93



>gb|AAM65324.1| unknown [Arabidopsis thaliana]
Length=441

 Score =   118 bits (296),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 69/93 (74%), Gaps = 6/93 (6%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEV------dnpdnpdnn  218
            MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPS++G++D +E           N ++ 
Sbjct  1    MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSVIGAVDGVEAMDVDVDSTKTNSNSE  60

Query  219  sgsapdsKSKGKRKLYVGSQSLGFRRDHMEALS  317
                   K KGKRKLYVGSQ++ +RRDHME LS
Sbjct  61   DSKTESEKEKGKRKLYVGSQAMSYRRDHMEVLS  93



>gb|KFK44003.1| hypothetical protein AALP_AA1G202200 [Arabis alpina]
Length=443

 Score =   118 bits (296),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 70/95 (74%), Gaps = 8/95 (8%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQME--------Vdnpdnpd  212
            MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVG++  ME             + D
Sbjct  1    MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGAVAGMEAMDVDVDSTKTNSSDD  60

Query  213  nnsgsapdsKSKGKRKLYVGSQSLGFRRDHMEALS  317
            + + +    K KGKRKLYVGSQ+L +RRDHME LS
Sbjct  61   SKTNAVESEKEKGKRKLYVGSQALNYRRDHMEMLS  95



>ref|XP_011013153.1| PREDICTED: actin-related protein 4-like isoform X2 [Populus euphratica]
Length=409

 Score =   118 bits (295),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 59/87 (68%), Positives = 64/87 (74%), Gaps = 15/87 (17%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsapd  236
            MYGGDEVSAIV+DLGSHTCKAGYAGEDAPKAVFPS+VGS DQM+V               
Sbjct  1    MYGGDEVSAIVIDLGSHTCKAGYAGEDAPKAVFPSVVGSTDQMDV---------------  45

Query  237  sKSKGKRKLYVGSQSLGFRRDHMEALS  317
              +  K KLYVGSQ+LGFRRDHME  S
Sbjct  46   DDTTSKCKLYVGSQALGFRRDHMEVFS  72



>ref|XP_011013152.1| PREDICTED: actin-related protein 4-like isoform X1 [Populus euphratica]
Length=420

 Score =   118 bits (295),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 59/87 (68%), Positives = 65/87 (75%), Gaps = 15/87 (17%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsapd  236
            MYGGDEVSAIV+DLGSHTCKAGYAGEDAPKAVFPS+VGS DQM+V               
Sbjct  1    MYGGDEVSAIVIDLGSHTCKAGYAGEDAPKAVFPSVVGSTDQMDV---------------  45

Query  237  sKSKGKRKLYVGSQSLGFRRDHMEALS  317
              +  K KLYVGSQ+LGFRRDHME +S
Sbjct  46   DDTTSKCKLYVGSQALGFRRDHMEVVS  72



>emb|CDY26159.1| BnaA06g12580D [Brassica napus]
Length=442

 Score =   118 bits (295),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 70/94 (74%), Gaps = 7/94 (7%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEV-------dnpdnpdn  215
            MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPS+VG++D  E           ++   
Sbjct  1    MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSVVGAVDGSEAMDVDADSAKNNSNSE  60

Query  216  nsgsapdsKSKGKRKLYVGSQSLGFRRDHMEALS  317
            +S +    K KGKRKLYVGSQ+L +RRDHME LS
Sbjct  61   DSKTNESDKEKGKRKLYVGSQALNYRRDHMEILS  94



>ref|XP_010477023.1| PREDICTED: actin-related protein 4 [Camelina sativa]
Length=439

 Score =   118 bits (295),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 69/91 (76%), Gaps = 4/91 (4%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVd----npdnpdnnsg  224
            MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPS++G+++ +E      +    ++   
Sbjct  1    MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSVIGAVEGVEAMDMDVDSTKANSEDS  60

Query  225  sapdsKSKGKRKLYVGSQSLGFRRDHMEALS  317
                 K KGKRKLYVGSQ+L +RRDHME LS
Sbjct  61   KTESEKEKGKRKLYVGSQALSYRRDHMEVLS  91



>emb|CDX83847.1| BnaC08g17980D [Brassica napus]
Length=439

 Score =   116 bits (291),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 71/91 (78%), Gaps = 4/91 (4%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVd----npdnpdnnsg  224
            MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPS+VG++D +E      +    ++NS 
Sbjct  1    MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSVVGAVDGVEAMDVDVDSAKTNSNSE  60

Query  225  sapdsKSKGKRKLYVGSQSLGFRRDHMEALS  317
             +   K KGKRKL VGSQ+L +RRDHME LS
Sbjct  61   DSKSEKEKGKRKLCVGSQALNYRRDHMEILS  91



>ref|NP_564051.1| actin-related protein 4 [Arabidopsis thaliana]
 sp|Q84M92.1|ARP4_ARATH RecName: Full=Actin-related protein 4 [Arabidopsis thaliana]
 tpg|DAA00027.1| TPA_exp: actin-related protein 4; AtARP4 [Arabidopsis thaliana]
 gb|AAP21282.1| At1g18450 [Arabidopsis thaliana]
 dbj|BAF00057.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE29715.1| actin-related protein 4 [Arabidopsis thaliana]
Length=441

 Score =   116 bits (290),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 68/93 (73%), Gaps = 6/93 (6%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEV------dnpdnpdnn  218
            MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPS++G++D +E           N ++ 
Sbjct  1    MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSVIGAVDGVEAMDVDVDSTKTNSNSE  60

Query  219  sgsapdsKSKGKRKLYVGSQSLGFRRDHMEALS  317
                   K K KRKLYVGSQ++ +RRDHME LS
Sbjct  61   DSKTESEKEKSKRKLYVGSQAMSYRRDHMEVLS  93



>ref|XP_006837032.1| hypothetical protein AMTR_s00110p00032330 [Amborella trichopoda]
 gb|ERM99885.1| hypothetical protein AMTR_s00110p00032330 [Amborella trichopoda]
Length=444

 Score =   115 bits (288),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 70/97 (72%), Gaps = 10/97 (10%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQ----------MEVdnpdn  206
            MYGGDEVSAIV+DLGSHTCKAGYAGEDAPKAVFPS+VGSI+Q           E  +   
Sbjct  1    MYGGDEVSAIVLDLGSHTCKAGYAGEDAPKAVFPSVVGSIEQSGLDDAVGIEKESQSVSE  60

Query  207  pdnnsgsapdsKSKGKRKLYVGSQSLGFRRDHMEALS  317
              N   +    K+K KRKLYVGSQ+LG+RRD+ME LS
Sbjct  61   AKNGIKTIDSDKAKTKRKLYVGSQALGYRRDYMEVLS  97



>gb|KFK41829.1| hypothetical protein AALP_AA2G176800 [Arabis alpina]
Length=441

 Score =   114 bits (285),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 71/93 (76%), Gaps = 6/93 (6%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSID---QMEV---dnpdnpdnn  218
            MYGGDEVSAIV+DLGSHTCKAGYAGEDAPKAVFPS+VG +D   +M++    N ++ D  
Sbjct  1    MYGGDEVSAIVIDLGSHTCKAGYAGEDAPKAVFPSVVGVVDGNHEMDIDDAANTNSEDAK  60

Query  219  sgsapdsKSKGKRKLYVGSQSLGFRRDHMEALS  317
            S      K KGKRK++VGSQ+L FRRD ME LS
Sbjct  61   SNVEESVKEKGKRKIFVGSQALNFRRDQMEMLS  93



>gb|AAM53244.1|AF507912_1 actin-related protein 4 [Arabidopsis thaliana]
Length=442

 Score =   114 bits (284),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/92 (62%), Positives = 67/92 (73%), Gaps = 6/92 (7%)
 Frame = +3

Query  60   YGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEV------dnpdnpdnns  221
            YGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPS++G++D +E           N ++  
Sbjct  3    YGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSVIGAVDGVEAMDVDVDSTKTNSNSED  62

Query  222  gsapdsKSKGKRKLYVGSQSLGFRRDHMEALS  317
                  K K KRKLYVGSQ++ +RRDHME LS
Sbjct  63   SKTESEKEKSKRKLYVGSQAMSYRRDHMEVLS  94



>ref|XP_003526079.1| PREDICTED: actin-related protein 4A-like [Glycine max]
Length=175

 Score =   109 bits (273),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/87 (61%), Positives = 64/87 (74%), Gaps = 4/87 (5%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsapd  236
            MYGGDEVS IV++LGSHTCK GYAG+DAPK V P +VG+ID M++    +          
Sbjct  1    MYGGDEVSIIVINLGSHTCKVGYAGKDAPKVVLPYVVGAIDHMDI----DGIAGINDENS  56

Query  237  sKSKGKRKLYVGSQSLGFRRDHMEALS  317
             K+KGK KLYVGSQSLG+RRDHME +S
Sbjct  57   DKTKGKCKLYVGSQSLGYRRDHMEVMS  83



>ref|XP_006302448.1| hypothetical protein CARUB_v10020534mg [Capsella rubella]
 gb|EOA35346.1| hypothetical protein CARUB_v10020534mg [Capsella rubella]
Length=360

 Score =   112 bits (279),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 67/90 (74%), Gaps = 3/90 (3%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSID--QMEV-dnpdnpdnnsgs  227
            MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPS++G ID   M++ D  +  D  +  
Sbjct  1    MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSVIGEIDGTGMDIDDAANTEDAKTNV  60

Query  228  apdsKSKGKRKLYVGSQSLGFRRDHMEALS  317
                K KG+RKLYVGSQ L  RRD ME LS
Sbjct  61   VESDKEKGRRKLYVGSQDLNVRRDQMEILS  90



>gb|EPS72646.1| hypothetical protein M569_02110, partial [Genlisea aurea]
Length=418

 Score =   111 bits (278),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 63/83 (76%), Gaps = 13/83 (16%)
 Frame = +3

Query  69   DEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsapdsKSK  248
            DEVSAIVVDLGSHTCKAGYAGEDAPKAVFPS+VG ID+M+V               ++SK
Sbjct  1    DEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSVVGLIDEMDV-------------YVTESK  47

Query  249  GKRKLYVGSQSLGFRRDHMEALS  317
             KRKLYVGSQ LGFRRD ME LS
Sbjct  48   VKRKLYVGSQDLGFRRDRMEVLS  70



>ref|XP_010474325.1| PREDICTED: LOW QUALITY PROTEIN: actin-related protein 4A [Camelina 
sativa]
Length=180

 Score =   107 bits (266),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/89 (62%), Positives = 62/89 (70%), Gaps = 4/89 (4%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSID----QMEVdnpdnpdnnsg  224
            MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPS+VG+ID     ++    +  D  + 
Sbjct  1    MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSVVGAIDGTGMDIDDVAANTEDAKTN  60

Query  225  sapdsKSKGKRKLYVGSQSLGFRRDHMEA  311
                     KRKLY GSQ+L FRRD ME 
Sbjct  61   VVESDXENDKRKLYFGSQALNFRRDQMEV  89



>ref|XP_009149328.1| PREDICTED: actin-related protein 4-like [Brassica rapa]
Length=450

 Score =   108 bits (270),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 66/90 (73%), Gaps = 7/90 (8%)
 Frame = +3

Query  69   DEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEV-------dnpdnpdnnsgs  227
            DEVSAIVVDLGSHTCKAGYAGEDAPKAVFPS+VG++D  E           ++   +S +
Sbjct  13   DEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSVVGAVDGSEAMDVDADSAKNNSNSEDSKT  72

Query  228  apdsKSKGKRKLYVGSQSLGFRRDHMEALS  317
                K KGKRKLYVGSQ+L +RRDHME LS
Sbjct  73   NESDKEKGKRKLYVGSQALNYRRDHMEILS  102



>ref|XP_009413467.1| PREDICTED: actin-related protein 4 [Musa acuminata subsp. malaccensis]
Length=437

 Score =   107 bits (267),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 69/91 (76%), Gaps = 5/91 (5%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQM----EVdnpdnpdnnsg  224
            MYGGDEVSAIV+DLGS+TCKAGYAGEDAPKAVFPS VGSI Q     EV +  + D+   
Sbjct  1    MYGGDEVSAIVLDLGSYTCKAGYAGEDAPKAVFPSAVGSIYQAGATDEVKHEKDSDSMYD  60

Query  225  sapdsKSKGKRKLYVGSQSLGFRRDHMEALS  317
            S    K K  RKLYVG+Q+LG+RRDHME +S
Sbjct  61   SENADKIK-TRKLYVGTQALGYRRDHMEVIS  90



>ref|XP_010428343.1| PREDICTED: actin-related protein 4-like [Camelina sativa]
Length=438

 Score =   106 bits (264),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 67/90 (74%), Gaps = 3/90 (3%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSID--QMEV-dnpdnpdnnsgs  227
            MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVF S+VG+ID   M++ D  D  D  +  
Sbjct  1    MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFSSVVGAIDGTGMDIDDAADMEDAKANV  60

Query  228  apdsKSKGKRKLYVGSQSLGFRRDHMEALS  317
                K  GKRKLY GSQ+L +RRD ME +S
Sbjct  61   VESDKEMGKRKLYFGSQALNYRRDQMEIVS  90



>tpg|DAA42880.1| TPA: hypothetical protein ZEAMMB73_922428 [Zea mays]
Length=182

 Score =   102 bits (255),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 68/97 (70%), Gaps = 11/97 (11%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQM----------EVdnpdn  206
            MYGGDEVSAIV+D+GS++CKAGYAG+D PKAVFPS+VGSI+Q           E D+  +
Sbjct  1    MYGGDEVSAIVIDVGSYSCKAGYAGDDTPKAVFPSVVGSIEQTEDTDDPKPEKEADSASD  60

Query  207  pdnnsgsapdsKSKGKRKLYVGSQSLGFRRDHMEALS  317
              N +      K+K KR+LYVG Q L FRRDHME +S
Sbjct  61   SKNGAKPMDVDKAKTKRRLYVG-QELEFRRDHMEVIS  96



>ref|XP_010935666.1| PREDICTED: actin-related protein 4 [Elaeis guineensis]
Length=233

 Score =   102 bits (254),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 69/97 (71%), Gaps = 10/97 (10%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsapd  236
            M GGDEVSA+V+DLGSHTCKAGYAGED P+AVFPS +GSIDQ+E +N    + +S    D
Sbjct  1    MDGGDEVSAVVIDLGSHTCKAGYAGEDVPRAVFPSGIGSIDQVEDNNGVKSEKDSEPTSD  60

Query  237  sKS----------KGKRKLYVGSQSLGFRRDHMEALS  317
            SK+          K KRKLYVGSQ+LG+R D ME  S
Sbjct  61   SKNGVEPPDSDKPKAKRKLYVGSQALGYRCDRMEVES  97



>ref|XP_004986029.1| PREDICTED: actin-related protein 4-like [Setaria italica]
Length=443

 Score =   102 bits (254),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 68/97 (70%), Gaps = 11/97 (11%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQM----------EVdnpdn  206
            MYGGDEVSAIV+D+GS++CKAGYAG+D PKAVFPS+VGSI+Q           E D+  +
Sbjct  1    MYGGDEVSAIVIDVGSYSCKAGYAGDDTPKAVFPSVVGSIEQTGDTDDSKPEKEADSASD  60

Query  207  pdnnsgsapdsKSKGKRKLYVGSQSLGFRRDHMEALS  317
              N +      K+K KRKLYVG Q L FRRDHME +S
Sbjct  61   SKNGAKPMDVDKAKTKRKLYVG-QELEFRRDHMEVIS  96



>ref|XP_002466003.1| hypothetical protein SORBIDRAFT_01g049880 [Sorghum bicolor]
 gb|EER93001.1| hypothetical protein SORBIDRAFT_01g049880 [Sorghum bicolor]
Length=443

 Score =   101 bits (252),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 68/97 (70%), Gaps = 11/97 (11%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQM----------EVdnpdn  206
            MYGGDEVSAIV+D+GS++CKAGYAG+D PKAVFPS+VGS++Q           E D+  +
Sbjct  1    MYGGDEVSAIVIDVGSYSCKAGYAGDDTPKAVFPSVVGSVEQTEGMDDPKPEKEADSASD  60

Query  207  pdnnsgsapdsKSKGKRKLYVGSQSLGFRRDHMEALS  317
              N +      K+K KRKLYVG Q L FRRDHME +S
Sbjct  61   SKNGAKPMDVDKAKTKRKLYVG-QELEFRRDHMEVIS  96



>gb|ACG40489.1| actin-like protein 6A [Zea mays]
Length=443

 Score =   101 bits (252),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 68/97 (70%), Gaps = 11/97 (11%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQM----------EVdnpdn  206
            MYGGDEVSAIV+D+GS++CKAGYAG+D PKAVFPS+VGSI+Q           E D+  +
Sbjct  1    MYGGDEVSAIVIDVGSYSCKAGYAGDDTPKAVFPSVVGSIEQTEDTDDPKPEKEADSASD  60

Query  207  pdnnsgsapdsKSKGKRKLYVGSQSLGFRRDHMEALS  317
              N +      K+K KR+LYVG Q L FRRDHME +S
Sbjct  61   SKNGAKPMDVDKAKTKRRLYVG-QELEFRRDHMEVIS  96



>ref|XP_008672855.1| PREDICTED: uncharacterized protein LOC100279759 isoform X1 [Zea 
mays]
 gb|ACF83607.1| unknown [Zea mays]
 tpg|DAA42881.1| TPA: actin-like protein 6A isoform 1 [Zea mays]
 tpg|DAA42882.1| TPA: actin-like protein 6A isoform 2 [Zea mays]
Length=443

 Score =   101 bits (252),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 68/97 (70%), Gaps = 11/97 (11%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQM----------EVdnpdn  206
            MYGGDEVSAIV+D+GS++CKAGYAG+D PKAVFPS+VGSI+Q           E D+  +
Sbjct  1    MYGGDEVSAIVIDVGSYSCKAGYAGDDTPKAVFPSVVGSIEQTEDTDDPKPEKEADSASD  60

Query  207  pdnnsgsapdsKSKGKRKLYVGSQSLGFRRDHMEALS  317
              N +      K+K KR+LYVG Q L FRRDHME +S
Sbjct  61   SKNGAKPMDVDKAKTKRRLYVG-QELEFRRDHMEVIS  96



>ref|NP_001060954.1| Os08g0137200 [Oryza sativa Japonica Group]
 sp|Q6ZJW9.1|ARP4_ORYSJ RecName: Full=Actin-related protein 4 [Oryza sativa Japonica 
Group]
 sp|A2YR10.2|ARP4_ORYSI RecName: Full=Actin-related protein 4 [Oryza sativa Indica Group]
 dbj|BAD03074.1| putative actin-related protein 4 (ARP4) [Oryza sativa Japonica 
Group]
 dbj|BAF22868.1| Os08g0137200 [Oryza sativa Japonica Group]
 dbj|BAG95134.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC82868.1| hypothetical protein OsI_27738 [Oryza sativa Indica Group]
Length=443

 Score = 99.4 bits (246),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 67/97 (69%), Gaps = 11/97 (11%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQM----------EVdnpdn  206
            MYGGDEVSAIV+D+GS++CKAGYAG+D PKAVFPS+VGSI+Q           E +   +
Sbjct  1    MYGGDEVSAIVIDVGSYSCKAGYAGDDTPKAVFPSVVGSIEQTGETDEAKADKEAEAASD  60

Query  207  pdnnsgsapdsKSKGKRKLYVGSQSLGFRRDHMEALS  317
              N +      K+K KRKLYVG Q L FRRDHME +S
Sbjct  61   SKNGAKPMDVDKAKTKRKLYVG-QELEFRRDHMEVIS  96



>dbj|BAK04027.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=443

 Score = 99.0 bits (245),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 68/97 (70%), Gaps = 11/97 (11%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQM----------EVdnpdn  206
            MYGGDEVSAIV+D+GS++CKAGYAG+D PK+VFPS+VGSI+Q           E D+  +
Sbjct  1    MYGGDEVSAIVIDVGSYSCKAGYAGDDTPKSVFPSVVGSIEQAEDTDEAKPEKEADSASD  60

Query  207  pdnnsgsapdsKSKGKRKLYVGSQSLGFRRDHMEALS  317
            P N S      K+K KRK YVG Q L FRRDHME +S
Sbjct  61   PKNGSKPMDVDKAKTKRKFYVG-QELEFRRDHMEVIS  96



>gb|EMT14913.1| Actin-related protein 4 [Aegilops tauschii]
Length=489

 Score = 99.0 bits (245),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 68/97 (70%), Gaps = 11/97 (11%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQM----------EVdnpdn  206
            MYGGDEVSAIV+D+GS++CKAGYAG+D PK+VFPS+VGSI+Q           E D+  +
Sbjct  1    MYGGDEVSAIVIDVGSYSCKAGYAGDDTPKSVFPSVVGSIEQAEDTDEAKPEKEADSASD  60

Query  207  pdnnsgsapdsKSKGKRKLYVGSQSLGFRRDHMEALS  317
            P N S      K+K KRK YVG Q L FRRDHME +S
Sbjct  61   PKNGSKPMDVDKAKTKRKFYVG-QELEFRRDHMEVIS  96



>ref|XP_006659807.1| PREDICTED: actin-related protein 4-like [Oryza brachyantha]
Length=443

 Score = 97.8 bits (242),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 66/97 (68%), Gaps = 11/97 (11%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQM----------EVdnpdn  206
            MYGGDEVSAIV+D+GS++CKAGYAG+D PKAVF S+VGSI+Q           + D   +
Sbjct  1    MYGGDEVSAIVIDVGSYSCKAGYAGDDTPKAVFSSVVGSIEQTGETEEAKADKDADTASD  60

Query  207  pdnnsgsapdsKSKGKRKLYVGSQSLGFRRDHMEALS  317
              N +      K+K KRKLYVG Q L FRRDHME +S
Sbjct  61   SKNGAKPMDVDKAKTKRKLYVG-QELDFRRDHMEVIS  96



>ref|XP_003559002.1| PREDICTED: actin-related protein 4 [Brachypodium distachyon]
Length=443

 Score = 95.9 bits (237),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 67/97 (69%), Gaps = 11/97 (11%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQM----------EVdnpdn  206
            MYGGDEVSAIV+D+GS++CKAGYAG+D PK+VFPS+VGSI+Q             D+  +
Sbjct  1    MYGGDEVSAIVIDVGSYSCKAGYAGDDTPKSVFPSVVGSIEQTGDTDEAKPDKGADSASD  60

Query  207  pdnnsgsapdsKSKGKRKLYVGSQSLGFRRDHMEALS  317
            P N S      K+K KRK YVG Q L FRRDHME +S
Sbjct  61   PKNGSKPMDVDKAKTKRKFYVG-QELEFRRDHMEVIS  96



>ref|XP_001764145.1| actin-related protein Arp4 [Physcomitrella patens]
 gb|EDQ70986.1| actin-related protein Arp4 [Physcomitrella patens]
Length=443

 Score = 95.9 bits (237),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 50/88 (57%), Positives = 62/88 (70%), Gaps = 2/88 (2%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQM-EVdnpdnpdnnsgsap  233
            MYGGDEVSAIV+DLGSH+CKAGYAGED PK+VFPS+VGS++    V +     +      
Sbjct  1    MYGGDEVSAIVLDLGSHSCKAGYAGEDQPKSVFPSVVGSVETPGAVVDGGGDTDMEAKKS  60

Query  234  dsKSKGK-RKLYVGSQSLGFRRDHMEAL  314
                K K RKLY G Q+LG+RRD+ME +
Sbjct  61   GEAEKAKSRKLYAGVQALGYRRDYMEVV  88



>ref|XP_004304616.1| PREDICTED: actin-related protein 4-like [Fragaria vesca subsp. 
vesca]
 ref|XP_011468261.1| PREDICTED: actin-related protein 4-like [Fragaria vesca subsp. 
vesca]
Length=433

 Score = 95.5 bits (236),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 64/86 (74%), Gaps = 1/86 (1%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsapd  236
            MY  D  SA+V+DLGSHTCK G+A ++APK VFPS+VGSIDQM+VD  +N  +    +  
Sbjct  1    MYARDAESAVVIDLGSHTCKVGFACDNAPK-VFPSVVGSIDQMKVDETENSGSADPKSDS  59

Query  237  sKSKGKRKLYVGSQSLGFRRDHMEAL  314
             ++KGK KLYVGS++LG R DHME L
Sbjct  60   DRTKGKWKLYVGSEALGNRCDHMEVL  85



>gb|EMT08634.1| Actin-related protein 4 [Aegilops tauschii]
Length=496

 Score = 95.5 bits (236),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 66/97 (68%), Gaps = 11/97 (11%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQM----------EVdnpdn  206
            MYGGDEVSAIV+D+GS++CKAGYAG+D PK VFPS+VGSI+Q           E D+  +
Sbjct  1    MYGGDEVSAIVIDVGSYSCKAGYAGDDTPKCVFPSVVGSIEQTGDTDEAKPEKEADSGSD  60

Query  207  pdnnsgsapdsKSKGKRKLYVGSQSLGFRRDHMEALS  317
            P N S      K+K KRK Y+G Q   FRRDHME +S
Sbjct  61   PKNGSKPMDVDKAKTKRKFYLG-QEFEFRRDHMEVIS  96



>gb|EEE68011.1| hypothetical protein OsJ_25972 [Oryza sativa Japonica Group]
Length=424

 Score = 92.0 bits (227),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 60/87 (69%), Gaps = 6/87 (7%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsapd  236
            MYGGDEVSAIV+D+GS++CKAGYAG+D PKAVFPS        E +   +  N +     
Sbjct  1    MYGGDEVSAIVIDVGSYSCKAGYAGDDTPKAVFPSA-----DKEAEAASDSKNGAKPMDV  55

Query  237  sKSKGKRKLYVGSQSLGFRRDHMEALS  317
             K+K KRKLYVG Q L FRRDHME +S
Sbjct  56   DKAKTKRKLYVG-QELEFRRDHMEVIS  81



>ref|XP_002966143.1| hypothetical protein SELMODRAFT_266988 [Selaginella moellendorffii]
 gb|EFJ32170.1| hypothetical protein SELMODRAFT_266988 [Selaginella moellendorffii]
Length=415

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 54/84 (64%), Gaps = 21/84 (25%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsapd  236
            MYGGDEVSAIVVDLGSH+CKAGYAGEDAPKAVFPS VGS+ +                  
Sbjct  1    MYGGDEVSAIVVDLGSHSCKAGYAGEDAPKAVFPSAVGSVGE------------------  42

Query  237  sKSKGKRKLYVGSQSLGFRRDHME  308
               K     YVG+Q++ FRRD ME
Sbjct  43   ---KPSSTYYVGNQAIQFRRDFME  63



>ref|XP_002982148.1| hypothetical protein SELMODRAFT_268538 [Selaginella moellendorffii]
 gb|EFJ16816.1| hypothetical protein SELMODRAFT_268538 [Selaginella moellendorffii]
Length=414

 Score = 89.7 bits (221),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 54/87 (62%), Gaps = 22/87 (25%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsapd  236
            MYGGDEVSAIVVDLGSH+CKAGYAGEDAPKAVFPS VGS+                    
Sbjct  1    MYGGDEVSAIVVDLGSHSCKAGYAGEDAPKAVFPSAVGSV--------------------  40

Query  237  sKSKGKRKLYVGSQSLGFRRDHMEALS  317
               +     YVG+Q++ FRRD ME  S
Sbjct  41   --GEKPSTYYVGNQAIQFRRDFMEVAS  65



>ref|XP_005651985.1| putative Acttin-related protein 4 [Coccomyxa subellipsoidea C-169]
 gb|EIE27441.1| putative Acttin-related protein 4 [Coccomyxa subellipsoidea C-169]
Length=398

 Score = 87.0 bits (214),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 57/86 (66%), Gaps = 10/86 (12%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsapd  236
            MYGGDEV+A+V+DLGS T KAGYAGED PKA+FP+ VG I + +               +
Sbjct  1    MYGGDEVNALVIDLGSSTVKAGYAGEDTPKALFPAAVGCIGEHD----------GSEVSN  50

Query  237  sKSKGKRKLYVGSQSLGFRRDHMEAL  314
               K  RKL+VGSQ++GFR+D ME +
Sbjct  51   GGEKNGRKLHVGSQAMGFRKDDMEVV  76



>ref|XP_005848141.1| hypothetical protein CHLNCDRAFT_145481 [Chlorella variabilis]
 gb|EFN56039.1| hypothetical protein CHLNCDRAFT_145481 [Chlorella variabilis]
Length=133

 Score = 82.0 bits (201),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 45/94 (48%), Positives = 57/94 (61%), Gaps = 21/94 (22%)
 Frame = +3

Query  48   SSIMYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSI----DQMEVdnpdnpdn  215
            S  +YGGDEV+A+V+D+G++  KAGYAGED PK VFPS VG++    D MEV        
Sbjct  2    SGPVYGGDEVNAVVLDVGTYHTKAGYAGEDTPKYVFPSAVGALGGGADGMEV--------  53

Query  216  nsgsapdsKSKGKRKLYVGSQSLGFRRDHMEALS  317
                        KR LYVG+ +L  RRDHME +S
Sbjct  54   ---------DGAKRTLYVGTHALSHRRDHMEVIS  78



>gb|EMS61463.1| hypothetical protein TRIUR3_27205 [Triticum urartu]
Length=743

 Score = 85.9 bits (211),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 63/93 (68%), Gaps = 11/93 (12%)
 Frame = +3

Query  69   DEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQM----------EVdnpdnpdnn  218
            DEVSAIV+D+GS++CKAGYAG+D PK VFPS+VGSI+Q           E D+  +P N 
Sbjct  29   DEVSAIVIDVGSYSCKAGYAGDDTPKCVFPSVVGSIEQTGDTDEAKPEKEADSGSDPKNG  88

Query  219  sgsapdsKSKGKRKLYVGSQSLGFRRDHMEALS  317
            S      K+K KRK Y+G Q L FRR+HME +S
Sbjct  89   SKPMDVDKAKTKRKFYLG-QELEFRREHMEVIS  120



>ref|XP_001778436.1| actin-related protein ARP4 [Physcomitrella patens]
 gb|EDQ56794.1| actin-related protein ARP4 [Physcomitrella patens]
Length=451

 Score = 84.3 bits (207),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/88 (48%), Positives = 60/88 (68%), Gaps = 6/88 (7%)
 Frame = +3

Query  69   DEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsapdsKSK  248
            DEVSAIV DLGSH+C++GYAGED PK+VFPS++  +   +++   +    + +  ++K  
Sbjct  10   DEVSAIVFDLGSHSCRSGYAGEDQPKSVFPSVILPLPISDLETYYDKSLGANTDKEAKKP  69

Query  249  GK------RKLYVGSQSLGFRRDHMEAL  314
            G+      RKLY G Q+LG+RRDHME L
Sbjct  70   GQAEVAKVRKLYAGVQALGYRRDHMEVL  97



>gb|KEH17933.1| actin-related protein 4A [Medicago truncatula]
Length=86

 Score = 79.0 bits (193),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 42/45 (93%), Gaps = 2/45 (4%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEV  191
            MYGG  VSAIV+DLGSHTCKA YAGEDAPKAVFPS+VG+IDQM+V
Sbjct  1    MYGG--VSAIVIDLGSHTCKAVYAGEDAPKAVFPSVVGAIDQMDV  43



>gb|KDO64535.1| hypothetical protein CISIN_1g0374701mg, partial [Citrus sinensis]
Length=35

 Score = 74.7 bits (182),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/35 (97%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPS  161
            MYGGDEVSAIV+DLGSHTCKAGYAGEDAPKAVFPS
Sbjct  1    MYGGDEVSAIVIDLGSHTCKAGYAGEDAPKAVFPS  35



>gb|KIZ06768.1| Actin-related protein 4 [Monoraphidium neglectum]
Length=183

 Score = 76.3 bits (186),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 58/91 (64%), Gaps = 10/91 (11%)
 Frame = +3

Query  45   SSSIMYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsg  224
            +++ +YGGDEV+A+V+DLG   C+AGYAG+D PKAVFP++ G +   +          + 
Sbjct  2    AANAVYGGDEVNAVVIDLGGCLCRAGYAGDDTPKAVFPAVAGVVAPSD----------AN  51

Query  225  sapdsKSKGKRKLYVGSQSLGFRRDHMEALS  317
                S + G R ++VG+ +L F+RD ME +S
Sbjct  52   GVEGSGAAGARGIHVGNTALSFKRDGMEVVS  82



>gb|KEH28122.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=219

 Score = 73.9 bits (180),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 33/35 (94%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPS  161
            MY GDEVSAIV+DLGSHTCKAGYAGEDAPKAVFPS
Sbjct  1    MYDGDEVSAIVIDLGSHTCKAGYAGEDAPKAVFPS  35



>ref|XP_002504876.1| actin superfamily [Micromonas sp. RCC299]
 gb|ACO66134.1| actin superfamily [Micromonas sp. RCC299]
Length=433

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 54/87 (62%), Gaps = 5/87 (6%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsapd  236
            MYGGDEVSAIVVDLGS T KAGYAGED PKAVFPS VG + + +    ++     G   +
Sbjct  1    MYGGDEVSAIVVDLGSSTVKAGYAGEDTPKAVFPSTVGWLAKDQ----ESAGKKDGGDVE  56

Query  237  sKSKGKRKLYVGSQSLGFRRDHMEALS  317
             K  G  K Y     + +RRDHME  S
Sbjct  57   MKDAGDGKTYF-VNDMSYRRDHMELAS  82



>ref|XP_640964.1| actin-like protein 6A [Dictyostelium discoideum AX4]
 gb|EAL66985.1| actin-like protein 6A [Dictyostelium discoideum AX4]
Length=440

 Score = 74.7 bits (182),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 38/87 (44%), Positives = 55/87 (63%), Gaps = 2/87 (2%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsapd  236
            MY GD+VSAIV+D+G+ + K GYAGED+PKAVFP+ +G + + E  N      +S     
Sbjct  1    MYSGDDVSAIVIDVGTFSTKGGYAGEDSPKAVFPTDIGVVYKNE--NETVGTGDSEMGEK  58

Query  237  sKSKGKRKLYVGSQSLGFRRDHMEALS  317
              S+ KR  Y G+  + +RR HME ++
Sbjct  59   DDSEPKRTYYCGTNGITYRRPHMEIIN  85



>gb|EKD04608.1| 53 kda brg1-associated factor b [Trichosporon asahii var. asahii 
CBS 8904]
Length=557

 Score = 75.1 bits (183),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 39/85 (46%), Positives = 49/85 (58%), Gaps = 0/85 (0%)
 Frame = +3

Query  54   IMYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsap  233
            ++Y GDEVSA+VVD GSHT +AGYAGED P+ V PS  G  D+      +    +     
Sbjct  1    MVYNGDEVSAVVVDFGSHTTRAGYAGEDGPRVVTPSFYGYTDEASGSGENGAHTDGDDPM  60

Query  234  dsKSKGKRKLYVGSQSLGFRRDHME  308
            D + KGKRK Y G   +G  R  ME
Sbjct  61   DGEKKGKRKYYFGEDGVGVWRPRME  85



>gb|ADI46900.1| ARP4m [Volvox carteri f. nagariensis]
Length=439

 Score = 72.0 bits (175),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 40/91 (44%), Positives = 57/91 (63%), Gaps = 1/91 (1%)
 Frame = +3

Query  48   SSIMYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSID-QMEVdnpdnpdnnsg  224
            SS +YGGDEV+A+V+DLG+H+CKAGYAG+D PKAVFPS+   +   ++          +G
Sbjct  2    SSNIYGGDEVNALVLDLGTHSCKAGYAGDDTPKAVFPSVSALVACSLKFQMVGIHPGANG  61

Query  225  sapdsKSKGKRKLYVGSQSLGFRRDHMEALS  317
            S         R+L VG Q+L  ++  ME +S
Sbjct  62   SMEVDGPNAGRRLSVGYQALSGKQLGMEVMS  92



>gb|ADI46834.1| ARP4f [Volvox carteri f. nagariensis]
Length=439

 Score = 72.0 bits (175),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 40/91 (44%), Positives = 57/91 (63%), Gaps = 1/91 (1%)
 Frame = +3

Query  48   SSIMYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSID-QMEVdnpdnpdnnsg  224
            SS +YGGDEV+A+V+DLG+H+CKAGYAG+D PKAVFPS+   +   ++          +G
Sbjct  2    SSNIYGGDEVNALVLDLGTHSCKAGYAGDDTPKAVFPSVSALVACSLKFQMVGIHPGANG  61

Query  225  sapdsKSKGKRKLYVGSQSLGFRRDHMEALS  317
            S         R+L VG Q+L  ++  ME +S
Sbjct  62   SMEVDGPNAGRRLSVGYQALSGKQLGMEVMS  92



>ref|XP_003060727.1| actin superfamily [Micromonas pusilla CCMP1545]
 gb|EEH55496.1| actin superfamily [Micromonas pusilla CCMP1545]
Length=451

 Score = 71.6 bits (174),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQ  182
            MYGGDEVSAIVVDLGS T KAGYAGED PKAVFPS VG +++
Sbjct  1    MYGGDEVSAIVVDLGSSTVKAGYAGEDTPKAVFPSAVGWLER  42



>ref|XP_003289725.1| hypothetical protein DICPUDRAFT_48789 [Dictyostelium purpureum]
 gb|EGC33759.1| hypothetical protein DICPUDRAFT_48789 [Dictyostelium purpureum]
Length=444

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 36/88 (41%), Positives = 56/88 (64%), Gaps = 1/88 (1%)
 Frame = +3

Query  57   MYGG-DEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsap  233
            MYGG D+VSAIV+D+G+ + K GYAGED+PKAVFPS +G + +   D+      +     
Sbjct  1    MYGGGDDVSAIVLDVGTFSTKGGYAGEDSPKAVFPSDIGVVYKNGDDSVVGISESEIGEK  60

Query  234  dsKSKGKRKLYVGSQSLGFRRDHMEALS  317
            +   + K+  Y G+ ++ +RR HME ++
Sbjct  61   EDIDQVKKTYYTGTNAITYRRPHMEVIN  88



>ref|XP_005838967.1| hypothetical protein GUITHDRAFT_102601 [Guillardia theta CCMP2712]
 gb|EKX51987.1| hypothetical protein GUITHDRAFT_102601 [Guillardia theta CCMP2712]
Length=440

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSI  176
            MYGGDEVSAIV+D+G  +CKAG+AGED PKAVFP+ VG +
Sbjct  1    MYGGDEVSAIVLDVGYTSCKAGFAGEDNPKAVFPTAVGVV  40



>ref|XP_001417251.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO95544.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=425

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVG  170
            MYGGDEVSA+V+DLG+H+ KAGYAG+D P+ VFPS VG
Sbjct  1    MYGGDEVSAVVIDLGTHSVKAGYAGQDTPQHVFPSAVG  38



>ref|XP_009286399.1| PREDICTED: actin-like protein 6A [Aptenodytes forsteri]
Length=134

 Score = 62.4 bits (150),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 51/87 (59%), Gaps = 5/87 (6%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsapd  236
            +YGGDEV A+V D+GS+T +AGYAGED PK  FP+ +G + + +     N         D
Sbjct  5    VYGGDEVGALVFDIGSYTVRAGYAGEDCPKVDFPTAIGVVLERD-----NGSTLMEIDGD  59

Query  237  sKSKGKRKLYVGSQSLGFRRDHMEALS  317
               +G    Y+ + +L   R++MEA+S
Sbjct  60   KGKQGGPTYYIDTNALRVPRENMEAIS  86



>gb|EMD40548.1| hypothetical protein CERSUDRAFT_111146 [Ceriporiopsis subvermispora 
B]
Length=438

 Score = 65.1 bits (157),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 35/87 (40%), Positives = 54/87 (62%), Gaps = 2/87 (2%)
 Frame = +3

Query  54   IMYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsap  233
            + YGGDEVSA+VVD+GS + +AGYAG+D PKA+ P+  G + +      D   +++    
Sbjct  2    VNYGGDEVSALVVDIGSSSIRAGYAGDDTPKAIVPTSYGYVKETPSTTEDVTMSDTTEGE  61

Query  234  dsK--SKGKRKLYVGSQSLGFRRDHME  308
            +SK  S+ + KLY+G       R++ME
Sbjct  62   ESKLASRPRVKLYIGQNGPSLWRENME  88



>ref|XP_005525127.1| PREDICTED: actin-like protein 6A [Pseudopodoces humilis]
Length=429

 Score = 64.7 bits (156),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 35/87 (40%), Positives = 51/87 (59%), Gaps = 5/87 (6%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsapd  236
            +YGGDEV A+V D+GS+T +AGYAGED PK  FP+ +G + + +     N         D
Sbjct  5    VYGGDEVGALVFDIGSYTVRAGYAGEDCPKVDFPTAIGVVLERD-----NGSTLMEIDGD  59

Query  237  sKSKGKRKLYVGSQSLGFRRDHMEALS  317
               +G    Y+ + +L   R+HMEA+S
Sbjct  60   KGKQGGPTYYIDTNALRVPREHMEAIS  86



>emb|CDQ80464.1| unnamed protein product [Oncorhynchus mykiss]
Length=182

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 52/88 (59%), Gaps = 7/88 (8%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVG-SIDQMEVdnpdnpdnnsgsap  233
            +YGGDEV A+V D+GS+T +AGYAGED PKA FP+++G ++D+ +            +  
Sbjct  45   VYGGDEVGALVFDIGSYTVRAGYAGEDCPKADFPTVMGVTLDRED------GSTPMETDG  98

Query  234  dsKSKGKRKLYVGSQSLGFRRDHMEALS  317
              K K     ++ +  L   R++ME +S
Sbjct  99   GDKGKQGTNYFIDTNQLRVARENMEVMS  126



>dbj|GAM25133.1| hypothetical protein SAMD00019534_083080 [Acytostelium subglobosum 
LB1]
Length=430

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 35/90 (39%), Positives = 53/90 (59%), Gaps = 3/90 (3%)
 Frame = +3

Query  57   MY-GGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSI--DQMEVdnpdnpdnnsgs  227
            MY GGD+VS+IV+D+G+ T K GYAGED+PKA+FP+ +G +     +           G 
Sbjct  1    MYSGGDDVSSIVLDVGTSTVKGGYAGEDSPKAIFPTDIGVVFTAGTDESTVGVNQQAIGE  60

Query  228  apdsKSKGKRKLYVGSQSLGFRRDHMEALS  317
            + +     KR  YVG+ ++ ++R HM   S
Sbjct  61   SEEPDPAAKRTYYVGTNAVTYKRPHMHIQS  90



>gb|EJY78936.1| Actin-related protein 4 [Oxytricha trifallax]
Length=856

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 34/84 (40%), Positives = 49/84 (58%), Gaps = 4/84 (5%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsapd  236
            MY GD+VS+ V+D+GS   +AGY+GED P++V PS  G +D     +    D +      
Sbjct  1    MYCGDDVSSCVIDIGSFQTRAGYSGEDCPRSVIPSYAGILD----GHVSEEDVDMADVGV  56

Query  237  sKSKGKRKLYVGSQSLGFRRDHME  308
             + K  RK  VGS  L ++RD+ME
Sbjct  57   EQQKQSRKYIVGSAELNYKRDNME  80



>gb|KDE08803.1| hypothetical protein MVLG_00908 [Microbotryum violaceum p1A1 
Lamole]
Length=445

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = +3

Query  54   IMYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQME  188
            + YGGDEVSA+V+D+GS T +AGYAGED PK +FPS+  ++   E
Sbjct  5    VQYGGDEVSALVLDIGSDTVRAGYAGEDTPKTIFPSVYSTVPASE  49



>ref|XP_004365527.2| BAF53b [Capsaspora owczarzaki ATCC 30864]
 gb|KJE89114.1| BAF53b [Capsaspora owczarzaki ATCC 30864]
Length=471

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 53/93 (57%), Gaps = 6/93 (6%)
 Frame = +3

Query  48   SSIMYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVG------SIDQMEVdnpdnp  209
            S  M+GGDEV A+V+D+GS T + G+AGED PK+VFPS+VG      +  Q  V    + 
Sbjct  2    SGAMFGGDEVGALVLDIGSATTRFGFAGEDTPKSVFPSVVGLAPSHHAASQDSVPMDTSD  61

Query  210  dnnsgsapdsKSKGKRKLYVGSQSLGFRRDHME  308
             +         ++  RK YVG+ +L   R +++
Sbjct  62   RDLPSGTAGGAARRSRKSYVGTTTLAVVRSNVD  94



>ref|XP_003078795.1| Actin-related protein Arp2/3 complex, subunit Arp2 (ISS) [Ostreococcus 
tauri]
 emb|CAL51675.1| Actin-related protein [Ostreococcus tauri]
Length=424

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 52/93 (56%), Gaps = 24/93 (26%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGS------IDQMEVdnpdnpdnn  218
            MYGGDEVSA+V+DLG+H+ KAGYAG+D P+ VF S VG+      +D  E          
Sbjct  1    MYGGDEVSAVVLDLGTHSVKAGYAGQDTPQHVFTSSVGARAKGGDVDMTE----------  50

Query  219  sgsapdsKSKGKRKLYVGSQSLGFRRDHMEALS  317
                    S+  R ++V   S+G RRD ++  S
Sbjct  51   ------GGSQSSRDIFV--DSMGIRRDEVDVTS  75



>emb|CDQ58638.1| unnamed protein product [Oncorhynchus mykiss]
Length=429

 Score = 63.2 bits (152),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 52/88 (59%), Gaps = 7/88 (8%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVG-SIDQMEVdnpdnpdnnsgsap  233
            +YGGDEV A+V D+GS+T +AGYAGED PKA FP+++G ++D+ +            +  
Sbjct  5    VYGGDEVGALVFDIGSYTVRAGYAGEDCPKADFPTVIGVTLDRED------GSTPMETDG  58

Query  234  dsKSKGKRKLYVGSQSLGFRRDHMEALS  317
              K K     ++ +  L   R++ME +S
Sbjct  59   GDKGKQGTNYFIDTNQLRVARENMEVMS  86



>ref|XP_010869611.1| PREDICTED: actin-like protein 6A isoform X2 [Esox lucius]
Length=429

 Score = 63.2 bits (152),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 52/88 (59%), Gaps = 7/88 (8%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVG-SIDQMEVdnpdnpdnnsgsap  233
            +YGGDEV A+V D+GS+T +AGYAGED PKA FP+++G ++D+ +            +  
Sbjct  5    VYGGDEVGALVFDIGSYTVRAGYAGEDCPKADFPTVIGVTLDRED------GSTPMETDG  58

Query  234  dsKSKGKRKLYVGSQSLGFRRDHMEALS  317
              K K     ++ +  L   R++ME +S
Sbjct  59   GDKGKQGTNYFIDTNQLRVARENMEVMS  86



>ref|XP_010869610.1| PREDICTED: actin-like protein 6A isoform X1 [Esox lucius]
Length=434

 Score = 63.2 bits (152),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 52/88 (59%), Gaps = 7/88 (8%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVG-SIDQMEVdnpdnpdnnsgsap  233
            +YGGDEV A+V D+GS+T +AGYAGED PKA FP+++G ++D+ +            +  
Sbjct  5    VYGGDEVGALVFDIGSYTVRAGYAGEDCPKADFPTVIGVTLDRED------GSTPMETDG  58

Query  234  dsKSKGKRKLYVGSQSLGFRRDHMEALS  317
              K K     ++ +  L   R++ME +S
Sbjct  59   GDKGKQGTNYFIDTNQLRVARENMEVMS  86



>ref|XP_008140546.1| PREDICTED: actin-like protein 6A [Eptesicus fuscus]
Length=428

 Score = 62.8 bits (151),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 33/87 (38%), Positives = 51/87 (59%), Gaps = 5/87 (6%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsapd  236
            +YGGDEV A+V D+GS+T +AGYAGED PK  FP+ +G + + +     +         D
Sbjct  5    VYGGDEVGALVFDIGSYTVRAGYAGEDCPKVDFPTAIGMVVERD-----DGSTLMEIDGD  59

Query  237  sKSKGKRKLYVGSQSLGFRRDHMEALS  317
               +G    Y+ + +L   R++MEA+S
Sbjct  60   KGKQGGPTYYIDTNALRVPRENMEAIS  86



>sp|Q4R333.1|ACL6A_MACFA RecName: Full=Actin-like protein 6A; AltName: Full=BRG1-associated 
factor 53A; Short=BAF53A [Macaca fascicularis]
 dbj|BAE02486.1| unnamed protein product [Macaca fascicularis]
Length=429

 Score = 62.8 bits (151),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 53/90 (59%), Gaps = 11/90 (12%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsapd  236
            +YGGDEV A+V D+GS+T +AGYAGED PK  FP+ +G + + +        + S     
Sbjct  5    VYGGDEVGALVFDIGSYTVRAGYAGEDCPKVDFPTAIGMVVERD--------DGSTLMEI  56

Query  237  sKSKGKR---KLYVGSQSLGFRRDHMEALS  317
               KGK+     Y+ + +L   R++MEA+S
Sbjct  57   DGDKGKQGGPTYYIATNALRVPRENMEAIS  86



>gb|ERE88632.1| actin-like protein 6A [Cricetulus griseus]
Length=326

 Score = 62.0 bits (149),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 53/90 (59%), Gaps = 11/90 (12%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsapd  236
            +YGGDEV A+V D+GS+T +AGYAGED PK  FP+ +G + + +        + S     
Sbjct  5    VYGGDEVGALVFDIGSYTVRAGYAGEDCPKVDFPTAIGMVLERD--------DGSTMMEI  56

Query  237  sKSKGKR---KLYVGSQSLGFRRDHMEALS  317
               KGK+     Y+ + +L   R++MEA+S
Sbjct  57   DGDKGKQGGPTYYIDTNALRVPRENMEAIS  86



>emb|CEG80912.1| hypothetical protein RMATCC62417_15175 [Rhizopus microsporus]
Length=316

 Score = 62.0 bits (149),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 29/85 (34%), Positives = 51/85 (60%), Gaps = 10/85 (12%)
 Frame = +3

Query  54   IMYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsap  233
            + YGGDEV+A+V+D+G+ + +AGYAGED P+ +FP+  G ++Q +  + ++   +     
Sbjct  2    VAYGGDEVNALVLDIGTSSVRAGYAGEDTPRCMFPTRFGYLEQEQQQDGEDVSMDM----  57

Query  234  dsKSKGKRKLYVGSQSLGFRRDHME  308
                  KR+ Y+G   +   + HME
Sbjct  58   ------KRQYYIGDNKINKLKSHME  76



>ref|XP_003218152.1| PREDICTED: actin-like protein 6A [Anolis carolinensis]
Length=428

 Score = 62.8 bits (151),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 33/87 (38%), Positives = 51/87 (59%), Gaps = 6/87 (7%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsapd  236
            +YGGDEV A+V D+GS+T +AGYAGED PK  FP+ +G +   +        ++      
Sbjct  5    VYGGDEVGALVFDIGSYTVRAGYAGEDCPKVDFPTAIGMVMDRD------DGSSMMEIDG  58

Query  237  sKSKGKRKLYVGSQSLGFRRDHMEALS  317
             K+K     Y+ + +L   R++MEA+S
Sbjct  59   DKNKQGPTYYIDTNALRVPRENMEAIS  85



>ref|NP_001133252.1| Actin-like protein 6B [Salmo salar]
 gb|ACI32907.1| Actin-like protein 6B [Salmo salar]
Length=471

 Score = 62.8 bits (151),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 33/88 (38%), Positives = 52/88 (59%), Gaps = 7/88 (8%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVG-SIDQMEVdnpdnpdnnsgsap  233
            +YGGDEV A+V D+GS+T +AGYAGED PKA FP+++G ++D+ +            +  
Sbjct  5    VYGGDEVGALVFDIGSYTVRAGYAGEDCPKADFPTVIGVTLDRED------GSTPMETDG  58

Query  234  dsKSKGKRKLYVGSQSLGFRRDHMEALS  317
              K K     ++ +  L   R++ME +S
Sbjct  59   GDKGKQGTNYFIDTNQLRVARENMEVMS  86



>gb|ABN14926.1| cytoskeletal actin 2 [Taenia asiatica]
Length=148

 Score = 60.1 bits (144),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVG  170
            M  GDE++A+VVD GS  CKAG+AG+DAP+AVFPSIVG
Sbjct  1    MSEGDEIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG  38



>ref|XP_002958261.1| actin-related protein Arp4 [Volvox carteri f. nagariensis]
 gb|EFJ40635.1| actin-related protein Arp4 [Volvox carteri f. nagariensis]
Length=431

 Score = 62.4 bits (150),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 35/84 (42%), Positives = 51/84 (61%), Gaps = 1/84 (1%)
 Frame = +3

Query  69   DEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSID-QMEVdnpdnpdnnsgsapdsKS  245
            DEV+A+V+DLG+H+CKAGYAG+D PKAVFPS+   +   ++          +GS      
Sbjct  1    DEVNALVLDLGTHSCKAGYAGDDTPKAVFPSVSALVACSLKFQMVGIHPGANGSMEVDGP  60

Query  246  KGKRKLYVGSQSLGFRRDHMEALS  317
               R+L VG Q+L  ++  ME +S
Sbjct  61   NAGRRLSVGYQALSGKQLGMEVMS  84



>emb|CEG67675.1| hypothetical protein RMATCC62417_04071 [Rhizopus microsporus]
Length=323

 Score = 61.6 bits (148),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 29/85 (34%), Positives = 51/85 (60%), Gaps = 10/85 (12%)
 Frame = +3

Query  54   IMYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsap  233
            + YGGDEV+A+V+D+G+ + +AGYAGED P+ +FP+  G ++Q +  + ++   +     
Sbjct  2    VAYGGDEVNALVLDIGTSSVRAGYAGEDTPRCMFPTRFGYLEQGQQQDGEDVSMDM----  57

Query  234  dsKSKGKRKLYVGSQSLGFRRDHME  308
                  KR+ Y+G   +   + HME
Sbjct  58   ------KRQYYIGDNKINKLKSHME  76



>ref|XP_002115616.1| hypothetical protein TRIADDRAFT_29808 [Trichoplax adhaerens]
 gb|EDV21979.1| hypothetical protein TRIADDRAFT_29808 [Trichoplax adhaerens]
Length=432

 Score = 62.4 bits (150),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 51/87 (59%), Gaps = 3/87 (3%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsapd  236
            +YGGDEV AIV+D+G+ T +AG+AGED PKA FPS VG       ++ +  D   G    
Sbjct  5    VYGGDEVGAIVLDIGNTTVRAGFAGEDTPKADFPSYVGCTTDGNFEDDNAMDTADGPTSV  64

Query  237  sKSKGKRKLYVGSQSLGFRRDHMEALS  317
            +    KRK Y+G   L   ++ ME +S
Sbjct  65   AS---KRKYYIGYNFLSSPKERMEMIS  88



>ref|XP_002679390.1| actin related protein [Naegleria gruberi]
 gb|EFC46646.1| actin related protein [Naegleria gruberi]
Length=437

 Score = 62.4 bits (150),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 33/86 (38%), Positives = 49/86 (57%), Gaps = 23/86 (27%)
 Frame = +3

Query  60   YGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsapds  239
            +GGDEV A+V+D+G+HT KAG+AGE+ PKA+ PS++G++                     
Sbjct  4    FGGDEVGAVVIDVGTHTIKAGFAGEENPKAIIPSVIGTV--------------------F  43

Query  240  KSKGKRKL---YVGSQSLGFRRDHME  308
             S  K K+   YVG++ + F R  ME
Sbjct  44   DSDDKSKISSYYVGNKEISFARPGME  69



>ref|XP_005069713.1| PREDICTED: actin-like protein 6A [Mesocricetus auratus]
Length=368

 Score = 62.0 bits (149),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 53/90 (59%), Gaps = 11/90 (12%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsapd  236
            +YGGDEV A+V D+GS+T +AGYAGED PK  FP+ +G + + +        + S     
Sbjct  5    VYGGDEVGALVFDIGSYTVRAGYAGEDCPKVDFPTAIGMVLERD--------DGSTMMEI  56

Query  237  sKSKGKR---KLYVGSQSLGFRRDHMEALS  317
               KGK+     Y+ + +L   R++MEA+S
Sbjct  57   DGDKGKQGGPTYYIDTNALRVPRENMEAIS  86



>ref|XP_006867761.1| PREDICTED: actin-like protein 6A isoform X1 [Chrysochloris asiatica]
Length=429

 Score = 62.4 bits (150),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 34/88 (39%), Positives = 52/88 (59%), Gaps = 7/88 (8%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsapd  236
            +YGGDEV A+V D+GS+T +AGYAGED PK  FP+ +G + + +        +       
Sbjct  5    VYGGDEVGALVFDIGSYTVRAGYAGEDCPKVDFPTAIGMVSERD------DGSTLMEIDG  58

Query  237  sKSK-GKRKLYVGSQSLGFRRDHMEALS  317
             KSK G    Y+ + +L   R++M+A+S
Sbjct  59   DKSKQGGPTYYIDTNALRVPRENMDAIS  86



>ref|XP_003509127.1| PREDICTED: actin-like protein 6A isoform X1 [Cricetulus griseus]
 gb|EGW10768.1| Actin-like protein 6A [Cricetulus griseus]
Length=429

 Score = 62.4 bits (150),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 53/90 (59%), Gaps = 11/90 (12%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsapd  236
            +YGGDEV A+V D+GS+T +AGYAGED PK  FP+ +G + + +        + S     
Sbjct  5    VYGGDEVGALVFDIGSYTVRAGYAGEDCPKVDFPTAIGMVLERD--------DGSTMMEI  56

Query  237  sKSKGKR---KLYVGSQSLGFRRDHMEALS  317
               KGK+     Y+ + +L   R++MEA+S
Sbjct  57   DGDKGKQGGPTYYIDTNALRVPRENMEAIS  86



>ref|XP_002590506.1| hypothetical protein BRAFLDRAFT_59623 [Branchiostoma floridae]
 gb|EEN46517.1| hypothetical protein BRAFLDRAFT_59623 [Branchiostoma floridae]
Length=424

 Score = 62.4 bits (150),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 51/85 (60%), Gaps = 9/85 (11%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsapd  236
            +YGGDEV A+V D G++T +AGYAGED+PK  FP+ VG ++  E             A  
Sbjct  5    VYGGDEVGALVFDFGAYTTRAGYAGEDSPKVEFPTHVGVVEGAE--------PMDTGATG  56

Query  237  sKSKG-KRKLYVGSQSLGFRRDHME  308
             K +G ++K+Y+   SL   R++ME
Sbjct  57   DKPQGAEKKVYIDYNSLFVARENME  81



>emb|CAB66543.1| hypothetical protein [Homo sapiens]
 emb|CAG38560.1| BAF53A [Homo sapiens]
 gb|ACE86855.1| actin-like 6A protein [synthetic construct]
 gb|ACE87542.1| actin-like 6A protein [synthetic construct]
Length=429

 Score = 62.4 bits (150),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 53/90 (59%), Gaps = 11/90 (12%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsapd  236
            +YGGDEV A+V D+GS+T +AGYAGED PK  FP+ +G + + +        + S     
Sbjct  5    VYGGDEVGALVFDIGSYTVRAGYAGEDCPKVDFPTAIGMVVERD--------DGSTLMEI  56

Query  237  sKSKGKR---KLYVGSQSLGFRRDHMEALS  317
               KGK+     Y+ + +L   R++MEA+S
Sbjct  57   DGDKGKQGGPTYYIDTNALRVPRENMEAIS  86



>ref|NP_004292.1| actin-like protein 6A isoform 1 [Homo sapiens]
 ref|NP_001098029.1| actin-like protein 6A [Macaca mulatta]
 ref|XP_002758129.1| PREDICTED: actin-like protein 6A isoform X1 [Callithrix jacchus]
 ref|XP_003832013.1| PREDICTED: actin-like protein 6A [Pan paniscus]
 ref|XP_003894847.1| PREDICTED: actin-like protein 6A isoform X1 [Papio anubis]
 ref|XP_004038093.1| PREDICTED: actin-like protein 6A isoform 1 [Gorilla gorilla gorilla]
 ref|XP_005546497.1| PREDICTED: actin-like protein 6A isoform X1 [Macaca fascicularis]
 ref|XP_007970221.1| PREDICTED: actin-like protein 6A isoform X1 [Chlorocebus sabaeus]
 ref|XP_009444902.1| PREDICTED: actin-like protein 6A isoform X1 [Pan troglodytes]
 ref|XP_010372176.1| PREDICTED: actin-like protein 6A [Rhinopithecus roxellana]
 sp|O96019.1|ACL6A_HUMAN RecName: Full=Actin-like protein 6A; AltName: Full=53 kDa BRG1-associated 
factor A; AltName: Full=Actin-related protein Baf53a; 
AltName: Full=ArpNbeta; AltName: Full=BRG1-associated 
factor 53A; Short=BAF53A; AltName: Full=INO80 complex subunit 
K [Homo sapiens]
 gb|AAC94991.1| BAF53a [Homo sapiens]
 dbj|BAA74577.1| actin-related protein hArpN beta [Homo sapiens]
 gb|AAH01391.1| Actin-like 6A [Homo sapiens]
 gb|AAH36371.1| Actin-like 6A [Homo sapiens]
 gb|EAW78401.1| actin-like 6A, isoform CRA_c [Homo sapiens]
 dbj|BAG51043.1| unnamed protein product [Homo sapiens]
 dbj|BAJ20830.1| actin-like 6A [synthetic construct]
 gb|ADQ32750.1| actin-like 6A [synthetic construct]
 gb|EHH16580.1| hypothetical protein EGK_11877 [Macaca mulatta]
 gb|AIC53949.1| ACTL6A, partial [synthetic construct]
Length=429

 Score = 62.4 bits (150),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 53/90 (59%), Gaps = 11/90 (12%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsapd  236
            +YGGDEV A+V D+GS+T +AGYAGED PK  FP+ +G + + +        + S     
Sbjct  5    VYGGDEVGALVFDIGSYTVRAGYAGEDCPKVDFPTAIGMVVERD--------DGSTLMEI  56

Query  237  sKSKGKR---KLYVGSQSLGFRRDHMEALS  317
               KGK+     Y+ + +L   R++MEA+S
Sbjct  57   DGDKGKQGGPTYYIDTNALRVPRENMEAIS  86



>ref|NP_062647.2| actin-like protein 6A [Mus musculus]
 ref|XP_006971194.1| PREDICTED: actin-like protein 6A [Peromyscus maniculatus bairdii]
 sp|Q9Z2N8.2|ACL6A_MOUSE RecName: Full=Actin-like protein 6A; AltName: Full=53 kDa BRG1-associated 
factor A; AltName: Full=Actin-related protein Baf53a; 
AltName: Full=BRG1-associated factor 53A; Short=BAF53A 
[Mus musculus]
 gb|AAH01994.1| Actl6a protein [Mus musculus]
 gb|AAH94498.1| Actl6a protein [Mus musculus]
 dbj|BAE39913.1| unnamed protein product [Mus musculus]
 gb|EDL35006.1| actin-like 6A, isoform CRA_a [Mus musculus]
Length=429

 Score = 62.4 bits (150),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 53/90 (59%), Gaps = 11/90 (12%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsapd  236
            +YGGDEV A+V D+GS+T +AGYAGED PK  FP+ +G + + +        + S     
Sbjct  5    VYGGDEVGALVFDIGSYTVRAGYAGEDCPKVDFPTAIGVVLERD--------DGSTMMEI  56

Query  237  sKSKGKR---KLYVGSQSLGFRRDHMEALS  317
               KGK+     Y+ + +L   R++MEA+S
Sbjct  57   DGDKGKQGGPTYYIDTNALRVPRENMEAIS  86



>gb|AAC94992.1| BAF53a [Mus musculus]
Length=429

 Score = 62.0 bits (149),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 53/90 (59%), Gaps = 11/90 (12%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsapd  236
            +YGGDEV A+V D+GS+T +AGYAGED PK  FP+ +G + + +        + S     
Sbjct  5    VYGGDEVGALVFDIGSYTVRAGYAGEDCPKVDFPTAIGVVLERD--------DGSTMMEI  56

Query  237  sKSKGKR---KLYVGSQSLGFRRDHMEALS  317
               KGK+     Y+ + +L   R++MEA+S
Sbjct  57   DGDKGKQGGPTYYIDTNALRVPRENMEAIS  86



>dbj|BAE41036.1| unnamed protein product [Mus musculus]
Length=429

 Score = 62.0 bits (149),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 53/90 (59%), Gaps = 11/90 (12%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsapd  236
            +YGGDEV A+V D+GS+T +AGYAGED PK  FP+ +G + + +        + S     
Sbjct  5    VYGGDEVGALVFDIGSYTVRAGYAGEDCPKVDFPTAIGVVLERD--------DGSTMMEI  56

Query  237  sKSKGKR---KLYVGSQSLGFRRDHMEALS  317
               KGK+     Y+ + +L   R++MEA+S
Sbjct  57   DGDKGKQGGPTYYIDTNALRVPRENMEAIS  86



>ref|XP_005883069.1| PREDICTED: actin-like protein 6A [Myotis brandtii]
 gb|EPQ18151.1| Actin-like protein 6A [Myotis brandtii]
Length=429

 Score = 62.0 bits (149),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 33/87 (38%), Positives = 51/87 (59%), Gaps = 5/87 (6%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsapd  236
            +YGGDEV A+V D+GS+T +AGYAGED PK  FP+ +G + + +     +         D
Sbjct  5    VYGGDEVGALVFDIGSYTVRAGYAGEDCPKVDFPTAIGMVVERD-----DGSTLMEIDGD  59

Query  237  sKSKGKRKLYVGSQSLGFRRDHMEALS  317
               +G    Y+ + +L   R++MEA+S
Sbjct  60   KGKQGGPTYYIDTNALRVPRENMEAIS  86



>emb|CEI91007.1| hypothetical protein RMCBS344292_05311 [Rhizopus microsporus]
Length=419

 Score = 62.0 bits (149),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 29/85 (34%), Positives = 50/85 (59%), Gaps = 10/85 (12%)
 Frame = +3

Query  54   IMYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsap  233
            + YGGDEV+A+V+D+G+ + +AGYAGED P+ +FP+  G ++Q +    ++   +     
Sbjct  2    VAYGGDEVNALVLDIGTSSVRAGYAGEDTPRCMFPTSFGYLEQRQQQEGEDVSMDI----  57

Query  234  dsKSKGKRKLYVGSQSLGFRRDHME  308
                  KR+ Y+G   +   + HME
Sbjct  58   ------KRQYYIGDNKINKLKSHME  76



>ref|XP_008836882.1| PREDICTED: actin-like protein 6A isoform X1 [Nannospalax galili]
Length=429

 Score = 62.0 bits (149),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 53/90 (59%), Gaps = 11/90 (12%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsapd  236
            +YGGDEV A+V D+GS+T +AGYAGED PK  FP+ +G + + +        + S     
Sbjct  5    VYGGDEVGALVFDIGSYTVRAGYAGEDCPKVDFPTAIGMVLERD--------DGSTLMEI  56

Query  237  sKSKGKR---KLYVGSQSLGFRRDHMEALS  317
               KGK+     Y+ + +L   R++MEA+S
Sbjct  57   DGDKGKQGGPTYYIDTNALRVPRENMEAIS  86



>ref|XP_003467569.1| PREDICTED: actin-like protein 6A [Cavia porcellus]
 ref|XP_003794325.1| PREDICTED: actin-like protein 6A isoform 1 [Otolemur garnettii]
 ref|XP_004479022.1| PREDICTED: actin-like protein 6A [Dasypus novemcinctus]
 ref|XP_004591333.1| PREDICTED: actin-like protein 6A isoform X1 [Ochotona princeps]
 ref|XP_006210678.1| PREDICTED: actin-like protein 6A isoform X1 [Vicugna pacos]
 ref|XP_008058677.1| PREDICTED: actin-like protein 6A [Tarsius syrichta]
 ref|XP_008566331.1| PREDICTED: actin-like protein 6A [Galeopterus variegatus]
Length=429

 Score = 62.0 bits (149),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 33/87 (38%), Positives = 51/87 (59%), Gaps = 5/87 (6%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsapd  236
            +YGGDEV A+V D+GS+T +AGYAGED PK  FP+ +G + + +     +         D
Sbjct  5    VYGGDEVGALVFDIGSYTVRAGYAGEDCPKVDFPTAIGMVVERD-----DGSTLMEIDGD  59

Query  237  sKSKGKRKLYVGSQSLGFRRDHMEALS  317
               +G    Y+ + +L   R++MEA+S
Sbjct  60   KGKQGGPTYYIDTNALRVPRENMEAIS  86



>ref|XP_005343823.1| PREDICTED: actin-like protein 6A [Microtus ochrogaster]
Length=429

 Score = 62.0 bits (149),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 53/90 (59%), Gaps = 11/90 (12%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsapd  236
            +YGGDEV A+V D+GS+T +AGYAGED PK  FP+ +G + + +        + S     
Sbjct  5    VYGGDEVGALVFDIGSYTVRAGYAGEDCPKVDFPTAIGVVLERD--------DGSTMMEI  56

Query  237  sKSKGKR---KLYVGSQSLGFRRDHMEALS  317
               KGK+     Y+ + +L   R++MEA+S
Sbjct  57   DGDKGKQGGPTYYIDTNALRVPRENMEAIS  86



>ref|XP_006084957.1| PREDICTED: LOW QUALITY PROTEIN: actin-like protein 6A [Myotis 
lucifugus]
Length=423

 Score = 62.0 bits (149),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 51/87 (59%), Gaps = 5/87 (6%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsapd  236
            +YGGDEV A+V D+GS+T +AGYAGED PK  FP+ +G + + +     +         D
Sbjct  5    VYGGDEVGALVFDIGSYTVRAGYAGEDCPKVDFPTAIGMVVERD-----DGSTLMEIDGD  59

Query  237  sKSKGKRKLYVGSQSLGFRRDHMEALS  317
               +G    Y+ + +L   R++MEA+S
Sbjct  60   KGKQGGPTYYIDTNALRVPRENMEAIS  86



>ref|XP_002716488.1| PREDICTED: actin-like protein 6A [Oryctolagus cuniculus]
Length=429

 Score = 62.0 bits (149),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 33/87 (38%), Positives = 51/87 (59%), Gaps = 5/87 (6%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsapd  236
            +YGGDEV A+V D+GS+T +AGYAGED PK  FP+ +G + + +     +         D
Sbjct  5    VYGGDEVGALVFDIGSYTVRAGYAGEDCPKVDFPTAIGMVMERD-----DGSTLMEIDGD  59

Query  237  sKSKGKRKLYVGSQSLGFRRDHMEALS  317
               +G    Y+ + +L   R++MEA+S
Sbjct  60   KGKQGGPTYYIDTNALRVPRENMEAIS  86



>ref|XP_422784.3| PREDICTED: actin-like 6A [Gallus gallus]
Length=429

 Score = 62.0 bits (149),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 34/87 (39%), Positives = 51/87 (59%), Gaps = 5/87 (6%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsapd  236
            +YGGDEV A+V D+GS+T +AGYAGED PK  FP+ +G + + +     N         D
Sbjct  5    VYGGDEVGALVFDIGSYTVRAGYAGEDCPKVDFPTAIGVVLERD-----NGSTLMEIDGD  59

Query  237  sKSKGKRKLYVGSQSLGFRRDHMEALS  317
               +G    Y+ + +L   R++MEA+S
Sbjct  60   KGKQGGPTYYIDTNALRVPRENMEAIS  86



>ref|XP_010571227.1| PREDICTED: actin-like protein 6A [Haliaeetus leucocephalus]
Length=429

 Score = 62.0 bits (149),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 34/87 (39%), Positives = 51/87 (59%), Gaps = 5/87 (6%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsapd  236
            +YGGDEV A+V D+GS+T +AGYAGED PK  FP+ +G + + +     N         D
Sbjct  5    VYGGDEVGALVFDIGSYTVRAGYAGEDCPKVDFPTAIGVVLERD-----NGSALMEIDGD  59

Query  237  sKSKGKRKLYVGSQSLGFRRDHMEALS  317
               +G    Y+ + +L   R++MEA+S
Sbjct  60   KGKQGGPTYYIDTNALRVPRENMEAIS  86



>ref|XP_005484852.1| PREDICTED: actin-like protein 6A [Zonotrichia albicollis]
 ref|XP_009087298.1| PREDICTED: actin-like protein 6A [Serinus canaria]
Length=429

 Score = 62.0 bits (149),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 34/87 (39%), Positives = 51/87 (59%), Gaps = 5/87 (6%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsapd  236
            +YGGDEV A+V D+GS+T +AGYAGED PK  FP+ +G + + +     N         D
Sbjct  5    VYGGDEVGALVFDIGSYTVRAGYAGEDCPKVDFPTAIGVVLERD-----NGSTLMEIDGD  59

Query  237  sKSKGKRKLYVGSQSLGFRRDHMEALS  317
               +G    Y+ + +L   R++MEA+S
Sbjct  60   KGKQGGPTYYIDTNALRVPRENMEAIS  86



>ref|XP_005146975.1| PREDICTED: actin-like protein 6A [Melopsittacus undulatus]
 ref|XP_009286317.1| PREDICTED: actin-like protein 6A isoform X1 [Aptenodytes forsteri]
Length=429

 Score = 62.0 bits (149),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 34/87 (39%), Positives = 51/87 (59%), Gaps = 5/87 (6%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsapd  236
            +YGGDEV A+V D+GS+T +AGYAGED PK  FP+ +G + + +     N         D
Sbjct  5    VYGGDEVGALVFDIGSYTVRAGYAGEDCPKVDFPTAIGVVLERD-----NGSTLMEIDGD  59

Query  237  sKSKGKRKLYVGSQSLGFRRDHMEALS  317
               +G    Y+ + +L   R++MEA+S
Sbjct  60   KGKQGGPTYYIDTNALRVPRENMEAIS  86



>ref|XP_004337370.1| actin, putative [Acanthamoeba castellanii str. Neff]
 gb|ELR15357.1| actin, putative [Acanthamoeba castellanii str. Neff]
Length=142

 Score = 59.3 bits (142),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +3

Query  66   GDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVG  170
            GDEV A+V+D GS  CKAG+AG+DAP+AVFPSIVG
Sbjct  2    GDEVQALVIDNGSGMCKAGFAGDDAPRAVFPSIVG  36



>ref|XP_005383099.1| PREDICTED: actin-like protein 6A isoform X2 [Chinchilla lanigera]
 ref|XP_010630761.1| PREDICTED: actin-like protein 6A [Fukomys damarensis]
 gb|KFO29827.1| Actin-like protein 6A [Fukomys damarensis]
Length=429

 Score = 62.0 bits (149),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 33/87 (38%), Positives = 51/87 (59%), Gaps = 5/87 (6%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsapd  236
            +YGGDEV A+V D+GS+T +AGYAGED PK  FP+ +G + + +     +         D
Sbjct  5    VYGGDEVGALVFDIGSYTVRAGYAGEDCPKVDFPTAIGMVLERD-----DGSTLMEIDGD  59

Query  237  sKSKGKRKLYVGSQSLGFRRDHMEALS  317
               +G    Y+ + +L   R++MEA+S
Sbjct  60   KGKQGGPTYYIDTNALRVPRENMEAIS  86



>gb|KFM13458.1| Actin-like 6A [Aptenodytes forsteri]
Length=379

 Score = 61.6 bits (148),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 34/87 (39%), Positives = 51/87 (59%), Gaps = 5/87 (6%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsapd  236
            +YGGDEV A+V D+GS+T +AGYAGED PK  FP+ +G + + +     N         D
Sbjct  5    VYGGDEVGALVFDIGSYTVRAGYAGEDCPKVDFPTAIGVVLERD-----NGSTLMEIDGD  59

Query  237  sKSKGKRKLYVGSQSLGFRRDHMEALS  317
               +G    Y+ + +L   R++MEA+S
Sbjct  60   KGKQGGPTYYIDTNALRVPRENMEAIS  86



>ref|XP_004901945.1| PREDICTED: actin-like protein 6A isoform X1 [Heterocephalus glaber]
 ref|XP_004834691.1| PREDICTED: actin-like protein 6A isoform X1 [Heterocephalus glaber]
 gb|EHB13876.1| Actin-like protein 6A [Heterocephalus glaber]
Length=429

 Score = 62.0 bits (149),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 53/90 (59%), Gaps = 11/90 (12%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsapd  236
            +YGGDEV A+V D+GS+T +AGYAGED PK  FP+ +G + + +        + S     
Sbjct  5    VYGGDEVGALVFDIGSYTVRAGYAGEDCPKVDFPTAIGMVLERD--------DGSTLMEI  56

Query  237  sKSKGKR---KLYVGSQSLGFRRDHMEALS  317
               KGK+     Y+ + +L   R++MEA+S
Sbjct  57   DGDKGKQGGPSYYIDTNALRVPRENMEAIS  86



>ref|XP_006276038.1| PREDICTED: actin-like protein 6A [Alligator mississippiensis]
Length=429

 Score = 62.0 bits (149),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 33/87 (38%), Positives = 51/87 (59%), Gaps = 5/87 (6%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsapd  236
            +YGGDEV A+V D+GS+T +AGYAGED PK  FP+ +G + + +     +         D
Sbjct  5    VYGGDEVGALVFDIGSYTVRAGYAGEDCPKVDFPTAIGVVLERD-----DGSTLMEIDGD  59

Query  237  sKSKGKRKLYVGSQSLGFRRDHMEALS  317
               +G    Y+ + +L   R++MEA+S
Sbjct  60   KGKQGGPTYYIDTNALRVPRENMEAIS  86



>ref|XP_005286018.1| PREDICTED: actin-like protein 6A [Chrysemys picta bellii]
Length=429

 Score = 62.0 bits (149),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 33/87 (38%), Positives = 51/87 (59%), Gaps = 5/87 (6%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsapd  236
            +YGGDEV A+V D+GS+T +AGYAGED PK  FP+ +G + + +     +         D
Sbjct  5    VYGGDEVGALVFDIGSYTVRAGYAGEDCPKVDFPTAIGVVLERD-----DGSTLMEIDGD  59

Query  237  sKSKGKRKLYVGSQSLGFRRDHMEALS  317
               +G    Y+ + +L   R++MEA+S
Sbjct  60   KGKQGGPTYYIDTNALRVPRENMEAIS  86



>ref|XP_004647347.1| PREDICTED: actin-like protein 6A isoform X1 [Octodon degus]
Length=429

 Score = 62.0 bits (149),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 33/87 (38%), Positives = 51/87 (59%), Gaps = 5/87 (6%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsapd  236
            +YGGDEV A+V D+GS+T +AGYAGED PK  FP+ +G + + +     +         D
Sbjct  5    VYGGDEVGALVFDIGSYTVRAGYAGEDCPKVDFPTAIGVVLERD-----DGSTLMEIDGD  59

Query  237  sKSKGKRKLYVGSQSLGFRRDHMEALS  317
               +G    Y+ + +L   R++MEA+S
Sbjct  60   KGKQGGPTYYIDTNALRVPRENMEAIS  86



>ref|XP_007302894.1| brg1-associated factor b [Stereum hirsutum FP-91666 SS1]
 gb|EIM88243.1| brg1-associated factor b [Stereum hirsutum FP-91666 SS1]
Length=440

 Score = 62.0 bits (149),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 26/43 (60%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  54   IMYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQ  182
            + YGGDEVSA+V+D+G+ T +AGYAG+DAPKA+ P+  G I Q
Sbjct  2    VQYGGDEVSALVLDIGTSTLRAGYAGDDAPKAIIPTSYGYITQ  44



>ref|XP_003256548.1| PREDICTED: actin-like protein 6A isoform 1 [Nomascus leucogenys]
Length=429

 Score = 62.0 bits (149),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 51/87 (59%), Gaps = 5/87 (6%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsapd  236
            +YGGDEV A+V D+GS+T +AGYAGED PK  FP+ +G    M V+  D           
Sbjct  5    VYGGDEVGALVFDIGSYTVRAGYAGEDCPKVDFPTAIG----MMVERDDGSTLMEIDGDK  60

Query  237  sKSKGKRKLYVGSQSLGFRRDHMEALS  317
             K +G    Y+ + +L   R++MEA+S
Sbjct  61   GK-QGGPTYYIDTNALRVPRENMEAIS  86



>gb|ABD83882.1| cytoskeletal beta actin [Ictalurus punctatus]
Length=74

 Score = 58.2 bits (139),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +3

Query  69   DEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVG  170
            DE++A+VVD GS  CKAG+AG+DAP+AVFPSIVG
Sbjct  9    DEIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG  42



>ref|XP_007512384.1| unknown [Bathycoccus prasinos]
 emb|CCO16984.1| unknown [Bathycoccus prasinos]
Length=459

 Score = 62.0 bits (149),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVG  170
            MYGGDEVSAIV+D+G+H+ KAGYAG+D P AVF S VG
Sbjct  1    MYGGDEVSAIVMDVGTHSVKAGYAGQDTPSAVFSSSVG  38



>ref|XP_004335590.1| actin-1, putative, partial [Acanthamoeba castellanii str. Neff]
 gb|ELR13577.1| actin-1, putative, partial [Acanthamoeba castellanii str. Neff]
Length=162

 Score = 59.3 bits (142),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +3

Query  66   GDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVG  170
            GDEV A+V+D GS  CKAG+AG+DAP+AVFPSIVG
Sbjct  2    GDEVQALVIDNGSGMCKAGFAGDDAPRAVFPSIVG  36



>gb|ADK94900.1| beta-actin [Hyriopsis cumingii]
Length=134

 Score = 58.9 bits (141),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVG  170
            M G D+V+A+VVD GS  CKAG+AG+DAP+AVFPSIVG
Sbjct  1    MSGEDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG  38



>gb|KHJ74840.1| hypothetical protein OESDEN_25544 [Oesophagostomum dentatum]
Length=64

 Score = 57.8 bits (138),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +3

Query  69   DEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVG  170
            DEV+A+VVD GS  CKAG+AG+DAP+AVFPSIVG
Sbjct  4    DEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG  37



>ref|XP_003747100.1| PREDICTED: actin-like protein 6B [Metaseiulus occidentalis]
Length=419

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = +3

Query  48   SSIMYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQM  185
            SS +YGGDEV A+V D G ++ +AGYAGEDAPKA  PS +G +DQ+
Sbjct  2    SSGIYGGDEVGAVVFDYGHYSFRAGYAGEDAPKADIPSAIGLVDQL  47



>ref|XP_008291929.1| PREDICTED: actin-like protein 6A isoform X2 [Stegastes partitus]
Length=429

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 54/91 (59%), Gaps = 13/91 (14%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVG-SIDQMEVdnpdnpdnnsgsap  233
            +YGGDEV A+V D+GS++ +AGYAGED PKA FP+++G ++D+ +          S    
Sbjct  5    VYGGDEVGALVFDIGSYSVRAGYAGEDCPKADFPTVIGVTLDRED---------GSTPME  55

Query  234  dsKSKGKR---KLYVGSQSLGFRRDHMEALS  317
                KGK+     Y+ +  L   R++ME +S
Sbjct  56   TDGDKGKQSGTTYYIDTNQLRVPRENMEVMS  86



>ref|XP_004570293.1| PREDICTED: actin-like protein 6A-like isoform X3 [Maylandia zebra]
 ref|XP_005746794.1| PREDICTED: actin-like protein 6A-like isoform X1 [Pundamilia 
nyererei]
 ref|XP_005931068.1| PREDICTED: actin-like protein 6A-like isoform X2 [Haplochromis 
burtoni]
Length=429

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 54/91 (59%), Gaps = 13/91 (14%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVG-SIDQMEVdnpdnpdnnsgsap  233
            +YGGDEV A+V D+GS++ +AGYAGED PKA FP+++G ++D+ +          S    
Sbjct  5    VYGGDEVGALVFDIGSYSVRAGYAGEDCPKADFPTVIGVTLDRED---------GSTPME  55

Query  234  dsKSKGKR---KLYVGSQSLGFRRDHMEALS  317
                KGK+     Y+ +  L   R++ME +S
Sbjct  56   TDGDKGKQSGTTYYIDTNQLRVPRENMEVMS  86



>ref|XP_003439834.1| PREDICTED: actin-like protein 6A-like isoform 1 [Oreochromis 
niloticus]
Length=429

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 54/91 (59%), Gaps = 13/91 (14%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVG-SIDQMEVdnpdnpdnnsgsap  233
            +YGGDEV A+V D+GS++ +AGYAGED PKA FP+++G ++D+ +          S    
Sbjct  5    VYGGDEVGALVFDIGSYSVRAGYAGEDCPKADFPTVIGVTLDRED---------GSTPME  55

Query  234  dsKSKGKR---KLYVGSQSLGFRRDHMEALS  317
                KGK+     Y+ +  L   R++ME +S
Sbjct  56   TDGDKGKQSGTTYYIDTNQLRVPRENMEVMS  86



>ref|XP_008291928.1| PREDICTED: actin-like protein 6A isoform X1 [Stegastes partitus]
Length=433

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 54/91 (59%), Gaps = 13/91 (14%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVG-SIDQMEVdnpdnpdnnsgsap  233
            +YGGDEV A+V D+GS++ +AGYAGED PKA FP+++G ++D+ +          S    
Sbjct  5    VYGGDEVGALVFDIGSYSVRAGYAGEDCPKADFPTVIGVTLDRED---------GSTPME  55

Query  234  dsKSKGKR---KLYVGSQSLGFRRDHMEALS  317
                KGK+     Y+ +  L   R++ME +S
Sbjct  56   TDGDKGKQSGTTYYIDTNQLRVPRENMEVMS  86



>ref|XP_004257596.1| actin 2 protein, putative, partial [Entamoeba invadens IP1]
 gb|ELP90825.1| actin 2 protein, putative, partial [Entamoeba invadens IP1]
Length=70

 Score = 57.8 bits (138),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +3

Query  72   EVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEV  191
            EV A+VVD GS  CKAG+AG+DAP+AVFPSIVG   Q+ V
Sbjct  6    EVQALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPKQVSV  45



>emb|CEL58128.1| Actin-related protein 4 OS=Emericella nidulans (strain FGSC A4 
/ ATCC 38163 / CBS 112,46 / NRRL 194 / M139) GN=arp4 PE=3 
SV=1 [Rhizoctonia solani AG-1 IB]
Length=423

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +3

Query  54   IMYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVG  170
            + YGGDEVSA+V+D+G+ T +AGYAG+D PKAVFP+  G
Sbjct  2    VAYGGDEVSALVLDIGTSTTRAGYAGDDVPKAVFPTTFG  40



>ref|XP_004708658.1| PREDICTED: actin-like protein 6A isoform X1 [Echinops telfairi]
Length=429

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 53/90 (59%), Gaps = 11/90 (12%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsapd  236
            +YGGDEV A+V D+GS+T +AGYAGED PK  FP+ +G + + +        + S     
Sbjct  5    VYGGDEVGALVFDIGSYTVRAGYAGEDCPKVDFPTAIGMVSERD--------DGSTLMEI  56

Query  237  sKSKGKR---KLYVGSQSLGFRRDHMEALS  317
               KGK+     Y+ + +L   R++M+A+S
Sbjct  57   DGDKGKQGGPTYYIDTNALRVPRENMDAIS  86



>gb|ESA10096.1| hypothetical protein GLOINDRAFT_199267 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX56816.1| actin [Rhizophagus irregularis DAOM 197198w]
Length=442

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +3

Query  60   YGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQ  182
            YGGDEVSAIV+D+GS   +AGYAGED PKAVFP+  G I++
Sbjct  4    YGGDEVSAIVLDVGSCWTRAGYAGEDTPKAVFPTSYGYIEE  44



>ref|XP_007946463.1| PREDICTED: actin-like protein 6A isoform X1 [Orycteropus afer 
afer]
Length=429

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 53/90 (59%), Gaps = 11/90 (12%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsapd  236
            +YGGDEV A+V D+GS+T +AGYAGED PK  FP+ +G + + +        + S     
Sbjct  5    VYGGDEVGALVFDIGSYTVRAGYAGEDCPKVDFPTAIGMVSERD--------DGSTLMEI  56

Query  237  sKSKGKR---KLYVGSQSLGFRRDHMEALS  317
               KGK+     Y+ + +L   R++M+A+S
Sbjct  57   DGDKGKQGGPTYYIDTNALRVPRENMDAIS  86



>ref|XP_002406965.1| actin, putative [Ixodes scapularis]
 gb|EEC12237.1| actin, putative, partial [Ixodes scapularis]
Length=258

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQM  185
            +YGGDEV A+V DLG ++ +AGYAGED+PKA  PS VG I+++
Sbjct  5    VYGGDEVGALVFDLGHYSVRAGYAGEDSPKAEIPSAVGVIEEL  47



>gb|EFA84276.1| actin-like protein 6A [Polysphondylium pallidum PN500]
Length=425

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 35/86 (41%), Positives = 53/86 (62%), Gaps = 2/86 (2%)
 Frame = +3

Query  57   MYGG-DEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVG-SIDQMEVdnpdnpdnnsgsa  230
            MYGG D+VSA+V+D+G+   K GYAGED+PKA+FP+ VG +    +     + +   G  
Sbjct  1    MYGGGDDVSAVVLDVGTSYSKGGYAGEDSPKAIFPTDVGVTYTSGKDGMVGSREQGIGED  60

Query  231  pdsKSKGKRKLYVGSQSLGFRRDHME  308
             D     K+  Y+G+ S+ ++R HME
Sbjct  61   QDMDQDVKKTYYIGTNSITYKRPHME  86



>gb|KIH49298.1| hypothetical protein ANCDUO_20628 [Ancylostoma duodenale]
Length=78

 Score = 57.8 bits (138),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +3

Query  69   DEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVG  170
            DEV+A+VVD GS  CKAG+AG+DAP+AVFPSIVG
Sbjct  4    DEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG  37



>ref|XP_010745346.1| PREDICTED: actin-like protein 6A [Larimichthys crocea]
Length=429

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 54/91 (59%), Gaps = 13/91 (14%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVG-SIDQMEVdnpdnpdnnsgsap  233
            +YGGDEV A+V D+GS++ +AGYAGED PKA FP+++G ++D+ +          S    
Sbjct  5    VYGGDEVGALVFDIGSYSVRAGYAGEDCPKADFPTVIGVTLDRED---------GSTPME  55

Query  234  dsKSKGKR---KLYVGSQSLGFRRDHMEALS  317
                KGK+     Y+ +  L   R++ME +S
Sbjct  56   TDGDKGKQSGTTYYIDTNQLRVPRENMEVMS  86



>gb|AAS55431.1| beta-actin [Labeo rohita]
Length=41

 Score = 57.0 bits (136),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +3

Query  69   DEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVG  170
            DE++A+VVD GS  CKAG+AG+DAP+AVFPSIVG
Sbjct  3    DEIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG  36



>ref|XP_009544018.1| actin-related protein 4 [Heterobasidion irregulare TC 32-1]
 gb|ETW84337.1| actin-related protein 4 [Heterobasidion irregulare TC 32-1]
Length=437

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/43 (63%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +3

Query  54   IMYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQ  182
            + YGGDEVSA+VVD+GS T +AGYAG+D PKA+ P+  G I Q
Sbjct  2    VQYGGDEVSALVVDIGSSTLRAGYAGDDTPKAIIPTSYGFIPQ  44



>ref|XP_004652131.1| PREDICTED: actin-like protein 6A [Jaculus jaculus]
Length=411

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 33/87 (38%), Positives = 50/87 (57%), Gaps = 5/87 (6%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsapd  236
            +YGGDEV A+V D+GS+T +AGYAGED PK  FP+ +G + + +     +         D
Sbjct  5    VYGGDEVGALVFDIGSYTVRAGYAGEDCPKVDFPTAIGMVVERD-----DGSTLMEIDGD  59

Query  237  sKSKGKRKLYVGSQSLGFRRDHMEALS  317
               +G    Y+ + +L   R+ MEA+S
Sbjct  60   KGKQGGPTYYIDTNALRVPRESMEAIS  86



>ref|XP_004332908.1| actin subfamily protein [Acanthamoeba castellanii str. Neff]
 gb|ELR10895.1| actin subfamily protein [Acanthamoeba castellanii str. Neff]
Length=198

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +3

Query  66   GDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVG  170
            GDEV A+V+D GS  CKAG+AG+DAP+AVFPSIVG
Sbjct  2    GDEVQALVIDNGSGMCKAGFAGDDAPRAVFPSIVG  36



>gb|EDM01200.1| rCG41530, isoform CRA_b [Rattus norvegicus]
Length=415

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 52/90 (58%), Gaps = 11/90 (12%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsapd  236
            +YGGDEV A+V D+GS+T +AGYAGED PK  FP+ +G + + +        + S     
Sbjct  5    VYGGDEVGALVFDIGSYTVRAGYAGEDCPKVDFPTAIGVVLERD--------DGSTMMEI  56

Query  237  sKSKGKR---KLYVGSQSLGFRRDHMEALS  317
               KGK+     Y+ + +L   R+ MEA+S
Sbjct  57   DGDKGKQGGPTYYIDTNALRVPRESMEAIS  86



>emb|CEG67674.1| hypothetical protein RMATCC62417_04071 [Rhizopus microsporus]
Length=419

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 29/85 (34%), Positives = 51/85 (60%), Gaps = 10/85 (12%)
 Frame = +3

Query  54   IMYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsap  233
            + YGGDEV+A+V+D+G+ + +AGYAGED P+ +FP+  G ++Q +  + ++   +     
Sbjct  2    VAYGGDEVNALVLDIGTSSVRAGYAGEDTPRCMFPTRFGYLEQGQQQDGEDVSMDM----  57

Query  234  dsKSKGKRKLYVGSQSLGFRRDHME  308
                  KR+ Y+G   +   + HME
Sbjct  58   ------KRQYYIGDNKINKLKSHME  76



>ref|XP_002124021.1| PREDICTED: actin-like protein 6B isoform X1 [Ciona intestinalis]
Length=423

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 29/46 (63%), Positives = 37/46 (80%), Gaps = 2/46 (4%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVG--SIDQME  188
            +YGGDEV A+V D+GS+T +AGYAGED PKA FP+ +G   I+QME
Sbjct  5    VYGGDEVGALVFDIGSNTVRAGYAGEDCPKADFPTHLGLEVIEQME  50



>emb|CEI97204.1| hypothetical protein RMCBS344292_11340 [Rhizopus microsporus]
Length=419

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 29/85 (34%), Positives = 51/85 (60%), Gaps = 10/85 (12%)
 Frame = +3

Query  54   IMYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsap  233
            + YGGDEV+A+V+D+G+ + +AGYAGED P+ +FP+  G ++Q +  + ++   +     
Sbjct  2    VAYGGDEVNALVLDIGTSSVRAGYAGEDTPRCMFPTRFGYLEQGQQQDGEDVSMDM----  57

Query  234  dsKSKGKRKLYVGSQSLGFRRDHME  308
                  KR+ Y+G   +   + HME
Sbjct  58   ------KRQYYIGDNKINKLKSHME  76



>ref|XP_008122944.1| PREDICTED: actin-like protein 6B [Anolis carolinensis]
Length=429

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 50/87 (57%), Gaps = 8/87 (9%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsapd  236
            +YGGDEV A+V D+GS + +AGYAGED PKA FP+ VG +   E        +      D
Sbjct  5    VYGGDEVGALVFDIGSFSIRAGYAGEDCPKADFPTTVGLLSHDE--------SAMELEGD  56

Query  237  sKSKGKRKLYVGSQSLGFRRDHMEALS  317
             ++K  +  Y+ + SL   R++ E +S
Sbjct  57   KENKAGKVYYIDTNSLHVPRENTEVIS  83



>ref|NP_989337.1| actin-like 6A [Xenopus (Silurana) tropicalis]
 gb|AAH64183.1| actin-like 6A [Xenopus (Silurana) tropicalis]
 emb|CAJ82562.1| novel protein similar to actin-like protein 6a (Actl6a, Baf53a) 
[Xenopus (Silurana) tropicalis]
Length=429

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 35/87 (40%), Positives = 50/87 (57%), Gaps = 5/87 (6%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsapd  236
            +YGGDEV A+V D+GS++ +AGYAGED PK  FP+ +G +   E    D           
Sbjct  5    VYGGDEVGALVFDIGSYSVRAGYAGEDCPKVDFPTTIGVVIDRE----DGSTPMETDGDQ  60

Query  237  sKSKGKRKLYVGSQSLGFRRDHMEALS  317
            +KS+     Y+ + SL   R++MEA S
Sbjct  61   NKSRSP-TYYIDTNSLRVPRENMEAFS  86



>ref|XP_006884086.1| PREDICTED: actin-like protein 6A isoform X1 [Elephantulus edwardii]
Length=429

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 53/90 (59%), Gaps = 11/90 (12%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsapd  236
            +YGGDEV A+V D+GS+T +AGYAGED PK  FP+ +G + + +        + S     
Sbjct  5    VYGGDEVGALVFDIGSYTVRAGYAGEDCPKVDFPTAIGMVSERD--------DGSTLMEI  56

Query  237  sKSKGKR---KLYVGSQSLGFRRDHMEALS  317
               KGK+     Y+ + +L   R++M+A+S
Sbjct  57   DGDKGKQGGPTYYIDTNALRVPRENMDAVS  86



>ref|NP_001080451.1| actin-like 6A [Xenopus laevis]
 gb|AAH43771.1| Baf53a-pending-prov protein [Xenopus laevis]
Length=429

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 35/87 (40%), Positives = 50/87 (57%), Gaps = 5/87 (6%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsapd  236
            +YGGDEV A+V D+GS++ +AGYAGED PK  FP+ +G +   E    D           
Sbjct  5    VYGGDEVGALVFDIGSYSVRAGYAGEDCPKVDFPTTIGVVIDRE----DGSTPMETDGDQ  60

Query  237  sKSKGKRKLYVGSQSLGFRRDHMEALS  317
            +KS+     Y+ + SL   R++MEA S
Sbjct  61   NKSRSP-TYYIDTNSLRVPRENMEAFS  86



>ref|NP_001034122.1| actin-like protein 6A [Rattus norvegicus]
 gb|AAH98698.1| Actin-like 6A [Rattus norvegicus]
Length=429

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 52/90 (58%), Gaps = 11/90 (12%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsapd  236
            +YGGDEV A+V D+GS+T +AGYAGED PK  FP+ +G + + +        + S     
Sbjct  5    VYGGDEVGALVFDIGSYTVRAGYAGEDCPKVDFPTAIGVVLERD--------DGSTMMEI  56

Query  237  sKSKGKR---KLYVGSQSLGFRRDHMEALS  317
               KGK+     Y+ + +L   R+ MEA+S
Sbjct  57   DGDKGKQGGPTYYIDTNALRVPRESMEAIS  86



>ref|XP_004225706.1| PREDICTED: actin-like protein 6A isoform X2 [Ciona intestinalis]
Length=349

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 29/46 (63%), Positives = 37/46 (80%), Gaps = 2/46 (4%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVG--SIDQME  188
            +YGGDEV A+V D+GS+T +AGYAGED PKA FP+ +G   I+QME
Sbjct  5    VYGGDEVGALVFDIGSNTVRAGYAGEDCPKADFPTHLGLEVIEQME  50



>emb|CCA69498.1| related to ACT1-actin [Piriformospora indica DSM 11827]
Length=416

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +3

Query  54   IMYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQ  182
            +++GGD+VSA+V+D+G+HT +AGYAG+DAPKAVF S  G  D+
Sbjct  2    VVFGGDDVSALVLDIGAHTVRAGYAGDDAPKAVFSSSYGYRDE  44



>ref|XP_007422848.1| PREDICTED: actin-like protein 6A [Python bivittatus]
Length=429

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 51/87 (59%), Gaps = 5/87 (6%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsapd  236
            +YGGDEV A+V D+GS T +AGYAGED PK  FP+ +G      V + D+  +      D
Sbjct  5    VYGGDEVGALVFDIGSCTVRAGYAGEDCPKVDFPTAIGV-----VLDRDDGSSMMEIDSD  59

Query  237  sKSKGKRKLYVGSQSLGFRRDHMEALS  317
               +G    Y+ + +L   R++MEA+S
Sbjct  60   KNKQGGPTYYIDTNALRVPRENMEAIS  86



>ref|XP_005778501.1| putative actin, partial [Emiliania huxleyi CCMP1516]
 gb|EOD26072.1| putative actin, partial [Emiliania huxleyi CCMP1516]
Length=80

 Score = 57.4 bits (137),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +3

Query  69   DEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQ  182
            DEV+A+VVD GS  CKAG+AG+DAP+AVFPSI+G   Q
Sbjct  4    DEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIIGRPRQ  41



>gb|ACF32688.1| actin [Amphidinium carterae]
Length=97

 Score = 57.8 bits (138),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +3

Query  69   DEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVG  170
            +EV+A+VVD+GS  CKAG+AG+DAP+AVFPSIVG
Sbjct  4    EEVAALVVDIGSGMCKAGFAGDDAPRAVFPSIVG  37



>gb|AAA27887.1| actin, partial [Caenorhabditis elegans]
 gb|AAA27889.1| actin, partial [Caenorhabditis elegans]
Length=86

 Score = 57.4 bits (137),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +3

Query  69   DEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVG  170
            DEV+A+VVD GS  CKAG+AG+DAP+AVFPSIVG
Sbjct  4    DEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG  37



>ref|XP_002039673.1| GM15786 [Drosophila sechellia]
 gb|EDW56538.1| GM15786 [Drosophila sechellia]
Length=81

 Score = 57.4 bits (137),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +3

Query  69   DEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVG  170
            DEV+A+VVD GS  CKAG+AG+DAP+AVFPSIVG
Sbjct  4    DEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG  37



>gb|EGU13103.1| hypothetical protein RTG_00629 [Rhodotorula glutinis ATCC 204091]
Length=948

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = +3

Query  45   SSSIMYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSI  176
            S  + YGGDEV A+V+D+GS T +AGYAGEDAPK +FP+   ++
Sbjct  2    SPPVQYGGDEVGALVLDIGSSTVRAGYAGEDAPKCLFPTAFATV  45



>ref|XP_003728392.1| PREDICTED: actin-like protein 6A [Strongylocentrotus purpuratus]
Length=439

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSID  179
            +YGGDEV A+V D+GS++ + GYAGED+PKA FP+  GS+D
Sbjct  5    VYGGDEVGALVFDVGSYSVRGGYAGEDSPKAEFPTTAGSVD  45



>ref|XP_001696669.1| actin-related protein [Chlamydomonas reinhardtii]
 gb|EDP08646.1| actin-related protein [Chlamydomonas reinhardtii]
Length=458

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 41/89 (46%), Positives = 52/89 (58%), Gaps = 5/89 (6%)
 Frame = +3

Query  66   GDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSI--DQMEVdnpdnpdnnsgsapds  239
             DEV+A+V+DLG+HT KAGY+G+D PKAVFPS V +I   QM   +   P   S      
Sbjct  16   ADEVNALVLDLGTHTFKAGYSGDDTPKAVFPSAVCAIAPTQMVGVHAVAPAAGSNGMDVD  75

Query  240  KSKGK---RKLYVGSQSLGFRRDHMEALS  317
               GK   RKL VG Q+L  ++  ME  S
Sbjct  76   SGNGKPGGRKLSVGYQALSAKQIGMEVQS  104



>gb|EMD44848.1| actin 2, putative [Entamoeba histolytica KU27]
Length=68

 Score = 57.0 bits (136),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +3

Query  63   GGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVG  170
            G +EV A+VVD GS  CKAG+AG+DAP+AVFPSIVG
Sbjct  2    GDEEVQALVVDNGSGMCKAGFAGDDAPRAVFPSIVG  37



>gb|EGT30044.1| hypothetical protein CAEBREN_16354 [Caenorhabditis brenneri]
Length=79

 Score = 57.4 bits (137),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +3

Query  69   DEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVG  170
            DEV+A+VVD GS  CKAG+AG+DAP+AVFPSIVG
Sbjct  4    DEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG  37



>ref|XP_003974271.1| PREDICTED: actin-like protein 6A-like isoform 2 [Takifugu rubripes]
Length=379

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 53/91 (58%), Gaps = 13/91 (14%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVG-SIDQMEVdnpdnpdnnsgsap  233
            +YGGDEV A+V D+GS++ +AGYAGED PKA FP+++G ++D+ +          S    
Sbjct  5    VYGGDEVGALVFDIGSYSVRAGYAGEDCPKADFPTVIGVTLDRED---------GSTPME  55

Query  234  dsKSKGKR---KLYVGSQSLGFRRDHMEALS  317
                KGK+     Y+ +  L   R+ ME +S
Sbjct  56   TDGDKGKQSGTTYYIDTNQLRVPRESMEVMS  86



>gb|EPB85937.1| hypothetical protein HMPREF1544_07269 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=443

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = +3

Query  54   IMYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQME  188
            + YGGDEV+A+V+D+GS   +AGYAGEDAP+ +FP+  G ID  E
Sbjct  2    VAYGGDEVNALVLDMGSTMTRAGYAGEDAPRVMFPTSFGYIDIEE  46



>gb|EMD45516.1| actin 2, putative [Entamoeba histolytica KU27]
Length=68

 Score = 57.0 bits (136),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +3

Query  63   GGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVG  170
            G +EV A+VVD GS  CKAG+AG+DAP+AVFPSIVG
Sbjct  2    GDEEVQALVVDNGSGMCKAGFAGDDAPRAVFPSIVG  37



>emb|CDI96496.1| actin [Echinococcus multilocularis]
Length=56

 Score = 56.6 bits (135),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +3

Query  63   GGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVG  170
            G +EV A+VVD GS  CKAG+AG+DAP+AVFPSIVG
Sbjct  2    GDEEVQALVVDNGSGMCKAGFAGDDAPRAVFPSIVG  37



>dbj|BAJ14767.1| beta actin [Eptatretus atami]
Length=120

 Score = 57.8 bits (138),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +3

Query  69   DEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVG  170
            DEV+A+VVD GS  CKAG+AG+DAP+AVFPSIVG
Sbjct  3    DEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG  36



>emb|CAG08066.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=429

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 53/91 (58%), Gaps = 13/91 (14%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVG-SIDQMEVdnpdnpdnnsgsap  233
            +YGGDEV A+V D+GS++ +AGYAGED PKA FP+++G ++D+ +          S    
Sbjct  5    VYGGDEVGALVFDIGSYSVRAGYAGEDCPKADFPTVIGVTLDRED---------GSTPME  55

Query  234  dsKSKGKR---KLYVGSQSLGFRRDHMEALS  317
                KGK+     Y+ +  L   R+ ME +S
Sbjct  56   TDGDKGKQSGTTYYIDTNQLRVPRESMEVMS  86



>emb|CAB55738.1| actin [Artemia franciscana]
 emb|CAB55739.1| actin [Artemia franciscana]
 emb|CAB55740.1| actin [Artemia franciscana]
 emb|CAB55741.1| actin [Artemia franciscana]
 emb|CAB55742.1| actin [Artemia franciscana]
 emb|CAB55743.1| actin [Artemia franciscana]
 emb|CAB55744.1| actin [Artemia franciscana]
 emb|CAB55745.1| actin [Artemia franciscana]
 emb|CAB55746.1| actin [Artemia franciscana]
 emb|CAB55747.1| actin [Artemia franciscana]
 emb|CAB55748.1| actin [Artemia franciscana]
 emb|CAB55749.1| actin [Artemia franciscana]
 emb|CAB55750.1| actin [Artemia franciscana]
 emb|CAB55751.1| actin [Artemia franciscana]
 emb|CAB55753.1| actin [Artemia franciscana]
 emb|CAB55754.1| actin [Artemia franciscana]
 emb|CAB55755.1| actin [Artemia franciscana]
 emb|CAB55756.1| actin [Artemia franciscana]
 emb|CAB55757.1| actin [Artemia franciscana]
Length=376

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +3

Query  66   GDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVG  170
            GDEV+A+V+D GS  CKAG+AG+DAP+AVFPSIVG
Sbjct  3    GDEVTALVIDNGSGMCKAGFAGDDAPRAVFPSIVG  37



>emb|CAB55752.1| actin [Artemia franciscana]
Length=376

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +3

Query  66   GDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVG  170
            GDEV+A+V+D GS  CKAG+AG+DAP+AVFPSIVG
Sbjct  3    GDEVTALVIDNGSGMCKAGFAGDDAPRAVFPSIVG  37



>ref|XP_003974270.1| PREDICTED: actin-like protein 6A-like isoform 1 [Takifugu rubripes]
Length=429

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 53/91 (58%), Gaps = 13/91 (14%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVG-SIDQMEVdnpdnpdnnsgsap  233
            +YGGDEV A+V D+GS++ +AGYAGED PKA FP+++G ++D+ +          S    
Sbjct  5    VYGGDEVGALVFDIGSYSVRAGYAGEDCPKADFPTVIGVTLDRED---------GSTPME  55

Query  234  dsKSKGKR---KLYVGSQSLGFRRDHMEALS  317
                KGK+     Y+ +  L   R+ ME +S
Sbjct  56   TDGDKGKQSGTTYYIDTNQLRVPRESMEVMS  86



>gb|EYB83185.1| hypothetical protein Y032_0340g2971, partial [Ancylostoma ceylanicum]
Length=128

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +3

Query  69   DEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVG  170
            DEV+A+VVD GS  CKAG+AG+DAP+AVFPSIVG
Sbjct  4    DEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG  37



>ref|XP_002838337.1| hypothetical protein [Tuber melanosporum Mel28]
 emb|CAZ82528.1| unnamed protein product [Tuber melanosporum]
Length=61

 Score = 56.6 bits (135),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +3

Query  69   DEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVG  170
            DEV+A+V+D GS  CKAG+AG+DAP+AVFPSIVG
Sbjct  3    DEVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVG  36



>gb|ADT79250.1| non-muscle actin I, partial [Hydractinia echinata]
 gb|ADT79251.1| non-muscle actin I, partial [Hydractinia symbiolongicarpus]
 gb|AEF97336.1| non-muscle actin III, partial [Hydractinia echinata]
Length=51

 Score = 56.2 bits (134),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +3

Query  69   DEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVG  170
            D+V+A+VVD GS  CKAG+AG+DAP+AVFPSIVG
Sbjct  4    DDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG  37



>gb|AEH04532.1| beta-actin [Haplochromis burtoni]
Length=129

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +3

Query  69   DEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVG  170
            DE++A+VVD GS  CKAG+AG+DAP+AVFPSIVG
Sbjct  3    DEIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG  36



>ref|XP_008328111.1| PREDICTED: actin-like protein 6A [Cynoglossus semilaevis]
Length=429

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 54/91 (59%), Gaps = 13/91 (14%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVG-SIDQMEVdnpdnpdnnsgsap  233
            +YGGDEV A+V D+GS++ +AGYAGED PKA FP+++G ++D+ +          +    
Sbjct  5    VYGGDEVGALVFDIGSYSVRAGYAGEDCPKADFPTVIGVTLDRED---------GTTPME  55

Query  234  dsKSKGKR---KLYVGSQSLGFRRDHMEALS  317
                KGK+     ++ +  L   R++ME +S
Sbjct  56   TDGDKGKQSGTTYFIDTNQLRVPRENMEVMS  86



>dbj|BAJ07368.1| actin [Hydatigera taeniaeformis]
Length=168

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVG  170
            M  G+E++A+VVD GS  CKAG+AG+DAP+AVFPSIVG
Sbjct  1    MSEGEEIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG  38



>gb|ADX01224.1| beta actin [Ixodes ricinus]
Length=144

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +3

Query  69   DEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVG  170
            DEV+A+VVD GS  CKAG+AG+DAP+AVFPSIVG
Sbjct  4    DEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG  37



>emb|CDJ93107.1| Actin actin domain containing protein, partial [Haemonchus contortus]
Length=102

 Score = 57.4 bits (137),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +3

Query  69   DEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVG  170
            DEV+A+VVD GS  CKAG+AG+DAP+AVFPSIVG
Sbjct  4    DEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG  37



>gb|EMS23789.1| actin-related protein Arp4p [Rhodosporidium toruloides NP11]
 emb|CDR40869.1| RHTO0S05e08152g1_1 [Rhodosporidium toruloides]
Length=441

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 25/44 (57%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = +3

Query  45   SSSIMYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSI  176
            S  + YGGDEV A+V+D+GS T +AGYAGEDAPK +FP+   ++
Sbjct  2    SPPVQYGGDEVGALVLDIGSSTVRAGYAGEDAPKCLFPTAFATV  45



>ref|XP_004382380.1| PREDICTED: actin-like protein 6A isoform 2 [Trichechus manatus 
latirostris]
Length=429

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 32/87 (37%), Positives = 50/87 (57%), Gaps = 5/87 (6%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsapd  236
            +YGGDEV A+V D+GS+T +AGYAGED PK  FP+ +G + + +     +         D
Sbjct  5    VYGGDEVGALVFDIGSYTVRAGYAGEDCPKVDFPTAIGMVLERD-----DGSTLMEIDGD  59

Query  237  sKSKGKRKLYVGSQSLGFRRDHMEALS  317
               +G    Y+ + +L   R++ME +S
Sbjct  60   KGKQGGPTYYIDTNALRVPRENMETIS  86



>ref|XP_003412917.1| PREDICTED: actin-like protein 6A isoform X1 [Loxodonta africana]
Length=429

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 32/87 (37%), Positives = 50/87 (57%), Gaps = 5/87 (6%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsapd  236
            +YGGDEV A+V D+GS+T +AGYAGED PK  FP+ +G + + +     +         D
Sbjct  5    VYGGDEVGALVFDIGSYTVRAGYAGEDCPKVDFPTAIGMVLERD-----DGSTLMEIDGD  59

Query  237  sKSKGKRKLYVGSQSLGFRRDHMEALS  317
               +G    Y+ + +L   R++ME +S
Sbjct  60   KGKQGGPTYYIDTNALRVPRENMETIS  86



>ref|NP_001279710.1| actin-like 6A [Callorhinchus milii]
 gb|AFK11475.1| actin-like 6A [Callorhinchus milii]
Length=457

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 51/87 (59%), Gaps = 5/87 (6%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEVdnpdnpdnnsgsapd  236
            +YGGDEV A+V D+GS+T +AGYAGED PKA FP+ +G    M ++  D           
Sbjct  5    VYGGDEVGALVFDIGSYTVRAGYAGEDCPKADFPTAIG----MLLERDDGSTPMEIEGDK  60

Query  237  sKSKGKRKLYVGSQSLGFRRDHMEALS  317
             KS G    ++ + SL   R+++E +S
Sbjct  61   GKSSGT-TYFIDTNSLRVPRENVEVIS  86



>dbj|BAJ07367.1| beta-actin [Hydatigera taeniaeformis]
Length=210

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVG  170
            M  G+E++A+VVD GS  CKAG+AG+DAP+AVFPSIVG
Sbjct  1    MSEGEEIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG  38



>gb|AEL89389.1| beta-actin [Poecilia reticulata]
Length=130

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +3

Query  69   DEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVG  170
            DE++A+VVD GS  CKAG+AG+DAP+AVFPSIVG
Sbjct  3    DEIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG  36



>ref|XP_005800552.1| PREDICTED: actin-like protein 6A-like [Xiphophorus maculatus]
Length=429

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 37/43 (86%), Gaps = 1/43 (2%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVG-SIDQ  182
            +YGGDEV A+V D+GS++ +AGYAGED PKA FP+++G +ID+
Sbjct  5    VYGGDEVGALVFDIGSYSVRAGYAGEDCPKADFPTVIGVTIDR  47



>ref|XP_006637533.1| PREDICTED: actin-like protein 6A-like [Lepisosteus oculatus]
Length=570

 Score = 60.8 bits (146),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/86 (40%), Positives = 48/86 (56%), Gaps = 8/86 (9%)
 Frame = +3

Query  63   GGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVG-SIDQMEVdnpdnpdnnsgsapds  239
            GGDEV A+V D+GS+T +AGYAGED PKA FP+++G S+D+ +                 
Sbjct  149  GGDEVGALVFDIGSYTVRAGYAGEDCPKADFPTVIGVSLDRED-------GTAPMETEGD  201

Query  240  KSKGKRKLYVGSQSLGFRRDHMEALS  317
            K K     Y+ +  L   R+ ME +S
Sbjct  202  KGKQGTTYYIDTNQLRVPREGMEVMS  227



>ref|XP_006007853.1| PREDICTED: actin-3-like isoform X2 [Latimeria chalumnae]
Length=334

 Score = 59.7 bits (143),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +3

Query  63   GGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVG  170
            G DE++A+VVD GS  CKAG+AG+DAP+AVFPSIVG
Sbjct  2    GDDEIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG  37



>ref|XP_008406236.1| PREDICTED: actin-like protein 6A [Poecilia reticulata]
Length=429

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 37/43 (86%), Gaps = 1/43 (2%)
 Frame = +3

Query  57   MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVG-SIDQ  182
            +YGGDEV A+V D+GS++ +AGYAGED PKA FP+++G +ID+
Sbjct  5    VYGGDEVGALVFDIGSYSVRAGYAGEDCPKADFPTVIGVTIDR  47



>gb|AAC32808.1| beta actin, partial [Pseudopleuronectes americanus]
Length=130

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +3

Query  69   DEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVG  170
            DE++A+VVD GS  CKAG+AG+DAP+AVFPSIVG
Sbjct  3    DEIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG  36



>gb|AAC32809.1| beta actin, partial [Pseudopleuronectes americanus]
 gb|AAM66751.1| beta-actin [Oreochromis niloticus]
 emb|CDR15102.1| unnamed protein product, partial [Oncorhynchus mykiss]
Length=121

 Score = 57.4 bits (137),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +3

Query  69   DEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVG  170
            DE++A+VVD GS  CKAG+AG+DAP+AVFPSIVG
Sbjct  3    DEIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG  36



>gb|EMD49430.1| actin, putative, partial [Entamoeba histolytica KU27]
Length=124

 Score = 57.4 bits (137),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +3

Query  63   GGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVG  170
            G +EV A+VVD GS  CKAG+AG+DAP+AVFPSIVG
Sbjct  2    GDEEVQALVVDNGSGMCKAGFAGDDAPRAVFPSIVG  37



>gb|KIK66854.1| hypothetical protein GYMLUDRAFT_218271 [Gymnopus luxurians FD-317 
M1]
Length=375

 Score = 60.1 bits (144),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +3

Query  69   DEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVGSIDQMEV  191
            DEVSA+VVD GS  CKAG+AG+DAP+AVFPSIVG   Q  +
Sbjct  3    DEVSALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRQQSI  43



>gb|ACF32733.1| actin [Karlodinium veneficum]
Length=76

 Score = 56.6 bits (135),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +3

Query  63   GGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSIVG  170
            G +EV+A+VVD GS  CKAG+AG+DAP+AVFPSIVG
Sbjct  2    GEEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG  37



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 554925890270