BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002B21

Length=566
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP06456.1|  unnamed protein product                                213   1e-61   Coffea canephora [robusta coffee]
ref|XP_009769363.1|  PREDICTED: pyruvate decarboxylase 1-like           209   3e-60   Nicotiana sylvestris
ref|XP_009622836.1|  PREDICTED: pyruvate decarboxylase 1-like           207   7e-60   Nicotiana tomentosiformis
ref|XP_011095042.1|  PREDICTED: pyruvate decarboxylase 1                207   1e-59   Sesamum indicum [beniseed]
ref|XP_010553236.1|  PREDICTED: pyruvate decarboxylase 2-like           206   2e-59   Tarenaya hassleriana [spider flower]
ref|XP_010092799.1|  Pyruvate decarboxylase isozyme 2                   206   2e-59   Morus notabilis
ref|XP_006362373.1|  PREDICTED: pyruvate decarboxylase 2-like           206   3e-59   Solanum tuberosum [potatoes]
ref|XP_007026637.1|  Thiamine pyrophosphate dependent pyruvate de...    202   3e-59   
ref|XP_006286440.1|  hypothetical protein CARUB_v10003893mg             206   4e-59   Capsella rubella
gb|KFK24633.1|  hypothetical protein AALP_AA8G005000                    205   5e-59   Arabis alpina [alpine rockcress]
ref|XP_010253807.1|  PREDICTED: pyruvate decarboxylase 2-like           205   7e-59   Nelumbo nucifera [Indian lotus]
emb|CDY66930.1|  BnaCnng52860D                                          205   7e-59   Brassica napus [oilseed rape]
ref|XP_010447294.1|  PREDICTED: pyruvate decarboxylase 1-like           205   8e-59   Camelina sativa [gold-of-pleasure]
ref|XP_009125425.1|  PREDICTED: pyruvate decarboxylase 4                205   9e-59   Brassica rapa
ref|XP_006283364.1|  hypothetical protein CARUB_v10004406mg             205   9e-59   Capsella rubella
ref|XP_006429441.1|  hypothetical protein CICLE_v10011317mg             201   2e-58   
ref|XP_007026634.1|  Thiamine pyrophosphate dependent pyruvate de...    204   2e-58   
ref|XP_006363625.1|  PREDICTED: pyruvate decarboxylase 1-like           203   3e-58   Solanum tuberosum [potatoes]
gb|KJB36955.1|  hypothetical protein B456_006G184000                    202   3e-58   Gossypium raimondii
ref|XP_010437810.1|  PREDICTED: pyruvate decarboxylase 1                203   5e-58   Camelina sativa [gold-of-pleasure]
gb|KJB36954.1|  hypothetical protein B456_006G184000                    202   9e-58   Gossypium raimondii
ref|XP_004249069.1|  PREDICTED: pyruvate decarboxylase 1-like           202   1e-57   Solanum lycopersicum
ref|XP_006363624.1|  PREDICTED: pyruvate decarboxylase 1-like           201   1e-57   Solanum tuberosum [potatoes]
gb|KDO56720.1|  hypothetical protein CISIN_1g044559mg                   201   1e-57   Citrus sinensis [apfelsine]
ref|XP_002870931.1|  hypothetical protein ARALYDRAFT_486945             201   2e-57   
ref|XP_006429440.1|  hypothetical protein CICLE_v10011317mg             201   2e-57   Citrus clementina [clementine]
ref|XP_006281555.1|  hypothetical protein CARUB_v10027657mg             201   3e-57   Capsella rubella
ref|XP_010558370.1|  PREDICTED: pyruvate decarboxylase 1-like           200   4e-57   Tarenaya hassleriana [spider flower]
emb|CDY17293.1|  BnaA10g09270D                                          200   4e-57   Brassica napus [oilseed rape]
gb|KJB36952.1|  hypothetical protein B456_006G183900                    198   4e-57   Gossypium raimondii
ref|XP_010432620.1|  PREDICTED: pyruvate decarboxylase 1-like           200   5e-57   Camelina sativa [gold-of-pleasure]
gb|KDP22863.1|  hypothetical protein JCGZ_00450                         200   5e-57   Jatropha curcas
ref|NP_200307.1|  pyruvate decarboxylase-2                              200   6e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009120024.1|  PREDICTED: pyruvate decarboxylase 2                200   6e-57   Brassica rapa
gb|AAB16855.1|  pyruvate decarboxylase                                  199   8e-57   Arabidopsis thaliana [mouse-ear cress]
emb|CDY19880.1|  BnaC09g31460D                                          199   1e-56   Brassica napus [oilseed rape]
ref|XP_010423945.1|  PREDICTED: pyruvate decarboxylase 4                199   1e-56   Camelina sativa [gold-of-pleasure]
ref|XP_006398630.1|  hypothetical protein EUTSA_v10013008mg             199   1e-56   Eutrema salsugineum [saltwater cress]
ref|XP_010543216.1|  PREDICTED: pyruvate decarboxylase 1                199   1e-56   Tarenaya hassleriana [spider flower]
ref|XP_002866069.1|  pyruvate decarboxylase-2                           199   1e-56   Arabidopsis lyrata subsp. lyrata
ref|XP_009789106.1|  PREDICTED: pyruvate decarboxylase 1                199   1e-56   Nicotiana sylvestris
ref|XP_010451999.1|  PREDICTED: pyruvate decarboxylase 4-like           199   1e-56   Camelina sativa [gold-of-pleasure]
ref|XP_002867205.1|  hypothetical protein ARALYDRAFT_491381             199   1e-56   
gb|EYU41928.1|  hypothetical protein MIMGU_mgv1a003147mg                199   2e-56   Erythranthe guttata [common monkey flower]
ref|XP_011046856.1|  PREDICTED: pyruvate decarboxylase 2                199   2e-56   Populus euphratica
gb|KFK27091.1|  hypothetical protein AALP_AA8G333000                    199   2e-56   Arabis alpina [alpine rockcress]
gb|AAB16854.1|  pyruvate decarboxylase                                  199   2e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010529008.1|  PREDICTED: pyruvate decarboxylase 2                198   3e-56   Tarenaya hassleriana [spider flower]
ref|NP_195033.1|  pyruvate decarboxylase 1                              198   3e-56   Arabidopsis thaliana [mouse-ear cress]
gb|KJB36951.1|  hypothetical protein B456_006G183900                    198   3e-56   Gossypium raimondii
ref|XP_008362250.1|  PREDICTED: pyruvate decarboxylase 2-like           198   3e-56   
emb|CDY69899.1|  BnaA01g37380D                                          190   4e-56   Brassica napus [oilseed rape]
ref|XP_010482907.1|  PREDICTED: pyruvate decarboxylase 2 isoform X1     197   5e-56   Camelina sativa [gold-of-pleasure]
ref|NP_195752.1|  pyruvate decarboxylase 4                              197   7e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007026635.1|  Thiamine pyrophosphate dependent pyruvate de...    197   7e-56   
ref|XP_008388854.1|  PREDICTED: LOW QUALITY PROTEIN: pyruvate dec...    194   9e-56   
gb|AAG13131.1|AF193791_1  pyruvate decarboxylase                        196   1e-55   Fragaria x ananassa
ref|XP_004492472.1|  PREDICTED: pyruvate decarboxylase isozyme 2-...    196   1e-55   Cicer arietinum [garbanzo]
ref|XP_004492473.1|  PREDICTED: pyruvate decarboxylase isozyme 2-...    196   2e-55   
ref|XP_004246778.1|  PREDICTED: pyruvate decarboxylase 1                196   2e-55   Solanum lycopersicum
ref|XP_002322997.1|  pyruvate decarboxylase family protein              196   2e-55   Populus trichocarpa [western balsam poplar]
ref|XP_007208309.1|  hypothetical protein PRUPE_ppa003086mg             196   2e-55   Prunus persica
gb|AIL23783.1|  pyruvate decarboxylase                                  195   3e-55   Prunus serrulata
gb|ABZ79223.1|  pyruvate decarboxylase                                  195   3e-55   Prunus armeniaca
ref|XP_006401505.1|  hypothetical protein EUTSA_v10013010mg             195   3e-55   Eutrema salsugineum [saltwater cress]
ref|XP_010443084.1|  PREDICTED: pyruvate decarboxylase 2-like           195   4e-55   Camelina sativa [gold-of-pleasure]
ref|XP_009628441.1|  PREDICTED: pyruvate decarboxylase 1                194   7e-55   Nicotiana tomentosiformis
ref|XP_010676788.1|  PREDICTED: pyruvate decarboxylase 2                194   7e-55   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009385546.1|  PREDICTED: pyruvate decarboxylase 1-like           194   7e-55   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008243339.1|  PREDICTED: pyruvate decarboxylase 2                194   7e-55   Prunus mume [ume]
ref|XP_010264586.1|  PREDICTED: pyruvate decarboxylase 2                194   8e-55   Nelumbo nucifera [Indian lotus]
ref|XP_011019081.1|  PREDICTED: pyruvate decarboxylase 2-like           194   8e-55   Populus euphratica
gb|AAL37492.1|  pyruvate decarboxylase                                  194   9e-55   Fragaria x ananassa
gb|AAP96920.1|  pyruvate decarboxylase                                  193   2e-54   Dianthus caryophyllus [carnation]
ref|XP_010033739.1|  PREDICTED: pyruvate decarboxylase 1                193   2e-54   Eucalyptus grandis [rose gum]
emb|CDY22174.1|  BnaC01g39270D                                          186   2e-54   Brassica napus [oilseed rape]
gb|AGA15799.1|  pyruvate decarboxylase 5                                182   2e-54   Diospyros kaki [Japanese persimmon]
ref|XP_007207128.1|  hypothetical protein PRUPE_ppa003096mg             192   4e-54   Prunus persica
ref|XP_004302532.1|  PREDICTED: pyruvate decarboxylase 2                192   6e-54   Fragaria vesca subsp. vesca
gb|AAO72533.1|  pyruvate decarboxylase 1                                191   7e-54   Lotus corniculatus
ref|XP_009123548.1|  PREDICTED: pyruvate decarboxylase 1-like           191   9e-54   Brassica rapa
gb|AAX33300.1|  pyruvate decarboxylase 1                                189   1e-53   Petunia x hybrida [garden petunia]
ref|XP_008221277.1|  PREDICTED: pyruvate decarboxylase 1-like           190   3e-53   Prunus mume [ume]
emb|CDY10495.1|  BnaCnng03960D                                          189   4e-53   Brassica napus [oilseed rape]
ref|XP_008362261.1|  PREDICTED: pyruvate decarboxylase 2-like           189   5e-53   
gb|AAL33553.1|AF436852_1  pyruvate decarboxylase                        178   6e-53   Cucumis melo [Oriental melon]
ref|XP_010920798.1|  PREDICTED: pyruvate decarboxylase 1                188   1e-52   Elaeis guineensis
ref|XP_009376417.1|  PREDICTED: pyruvate decarboxylase 2                188   1e-52   
ref|XP_010033533.1|  PREDICTED: pyruvate decarboxylase 2                188   2e-52   Eucalyptus grandis [rose gum]
gb|KCW88160.1|  hypothetical protein EUGRSUZ_A00549                     188   2e-52   Eucalyptus grandis [rose gum]
ref|XP_002308230.1|  pyruvate decarboxylase family protein              187   2e-52   Populus trichocarpa [western balsam poplar]
ref|NP_001284421.1|  pyruvate decarboxylase 1                           187   2e-52   Cucumis melo [Oriental melon]
ref|XP_007134808.1|  hypothetical protein PHAVU_010G078000g             187   2e-52   Phaseolus vulgaris [French bean]
dbj|BAC23043.1|  pyruvate decarboxylase                                 187   3e-52   Solanum tuberosum [potatoes]
ref|XP_010253808.1|  PREDICTED: pyruvate decarboxylase 1                187   3e-52   Nelumbo nucifera [Indian lotus]
ref|XP_003623316.1|  Pyruvate decarboxylase isozyme                     186   5e-52   
ref|XP_004145248.1|  PREDICTED: pyruvate decarboxylase isozyme 2-...    186   5e-52   Cucumis sativus [cucumbers]
ref|XP_004165846.1|  PREDICTED: LOW QUALITY PROTEIN: pyruvate dec...    186   6e-52   
ref|XP_008779570.1|  PREDICTED: pyruvate decarboxylase 2-like           177   6e-52   
gb|KHN18047.1|  Pyruvate decarboxylase isozyme 2                        186   8e-52   Glycine soja [wild soybean]
ref|XP_003516954.1|  PREDICTED: pyruvate decarboxylase 4                186   9e-52   Glycine max [soybeans]
ref|XP_003604737.1|  Pyruvate decarboxylase isozyme                     186   1e-51   Medicago truncatula
ref|XP_008457351.1|  PREDICTED: pyruvate decarboxylase 2-like           185   2e-51   Cucumis melo [Oriental melon]
ref|XP_003614223.1|  Pyruvate decarboxylase isozyme                     184   3e-51   Medicago truncatula
ref|XP_009338952.1|  PREDICTED: pyruvate decarboxylase 2-like           184   4e-51   Pyrus x bretschneideri [bai li]
ref|XP_009369597.1|  PREDICTED: pyruvate decarboxylase 2-like           184   4e-51   Pyrus x bretschneideri [bai li]
ref|XP_008384777.1|  PREDICTED: pyruvate decarboxylase 1-like iso...    184   4e-51   
ref|XP_008384776.1|  PREDICTED: pyruvate decarboxylase 2-like iso...    184   4e-51   
ref|XP_010922580.1|  PREDICTED: pyruvate decarboxylase 2-like           184   4e-51   Elaeis guineensis
gb|KJB21559.1|  hypothetical protein B456_004G001200                    184   5e-51   Gossypium raimondii
dbj|BAJ94428.1|  predicted protein                                      184   6e-51   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AEF33613.1|  pyruvate decarboxylase                                  183   9e-51   Salvia miltiorrhiza f. alba
ref|XP_008805101.1|  PREDICTED: pyruvate decarboxylase 1-like           183   9e-51   Phoenix dactylifera
gb|ACL52480.1|  unknown                                                 180   9e-51   Zea mays [maize]
gb|AGA15797.1|  pyruvate decarboxylase 2                                183   9e-51   Diospyros kaki [Japanese persimmon]
ref|XP_011094440.1|  PREDICTED: pyruvate decarboxylase 1-like           183   1e-50   Sesamum indicum [beniseed]
ref|XP_008344771.1|  PREDICTED: pyruvate decarboxylase 1-like           182   1e-50   
ref|XP_004156618.1|  PREDICTED: pyruvate decarboxylase isozyme 2-...    182   1e-50   
ref|XP_004137700.1|  PREDICTED: pyruvate decarboxylase isozyme 2-...    182   2e-50   Cucumis sativus [cucumbers]
ref|XP_002465414.1|  hypothetical protein SORBIDRAFT_01g038360          182   2e-50   Sorghum bicolor [broomcorn]
tpg|DAA44862.1|  TPA: pyruvate decarboxylase3                           180   2e-50   
ref|XP_010033427.1|  PREDICTED: pyruvate decarboxylase 1-like           182   2e-50   Eucalyptus grandis [rose gum]
gb|EPS58298.1|  pyruvate decarboxylase                                  181   3e-50   Genlisea aurea
gb|EMT10366.1|  Pyruvate decarboxylase isozyme 2                        178   3e-50   
ref|XP_009391704.1|  PREDICTED: pyruvate decarboxylase 1                181   6e-50   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004984863.1|  PREDICTED: pyruvate decarboxylase 2-like           181   6e-50   Setaria italica
gb|AAL99745.1|  pyruvate decarboxylase                                  181   7e-50   Zea mays [maize]
ref|NP_001105052.1|  pyruvate decarboxylase 3                           181   8e-50   Zea mays [maize]
ref|XP_008775409.1|  PREDICTED: pyruvate decarboxylase 1 isoform X2     180   9e-50   
ref|XP_003558149.1|  PREDICTED: pyruvate decarboxylase 2                180   9e-50   Brachypodium distachyon [annual false brome]
ref|XP_008775408.1|  PREDICTED: pyruvate decarboxylase 1 isoform X1     180   1e-49   Phoenix dactylifera
ref|XP_003529168.1|  PREDICTED: pyruvate decarboxylase 1                180   1e-49   Glycine max [soybeans]
ref|XP_003552267.1|  PREDICTED: pyruvate decarboxylase 2                180   1e-49   Glycine max [soybeans]
dbj|BAK04101.1|  predicted protein                                      179   2e-49   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004958794.1|  PREDICTED: pyruvate decarboxylase 2-like           179   2e-49   Setaria italica
ref|XP_002530500.1|  pyruvate decarboxylase, putative                   179   2e-49   Ricinus communis
ref|XP_004294304.1|  PREDICTED: pyruvate decarboxylase 2-like iso...    179   2e-49   Fragaria vesca subsp. vesca
ref|NP_001055803.1|  Os05g0469600                                       179   3e-49   
ref|XP_011460964.1|  PREDICTED: pyruvate decarboxylase 2-like iso...    179   3e-49   Fragaria vesca subsp. vesca
ref|XP_007016910.1|  Thiamine pyrophosphate dependent pyruvate de...    179   3e-49   
ref|XP_003623318.1|  Pyruvate decarboxylase isozyme                     179   3e-49   Medicago truncatula
sp|A2Y5L9.1|PDC1_ORYSI  RecName: Full=Pyruvate decarboxylase 1; S...    179   4e-49   Oryza sativa Indica Group [Indian rice]
gb|AIE47264.1|  pyruvate decarboxylase                                  178   4e-49   Hevea brasiliensis [jebe]
ref|XP_007140235.1|  hypothetical protein PHAVU_008G095400g             178   6e-49   Phaseolus vulgaris [French bean]
ref|XP_009402387.1|  PREDICTED: pyruvate decarboxylase 1-like           178   6e-49   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAG22488.1|AF195868_1  pyruvate decarboxylase 1                      177   8e-49   Vitis vinifera
ref|XP_002276535.1|  PREDICTED: pyruvate decarboxylase 1 isoform X2     177   1e-48   Vitis vinifera
ref|XP_010650884.1|  PREDICTED: pyruvate decarboxylase 1 isoform X1     177   1e-48   Vitis vinifera
ref|XP_009399900.1|  PREDICTED: pyruvate decarboxylase 2                177   1e-48   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011071825.1|  PREDICTED: pyruvate decarboxylase 1-like           177   2e-48   Sesamum indicum [beniseed]
dbj|BAC20138.1|  pyruvate decarboxylase                                 176   2e-48   Oryza sativa [red rice]
gb|EAY98380.1|  hypothetical protein OsI_20291                          176   2e-48   Oryza sativa Indica Group [Indian rice]
ref|XP_009384923.1|  PREDICTED: pyruvate decarboxylase 1-like           176   3e-48   Musa acuminata subsp. malaccensis [pisang utan]
sp|A2XFI3.2|PDC2_ORYSI  RecName: Full=Pyruvate decarboxylase 2; S...    176   3e-48   Oryza sativa Indica Group [Indian rice]
ref|NP_001049811.1|  Os03g0293500                                       176   3e-48   
ref|XP_010034573.1|  PREDICTED: pyruvate decarboxylase 1-like           176   3e-48   Eucalyptus grandis [rose gum]
ref|XP_002272615.1|  PREDICTED: pyruvate decarboxylase 2                176   3e-48   Vitis vinifera
ref|XP_008775407.1|  PREDICTED: pyruvate decarboxylase 2-like           176   3e-48   Phoenix dactylifera
ref|XP_010040425.1|  PREDICTED: pyruvate decarboxylase 1-like           167   7e-48   Eucalyptus grandis [rose gum]
gb|EYU42548.1|  hypothetical protein MIMGU_mgv1a003111mg                174   1e-47   Erythranthe guttata [common monkey flower]
gb|KCW52500.1|  hypothetical protein EUGRSUZ_J01896                     174   1e-47   Eucalyptus grandis [rose gum]
gb|EMT15339.1|  hypothetical protein F775_43983                         174   2e-47   
gb|AIE47265.1|  pyruvate decarboxylase                                  174   2e-47   Hevea brasiliensis [jebe]
gb|KHN22554.1|  Pyruvate decarboxylase isozyme 2                        174   2e-47   Glycine soja [wild soybean]
ref|XP_008654188.1|  PREDICTED: pyruvate decarboxylase 3-like           174   3e-47   Zea mays [maize]
gb|ABJ99596.1|  pyruvate decarboxylase                                  172   6e-47   Lycoris aurea [golden hurricane-lily]
ref|XP_003520410.1|  PREDICTED: pyruvate decarboxylase 1-like           172   7e-47   
gb|AIE47263.1|  pyruvate decarboxylase                                  172   1e-46   Hevea brasiliensis [jebe]
ref|XP_011096418.1|  PREDICTED: pyruvate decarboxylase 1                171   1e-46   Sesamum indicum [beniseed]
gb|KCW49436.1|  hypothetical protein EUGRSUZ_K02968                     171   2e-46   Eucalyptus grandis [rose gum]
emb|CDO99368.1|  unnamed protein product                                171   2e-46   Coffea canephora [robusta coffee]
ref|XP_010039167.1|  PREDICTED: pyruvate decarboxylase 1-like           171   2e-46   Eucalyptus grandis [rose gum]
gb|KDP21067.1|  hypothetical protein JCGZ_21538                         171   3e-46   Jatropha curcas
gb|ABJ99597.1|  pyruvate decarboxylase                                  171   3e-46   Lycoris aurea [golden hurricane-lily]
gb|AIE47262.1|  pyruvate decarboxylase                                  170   3e-46   Hevea brasiliensis [jebe]
ref|XP_004506726.1|  PREDICTED: pyruvate decarboxylase isozyme 2-...    171   3e-46   Cicer arietinum [garbanzo]
gb|KJB57438.1|  hypothetical protein B456_009G164100                    167   4e-46   Gossypium raimondii
ref|XP_006350849.1|  PREDICTED: pyruvate decarboxylase 2-like           170   5e-46   Solanum tuberosum [potatoes]
gb|AAA68290.1|  pyruvate decarboxylase 1                                170   5e-46   Oryza sativa Indica Group [Indian rice]
ref|XP_009607456.1|  PREDICTED: pyruvate decarboxylase 1                169   6e-46   Nicotiana tomentosiformis
sp|A2YQ76.2|PDC3_ORYSI  RecName: Full=Pyruvate decarboxylase 3; S...    169   6e-46   Oryza sativa Indica Group [Indian rice]
ref|XP_009801931.1|  PREDICTED: pyruvate decarboxylase 1 isoform X1     169   6e-46   Nicotiana sylvestris
ref|NP_001060727.1|  Os07g0693100                                       169   7e-46   
gb|KCW44287.1|  hypothetical protein EUGRSUZ_L02272                     168   7e-46   Eucalyptus grandis [rose gum]
ref|XP_004232952.1|  PREDICTED: pyruvate decarboxylase 1                169   7e-46   Solanum lycopersicum
ref|XP_004134669.1|  PREDICTED: pyruvate decarboxylase isozyme 1-...    169   8e-46   Cucumis sativus [cucumbers]
ref|XP_010448857.1|  PREDICTED: pyruvate decarboxylase 2-like           170   8e-46   Camelina sativa [gold-of-pleasure]
ref|XP_010279076.1|  PREDICTED: pyruvate decarboxylase 1-like           169   9e-46   Nelumbo nucifera [Indian lotus]
gb|KJB57437.1|  hypothetical protein B456_009G164100                    168   1e-45   Gossypium raimondii
gb|KJB57436.1|  hypothetical protein B456_009G164100                    168   1e-45   Gossypium raimondii
gb|KJB57434.1|  hypothetical protein B456_009G164100                    168   2e-45   Gossypium raimondii
ref|XP_007026638.1|  Thiamine pyrophosphate dependent pyruvate de...    164   2e-45   
sp|P51850.1|PDC1_PEA  RecName: Full=Pyruvate decarboxylase 1; Sho...    168   2e-45   Pisum sativum [garden pea]
ref|XP_010277737.1|  PREDICTED: pyruvate decarboxylase 1                168   3e-45   Nelumbo nucifera [Indian lotus]
ref|NP_001284406.1|  pyruvate decarboxylase                             167   3e-45   Cucumis melo [Oriental melon]
gb|KHG03537.1|  Pyruvate decarboxylase isozyme 1                        167   3e-45   Gossypium arboreum [tree cotton]
ref|XP_006843656.1|  hypothetical protein AMTR_s00007p00179930          167   5e-45   Amborella trichopoda
gb|KDO77807.1|  hypothetical protein CISIN_1g007800mg                   165   5e-45   Citrus sinensis [apfelsine]
ref|XP_008779842.1|  PREDICTED: pyruvate decarboxylase 2-like           159   5e-45   
ref|XP_002275486.1|  PREDICTED: pyruvate decarboxylase 1                167   6e-45   Vitis vinifera
ref|XP_010279075.1|  PREDICTED: pyruvate decarboxylase 1-like           167   6e-45   Nelumbo nucifera [Indian lotus]
ref|XP_007025439.1|  Thiamine pyrophosphate dependent pyruvate de...    164   7e-45   
ref|XP_004485877.1|  PREDICTED: pyruvate decarboxylase isozyme 1-...    167   7e-45   Cicer arietinum [garbanzo]
ref|XP_010052217.1|  PREDICTED: pyruvate decarboxylase 1                167   7e-45   Eucalyptus grandis [rose gum]
ref|XP_007025440.1|  Thiamine pyrophosphate dependent pyruvate de...    164   1e-44   
ref|XP_011046076.1|  PREDICTED: pyruvate decarboxylase 1-like           166   1e-44   Populus euphratica
ref|XP_009773011.1|  PREDICTED: pyruvate decarboxylase 2 isoform X2     166   1e-44   Nicotiana sylvestris
ref|XP_003522062.1|  PREDICTED: pyruvate decarboxylase 1-like           166   1e-44   
ref|XP_009773010.1|  PREDICTED: pyruvate decarboxylase 2 isoform X1     166   1e-44   Nicotiana sylvestris
ref|XP_009594221.1|  PREDICTED: pyruvate decarboxylase 2 isoform X2     166   1e-44   Nicotiana tomentosiformis
ref|XP_010323135.1|  PREDICTED: pyruvate decarboxylase 2                166   1e-44   Solanum lycopersicum
ref|XP_009594220.1|  PREDICTED: pyruvate decarboxylase 2 isoform X1     166   1e-44   Nicotiana tomentosiformis
ref|XP_010037690.1|  PREDICTED: pyruvate decarboxylase 1-like           166   1e-44   Eucalyptus grandis [rose gum]
sp|P51846.1|PDC2_TOBAC  RecName: Full=Pyruvate decarboxylase 2; S...    166   1e-44   Nicotiana tabacum [American tobacco]
gb|KDO77805.1|  hypothetical protein CISIN_1g007800mg                   166   1e-44   Citrus sinensis [apfelsine]
gb|KDO77806.1|  hypothetical protein CISIN_1g007800mg                   165   2e-44   Citrus sinensis [apfelsine]
gb|KDO77804.1|  hypothetical protein CISIN_1g007800mg                   166   2e-44   Citrus sinensis [apfelsine]
ref|NP_001275795.1|  pyruvate decarboxylase                             166   2e-44   Citrus sinensis [apfelsine]
ref|XP_010040424.1|  PREDICTED: pyruvate decarboxylase 1-like           166   2e-44   Eucalyptus grandis [rose gum]
ref|XP_007025438.1|  Pyruvate decarboxylase-2 isoform 2                 165   2e-44   
gb|KCW45220.1|  hypothetical protein EUGRSUZ_L01136                     166   2e-44   Eucalyptus grandis [rose gum]
ref|XP_007025437.1|  Pyruvate decarboxylase-2 isoform 1                 165   2e-44   
gb|KCW45222.1|  hypothetical protein EUGRSUZ_L01136                     165   3e-44   Eucalyptus grandis [rose gum]
gb|AAO42252.1|  putative pyruvate decarboxylase                         165   3e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010924891.1|  PREDICTED: pyruvate decarboxylase 1-like           165   3e-44   Elaeis guineensis
ref|XP_008225205.1|  PREDICTED: pyruvate decarboxylase 1                164   4e-44   Prunus mume [ume]
gb|AAA68289.1|  pyruvate decarboxylase                                  164   4e-44   Oryza sativa Indica Group [Indian rice]
ref|XP_004961783.1|  PREDICTED: pyruvate decarboxylase 1-like           164   4e-44   Setaria italica
ref|XP_003542972.1|  PREDICTED: pyruvate decarboxylase 1-like           164   5e-44   Glycine max [soybeans]
ref|XP_010686333.1|  PREDICTED: pyruvate decarboxylase 1                164   5e-44   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008244071.1|  PREDICTED: pyruvate decarboxylase 2-like           164   5e-44   Prunus mume [ume]
ref|XP_002305755.2|  pyruvate decarboxylase family protein              164   6e-44   
ref|XP_002870930.1|  pyruvate decarboxylase-3                           164   6e-44   Arabidopsis lyrata subsp. lyrata
ref|XP_009386639.1|  PREDICTED: pyruvate decarboxylase 1-like           164   7e-44   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011027712.1|  PREDICTED: pyruvate decarboxylase 1-like           164   7e-44   Populus euphratica
emb|CDO96745.1|  unnamed protein product                                164   8e-44   Coffea canephora [robusta coffee]
ref|XP_010912563.1|  PREDICTED: pyruvate decarboxylase 1                162   8e-44   Elaeis guineensis
emb|CAG30578.1|  pyruvate decarboxylase isozyme 1                       164   9e-44   Lotus japonicus
ref|XP_011045902.1|  PREDICTED: pyruvate decarboxylase 1                163   1e-43   Populus euphratica
ref|XP_006449474.1|  hypothetical protein CICLE_v10014703mg             162   1e-43   Citrus clementina [clementine]
ref|XP_007213938.1|  hypothetical protein PRUPE_ppa003458mg             163   1e-43   Prunus persica
gb|AAX33299.1|  pyruvate decarboxylase 2                                163   1e-43   Petunia x hybrida [garden petunia]
ref|NP_195753.1|  pyruvate decarboxylase-3                              163   1e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010108431.1|  Pyruvate decarboxylase isozyme 1                   163   1e-43   Morus notabilis
ref|XP_010257091.1|  PREDICTED: pyruvate decarboxylase 1-like           163   1e-43   Nelumbo nucifera [Indian lotus]
ref|XP_006449473.1|  hypothetical protein CICLE_v10014703mg             162   2e-43   
ref|XP_007148065.1|  hypothetical protein PHAVU_006G177600g             162   3e-43   Phaseolus vulgaris [French bean]
ref|XP_002522545.1|  pyruvate decarboxylase, putative                   162   4e-43   Ricinus communis
ref|XP_002439941.1|  hypothetical protein SORBIDRAFT_09g023060          162   5e-43   Sorghum bicolor [broomcorn]
ref|XP_003593734.1|  Pyruvate decarboxylase                             161   6e-43   Medicago truncatula
gb|EYU28059.1|  hypothetical protein MIMGU_mgv1a003736mg                161   6e-43   Erythranthe guttata [common monkey flower]
ref|XP_008805886.1|  PREDICTED: pyruvate decarboxylase 1                161   6e-43   Phoenix dactylifera
gb|ACR35995.1|  unknown                                                 161   7e-43   Zea mays [maize]
sp|P28516.1|PDC1_MAIZE  RecName: Full=Pyruvate decarboxylase 1; S...    161   7e-43   Zea mays [maize]
ref|NP_001105422.1|  pyruvate decarboxylase 1                           161   7e-43   
gb|ACG29583.1|  pyruvate decarboxylase isozyme 1                        161   7e-43   Zea mays [maize]
ref|XP_001763233.1|  predicted protein                                  160   1e-42   
ref|XP_008370941.1|  PREDICTED: pyruvate decarboxylase 2-like           152   1e-42   
ref|XP_004293926.1|  PREDICTED: pyruvate decarboxylase 1                160   2e-42   Fragaria vesca subsp. vesca
ref|XP_006372352.1|  hypothetical protein POPTR_0017s00800g             160   2e-42   Populus trichocarpa [western balsam poplar]
ref|XP_006658999.1|  PREDICTED: pyruvate decarboxylase 3-like           159   2e-42   
ref|XP_009352809.1|  PREDICTED: pyruvate decarboxylase 1                158   3e-42   Pyrus x bretschneideri [bai li]
ref|XP_002317431.1|  pyruvate decarboxylase family protein              159   5e-42   Populus trichocarpa [western balsam poplar]
gb|AFW80093.1|  pyruvate decarboxylase2                                 155   2e-41   
ref|XP_010089789.1|  Pyruvate decarboxylase isozyme 2                   156   3e-41   Morus notabilis
ref|NP_001105645.1|  pyruvate decarboxylase                             155   5e-41   Zea mays [maize]
gb|ACG41852.1|  pyruvate decarboxylase isozyme 1                        155   6e-41   Zea mays [maize]
gb|ACL54539.1|  unknown                                                 155   6e-41   Zea mays [maize]
ref|XP_007214497.1|  hypothetical protein PRUPE_ppa019548mg             155   7e-41   
ref|XP_001756932.1|  predicted protein                                  155   8e-41   
ref|XP_002974798.1|  hypothetical protein SELMODRAFT_101858             155   9e-41   
ref|XP_002963708.1|  hypothetical protein SELMODRAFT_80644              155   9e-41   
ref|XP_002514646.1|  pyruvate decarboxylase, putative                   154   1e-40   Ricinus communis
ref|XP_002989648.1|  hypothetical protein SELMODRAFT_160305             154   3e-40   Selaginella moellendorffii
ref|XP_002986100.1|  hypothetical protein SELMODRAFT_157772             154   3e-40   Selaginella moellendorffii
ref|XP_003532957.2|  PREDICTED: pyruvate decarboxylase 2-like           154   4e-40   Glycine max [soybeans]
gb|KHN26768.1|  Pyruvate decarboxylase isozyme 2                        153   4e-40   Glycine soja [wild soybean]
ref|XP_010040428.1|  PREDICTED: pyruvate decarboxylase 1-like           153   6e-40   Eucalyptus grandis [rose gum]
ref|XP_007208149.1|  hypothetical protein PRUPE_ppa023325mg             152   7e-40   
gb|EMS61276.1|  Pyruvate decarboxylase isozyme 2                        147   2e-39   
ref|XP_004485602.1|  PREDICTED: pyruvate decarboxylase isozyme 2-...    150   8e-39   
ref|XP_001782896.1|  predicted protein                                  149   1e-38   
ref|XP_007213456.1|  hypothetical protein PRUPE_ppa024595mg             140   1e-38   
ref|XP_002455158.1|  hypothetical protein SORBIDRAFT_03g005240          146   2e-38   
gb|KGN54393.1|  hypothetical protein Csa_4G312260                       143   3e-38   
ref|XP_002514645.1|  pyruvate decarboxylase, putative                   147   4e-38   
gb|AES63495.2|  pyruvate decarboxylase                                  147   7e-38   
ref|XP_003593244.1|  Pyruvate decarboxylase isozyme                     147   7e-38   
ref|XP_001773989.1|  predicted protein                                  145   8e-38   
ref|XP_004486250.1|  PREDICTED: pyruvate decarboxylase isozyme 2-...    147   9e-38   
gb|KCW88159.1|  hypothetical protein EUGRSUZ_A00548                     146   9e-38   
ref|XP_004968281.1|  PREDICTED: pyruvate decarboxylase 2-like           144   1e-37   
gb|KCW44313.1|  hypothetical protein EUGRSUZ_L02239                     144   2e-37   
ref|NP_001042088.1|  Os01g0160100                                       142   2e-37   
ref|XP_010054593.1|  PREDICTED: pyruvate decarboxylase 1-like           145   5e-37   
dbj|BAK02798.1|  predicted protein                                      142   6e-37   
gb|KCW76960.1|  hypothetical protein EUGRSUZ_D01319                     144   7e-37   
ref|XP_004148630.1|  PREDICTED: pyruvate decarboxylase isozyme 1-...    144   1e-36   
emb|CDM81546.1|  unnamed protein product                                140   2e-36   
ref|XP_008464266.1|  PREDICTED: pyruvate decarboxylase 1-like           143   2e-36   
ref|XP_004167935.1|  PREDICTED: LOW QUALITY PROTEIN: pyruvate dec...    142   3e-36   
ref|XP_004148631.1|  PREDICTED: pyruvate decarboxylase isozyme 1-...    142   3e-36   
gb|KGN54391.1|  hypothetical protein Csa_4G312240                       143   4e-36   
gb|KGN54392.1|  hypothetical protein Csa_4G312250                       142   4e-36   
gb|EAY72634.1|  hypothetical protein OsI_00500                          138   6e-36   
ref|XP_008464213.1|  PREDICTED: pyruvate decarboxylase 1-like           141   9e-36   
ref|XP_008464214.1|  PREDICTED: LOW QUALITY PROTEIN: pyruvate dec...    141   1e-35   
ref|XP_004148632.1|  PREDICTED: pyruvate decarboxylase isozyme 1-...    140   2e-35   
ref|XP_003569007.1|  PREDICTED: pyruvate decarboxylase 1-like           135   9e-35   
ref|XP_005643654.1|  pyruvate decarboxylase                             133   6e-33   
gb|AAA90948.1|  pyruvate decarboxylase 2                                125   4e-32   
gb|EEE58866.1|  hypothetical protein OsJ_10464                          124   6e-32   
ref|XP_009358206.1|  PREDICTED: pyruvate decarboxylase 1-like           124   1e-31   
ref|XP_002461271.1|  hypothetical protein SORBIDRAFT_02g043900          122   2e-31   
gb|KFK34230.1|  hypothetical protein AALP_AA5G117800                    120   4e-31   
ref|XP_002977201.1|  hypothetical protein SELMODRAFT_417071             124   2e-29   
emb|CBI15925.3|  unnamed protein product                                110   8e-28   
ref|XP_005847311.1|  hypothetical protein CHLNCDRAFT_52583              118   2e-27   
ref|XP_008355124.1|  PREDICTED: pyruvate decarboxylase 1-like           115   4e-27   
ref|WP_040916638.1|  hypothetical protein                               111   8e-27   
ref|WP_019235242.1|  pyruvate decarboxylase                             114   3e-26   
ref|XP_011397126.1|  Pyruvate decarboxylase 2                           114   4e-26   
ref|WP_031564015.1|  pyruvate decarboxylase                             114   5e-26   
ref|WP_028382550.1|  pyruvate decarboxylase                             113   7e-26   
ref|WP_014105323.1|  pyruvate decarboxylase                             113   9e-26   
ref|WP_010654974.1|  pyruvate decarboxylase                             112   2e-25   
ref|WP_007397706.1|  MULTISPECIES: pyruvate decarboxylase               112   3e-25   
ref|WP_003622049.1|  pyruvate decarboxylase                             112   3e-25   
ref|WP_010515737.1|  pyruvate decarboxylase                             112   3e-25   
ref|WP_019090978.1|  pyruvate decarboxylase                             112   3e-25   
ref|WP_010509054.1|  pyruvate decarboxylase                             112   3e-25   
ref|WP_039736366.1|  pyruvate decarboxylase                             111   4e-25   
ref|WP_006115789.1|  pyruvate decarboxylase                             111   4e-25   
ref|WP_019088123.1|  pyruvate decarboxylase                             111   5e-25   
ref|WP_020944449.1|  pyruvate decarboxylase                             111   5e-25   
ref|WP_035366029.1|  pyruvate decarboxylase                             111   5e-25   
ref|WP_019085054.1|  pyruvate decarboxylase                             111   5e-25   
ref|WP_025439431.1|  pyruvate decarboxylase                             110   7e-25   
ref|WP_042788399.1|  pyruvate decarboxylase                             109   2e-24   
gb|EUA30271.1|  thiamine pyrophosphate enzyme, N-terminal TPP bin...    104   2e-24   
ref|XP_007918504.1|  putative pyruvate decarboxylase protein            109   2e-24   
ref|WP_014457473.1|  pyruvate decarboxylase                             109   3e-24   
gb|EAZ02532.1|  hypothetical protein OsI_24641                          103   3e-24   
ref|WP_002764831.1|  pyruvate decarboxylase                             108   6e-24   
ref|WP_014841393.1|  pyruvate decarboxylase                             108   7e-24   
ref|WP_027265760.1|  pyruvate decarboxylase                             108   8e-24   
ref|WP_011215259.1|  pyruvate decarboxylase                             108   8e-24   
ref|WP_027226213.1|  pyruvate decarboxylase                             107   8e-24   
ref|WP_027220769.1|  pyruvate decarboxylase                             107   8e-24   
ref|WP_002787689.1|  pyruvate decarboxylase                             107   9e-24   
ref|XP_011395109.1|  pyruvate decarboxylase                             107   9e-24   
dbj|GAB31399.1|  pyruvate decarboxylase                                 107   1e-23   
dbj|GAB28165.1|  pyruvate decarboxylase                                 107   1e-23   
gb|EWM28627.1|  pyruvate decarboxylase                                  105   1e-23   
ref|XP_009853563.1|  Pyruvate decarboxylase                             107   1e-23   
ref|XP_001703530.1|  mitochondrial pyruvate dehydrogenase complex...    107   1e-23   
ref|WP_028378501.1|  pyruvate decarboxylase                             107   2e-23   
ref|XP_011395110.1|  pyruvate decarboxylase, variant                    107   2e-23   
ref|WP_027224144.1|  pyruvate decarboxylase                             107   2e-23   
ref|WP_027221397.1|  pyruvate decarboxylase                             107   2e-23   
ref|WP_010946889.1|  pyruvate decarboxylase                             107   2e-23   
ref|WP_027268181.1|  pyruvate decarboxylase                             107   2e-23   
emb|CDP16475.1|  unnamed protein product                                100   2e-23   
gb|KEZ43627.1|  hypothetical protein SAPIO_CDS4223                      108   2e-23   
ref|WP_008853550.1|  pyruvate decarboxylase                             107   2e-23   
ref|WP_010505240.1|  pyruvate decarboxylase                             107   2e-23   
ref|WP_023941876.1|  pyruvate decarboxylase                             106   3e-23   
gb|EPX73372.1|  pyruvate decarboxylase                                  106   3e-23   
ref|WP_042060334.1|  pyruvate decarboxylase                             106   3e-23   
ref|XP_003351329.1|  hypothetical protein SMAC_03633                    105   3e-23   
dbj|BAA13925.1|  unnamed protein product                                106   3e-23   
ref|WP_011213511.1|  pyruvate decarboxylase                             106   3e-23   
sp|Q92345.3|PDC2_SCHPO  RecName: Full=Probable pyruvate decarboxy...    106   3e-23   
gb|EPY50138.1|  pyruvate decarboxylase                                  106   3e-23   
ref|XP_005854872.1|  pyruvate decarboxylase                             106   3e-23   
ref|NP_592796.3|  pyruvate decarboxylase (predicted)                    106   4e-23   
ref|XP_009159300.1|  pyruvate decarboxylase                             106   5e-23   
gb|AAP54301.2|  Pyruvate decarboxylase isozyme 3, putative              101   5e-23   
ref|XP_002951658.1|  hypothetical protein VOLCADRAFT_105183             106   5e-23   
ref|WP_020414286.1|  hypothetical protein                               105   5e-23   
gb|AEW09284.1|  hypothetical protein UMN_2387_01                      98.6    5e-23   
ref|WP_002648470.1|  pyruvate decarboxylase                             105   6e-23   
ref|WP_034959544.1|  pyruvate decarboxylase                             100   7e-23   
ref|XP_001904289.1|  hypothetical protein                               105   7e-23   
gb|EAZ44507.1|  hypothetical protein OsJ_29124                          100   1e-22   
ref|WP_043549626.1|  pyruvate decarboxylase                             105   1e-22   
ref|WP_034336516.1|  pyruvate decarboxylase                             104   1e-22   
gb|KIW34410.1|  hypothetical protein PV07_01188                         104   1e-22   
emb|CAH66036.1|  H0515C11.12                                          98.2    1e-22   
ref|WP_026707173.1|  pyruvate decarboxylase                             104   2e-22   
ref|WP_025828656.1|  pyruvate decarboxylase                             104   2e-22   
emb|CDM34749.1|  Probable pyruvate decarboxylase C186.09                103   2e-22   
ref|WP_003922707.1|  alpha-keto acid decarboxylase                      103   2e-22   
ref|XP_010040426.1|  PREDICTED: pyruvate decarboxylase 1-like         92.0    3e-22   
gb|EXL39445.1|  pyruvate decarboxylase                                  103   5e-22   
ref|WP_029606093.1|  pyruvate decarboxylase                             103   5e-22   
gb|EAY96766.1|  hypothetical protein OsI_18688                        99.0    5e-22   
ref|WP_031743820.1|  indolepyruvate decarboxylase                       100   5e-22   
gb|AAK21348.1|AC024594_12  putative pyruvate decarboxylase              101   5e-22   
ref|WP_008852112.1|  pyruvate decarboxylase                             102   5e-22   
gb|EHK26559.1|  hypothetical protein TRIVIDRAFT_52525                   102   5e-22   
ref|WP_024457955.1|  indolepyruvate decarboxylase                       100   5e-22   
ref|XP_753176.1|  pyruvate decarboxylase                                102   5e-22   
ref|XP_006488692.1|  PREDICTED: LOW QUALITY PROTEIN: pyruvate dec...  94.4    6e-22   
ref|WP_024458406.1|  indolepyruvate decarboxylase                       100   6e-22   
ref|WP_024456954.1|  indolepyruvate decarboxylase                       100   6e-22   
ref|WP_016720255.1|  alpha-keto acid decarboxylase                      100   6e-22   
gb|KEY84000.1|  pyruvate decarboxylase                                  102   7e-22   
ref|WP_031708769.1|  indolepyruvate decarboxylase                       101   7e-22   
ref|XP_001270421.1|  pyruvate decarboxylase                             103   7e-22   
ref|XP_002552742.1|  KLTH0D00418p                                       102   8e-22   
ref|WP_012386294.1|  pyruvate decarboxylase                             102   1e-21   
ref|WP_034167542.1|  indolepyruvate decarboxylase                       100   1e-21   
ref|WP_003900222.1|  MULTISPECIES: alpha-keto acid decarboxylase        100   1e-21   
ref|WP_031660802.1|  indolepyruvate decarboxylase                       100   1e-21   
ref|WP_031695085.1|  indolepyruvate decarboxylase                       100   1e-21   
ref|WP_031729844.1|  indolepyruvate decarboxylase                       100   1e-21   
ref|WP_003404411.1|  pyruvate or indole-3-pyruvate decarboxylase pdc    100   1e-21   
ref|WP_023641674.1|  alpha-keto acid decarboxylase                      100   1e-21   
ref|WP_031716905.1|  indolepyruvate decarboxylase                       100   1e-21   
ref|WP_031712998.1|  indolepyruvate decarboxylase                       100   1e-21   
ref|WP_014000464.1|  alpha-keto acid decarboxylase                      100   1e-21   
ref|WP_042914660.1|  indolepyruvate decarboxylase                       100   1e-21   
gb|AIH99848.1|  indolepyruvate decarboxylase                            100   1e-21   
ref|WP_031738643.1|  indolepyruvate decarboxylase                       100   1e-21   
ref|WP_031677215.1|  indolepyruvate decarboxylase                       100   1e-21   
ref|WP_003898617.1|  alpha-keto acid decarboxylase                      100   1e-21   
ref|WP_031702981.1|  indolepyruvate decarboxylase                       100   1e-21   
ref|WP_044096050.1|  indolepyruvate decarboxylase                       100   1e-21   
ref|WP_031731750.1|  indolepyruvate decarboxylase                       100   1e-21   
ref|WP_023644611.1|  alpha-keto acid decarboxylase                      100   1e-21   
ref|WP_016719318.1|  alpha-keto acid decarboxylase                      100   1e-21   
ref|WP_015292487.1|  Putative pyruvate or indole-3-pyruvate decar...    100   1e-21   
ref|WP_013988779.1|  alpha-keto acid decarboxylase                      100   1e-21   
ref|WP_031658842.1|  indolepyruvate decarboxylase                       100   1e-21   
ref|WP_029400992.1|  indolepyruvate decarboxylase                       100   1e-21   
ref|WP_031741435.1|  indolepyruvate decarboxylase                       100   1e-21   
ref|WP_011252642.1|  pyruvate decarboxylase                             102   1e-21   
ref|WP_041111546.1|  pyruvate decarboxylase                             102   1e-21   
gb|AAX95116.1|  Thiamine pyrophosphate enzyme, N-terminal TPP bin...  96.7    1e-21   
gb|AHB37780.1|  pyruvate decarboxylase                                  102   1e-21   
ref|WP_015289336.1|  Putative pyruvate or indole-3-pyruvate decar...    100   1e-21   
ref|WP_015302683.1|  Putative pyruvate or indole-3-pyruvate decar...    100   1e-21   
ref|WP_031746921.1|  indolepyruvate decarboxylase                       100   1e-21   
ref|WP_007283613.1|  pyruvate decarboxylase                             101   1e-21   
gb|KBZ57184.1|  pyruvate or indole-3-pyruvate decarboxylase Pdc         100   1e-21   
ref|WP_015073497.1|  pyruvate decarboxylase                             101   2e-21   
ref|XP_001217746.1|  predicted protein                                  102   2e-21   
ref|WP_031581818.1|  indolepyruvate decarboxylase                     99.8    2e-21   
gb|KFZ19401.1|  hypothetical protein V501_00673                         101   2e-21   
ref|WP_031737997.1|  indolepyruvate decarboxylase                     99.4    2e-21   
ref|WP_031724547.1|  indolepyruvate decarboxylase                     99.4    2e-21   
gb|ETB43480.1|  alpha-keto acid decarboxylase                         99.0    3e-21   
gb|ETB50743.1|  alpha-keto acid decarboxylase                         99.0    3e-21   
ref|WP_023883487.1|  alpha-keto acid decarboxylase                    99.0    3e-21   
gb|ETB49168.1|  alpha-keto acid decarboxylase                         99.0    3e-21   
gb|EUA37067.1|  thiamine pyrophosphate enzyme, N-terminal TPP bin...  99.0    3e-21   
ref|WP_031717975.1|  indolepyruvate decarboxylase                     99.0    3e-21   
ref|WP_038612918.1|  pyruvate decarboxylase                             100   4e-21   
ref|WP_018389274.1|  hypothetical protein                               100   4e-21   
gb|EXL66437.1|  pyruvate decarboxylase                                98.6    5e-21   
gb|AFG60895.1|  hypothetical protein UMN_2387_01                      93.6    5e-21   
emb|CDH18115.1|  uncharacterized protein ZBAI_09903                   94.7    5e-21   
ref|WP_026071395.1|  indolepyruvate decarboxylase                       100   6e-21   
ref|WP_029383840.1|  indolepyruvate decarboxylase                       100   6e-21   
gb|ELR83736.1|  pdc                                                     100   6e-21   
ref|WP_036429135.1|  indolepyruvate decarboxylase                       100   6e-21   
gb|AEW09283.1|  hypothetical protein UMN_2387_01                      93.2    6e-21   
ref|WP_038538416.1|  MULTISPECIES: indolepyruvate decarboxylase         100   6e-21   
ref|WP_042911065.1|  indolepyruvate decarboxylase                       100   6e-21   
ref|WP_041298159.1|  indolepyruvate decarboxylase                     99.8    6e-21   
ref|WP_036454662.1|  MULTISPECIES: indolepyruvate decarboxylase       99.8    6e-21   
gb|EFG75569.1|  alpha-keto-acid decarboxylase                         99.8    7e-21   
gb|KID98030.1|  pyruvate decarboxylase                                99.8    8e-21   
gb|AFG60892.1|  hypothetical protein UMN_2387_01                      92.8    8e-21   
gb|KID83275.1|  pyruvate decarboxylase                                99.8    9e-21   
ref|WP_036447590.1|  indolepyruvate decarboxylase                     97.4    9e-21   
ref|WP_010667855.1|  pyruvate decarboxylase                           99.4    1e-20   
ref|WP_036365050.1|  indolepyruvate decarboxylase                     99.4    1e-20   
ref|WP_029110438.1|  indolepyruvate decarboxylase                     97.1    1e-20   
ref|WP_026398870.1|  pyruvate decarboxylase                           99.0    2e-20   
dbj|GAA90238.1|  pyruvate decarboxylase                               99.8    2e-20   
gb|KBZ59417.1|  pyruvate or indole-3-pyruvate decarboxylase Pdc       98.6    2e-20   
gb|EUA07723.1|  thiamine pyrophosphate enzyme, N-terminal TPP bin...  95.5    2e-20   
ref|WP_044487275.1|  indolepyruvate decarboxylase                     98.6    2e-20   
ref|WP_007777235.1|  alpha-keto acid decarboxylase                    98.6    2e-20   
ref|WP_033719009.1|  indolepyruvate decarboxylase                     98.6    2e-20   
ref|WP_003877322.1|  Pdc                                              98.6    2e-20   
ref|WP_023864093.1|  alpha-keto acid decarboxylase                    98.6    2e-20   
ref|WP_036448841.1|  indolepyruvate decarboxylase                     98.6    2e-20   
ref|WP_031351756.1|  indolepyruvate decarboxylase                     98.6    2e-20   
gb|ETW24796.1|  alpha-keto acid decarboxylase                         98.6    2e-20   
ref|WP_019732169.1|  MULTISPECIES: alpha-keto acid decarboxylase      98.6    2e-20   
ref|WP_036412252.1|  indolepyruvate decarboxylase                     98.6    2e-20   
sp|A0QBE6.2|KDC_MYCA1  RecName: Full=Alpha-keto-acid decarboxylas...  98.6    2e-20   
ref|WP_011723869.1|  alpha-keto acid decarboxylase                    98.6    2e-20   
sp|Q742Q2.1|KDC_MYCPA  RecName: Full=Alpha-keto-acid decarboxylas...  98.6    2e-20   
ref|WP_009975093.1|  alpha-keto acid decarboxylase                    98.6    2e-20   
ref|WP_036445652.1|  indolepyruvate decarboxylase                     98.6    2e-20   
ref|WP_031349027.1|  indolepyruvate decarboxylase                     98.6    2e-20   



>emb|CDP06456.1| unnamed protein product [Coffea canephora]
Length=603

 Score =   213 bits (541),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 116/145 (80%), Positives = 133/145 (92%), Gaps = 0/145 (0%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVF  264
            MDT+IG+++ CKP S DV + PT G  T+H +P++F+SA++TLGRHLARRLVQ+GV DVF
Sbjct  1    MDTRIGALDTCKPLSNDVGSLPTNGAVTIHQSPISFNSADSTLGRHLARRLVQVGVNDVF  60

Query  265  SVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLN  444
            SVPGDFNLTLLDHL+AEPGL L+GCCNELNAGYAADGYAR RGVGACVVTFTVGGLS+LN
Sbjct  61   SVPGDFNLTLLDHLLAEPGLNLVGCCNELNAGYAADGYARCRGVGACVVTFTVGGLSILN  120

Query  445  AIAGAYSENLPLICIVGGPNSNDYG  519
            AIAGAYSENLP+ICIVGGPNSNDYG
Sbjct  121  AIAGAYSENLPVICIVGGPNSNDYG  145



>ref|XP_009769363.1| PREDICTED: pyruvate decarboxylase 1-like [Nicotiana sylvestris]
Length=603

 Score =   209 bits (531),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 118/145 (81%), Positives = 129/145 (89%), Gaps = 0/145 (0%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVF  264
            MD KIG+I+ CKP + DV + PT    T+H+  V F+S ++TLGRHLARRLVQ+GVTDVF
Sbjct  1    MDAKIGAIDTCKPANNDVGSLPTTNTVTIHTPTVPFNSPDSTLGRHLARRLVQVGVTDVF  60

Query  265  SVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLN  444
             VPGDFNLTLLDHLIAEPGL+ IGCCNELNAGYAADGYARARGVGACVVTFTVGGLSVLN
Sbjct  61   GVPGDFNLTLLDHLIAEPGLKFIGCCNELNAGYAADGYARARGVGACVVTFTVGGLSVLN  120

Query  445  AIAGAYSENLPLICIVGGPNSNDYG  519
            AIAGAYSENLPLICIVGGPNSNDYG
Sbjct  121  AIAGAYSENLPLICIVGGPNSNDYG  145



>ref|XP_009622836.1| PREDICTED: pyruvate decarboxylase 1-like [Nicotiana tomentosiformis]
Length=603

 Score =   207 bits (528),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 118/145 (81%), Positives = 129/145 (89%), Gaps = 0/145 (0%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVF  264
            MD KIG+I+ CKP + DV + PT    T+H+  V F+S ++TLGRHLARRLVQ+GVTDVF
Sbjct  1    MDAKIGAIDTCKPANNDVGSLPTTNSVTIHTPTVPFNSPDSTLGRHLARRLVQVGVTDVF  60

Query  265  SVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLN  444
             VPGDFNLTLLDHLIAEPGL+ IGCCNELNAGYAADGYARARGVGACVVTFTVGGLSVLN
Sbjct  61   GVPGDFNLTLLDHLIAEPGLKFIGCCNELNAGYAADGYARARGVGACVVTFTVGGLSVLN  120

Query  445  AIAGAYSENLPLICIVGGPNSNDYG  519
            AIAGAYSENLPLICIVGGPNSNDYG
Sbjct  121  AIAGAYSENLPLICIVGGPNSNDYG  145



>ref|XP_011095042.1| PREDICTED: pyruvate decarboxylase 1 [Sesamum indicum]
Length=605

 Score =   207 bits (526),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 123/147 (84%), Positives = 136/147 (93%), Gaps = 2/147 (1%)
 Frame = +1

Query  85   MDTKIGSIEACKPGS-GDVANAPTIGV-NTVHSTPVAFSSAEATLGRHLARRLVQIGVTD  258
            M+TKIGS+++CKP +  DV + P+ GV +T+ S+ VAF+SAEATLGRHLARRLVQIGV+D
Sbjct  1    METKIGSLDSCKPATCNDVGSLPSNGVVSTIQSSVVAFNSAEATLGRHLARRLVQIGVSD  60

Query  259  VFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSV  438
            VFSVPGDFNLTLLDHLIAEP L LIGCCNELNAGYAADGYARARGVGACVVTFTVGGLSV
Sbjct  61   VFSVPGDFNLTLLDHLIAEPSLNLIGCCNELNAGYAADGYARARGVGACVVTFTVGGLSV  120

Query  439  LNAIAGAYSENLPLICIVGGPNSNDYG  519
            LNAIAGAYSENLP+ICIVGGPNSNDYG
Sbjct  121  LNAIAGAYSENLPVICIVGGPNSNDYG  147



>ref|XP_010553236.1| PREDICTED: pyruvate decarboxylase 2-like [Tarenaya hassleriana]
Length=610

 Score =   206 bits (525),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 119/150 (79%), Positives = 133/150 (89%), Gaps = 5/150 (3%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTVHSTPVAFSSA-----EATLGRHLARRLVQIG  249
            MDTK+GSI++C P S D+  +P  GV+T+ S+P + S A     +ATLGRHLARRLV+IG
Sbjct  1    MDTKVGSIDSCIPASNDIGGSPNCGVSTIESSPTSHSPAVVSPSDATLGRHLARRLVEIG  60

Query  250  VTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGG  429
            VTDVFSVPGDFNLTLLDHLIAEP L+LIGCCNELNAGYAADGYAR+RGVGACVVTFTVGG
Sbjct  61   VTDVFSVPGDFNLTLLDHLIAEPRLKLIGCCNELNAGYAADGYARSRGVGACVVTFTVGG  120

Query  430  LSVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            LSVLNAIAGAYSENLP+ICIVGGPNSNDYG
Sbjct  121  LSVLNAIAGAYSENLPVICIVGGPNSNDYG  150



>ref|XP_010092799.1| Pyruvate decarboxylase isozyme 2 [Morus notabilis]
 gb|EXB52385.1| Pyruvate decarboxylase isozyme 2 [Morus notabilis]
Length=606

 Score =   206 bits (525),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 121/148 (82%), Positives = 131/148 (89%), Gaps = 3/148 (2%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTVHSTPV---AFSSAEATLGRHLARRLVQIGVT  255
            MDTKIG+++AC P S DV   P   V T+ S+ V   AFSS+EATLGRHLARRLVQ+GVT
Sbjct  1    MDTKIGAVDACNPASNDVGGPPIGAVCTIQSSSVPSIAFSSSEATLGRHLARRLVQVGVT  60

Query  256  DVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLS  435
            DVF+VPGDFNLTLLDHLIAEPGL  +GCCNELNAGYAADGYARARGVGACVVTFTVGGLS
Sbjct  61   DVFTVPGDFNLTLLDHLIAEPGLNNVGCCNELNAGYAADGYARARGVGACVVTFTVGGLS  120

Query  436  VLNAIAGAYSENLPLICIVGGPNSNDYG  519
            VLNAIAGAYSENLPLIC+VGGPNSNDYG
Sbjct  121  VLNAIAGAYSENLPLICVVGGPNSNDYG  148



>ref|XP_006362373.1| PREDICTED: pyruvate decarboxylase 2-like [Solanum tuberosum]
Length=603

 Score =   206 bits (524),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 117/145 (81%), Positives = 131/145 (90%), Gaps = 0/145 (0%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVF  264
            MD KIG+I+ CKP +GD+AN PT    T+ ++ + F+S ++TLGRHLARRLVQIGVTDVF
Sbjct  1    MDFKIGAIDTCKPINGDIANVPTNKAVTIQNSTIPFNSPDSTLGRHLARRLVQIGVTDVF  60

Query  265  SVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLN  444
            SVPGDFNLTLLDHLIAEP L LIGCCNELNAGYAADGYARARG+GACVVTFTVGGLS++N
Sbjct  61   SVPGDFNLTLLDHLIAEPELNLIGCCNELNAGYAADGYARARGIGACVVTFTVGGLSIVN  120

Query  445  AIAGAYSENLPLICIVGGPNSNDYG  519
            AIAGAYSENLPLICIVGGPNSNDYG
Sbjct  121  AIAGAYSENLPLICIVGGPNSNDYG  145



>ref|XP_007026637.1| Thiamine pyrophosphate dependent pyruvate decarboxylase family 
protein [Theobroma cacao]
 gb|EOY07139.1| Thiamine pyrophosphate dependent pyruvate decarboxylase family 
protein [Theobroma cacao]
Length=447

 Score =   202 bits (515),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 130/147 (88%), Gaps = 2/147 (1%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTVHST--PVAFSSAEATLGRHLARRLVQIGVTD  258
            MDTKIGS++ CKP S D+ + P   V T+  +  P   +S+EATLGRHLARRLVQ+GVTD
Sbjct  1    MDTKIGSVDICKPTSNDIGSPPNGIVATIQGSVSPTVINSSEATLGRHLARRLVQVGVTD  60

Query  259  VFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSV  438
            VFSVPGDFNLTLLDHLIAEP L+LIGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSV
Sbjct  61   VFSVPGDFNLTLLDHLIAEPELKLIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSV  120

Query  439  LNAIAGAYSENLPLICIVGGPNSNDYG  519
            LNAIAGAYSENLPLICIVGGPNSND+G
Sbjct  121  LNAIAGAYSENLPLICIVGGPNSNDFG  147



>ref|XP_006286440.1| hypothetical protein CARUB_v10003893mg [Capsella rubella]
 gb|EOA19338.1| hypothetical protein CARUB_v10003893mg [Capsella rubella]
Length=604

 Score =   206 bits (523),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 131/146 (90%), Gaps = 1/146 (1%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTVH-STPVAFSSAEATLGRHLARRLVQIGVTDV  261
            MDTKIGSI+ CKP +GD+ + P+  V T+  S+P   +S+EATLGRHLARRLVQ GVTD+
Sbjct  1    MDTKIGSIDTCKPTTGDIGSPPSNAVATIQDSSPSTVTSSEATLGRHLARRLVQAGVTDI  60

Query  262  FSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVL  441
            FSVPGDFNLTLLDHLIAEP L+ IGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSVL
Sbjct  61   FSVPGDFNLTLLDHLIAEPELKNIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVL  120

Query  442  NAIAGAYSENLPLICIVGGPNSNDYG  519
            NAIAGAYSENLPLICIVGGPNSND+G
Sbjct  121  NAIAGAYSENLPLICIVGGPNSNDFG  146



>gb|KFK24633.1| hypothetical protein AALP_AA8G005000 [Arabis alpina]
Length=607

 Score =   205 bits (522),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 119/149 (80%), Positives = 132/149 (89%), Gaps = 4/149 (3%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTVH----STPVAFSSAEATLGRHLARRLVQIGV  252
            MDTKIGSI+ CKP +GDV + P   V T+H    +T ++ SS+EATLGRHLARRLVQ GV
Sbjct  1    MDTKIGSIDTCKPTNGDVGSPPNSTVATIHDSVPATAISISSSEATLGRHLARRLVQAGV  60

Query  253  TDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGL  432
            TD+FSVPGDFNLTLLDHLIAEP L+ IGCCNELNAGYAADGYAR+RGVGACVVTFTVGGL
Sbjct  61   TDIFSVPGDFNLTLLDHLIAEPELKNIGCCNELNAGYAADGYARSRGVGACVVTFTVGGL  120

Query  433  SVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            SVLNAIAGAYSENLP+ICIVGGPNSND+G
Sbjct  121  SVLNAIAGAYSENLPVICIVGGPNSNDFG  149



>ref|XP_010253807.1| PREDICTED: pyruvate decarboxylase 2-like [Nelumbo nucifera]
Length=605

 Score =   205 bits (521),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 121/147 (82%), Positives = 130/147 (88%), Gaps = 2/147 (1%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTVHST--PVAFSSAEATLGRHLARRLVQIGVTD  258
            MDTKIGSI+A KP   DV + P  GV+ V ++  P    S+EATLGRH+ARRLVQIGVTD
Sbjct  1    MDTKIGSIDASKPTCNDVGSLPNGGVSIVQNSVSPAVMGSSEATLGRHIARRLVQIGVTD  60

Query  259  VFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSV  438
            VFSVPGDFNLTLLDHLIAEPGL LIGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSV
Sbjct  61   VFSVPGDFNLTLLDHLIAEPGLNLIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSV  120

Query  439  LNAIAGAYSENLPLICIVGGPNSNDYG  519
            LNAIAGAYSENLP+ICIVGGPNSNDYG
Sbjct  121  LNAIAGAYSENLPIICIVGGPNSNDYG  147



>emb|CDY66930.1| BnaCnng52860D [Brassica napus]
Length=607

 Score =   205 bits (521),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 119/149 (80%), Positives = 133/149 (89%), Gaps = 4/149 (3%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTVH----STPVAFSSAEATLGRHLARRLVQIGV  252
            MDTKIGSI+ACKP +GDV + P+  V T+H    S+ ++  S+EATLGRHLARRLVQ GV
Sbjct  1    MDTKIGSIDACKPTNGDVGSPPSGAVATIHDSAPSSALSVGSSEATLGRHLARRLVQAGV  60

Query  253  TDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGL  432
            TD+FSVPGDFNLTLLDHLIAEP L+ IGCCNELNAGYAADGYAR+RGVGACVVTFTVGGL
Sbjct  61   TDIFSVPGDFNLTLLDHLIAEPELKNIGCCNELNAGYAADGYARSRGVGACVVTFTVGGL  120

Query  433  SVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            SVLNAIAGAYSENLP+ICIVGGPNSND+G
Sbjct  121  SVLNAIAGAYSENLPVICIVGGPNSNDFG  149



>ref|XP_010447294.1| PREDICTED: pyruvate decarboxylase 1-like [Camelina sativa]
Length=605

 Score =   205 bits (521),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 130/147 (88%), Gaps = 2/147 (1%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTVHST--PVAFSSAEATLGRHLARRLVQIGVTD  258
            MDTKIGSI+ CKP +GDV + P   V T+H +  P + +S +ATLGRHLARRLVQ GVTD
Sbjct  1    MDTKIGSIDECKPTNGDVGSPPNTTVKTIHDSVIPSSVNSCDATLGRHLARRLVQSGVTD  60

Query  259  VFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSV  438
            +FSVPGDFNLTLLDHL+AEP L LIGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSV
Sbjct  61   IFSVPGDFNLTLLDHLMAEPELNLIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSV  120

Query  439  LNAIAGAYSENLPLICIVGGPNSNDYG  519
            LNAIAGAYSENLP+ICIVGGPNSNDYG
Sbjct  121  LNAIAGAYSENLPVICIVGGPNSNDYG  147



>ref|XP_009125425.1| PREDICTED: pyruvate decarboxylase 4 [Brassica rapa]
 emb|CDY55899.1| BnaAnng13920D [Brassica napus]
Length=607

 Score =   205 bits (521),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 119/149 (80%), Positives = 133/149 (89%), Gaps = 4/149 (3%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTVH----STPVAFSSAEATLGRHLARRLVQIGV  252
            MDTKIGSI+ACKP +GDV + P+  V T+H    S+ ++  S+EATLGRHLARRLVQ GV
Sbjct  1    MDTKIGSIDACKPTNGDVGSPPSGAVATIHDSAPSSALSVGSSEATLGRHLARRLVQAGV  60

Query  253  TDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGL  432
            TD+FSVPGDFNLTLLDHLIAEP L+ IGCCNELNAGYAADGYAR+RGVGACVVTFTVGGL
Sbjct  61   TDIFSVPGDFNLTLLDHLIAEPELKNIGCCNELNAGYAADGYARSRGVGACVVTFTVGGL  120

Query  433  SVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            SVLNAIAGAYSENLP+ICIVGGPNSND+G
Sbjct  121  SVLNAIAGAYSENLPVICIVGGPNSNDFG  149



>ref|XP_006283364.1| hypothetical protein CARUB_v10004406mg [Capsella rubella]
 gb|EOA16262.1| hypothetical protein CARUB_v10004406mg [Capsella rubella]
Length=607

 Score =   205 bits (521),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 122/149 (82%), Positives = 131/149 (88%), Gaps = 4/149 (3%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTVH-STP---VAFSSAEATLGRHLARRLVQIGV  252
            MDTKIGSI+ CKP +GDV + P   V T+H S P   ++ SS +ATLGRHLARRLVQ GV
Sbjct  1    MDTKIGSIDECKPTTGDVGSPPNGAVATIHDSVPPSAISVSSCDATLGRHLARRLVQAGV  60

Query  253  TDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGL  432
            TDVFSVPGDFNLTLLDHL+AEP L LIGCCNELNAGYAADGYAR+RGVGACVVTFTVGGL
Sbjct  61   TDVFSVPGDFNLTLLDHLMAEPELNLIGCCNELNAGYAADGYARSRGVGACVVTFTVGGL  120

Query  433  SVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            SVLNAIAGAYSENLPLICIVGGPNSNDYG
Sbjct  121  SVLNAIAGAYSENLPLICIVGGPNSNDYG  149



>ref|XP_006429441.1| hypothetical protein CICLE_v10011317mg [Citrus clementina]
 gb|ESR42681.1| hypothetical protein CICLE_v10011317mg [Citrus clementina]
Length=488

 Score =   201 bits (512),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 120/149 (81%), Positives = 131/149 (88%), Gaps = 5/149 (3%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTVHS----TPVAFSSAEATLGRHLARRLVQIGV  252
            MDTKIGS++ CKP   D+A+ P   V+T+ S    TP+  + +E+TLGRHLARRLVQIG 
Sbjct  1    MDTKIGSLDTCKPPCSDLASPPNGAVSTIQSSVPATPLV-NPSESTLGRHLARRLVQIGA  59

Query  253  TDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGL  432
            TDVFSVPGDFNLTLLDHLIAEPGL LIGCCNELNAGYAADGYAR+RGVGACVVTFTVGGL
Sbjct  60   TDVFSVPGDFNLTLLDHLIAEPGLNLIGCCNELNAGYAADGYARSRGVGACVVTFTVGGL  119

Query  433  SVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            SVLNAIAGAYSENLPLICIVGGPNSNDYG
Sbjct  120  SVLNAIAGAYSENLPLICIVGGPNSNDYG  148



>ref|XP_007026634.1| Thiamine pyrophosphate dependent pyruvate decarboxylase family 
protein [Theobroma cacao]
 gb|EOY07136.1| Thiamine pyrophosphate dependent pyruvate decarboxylase family 
protein [Theobroma cacao]
Length=605

 Score =   204 bits (518),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 120/147 (82%), Positives = 128/147 (87%), Gaps = 2/147 (1%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTVHST--PVAFSSAEATLGRHLARRLVQIGVTD  258
            MDTKIGS++ CKP S DV + P   V T+  +  P   +S EATLGRHLARRLVQ+GVTD
Sbjct  1    MDTKIGSLDVCKPSSTDVGSPPNGTVATIQGSVSPTVINSCEATLGRHLARRLVQVGVTD  60

Query  259  VFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSV  438
            VFSVPGDFNLTLLDHLIAEP L LIGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSV
Sbjct  61   VFSVPGDFNLTLLDHLIAEPELNLIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSV  120

Query  439  LNAIAGAYSENLPLICIVGGPNSNDYG  519
            LNAIAGAYSENLPLICIVGGPNSNDYG
Sbjct  121  LNAIAGAYSENLPLICIVGGPNSNDYG  147



>ref|XP_006363625.1| PREDICTED: pyruvate decarboxylase 1-like [Solanum tuberosum]
Length=603

 Score =   203 bits (517),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 117/145 (81%), Positives = 126/145 (87%), Gaps = 0/145 (0%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVF  264
            MD KIG+I+ CKP   DV   PT+   T+H+  V F+S E+TLGRHLARRLVQ+GVTDVF
Sbjct  1    MDVKIGAIDTCKPPHTDVGCLPTVNAVTIHNPAVPFNSPESTLGRHLARRLVQVGVTDVF  60

Query  265  SVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLN  444
             VPGDFNLTLLDHLI EPGL  +GCCNELNAGYAADGYARARGVGACVVTFTVGGLSVLN
Sbjct  61   GVPGDFNLTLLDHLIDEPGLNFVGCCNELNAGYAADGYARARGVGACVVTFTVGGLSVLN  120

Query  445  AIAGAYSENLPLICIVGGPNSNDYG  519
            AIAGAYSENLPLICIVGGPNSNDYG
Sbjct  121  AIAGAYSENLPLICIVGGPNSNDYG  145



>gb|KJB36955.1| hypothetical protein B456_006G184000 [Gossypium raimondii]
Length=555

 Score =   202 bits (514),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 129/147 (88%), Gaps = 2/147 (1%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTVHST--PVAFSSAEATLGRHLARRLVQIGVTD  258
            MDT IGS+++CKP S DV     + V+T+  +  P    S+EATLGRHLARRLVQIG++D
Sbjct  1    MDTNIGSLDSCKPTSNDVCCPANVTVSTIQGSVSPTIIKSSEATLGRHLARRLVQIGISD  60

Query  259  VFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSV  438
            VFSVPGDFNLTLLDHLIAEPGL LIGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSV
Sbjct  61   VFSVPGDFNLTLLDHLIAEPGLNLIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSV  120

Query  439  LNAIAGAYSENLPLICIVGGPNSNDYG  519
            LNAIAGAYSENLPLICIVGGPNSNDYG
Sbjct  121  LNAIAGAYSENLPLICIVGGPNSNDYG  147



>ref|XP_010437810.1| PREDICTED: pyruvate decarboxylase 1 [Camelina sativa]
Length=608

 Score =   203 bits (516),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 118/150 (79%), Positives = 131/150 (87%), Gaps = 5/150 (3%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTVH-----STPVAFSSAEATLGRHLARRLVQIG  249
            MDTKIGSI+ CKP +GDV + P   V T+H     S+ ++ +S +ATLGRHLARRLVQ G
Sbjct  1    MDTKIGSIDECKPTNGDVGSPPNSTVKTIHDSVVPSSAISVNSCDATLGRHLARRLVQSG  60

Query  250  VTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGG  429
            VTD+FSVPGDFNLTLLDHL+AEP L LIGCCNELNAGYAADGYAR+RGVGACVVTFTVGG
Sbjct  61   VTDIFSVPGDFNLTLLDHLMAEPELNLIGCCNELNAGYAADGYARSRGVGACVVTFTVGG  120

Query  430  LSVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            LSVLNAIAGAYSENLP+ICIVGGPNSNDYG
Sbjct  121  LSVLNAIAGAYSENLPVICIVGGPNSNDYG  150



>gb|KJB36954.1| hypothetical protein B456_006G184000 [Gossypium raimondii]
 gb|KJB36956.1| hypothetical protein B456_006G184000 [Gossypium raimondii]
Length=605

 Score =   202 bits (514),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 129/147 (88%), Gaps = 2/147 (1%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTVHST--PVAFSSAEATLGRHLARRLVQIGVTD  258
            MDT IGS+++CKP S DV     + V+T+  +  P    S+EATLGRHLARRLVQIG++D
Sbjct  1    MDTNIGSLDSCKPTSNDVCCPANVTVSTIQGSVSPTIIKSSEATLGRHLARRLVQIGISD  60

Query  259  VFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSV  438
            VFSVPGDFNLTLLDHLIAEPGL LIGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSV
Sbjct  61   VFSVPGDFNLTLLDHLIAEPGLNLIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSV  120

Query  439  LNAIAGAYSENLPLICIVGGPNSNDYG  519
            LNAIAGAYSENLPLICIVGGPNSNDYG
Sbjct  121  LNAIAGAYSENLPLICIVGGPNSNDYG  147



>ref|XP_004249069.1| PREDICTED: pyruvate decarboxylase 1-like [Solanum lycopersicum]
Length=603

 Score =   202 bits (513),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 116/145 (80%), Positives = 125/145 (86%), Gaps = 0/145 (0%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVF  264
            MD KIG+I+ CKP   DV   PT+   T+H+  V F+S E+TLGRHLARRLVQ+GVTDVF
Sbjct  1    MDVKIGAIDTCKPPHTDVGCLPTVNAVTIHNPAVPFNSPESTLGRHLARRLVQVGVTDVF  60

Query  265  SVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLN  444
             VPGDFNLTLLDHLI EP L  +GCCNELNAGYAADGYARARGVGACVVTFTVGGLSVLN
Sbjct  61   GVPGDFNLTLLDHLIDEPALNFVGCCNELNAGYAADGYARARGVGACVVTFTVGGLSVLN  120

Query  445  AIAGAYSENLPLICIVGGPNSNDYG  519
            AIAGAYSENLPLICIVGGPNSNDYG
Sbjct  121  AIAGAYSENLPLICIVGGPNSNDYG  145



>ref|XP_006363624.1| PREDICTED: pyruvate decarboxylase 1-like [Solanum tuberosum]
Length=603

 Score =   201 bits (512),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 116/145 (80%), Positives = 124/145 (86%), Gaps = 0/145 (0%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVF  264
            MD K G+I+ CKP   DV   PT+   T+H+  V F+S E+TLGRHLARRLVQ+GVTDVF
Sbjct  1    MDVKNGAIDTCKPQHTDVGCLPTVNAVTIHNPAVPFNSPESTLGRHLARRLVQVGVTDVF  60

Query  265  SVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLN  444
             VPGDFNLTLLDHLI EPGL  IGCCNELNAGYAADGYARA GVGACVVTFTVGGLSVLN
Sbjct  61   GVPGDFNLTLLDHLIDEPGLNFIGCCNELNAGYAADGYARAHGVGACVVTFTVGGLSVLN  120

Query  445  AIAGAYSENLPLICIVGGPNSNDYG  519
            AIAGAYSENLPLICIVGGPNSNDYG
Sbjct  121  AIAGAYSENLPLICIVGGPNSNDYG  145



>gb|KDO56720.1| hypothetical protein CISIN_1g044559mg [Citrus sinensis]
Length=585

 Score =   201 bits (511),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 120/149 (81%), Positives = 131/149 (88%), Gaps = 5/149 (3%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTVHS----TPVAFSSAEATLGRHLARRLVQIGV  252
            MDTKIGS++ CKP   D+A+ P   V+T+ S    TP+  + +E+TLGRHLARRLVQIG 
Sbjct  1    MDTKIGSLDTCKPPCSDLASPPNGAVSTIQSSVPATPLV-NPSESTLGRHLARRLVQIGA  59

Query  253  TDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGL  432
            TDVFSVPGDFNLTLLDHLIAEPGL LIGCCNELNAGYAADGYAR+RGVGACVVTFTVGGL
Sbjct  60   TDVFSVPGDFNLTLLDHLIAEPGLNLIGCCNELNAGYAADGYARSRGVGACVVTFTVGGL  119

Query  433  SVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            SVLNAIAGAYSENLPLICIVGGPNSNDYG
Sbjct  120  SVLNAIAGAYSENLPLICIVGGPNSNDYG  148



>ref|XP_002870931.1| hypothetical protein ARALYDRAFT_486945 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47190.1| hypothetical protein ARALYDRAFT_486945 [Arabidopsis lyrata subsp. 
lyrata]
Length=603

 Score =   201 bits (511),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 115/145 (79%), Positives = 128/145 (88%), Gaps = 0/145 (0%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVF  264
            MDTKIGSI+ CKP +GDV + P+  V T+  +    +++EATLGRHLARRLVQ GVTD+F
Sbjct  1    MDTKIGSIDTCKPTTGDVGSPPSNAVATIQDSAPTTATSEATLGRHLARRLVQAGVTDIF  60

Query  265  SVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLN  444
            SVPGDFNLTLLDHLIAEP L  IGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSVLN
Sbjct  61   SVPGDFNLTLLDHLIAEPELNNIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLN  120

Query  445  AIAGAYSENLPLICIVGGPNSNDYG  519
            AIAGAYSENLP+ICIVGGPNSND+G
Sbjct  121  AIAGAYSENLPVICIVGGPNSNDFG  145



>ref|XP_006429440.1| hypothetical protein CICLE_v10011317mg [Citrus clementina]
 ref|XP_006481076.1| PREDICTED: pyruvate decarboxylase 1-like [Citrus sinensis]
 gb|ESR42680.1| hypothetical protein CICLE_v10011317mg [Citrus clementina]
Length=606

 Score =   201 bits (511),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 120/149 (81%), Positives = 131/149 (88%), Gaps = 5/149 (3%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTVHS----TPVAFSSAEATLGRHLARRLVQIGV  252
            MDTKIGS++ CKP   D+A+ P   V+T+ S    TP+  + +E+TLGRHLARRLVQIG 
Sbjct  1    MDTKIGSLDTCKPPCSDLASPPNGAVSTIQSSVPATPLV-NPSESTLGRHLARRLVQIGA  59

Query  253  TDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGL  432
            TDVFSVPGDFNLTLLDHLIAEPGL LIGCCNELNAGYAADGYAR+RGVGACVVTFTVGGL
Sbjct  60   TDVFSVPGDFNLTLLDHLIAEPGLNLIGCCNELNAGYAADGYARSRGVGACVVTFTVGGL  119

Query  433  SVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            SVLNAIAGAYSENLPLICIVGGPNSNDYG
Sbjct  120  SVLNAIAGAYSENLPLICIVGGPNSNDYG  148



>ref|XP_006281555.1| hypothetical protein CARUB_v10027657mg [Capsella rubella]
 gb|EOA14453.1| hypothetical protein CARUB_v10027657mg [Capsella rubella]
Length=607

 Score =   201 bits (510),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 121/149 (81%), Positives = 132/149 (89%), Gaps = 4/149 (3%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTVH-STPV---AFSSAEATLGRHLARRLVQIGV  252
            MDTKIGSI+AC P   D+   P  GV+TV  S+P+   A +S +ATLGR+LARRLV+IGV
Sbjct  1    MDTKIGSIDACNPIHDDIGGPPNGGVSTVQNSSPLHSTAITSCDATLGRYLARRLVEIGV  60

Query  253  TDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGL  432
            TDVFSVPGDFNLTLLDHLIAEP L+LIGCCNELNAGYAADGYAR+RGVGACVVTFTVGGL
Sbjct  61   TDVFSVPGDFNLTLLDHLIAEPNLKLIGCCNELNAGYAADGYARSRGVGACVVTFTVGGL  120

Query  433  SVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            SVLNAIAGAYSENLPLICIVGGPNSNDYG
Sbjct  121  SVLNAIAGAYSENLPLICIVGGPNSNDYG  149



>ref|XP_010558370.1| PREDICTED: pyruvate decarboxylase 1-like [Tarenaya hassleriana]
 ref|XP_010558371.1| PREDICTED: pyruvate decarboxylase 1-like [Tarenaya hassleriana]
Length=603

 Score =   200 bits (509),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 116/145 (80%), Positives = 126/145 (87%), Gaps = 0/145 (0%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVF  264
            MDTKIGSI   KP  G+V + P   V+T+ +   AF  ++ATLGRH+ARRLVQ+GVTDVF
Sbjct  1    MDTKIGSINTTKPAHGEVGSPPNGAVSTIQNYVSAFGPSDATLGRHVARRLVQVGVTDVF  60

Query  265  SVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLN  444
            SVPGDFNLTLLDHLIAEP L LIGCCNELNAGYAADGYAR RGVGACVVTFTVGGLSVLN
Sbjct  61   SVPGDFNLTLLDHLIAEPELNLIGCCNELNAGYAADGYARNRGVGACVVTFTVGGLSVLN  120

Query  445  AIAGAYSENLPLICIVGGPNSNDYG  519
            AIAGAYSENLP+ICIVGGPNSNDYG
Sbjct  121  AIAGAYSENLPVICIVGGPNSNDYG  145



>emb|CDY17293.1| BnaA10g09270D [Brassica napus]
Length=607

 Score =   200 bits (509),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 118/149 (79%), Positives = 130/149 (87%), Gaps = 4/149 (3%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTVHSTPVAFSSA----EATLGRHLARRLVQIGV  252
            MDT IGSI+ C P +GD+   P   V+TV ++P A S+     +ATLGR+LARRLV+IGV
Sbjct  1    MDTVIGSIDTCNPATGDICRPPNGTVSTVQTSPPAHSTTISPCDATLGRYLARRLVEIGV  60

Query  253  TDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGL  432
            TDVFSVPGDFNLTLLDHLIAEP L+LIGCCNELNAGYAADGYAR+RGVGACVVTFTVGGL
Sbjct  61   TDVFSVPGDFNLTLLDHLIAEPSLKLIGCCNELNAGYAADGYARSRGVGACVVTFTVGGL  120

Query  433  SVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            SVLNAIAGAYSENLPLICIVGGPNSNDYG
Sbjct  121  SVLNAIAGAYSENLPLICIVGGPNSNDYG  149



>gb|KJB36952.1| hypothetical protein B456_006G183900 [Gossypium raimondii]
Length=480

 Score =   198 bits (503),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 128/147 (87%), Gaps = 2/147 (1%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTVHST--PVAFSSAEATLGRHLARRLVQIGVTD  258
            MDTKIGS++ CKP S DV +     V+T+  +  P   + +EATLGRHLARRLVQIGV D
Sbjct  1    MDTKIGSLDNCKPASNDVCSPVNGTVSTIQGSVYPAVVNFSEATLGRHLARRLVQIGVND  60

Query  259  VFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSV  438
            VFSVPGDFNLTLLDHLIAEPGL LIGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSV
Sbjct  61   VFSVPGDFNLTLLDHLIAEPGLNLIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSV  120

Query  439  LNAIAGAYSENLPLICIVGGPNSNDYG  519
            LNAIAGAYSE+LPLICIVGGPNSNDYG
Sbjct  121  LNAIAGAYSESLPLICIVGGPNSNDYG  147



>ref|XP_010432620.1| PREDICTED: pyruvate decarboxylase 1-like [Camelina sativa]
Length=609

 Score =   200 bits (509),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 132/151 (87%), Gaps = 6/151 (4%)
 Frame = +1

Query  85   MDTKIGS-IEACKPGSGDVANAPTIGVNTVH-----STPVAFSSAEATLGRHLARRLVQI  246
            MDTKIGS I+ CKP +GDV + P + V T+H     S+ ++ +S +ATLGRHLARRLVQ 
Sbjct  1    MDTKIGSSIDECKPTNGDVGSPPNVTVKTIHDSVVPSSAISVNSCDATLGRHLARRLVQS  60

Query  247  GVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVG  426
            GVTD+FSVPGDFNLTLLDHL+AEP L LIGCCNELNAGYAADGYAR+RGVGACVVTFTVG
Sbjct  61   GVTDIFSVPGDFNLTLLDHLMAEPELNLIGCCNELNAGYAADGYARSRGVGACVVTFTVG  120

Query  427  GLSVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            GLSVLNAIAGAYSENLP+ICIVGGPNSNDYG
Sbjct  121  GLSVLNAIAGAYSENLPVICIVGGPNSNDYG  151



>gb|KDP22863.1| hypothetical protein JCGZ_00450 [Jatropha curcas]
Length=605

 Score =   200 bits (508),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 116/147 (79%), Positives = 130/147 (88%), Gaps = 2/147 (1%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTVHST--PVAFSSAEATLGRHLARRLVQIGVTD  258
            MDTKIGS++ CKP +GD+ + P   V+T+  +  P   +  ++TLGRHLARRLVQIGV+D
Sbjct  1    MDTKIGSLDTCKPTNGDLCSPPNSTVSTIQGSVSPTFHTPPDSTLGRHLARRLVQIGVSD  60

Query  259  VFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSV  438
            VFSVPGDFNLTLLDHLIAEPGL LIGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSV
Sbjct  61   VFSVPGDFNLTLLDHLIAEPGLNLIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSV  120

Query  439  LNAIAGAYSENLPLICIVGGPNSNDYG  519
            LNAIAGAYSENLP+ICIVGGPNSNDYG
Sbjct  121  LNAIAGAYSENLPVICIVGGPNSNDYG  147



>ref|NP_200307.1| pyruvate decarboxylase-2 [Arabidopsis thaliana]
 sp|Q9FFT4.1|PDC2_ARATH RecName: Full=Pyruvate decarboxylase 2; Short=AtPDC2 [Arabidopsis 
thaliana]
 dbj|BAB08775.1| pyruvate decarboxylase [Arabidopsis thaliana]
 gb|AED96563.1| pyruvate decarboxylase-2 [Arabidopsis thaliana]
Length=607

 Score =   200 bits (508),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 122/151 (81%), Positives = 131/151 (87%), Gaps = 8/151 (5%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTV------HSTPVAFSSAEATLGRHLARRLVQI  246
            MDTKIGSI+AC P + D+   P  GV+TV      HST V  S  +ATLGR+LARRLV+I
Sbjct  1    MDTKIGSIDACNPTNHDIGGPPNGGVSTVQNTSPLHSTTV--SPCDATLGRYLARRLVEI  58

Query  247  GVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVG  426
            GVTDVFSVPGDFNLTLLDHLIAEP L+LIGCCNELNAGYAADGYAR+RGVGACVVTFTVG
Sbjct  59   GVTDVFSVPGDFNLTLLDHLIAEPNLKLIGCCNELNAGYAADGYARSRGVGACVVTFTVG  118

Query  427  GLSVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            GLSVLNAIAGAYSENLPLICIVGGPNSNDYG
Sbjct  119  GLSVLNAIAGAYSENLPLICIVGGPNSNDYG  149



>ref|XP_009120024.1| PREDICTED: pyruvate decarboxylase 2 [Brassica rapa]
Length=607

 Score =   200 bits (508),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 118/149 (79%), Positives = 130/149 (87%), Gaps = 4/149 (3%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTVHSTPVAFSSA----EATLGRHLARRLVQIGV  252
            MDT IGSI+ C P +GD+   P   V+TV ++P A S+     +ATLGR+LARRLV+IGV
Sbjct  1    MDTVIGSIDTCNPTTGDICRPPNGTVSTVQTSPPAHSTTISPCDATLGRYLARRLVEIGV  60

Query  253  TDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGL  432
            TDVFSVPGDFNLTLLDHLIAEP L+LIGCCNELNAGYAADGYAR+RGVGACVVTFTVGGL
Sbjct  61   TDVFSVPGDFNLTLLDHLIAEPSLKLIGCCNELNAGYAADGYARSRGVGACVVTFTVGGL  120

Query  433  SVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            SVLNAIAGAYSENLPLICIVGGPNSNDYG
Sbjct  121  SVLNAIAGAYSENLPLICIVGGPNSNDYG  149



>gb|AAB16855.1| pyruvate decarboxylase [Arabidopsis thaliana]
Length=607

 Score =   199 bits (507),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 122/151 (81%), Positives = 131/151 (87%), Gaps = 8/151 (5%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTV------HSTPVAFSSAEATLGRHLARRLVQI  246
            MDTKIGSI+AC P + D+   P  GV+TV      HST V  S  +ATLGR+LARRLV+I
Sbjct  1    MDTKIGSIDACNPTNHDIGGPPNGGVSTVQNTSPLHSTTV--SPCDATLGRYLARRLVEI  58

Query  247  GVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVG  426
            GVTDVFSVPGDFNLTLLDHLIAEP L+LIGCCNELNAGYAADGYAR+RGVGACVVTFTVG
Sbjct  59   GVTDVFSVPGDFNLTLLDHLIAEPNLKLIGCCNELNAGYAADGYARSRGVGACVVTFTVG  118

Query  427  GLSVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            GLSVLNAIAGAYSENLPLICIVGGPNSNDYG
Sbjct  119  GLSVLNAIAGAYSENLPLICIVGGPNSNDYG  149



>emb|CDY19880.1| BnaC09g31460D [Brassica napus]
Length=607

 Score =   199 bits (507),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 120/149 (81%), Positives = 129/149 (87%), Gaps = 4/149 (3%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTVH-STP---VAFSSAEATLGRHLARRLVQIGV  252
            MDT IGSI+AC P +GD+   P   V+TV  STP      S  +ATLGR+LARRLV+IGV
Sbjct  1    MDTVIGSIDACNPATGDICRPPNGAVSTVQNSTPAHSTTISPCDATLGRYLARRLVEIGV  60

Query  253  TDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGL  432
            TDVFSVPGDFNLTLLDHLIAEP L+LIGCCNELNAGYAADGYAR+RGVGACVVTFTVGGL
Sbjct  61   TDVFSVPGDFNLTLLDHLIAEPSLKLIGCCNELNAGYAADGYARSRGVGACVVTFTVGGL  120

Query  433  SVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            SVLNAIAGAYSENLPLICIVGGPNSNDYG
Sbjct  121  SVLNAIAGAYSENLPLICIVGGPNSNDYG  149



>ref|XP_010423945.1| PREDICTED: pyruvate decarboxylase 4 [Camelina sativa]
Length=603

 Score =   199 bits (506),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 114/145 (79%), Positives = 127/145 (88%), Gaps = 0/145 (0%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVF  264
            MDTKIGSI+ CKP +GDV + P+  + T+       +++EATLGRHLARRLVQ GVTD+F
Sbjct  1    MDTKIGSIDTCKPTTGDVGSPPSNAIATIQDCAPTTATSEATLGRHLARRLVQAGVTDIF  60

Query  265  SVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLN  444
            SVPGDFNLTLLDHLIAEP L  IGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSVLN
Sbjct  61   SVPGDFNLTLLDHLIAEPELNNIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLN  120

Query  445  AIAGAYSENLPLICIVGGPNSNDYG  519
            AIAGAYSENLP+ICIVGGPNSND+G
Sbjct  121  AIAGAYSENLPVICIVGGPNSNDFG  145



>ref|XP_006398630.1| hypothetical protein EUTSA_v10013008mg [Eutrema salsugineum]
 gb|ESQ40083.1| hypothetical protein EUTSA_v10013008mg [Eutrema salsugineum]
Length=607

 Score =   199 bits (506),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 120/149 (81%), Positives = 131/149 (88%), Gaps = 4/149 (3%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTVH-STP---VAFSSAEATLGRHLARRLVQIGV  252
            MDTKIGSI+ACKP +GDV +     V T++ S P   +AF S+EATLGRHLARRLVQ GV
Sbjct  1    MDTKIGSIDACKPTNGDVCSPSNGAVATINDSAPAPSIAFGSSEATLGRHLARRLVQAGV  60

Query  253  TDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGL  432
            TD+FSVPGDFNLTLLDHLIAEP L  IGCCNELNAGYAADGYAR+RGVGACVVTFTVGGL
Sbjct  61   TDIFSVPGDFNLTLLDHLIAEPELNNIGCCNELNAGYAADGYARSRGVGACVVTFTVGGL  120

Query  433  SVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            SVLNAIAGAYSENLP+ICIVGGPNSND+G
Sbjct  121  SVLNAIAGAYSENLPVICIVGGPNSNDFG  149



>ref|XP_010543216.1| PREDICTED: pyruvate decarboxylase 1 [Tarenaya hassleriana]
Length=604

 Score =   199 bits (506),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 116/146 (79%), Positives = 130/146 (89%), Gaps = 1/146 (1%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTVHST-PVAFSSAEATLGRHLARRLVQIGVTDV  261
            MDT+IGSI+ CKP  GDV       V+T+ S+ P + ++++ATLGRH+ARRLVQ+GVTDV
Sbjct  1    MDTRIGSIDTCKPACGDVICPQNGAVSTIQSSFPASDAASDATLGRHVARRLVQVGVTDV  60

Query  262  FSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVL  441
            FSVPGDFNLTLLDHLIAEP L LIGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSVL
Sbjct  61   FSVPGDFNLTLLDHLIAEPELNLIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVL  120

Query  442  NAIAGAYSENLPLICIVGGPNSNDYG  519
            NAIAGAYSENLP+ICIVGGPNSNDYG
Sbjct  121  NAIAGAYSENLPVICIVGGPNSNDYG  146



>ref|XP_002866069.1| pyruvate decarboxylase-2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42328.1| pyruvate decarboxylase-2 [Arabidopsis lyrata subsp. lyrata]
Length=607

 Score =   199 bits (506),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 120/149 (81%), Positives = 129/149 (87%), Gaps = 4/149 (3%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTVH-STP---VAFSSAEATLGRHLARRLVQIGV  252
            MDTKIGSI+ C P   D+   P  GV+TV  S+P   +  S  EATLGR+LARRLV+IGV
Sbjct  1    MDTKIGSIDVCNPTHDDIGGPPNGGVSTVQNSSPLHSITVSPCEATLGRYLARRLVEIGV  60

Query  253  TDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGL  432
            TDVFSVPGDFNLTLLDHLIAEP L+LIGCCNELNAGYAADGYAR+RGVGACVVTFTVGGL
Sbjct  61   TDVFSVPGDFNLTLLDHLIAEPSLKLIGCCNELNAGYAADGYARSRGVGACVVTFTVGGL  120

Query  433  SVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            SVLNAIAGAYSENLPLICIVGGPNSNDYG
Sbjct  121  SVLNAIAGAYSENLPLICIVGGPNSNDYG  149



>ref|XP_009789106.1| PREDICTED: pyruvate decarboxylase 1 [Nicotiana sylvestris]
Length=625

 Score =   199 bits (507),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 115/145 (79%), Positives = 128/145 (88%), Gaps = 0/145 (0%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVF  264
            MD K+G+I+ CKP +  VAN P     T+ ++ V F+S ++TLGRHLARRLVQIGVTDVF
Sbjct  23   MDFKVGAIDTCKPLNNVVANLPAQNAVTIQTSTVPFNSPDSTLGRHLARRLVQIGVTDVF  82

Query  265  SVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLN  444
            SVPGDFNLTLLDHL++EP L L+GCCNELNAGYAADGYARARGVGACVVTFTVGGLSVLN
Sbjct  83   SVPGDFNLTLLDHLVSEPELNLVGCCNELNAGYAADGYARARGVGACVVTFTVGGLSVLN  142

Query  445  AIAGAYSENLPLICIVGGPNSNDYG  519
            AIAGAYSENLPLICIVGGPNSNDYG
Sbjct  143  AIAGAYSENLPLICIVGGPNSNDYG  167



>ref|XP_010451999.1| PREDICTED: pyruvate decarboxylase 4-like [Camelina sativa]
Length=603

 Score =   199 bits (506),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 114/145 (79%), Positives = 128/145 (88%), Gaps = 0/145 (0%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVF  264
            MDTKIGSI+ CKP +GDV + P+  V T+  +    +++EATLGRHLARRLVQ  VTD+F
Sbjct  1    MDTKIGSIDTCKPTTGDVGSPPSNAVATIQDSVPTTATSEATLGRHLARRLVQAEVTDIF  60

Query  265  SVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLN  444
            SVPGDFNLTLLDHLIAEP L+ IGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSVLN
Sbjct  61   SVPGDFNLTLLDHLIAEPELKNIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLN  120

Query  445  AIAGAYSENLPLICIVGGPNSNDYG  519
            AIAGAYSENLP+ICIVGGPNSND+G
Sbjct  121  AIAGAYSENLPVICIVGGPNSNDFG  145



>ref|XP_002867205.1| hypothetical protein ARALYDRAFT_491381 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43464.1| hypothetical protein ARALYDRAFT_491381 [Arabidopsis lyrata subsp. 
lyrata]
Length=607

 Score =   199 bits (506),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 131/149 (88%), Gaps = 4/149 (3%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTVH----STPVAFSSAEATLGRHLARRLVQIGV  252
            MDTKIGSI+ CKP +GDV + P   V+T+H    S+ +  +S ++T+GR++ARRLVQ GV
Sbjct  1    MDTKIGSIDYCKPTNGDVGSPPNGAVSTIHNSVPSSAITVNSCDSTIGRYIARRLVQAGV  60

Query  253  TDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGL  432
            TD+FSVPGDFNLTLLDHL+AEP L LIGCCNELNAGYAADGYAR+RGVGACVVTFTVGGL
Sbjct  61   TDIFSVPGDFNLTLLDHLMAEPELNLIGCCNELNAGYAADGYARSRGVGACVVTFTVGGL  120

Query  433  SVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            SVLNAIAGAYSENLPLICIVGGPNSNDYG
Sbjct  121  SVLNAIAGAYSENLPLICIVGGPNSNDYG  149



>gb|EYU41928.1| hypothetical protein MIMGU_mgv1a003147mg [Erythranthe guttata]
Length=605

 Score =   199 bits (505),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 119/147 (81%), Positives = 132/147 (90%), Gaps = 2/147 (1%)
 Frame = +1

Query  85   MDTKIGSIEAC-KPGSGDVANAPTIG-VNTVHSTPVAFSSAEATLGRHLARRLVQIGVTD  258
            MDTKIGS++ C  P   +V + P+ G V+T+  + VA +SAEATLGRHLARRLVQIGV+D
Sbjct  1    MDTKIGSLDTCASPTCTEVGSLPSNGAVSTIQCSAVAINSAEATLGRHLARRLVQIGVSD  60

Query  259  VFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSV  438
            VFSVPGDFNLTLLDHLIAEPGL LIGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSV
Sbjct  61   VFSVPGDFNLTLLDHLIAEPGLNLIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSV  120

Query  439  LNAIAGAYSENLPLICIVGGPNSNDYG  519
            +NAIAGAYSENLP+ICIVGGPNSNDYG
Sbjct  121  INAIAGAYSENLPVICIVGGPNSNDYG  147



>ref|XP_011046856.1| PREDICTED: pyruvate decarboxylase 2 [Populus euphratica]
Length=605

 Score =   199 bits (505),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 116/147 (79%), Positives = 127/147 (86%), Gaps = 2/147 (1%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTVHST--PVAFSSAEATLGRHLARRLVQIGVTD  258
            MDTKIGS++ C+P S D+ N     V  + S+  P   +S+EATLGRHLARRLVQIGV D
Sbjct  1    MDTKIGSLDTCRPTSNDMINPTNGAVAAIQSSVSPTVINSSEATLGRHLARRLVQIGVND  60

Query  259  VFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSV  438
            VFSVPGDFNLTLLDHLIAEP L L+GCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSV
Sbjct  61   VFSVPGDFNLTLLDHLIAEPELNLVGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSV  120

Query  439  LNAIAGAYSENLPLICIVGGPNSNDYG  519
            LNAIAGAYSENLP+ICIVGGPNSNDYG
Sbjct  121  LNAIAGAYSENLPVICIVGGPNSNDYG  147



>gb|KFK27091.1| hypothetical protein AALP_AA8G333000 [Arabis alpina]
Length=607

 Score =   199 bits (505),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 119/149 (80%), Positives = 130/149 (87%), Gaps = 4/149 (3%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTVH-STP---VAFSSAEATLGRHLARRLVQIGV  252
            MDTKIG+I+ C P SG +   P  GV+T+  STP    A S  +ATLGR+LARRLV+IGV
Sbjct  1    MDTKIGAIDVCNPTSGVIGGPPNGGVSTIQNSTPSHSTAISPCDATLGRYLARRLVEIGV  60

Query  253  TDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGL  432
            TDVFSVPGDFNLTLLDHL+AEP L+LIGCCNELNAGYAADGYAR+RGVGACVVTFTVGGL
Sbjct  61   TDVFSVPGDFNLTLLDHLVAEPNLKLIGCCNELNAGYAADGYARSRGVGACVVTFTVGGL  120

Query  433  SVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            SVLNAIAGAYSENLPLICIVGGPNSNDYG
Sbjct  121  SVLNAIAGAYSENLPLICIVGGPNSNDYG  149



>gb|AAB16854.1| pyruvate decarboxylase [Arabidopsis thaliana]
Length=606

 Score =   199 bits (505),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 120/150 (80%), Positives = 130/150 (87%), Gaps = 6/150 (4%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGV-----NTVHSTPVAFSSAEATLGRHLARRLVQIG  249
            MDTKIGSI+ CKP +GDV  +PT G      N+V S+ +  +  +ATLGRHLARRLVQ G
Sbjct  1    MDTKIGSIDDCKPTNGDVC-SPTNGTVATIHNSVPSSAITINYCDATLGRHLARRLVQAG  59

Query  250  VTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGG  429
            VTDVFSVPGDFNLTLLDHL+AEP L LIGCCNELNAGYAADGYAR+RGVGACVVTFTVGG
Sbjct  60   VTDVFSVPGDFNLTLLDHLMAEPDLNLIGCCNELNAGYAADGYARSRGVGACVVTFTVGG  119

Query  430  LSVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            LSVLNAIAGAYSENLPLICIVGGPNSNDYG
Sbjct  120  LSVLNAIAGAYSENLPLICIVGGPNSNDYG  149



>ref|XP_010529008.1| PREDICTED: pyruvate decarboxylase 2 [Tarenaya hassleriana]
Length=608

 Score =   198 bits (504),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 131/151 (87%), Gaps = 8/151 (5%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTV------HSTPVAFSSAEATLGRHLARRLVQI  246
            MDTKIGSI++C P + D+  +P  GV+ +      HS PV  S  +ATLGRHLARRLV+I
Sbjct  1    MDTKIGSIDSCIPANDDIGGSPNGGVSVIQNSGPPHSVPV--SPCDATLGRHLARRLVEI  58

Query  247  GVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVG  426
            GVTDVFSVPGDFNLTLLDHLIAEP L+L+GCCNELNAGYAADGYAR+RGVGACVVTFTVG
Sbjct  59   GVTDVFSVPGDFNLTLLDHLIAEPRLKLVGCCNELNAGYAADGYARSRGVGACVVTFTVG  118

Query  427  GLSVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            GLSVLNAIAGAYSENLP+ICIVGGPNSNDYG
Sbjct  119  GLSVLNAIAGAYSENLPVICIVGGPNSNDYG  149



>ref|NP_195033.1| pyruvate decarboxylase 1 [Arabidopsis thaliana]
 sp|O82647.1|PDC1_ARATH RecName: Full=Pyruvate decarboxylase 1; Short=AtPDC1 [Arabidopsis 
thaliana]
 emb|CAA21216.1| pyruvate decarboxylase-1 (Pdc1) [Arabidopsis thaliana]
 emb|CAB80024.1| pyruvate decarboxylase-1 (Pdc1) [Arabidopsis thaliana]
 gb|AAL49793.1| putative pyruvate decarboxylase-1 Pdc1 [Arabidopsis thaliana]
 gb|AAM67459.1| putative pyruvate decarboxylase-1 Pdc1 [Arabidopsis thaliana]
 gb|AEE86169.1| pyruvate decarboxylase [Arabidopsis thaliana]
Length=607

 Score =   198 bits (504),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 120/150 (80%), Positives = 130/150 (87%), Gaps = 6/150 (4%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGV-----NTVHSTPVAFSSAEATLGRHLARRLVQIG  249
            MDTKIGSI+ CKP +GDV  +PT G      N+V S+ +  +  +ATLGRHLARRLVQ G
Sbjct  1    MDTKIGSIDDCKPTNGDVC-SPTNGTVATIHNSVPSSAITINYCDATLGRHLARRLVQAG  59

Query  250  VTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGG  429
            VTDVFSVPGDFNLTLLDHL+AEP L LIGCCNELNAGYAADGYAR+RGVGACVVTFTVGG
Sbjct  60   VTDVFSVPGDFNLTLLDHLMAEPDLNLIGCCNELNAGYAADGYARSRGVGACVVTFTVGG  119

Query  430  LSVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            LSVLNAIAGAYSENLPLICIVGGPNSNDYG
Sbjct  120  LSVLNAIAGAYSENLPLICIVGGPNSNDYG  149



>gb|KJB36951.1| hypothetical protein B456_006G183900 [Gossypium raimondii]
 gb|KJB36953.1| hypothetical protein B456_006G183900 [Gossypium raimondii]
Length=605

 Score =   198 bits (503),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 128/147 (87%), Gaps = 2/147 (1%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTVHST--PVAFSSAEATLGRHLARRLVQIGVTD  258
            MDTKIGS++ CKP S DV +     V+T+  +  P   + +EATLGRHLARRLVQIGV D
Sbjct  1    MDTKIGSLDNCKPASNDVCSPVNGTVSTIQGSVYPAVVNFSEATLGRHLARRLVQIGVND  60

Query  259  VFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSV  438
            VFSVPGDFNLTLLDHLIAEPGL LIGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSV
Sbjct  61   VFSVPGDFNLTLLDHLIAEPGLNLIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSV  120

Query  439  LNAIAGAYSENLPLICIVGGPNSNDYG  519
            LNAIAGAYSE+LPLICIVGGPNSNDYG
Sbjct  121  LNAIAGAYSESLPLICIVGGPNSNDYG  147



>ref|XP_008362250.1| PREDICTED: pyruvate decarboxylase 2-like [Malus domestica]
Length=604

 Score =   198 bits (503),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 116/146 (79%), Positives = 128/146 (88%), Gaps = 1/146 (1%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTVHST-PVAFSSAEATLGRHLARRLVQIGVTDV  261
            MDTKIGS++ CKP   +V + P    + + ST P   +S++ATLGRH+ARRLVQIGVTDV
Sbjct  1    MDTKIGSLDVCKPACTNVGSLPNGAASAIQSTAPSTVNSSDATLGRHIARRLVQIGVTDV  60

Query  262  FSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVL  441
            F+VPGDFNLTLLDHLIAEPGL  IGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSVL
Sbjct  61   FTVPGDFNLTLLDHLIAEPGLTNIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVL  120

Query  442  NAIAGAYSENLPLICIVGGPNSNDYG  519
            NAIAGAYSENLPLICIVGGPNSNDYG
Sbjct  121  NAIAGAYSENLPLICIVGGPNSNDYG  146



>emb|CDY69899.1| BnaA01g37380D, partial [Brassica napus]
Length=279

 Score =   190 bits (482),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 119/149 (80%), Positives = 125/149 (84%), Gaps = 10/149 (7%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVA--NAPTIGVNTVHSTP--VAFSSAEATLGRHLARRLVQIGV  252
            MDT  GS++ CKP SGDV   N P      V STP  V   S+ ATLGRHLA RLV+IGV
Sbjct  1    MDTIAGSLDTCKPDSGDVVRPNGP------VQSTPRTVFTDSSNATLGRHLAHRLVEIGV  54

Query  253  TDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGL  432
             DVFSVPGDFNLTLLDHLIAEPGL LIGCCNELNAGYAADGYAR+RGVGACVVTFTVGGL
Sbjct  55   NDVFSVPGDFNLTLLDHLIAEPGLNLIGCCNELNAGYAADGYARSRGVGACVVTFTVGGL  114

Query  433  SVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            SV+NAIAGAYSENLPLICIVGGPNSNDYG
Sbjct  115  SVINAIAGAYSENLPLICIVGGPNSNDYG  143



>ref|XP_010482907.1| PREDICTED: pyruvate decarboxylase 2 isoform X1 [Camelina sativa]
 ref|XP_010482908.1| PREDICTED: pyruvate decarboxylase 2 isoform X2 [Camelina sativa]
Length=607

 Score =   197 bits (502),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 119/149 (80%), Positives = 130/149 (87%), Gaps = 4/149 (3%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTVH-STPV---AFSSAEATLGRHLARRLVQIGV  252
            MDTKIGSI+ C P   D+   P  GV+TV  S+P+   + S  +ATLGR+LARRLV+IGV
Sbjct  1    MDTKIGSIDVCNPTHDDIGGPPNGGVSTVQNSSPLHSTSISPCDATLGRYLARRLVEIGV  60

Query  253  TDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGL  432
            TDVFSVPGDFNLTLLDHLIAEP L+LIGCCNELNAGYAADGYAR+RGVGACVVTFTVGGL
Sbjct  61   TDVFSVPGDFNLTLLDHLIAEPDLKLIGCCNELNAGYAADGYARSRGVGACVVTFTVGGL  120

Query  433  SVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            SVLNAIAGAYSENLPLICIVGGPNSNDYG
Sbjct  121  SVLNAIAGAYSENLPLICIVGGPNSNDYG  149



>ref|NP_195752.1| pyruvate decarboxylase 4 [Arabidopsis thaliana]
 sp|Q9M040.1|PDC4_ARATH RecName: Full=Pyruvate decarboxylase 4; Short=AtPDC4 [Arabidopsis 
thaliana]
 emb|CAB81915.1| pyruvate decarboxylase-like protein [Arabidopsis thaliana]
 gb|AED90327.1| pyruvate decarboxylase [Arabidopsis thaliana]
Length=603

 Score =   197 bits (500),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 112/145 (77%), Positives = 128/145 (88%), Gaps = 0/145 (0%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVF  264
            MDTKIG+I+ CKP +GD+ + P+  V T+  +    +++E+TLGRHL+RRLVQ GVTDVF
Sbjct  1    MDTKIGAIDTCKPTTGDIGSPPSNAVATIQDSAPITTTSESTLGRHLSRRLVQAGVTDVF  60

Query  265  SVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLN  444
            SVPGDFNLTLLDHLIAEP L  IGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSVLN
Sbjct  61   SVPGDFNLTLLDHLIAEPELNNIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLN  120

Query  445  AIAGAYSENLPLICIVGGPNSNDYG  519
            AIAGAYSENLP+ICIVGGPNSND+G
Sbjct  121  AIAGAYSENLPVICIVGGPNSNDFG  145



>ref|XP_007026635.1| Thiamine pyrophosphate dependent pyruvate decarboxylase family 
protein [Theobroma cacao]
 gb|EOY07137.1| Thiamine pyrophosphate dependent pyruvate decarboxylase family 
protein [Theobroma cacao]
Length=614

 Score =   197 bits (501),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 117/147 (80%), Positives = 128/147 (87%), Gaps = 2/147 (1%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTVHST--PVAFSSAEATLGRHLARRLVQIGVTD  258
            MDTKIGS++ CKP S DV + P   V T+  +  P   +S+EATLGRHLARRLVQ+GVTD
Sbjct  1    MDTKIGSVDVCKPSSNDVGSPPNGIVATIQGSVSPTVINSSEATLGRHLARRLVQVGVTD  60

Query  259  VFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSV  438
            VFSVPGDFNLTLLDHLIAEP L LIGCCNELNAGYAADGYAR+RGVGACVVT TVGGLSV
Sbjct  61   VFSVPGDFNLTLLDHLIAEPELNLIGCCNELNAGYAADGYARSRGVGACVVTCTVGGLSV  120

Query  439  LNAIAGAYSENLPLICIVGGPNSNDYG  519
            LNAIAGAYSE+LPLICIVGGPNSND+G
Sbjct  121  LNAIAGAYSESLPLICIVGGPNSNDFG  147



>ref|XP_008388854.1| PREDICTED: LOW QUALITY PROTEIN: pyruvate decarboxylase 1 [Malus 
domestica]
Length=474

 Score =   194 bits (493),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 117/147 (80%), Positives = 126/147 (86%), Gaps = 2/147 (1%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTVHSTPV--AFSSAEATLGRHLARRLVQIGVTD  258
            MDTKIGS++ CKP   DV + P   V+ + S  +     S +ATLGRHLARRLVQIGVTD
Sbjct  1    MDTKIGSLDVCKPACXDVGSFPNGVVSVIQSFALFTVIYSCDATLGRHLARRLVQIGVTD  60

Query  259  VFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSV  438
            VF+VPGDFNLTLLDHLIAEPGL  IGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSV
Sbjct  61   VFTVPGDFNLTLLDHLIAEPGLTNIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSV  120

Query  439  LNAIAGAYSENLPLICIVGGPNSNDYG  519
            LNAIAGAYSENLPLICIVGGPNSNDYG
Sbjct  121  LNAIAGAYSENLPLICIVGGPNSNDYG  147



>gb|AAG13131.1|AF193791_1 pyruvate decarboxylase [Fragaria x ananassa]
Length=605

 Score =   196 bits (499),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 128/147 (87%), Gaps = 2/147 (1%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTVHST--PVAFSSAEATLGRHLARRLVQIGVTD  258
            MDTKIGSI+ CK  + DV   P    +TV ++    + SSA+ATLGRHLARRLVQIGVTD
Sbjct  1    MDTKIGSIDVCKTENHDVGCLPNSATSTVQNSVPSTSLSSADATLGRHLARRLVQIGVTD  60

Query  259  VFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSV  438
            VF+VPGDFNLTLLDHLIAEPGL  IGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSV
Sbjct  61   VFTVPGDFNLTLLDHLIAEPGLTNIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSV  120

Query  439  LNAIAGAYSENLPLICIVGGPNSNDYG  519
            LNAIAGAYSENLP+ICIVGGPNSNDYG
Sbjct  121  LNAIAGAYSENLPVICIVGGPNSNDYG  147



>ref|XP_004492472.1| PREDICTED: pyruvate decarboxylase isozyme 2-like isoform X1 [Cicer 
arietinum]
Length=603

 Score =   196 bits (498),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 116/145 (80%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVF  264
            MDT +GS+E+ KP S D+ + P              SSAEATLGRHLARRLVQIGVTDVF
Sbjct  1    MDTMLGSLESTKPPSNDIVSCPKANSTAAIQPCTIVSSAEATLGRHLARRLVQIGVTDVF  60

Query  265  SVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLN  444
            SVPGDFNLTLLDHLIAEP L LIGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSV+N
Sbjct  61   SVPGDFNLTLLDHLIAEPELNLIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVIN  120

Query  445  AIAGAYSENLPLICIVGGPNSNDYG  519
            AIAGAYSENLPLICIVGGPNSNDYG
Sbjct  121  AIAGAYSENLPLICIVGGPNSNDYG  145



>ref|XP_004492473.1| PREDICTED: pyruvate decarboxylase isozyme 2-like isoform X2 [Cicer 
arietinum]
Length=603

 Score =   196 bits (498),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 116/145 (80%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVF  264
            MDT +GS+E+ KP S D+ + P              SSAEATLGRHLARRLVQIGVTDVF
Sbjct  1    MDTMLGSLESTKPPSNDIVSCPKANSTAAIQPCTIVSSAEATLGRHLARRLVQIGVTDVF  60

Query  265  SVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLN  444
            SVPGDFNLTLLDHLIAEP L LIGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSV+N
Sbjct  61   SVPGDFNLTLLDHLIAEPELNLIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVIN  120

Query  445  AIAGAYSENLPLICIVGGPNSNDYG  519
            AIAGAYSENLPLICIVGGPNSNDYG
Sbjct  121  AIAGAYSENLPLICIVGGPNSNDYG  145



>ref|XP_004246778.1| PREDICTED: pyruvate decarboxylase 1 [Solanum lycopersicum]
Length=600

 Score =   196 bits (497),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 114/145 (79%), Positives = 128/145 (88%), Gaps = 3/145 (2%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVF  264
            MD KI   + CKP +GD+AN PT    T+ ++ + F+S ++TLGRHLARRLVQIGVTDVF
Sbjct  1    MDFKI---DTCKPINGDIANVPTNKAVTIQNSTIPFNSPDSTLGRHLARRLVQIGVTDVF  57

Query  265  SVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLN  444
            SVPGDFNLTLLDHLIAEP L LIGCCNELNAGYAADGYARARG+GACVVTFTVGGLS++N
Sbjct  58   SVPGDFNLTLLDHLIAEPELNLIGCCNELNAGYAADGYARARGIGACVVTFTVGGLSIVN  117

Query  445  AIAGAYSENLPLICIVGGPNSNDYG  519
            AIAGAYSENLPLIC+VGGPNSNDYG
Sbjct  118  AIAGAYSENLPLICMVGGPNSNDYG  142



>ref|XP_002322997.1| pyruvate decarboxylase family protein [Populus trichocarpa]
 gb|EEF04758.1| pyruvate decarboxylase family protein [Populus trichocarpa]
Length=605

 Score =   196 bits (497),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 127/147 (86%), Gaps = 2/147 (1%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTVHST--PVAFSSAEATLGRHLARRLVQIGVTD  258
            MDTKIGS++ C+P S D+ N     V  + S+  P   +++E+TLGRHLARRLVQIGV D
Sbjct  1    MDTKIGSLDTCRPTSNDMINPTNGAVAAIQSSVSPTIINASESTLGRHLARRLVQIGVND  60

Query  259  VFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSV  438
            VFSVPGDFNLTLLDHLIAEP L L+GCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSV
Sbjct  61   VFSVPGDFNLTLLDHLIAEPELNLVGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSV  120

Query  439  LNAIAGAYSENLPLICIVGGPNSNDYG  519
            LNAIAGAYSENLP+ICIVGGPNSNDYG
Sbjct  121  LNAIAGAYSENLPVICIVGGPNSNDYG  147



>ref|XP_007208309.1| hypothetical protein PRUPE_ppa003086mg [Prunus persica]
 gb|AEA06512.1| pyruvate decarboxylase [Prunus dulcis x Prunus persica]
 gb|AEA06513.1| pyruvate decarboxylase [Prunus cerasifera]
 gb|EMJ09508.1| hypothetical protein PRUPE_ppa003086mg [Prunus persica]
Length=605

 Score =   196 bits (497),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 117/147 (80%), Positives = 128/147 (87%), Gaps = 2/147 (1%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPT-IGVNTVHSTP-VAFSSAEATLGRHLARRLVQIGVTD  258
            MDTKIG+++ CKP S +V + P    +   +S P    +S+EATLGRHLARRLVQIGVTD
Sbjct  1    MDTKIGALDVCKPASNEVGSLPNGTAMAIQNSVPSTVINSSEATLGRHLARRLVQIGVTD  60

Query  259  VFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSV  438
            VF+VPGDFNLTLLDHLIAEPGL  IGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSV
Sbjct  61   VFTVPGDFNLTLLDHLIAEPGLTNIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSV  120

Query  439  LNAIAGAYSENLPLICIVGGPNSNDYG  519
            LNAIAGAYSENLPLICIVGGPNSNDYG
Sbjct  121  LNAIAGAYSENLPLICIVGGPNSNDYG  147



>gb|AIL23783.1| pyruvate decarboxylase [Prunus serrulata]
Length=605

 Score =   195 bits (496),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 117/147 (80%), Positives = 128/147 (87%), Gaps = 2/147 (1%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPT-IGVNTVHSTP-VAFSSAEATLGRHLARRLVQIGVTD  258
            MDTKIG+++ CKP S +V + P    +   +S P    +S+EATLGRHLARRLVQIGVTD
Sbjct  1    MDTKIGALDVCKPASNEVGSLPNGTAMAIQNSVPSTVINSSEATLGRHLARRLVQIGVTD  60

Query  259  VFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSV  438
            VF+VPGDFNLTLLDHLIAEPGL  IGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSV
Sbjct  61   VFTVPGDFNLTLLDHLIAEPGLTNIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSV  120

Query  439  LNAIAGAYSENLPLICIVGGPNSNDYG  519
            LNAIAGAYSENLPLICIVGGPNSNDYG
Sbjct  121  LNAIAGAYSENLPLICIVGGPNSNDYG  147



>gb|ABZ79223.1| pyruvate decarboxylase [Prunus armeniaca]
Length=605

 Score =   195 bits (496),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 117/147 (80%), Positives = 128/147 (87%), Gaps = 2/147 (1%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPT-IGVNTVHSTP-VAFSSAEATLGRHLARRLVQIGVTD  258
            MDTKIG+++ CKP S +V + P    +   +S P    +S+EATLGRHLARRLVQIGVTD
Sbjct  1    MDTKIGALDVCKPASNEVGSLPNGTAMAIQNSVPSTVINSSEATLGRHLARRLVQIGVTD  60

Query  259  VFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSV  438
            VF+VPGDFNLTLLDHLIAEPGL  IGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSV
Sbjct  61   VFTVPGDFNLTLLDHLIAEPGLTNIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSV  120

Query  439  LNAIAGAYSENLPLICIVGGPNSNDYG  519
            LNAIAGAYSENLPLICIVGGPNSNDYG
Sbjct  121  LNAIAGAYSENLPLICIVGGPNSNDYG  147



>ref|XP_006401505.1| hypothetical protein EUTSA_v10013010mg [Eutrema salsugineum]
 gb|ESQ42958.1| hypothetical protein EUTSA_v10013010mg [Eutrema salsugineum]
Length=607

 Score =   195 bits (496),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 114/149 (77%), Positives = 130/149 (87%), Gaps = 4/149 (3%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTVHSTPVAFSSA----EATLGRHLARRLVQIGV  252
            MD++IGSI+AC P  GD+   P  GV+T+ ++  A S+     +ATLGR+LARRLV+IGV
Sbjct  1    MDSRIGSIDACNPTIGDIGGPPNGGVSTIQNSSPAHSTTVSPCDATLGRYLARRLVEIGV  60

Query  253  TDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGL  432
             DVFSVPGDFNLTLLDHL+AEP L+L+GCCNELNAGYAADGYAR+RGVGACVVTFTVGGL
Sbjct  61   NDVFSVPGDFNLTLLDHLLAEPNLKLVGCCNELNAGYAADGYARSRGVGACVVTFTVGGL  120

Query  433  SVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            SVLNAIAGAYSENLPLICIVGGPNSNDYG
Sbjct  121  SVLNAIAGAYSENLPLICIVGGPNSNDYG  149



>ref|XP_010443084.1| PREDICTED: pyruvate decarboxylase 2-like [Camelina sativa]
Length=607

 Score =   195 bits (495),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 118/149 (79%), Positives = 130/149 (87%), Gaps = 4/149 (3%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTVH-STPV---AFSSAEATLGRHLARRLVQIGV  252
            MDTKIGSI+ C P   D+   P  GV+TV  S+P+   + S  +ATLGR+LARRLV+IGV
Sbjct  1    MDTKIGSIDVCYPTHDDIGGPPNGGVSTVQNSSPLHSTSISPCDATLGRYLARRLVEIGV  60

Query  253  TDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGL  432
            TDVFSVPGDFNLTLLDHL+AEPGL+LIGCCNELNAGYAADGYAR+RGVGACVVTFTVGGL
Sbjct  61   TDVFSVPGDFNLTLLDHLMAEPGLKLIGCCNELNAGYAADGYARSRGVGACVVTFTVGGL  120

Query  433  SVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            SVLNAIAGA SENLPLICIVGGPNSNDYG
Sbjct  121  SVLNAIAGANSENLPLICIVGGPNSNDYG  149



>ref|XP_009628441.1| PREDICTED: pyruvate decarboxylase 1 [Nicotiana tomentosiformis]
Length=603

 Score =   194 bits (494),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 111/145 (77%), Positives = 126/145 (87%), Gaps = 0/145 (0%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVF  264
            MD K+ +I+ CKP + +++N P     T+ +  V F+S  +TLGRHLARRL+QIGVTDVF
Sbjct  1    MDFKVSAIDTCKPLNNEISNLPAQNAVTIQTPTVPFNSPYSTLGRHLARRLLQIGVTDVF  60

Query  265  SVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLN  444
            SVPGDFNLTLLDHL++EP L L+GCCNELNAGYAADGYARARGVGACVVTFTVGGLSVLN
Sbjct  61   SVPGDFNLTLLDHLVSEPELNLVGCCNELNAGYAADGYARARGVGACVVTFTVGGLSVLN  120

Query  445  AIAGAYSENLPLICIVGGPNSNDYG  519
            AIAGAYSENLPLICIVGGPNSNDYG
Sbjct  121  AIAGAYSENLPLICIVGGPNSNDYG  145



>ref|XP_010676788.1| PREDICTED: pyruvate decarboxylase 2 [Beta vulgaris subsp. vulgaris]
Length=607

 Score =   194 bits (494),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 127/151 (84%), Gaps = 8/151 (5%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDV------ANAPTIGVNTVHSTPVAFSSAEATLGRHLARRLVQI  246
            MDTKIGSI+ CKP + D+       +  T+  +  H  P+A    E+TLGRHLARRLVQI
Sbjct  1    MDTKIGSIDTCKPSNSDICCPAKNGDVSTLQSSAPHGAPIA--PPESTLGRHLARRLVQI  58

Query  247  GVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVG  426
            GV DVFSVPGDFNLTLLDHL+AEPGL L+GCCNELNAGYAADGYAR+RGVGACVVTFTVG
Sbjct  59   GVNDVFSVPGDFNLTLLDHLLAEPGLNLVGCCNELNAGYAADGYARSRGVGACVVTFTVG  118

Query  427  GLSVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            GLSVLNAIAGAYSENLP+ICIVGGPNSNDYG
Sbjct  119  GLSVLNAIAGAYSENLPVICIVGGPNSNDYG  149



>ref|XP_009385546.1| PREDICTED: pyruvate decarboxylase 1-like [Musa acuminata subsp. 
malaccensis]
Length=603

 Score =   194 bits (493),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 117/146 (80%), Positives = 130/146 (89%), Gaps = 2/146 (1%)
 Frame = +1

Query  85   MDTKIGSIE-ACKPGSGDVANAPTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDV  261
            M+TK+GS++   KP S DV   P+   +T+  + VA SS +ATLGRHLARRLVQ+GVTDV
Sbjct  1    METKVGSVDGVAKPVSNDVGGLPSATCHTLSPSAVACSS-DATLGRHLARRLVQLGVTDV  59

Query  262  FSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVL  441
            F+VPGDFNLTLLDHLIAEPGLRLIGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSVL
Sbjct  60   FAVPGDFNLTLLDHLIAEPGLRLIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVL  119

Query  442  NAIAGAYSENLPLICIVGGPNSNDYG  519
            NAIAGAYSENLPLICIVGGPN+NDYG
Sbjct  120  NAIAGAYSENLPLICIVGGPNTNDYG  145



>ref|XP_008243339.1| PREDICTED: pyruvate decarboxylase 2 [Prunus mume]
Length=605

 Score =   194 bits (493),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 119/149 (80%), Positives = 131/149 (88%), Gaps = 6/149 (4%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVA---NAPTIGV-NTVHSTPVAFSSAEATLGRHLARRLVQIGV  252
            MDTKIG+++ CKP S +V    N   + + N+V ST +  +S+EATLGRHLARRLVQIGV
Sbjct  1    MDTKIGALDVCKPASNEVGCLPNGTAMAIQNSVPSTVI--NSSEATLGRHLARRLVQIGV  58

Query  253  TDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGL  432
            TDVF+VPGDFNLTLLDHLIAEPGL  IGCCNELNAGYAADGYAR+RGVGACVVTFTVGGL
Sbjct  59   TDVFTVPGDFNLTLLDHLIAEPGLTNIGCCNELNAGYAADGYARSRGVGACVVTFTVGGL  118

Query  433  SVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            SVLNAIAGAYSENLPLICIVGGPNSNDYG
Sbjct  119  SVLNAIAGAYSENLPLICIVGGPNSNDYG  147



>ref|XP_010264586.1| PREDICTED: pyruvate decarboxylase 2 [Nelumbo nucifera]
Length=606

 Score =   194 bits (493),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 128/148 (86%), Gaps = 3/148 (2%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTV---HSTPVAFSSAEATLGRHLARRLVQIGVT  255
            MDTKIG+I+A KP   DV + P  G  +V    +TP   SS++ATLGRHLARRL QIGVT
Sbjct  1    MDTKIGNIDAGKPACNDVGSIPQNGAVSVVQNSATPAVVSSSDATLGRHLARRLAQIGVT  60

Query  256  DVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLS  435
            DVFSVPGDFNLTLLDHLIAEP L++IGCCNELNAGYAADGYAR+RGVGACVVTF+VGGLS
Sbjct  61   DVFSVPGDFNLTLLDHLIAEPALKVIGCCNELNAGYAADGYARSRGVGACVVTFSVGGLS  120

Query  436  VLNAIAGAYSENLPLICIVGGPNSNDYG  519
            VLNAIAGA SENLP+ICIVGGPNSNDYG
Sbjct  121  VLNAIAGACSENLPIICIVGGPNSNDYG  148



>ref|XP_011019081.1| PREDICTED: pyruvate decarboxylase 2-like [Populus euphratica]
Length=605

 Score =   194 bits (493),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 128/147 (87%), Gaps = 2/147 (1%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTVHST--PVAFSSAEATLGRHLARRLVQIGVTD  258
            MDTKIGS++ CKP S D+ N     V+T+ ++      + +++TLGRHLARRLVQIGVTD
Sbjct  1    MDTKIGSLDTCKPTSDDMINPTNATVSTIQNSLSSTIINPSQSTLGRHLARRLVQIGVTD  60

Query  259  VFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSV  438
            VFSVPGDFNLTLLDHLIAEPGL LIGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSV
Sbjct  61   VFSVPGDFNLTLLDHLIAEPGLNLIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSV  120

Query  439  LNAIAGAYSENLPLICIVGGPNSNDYG  519
            LNAIAGA SENLP+ICIVGGPNSNDYG
Sbjct  121  LNAIAGANSENLPVICIVGGPNSNDYG  147



>gb|AAL37492.1| pyruvate decarboxylase [Fragaria x ananassa]
Length=605

 Score =   194 bits (493),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 117/147 (80%), Positives = 126/147 (86%), Gaps = 2/147 (1%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTVHST--PVAFSSAEATLGRHLARRLVQIGVTD  258
            MDTKIGSI+ CK  + DV   P    +TV  +      SSA+ATLGRHLARRLVQIG+TD
Sbjct  1    MDTKIGSIDVCKTENHDVGCLPNSTTSTVQDSVPSTCLSSADATLGRHLARRLVQIGITD  60

Query  259  VFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSV  438
            VF+VPGDFNLTLLDHLIAEPGL  IGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSV
Sbjct  61   VFTVPGDFNLTLLDHLIAEPGLTNIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSV  120

Query  439  LNAIAGAYSENLPLICIVGGPNSNDYG  519
            LNAIAGAYSENLP+ICIVGGPNSNDYG
Sbjct  121  LNAIAGAYSENLPVICIVGGPNSNDYG  147



>gb|AAP96920.1| pyruvate decarboxylase [Dianthus caryophyllus]
Length=605

 Score =   193 bits (491),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 125/147 (85%), Gaps = 2/147 (1%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDV--ANAPTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTD  258
            MDTKIGS++ C P + D+   N  T     +H+ P   +  E+TLGRHLARRLVQIGV D
Sbjct  1    MDTKIGSLDTCPPQNSDICCPNKTTTTATHLHAPPTTHAPPESTLGRHLARRLVQIGVND  60

Query  259  VFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSV  438
            VFSVPGDFNLTLLDHL+AEPGL L+GCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSV
Sbjct  61   VFSVPGDFNLTLLDHLLAEPGLNLVGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSV  120

Query  439  LNAIAGAYSENLPLICIVGGPNSNDYG  519
            LNAIAGAYSENLP+ICIVGGPNSNDYG
Sbjct  121  LNAIAGAYSENLPVICIVGGPNSNDYG  147



>ref|XP_010033739.1| PREDICTED: pyruvate decarboxylase 1 [Eucalyptus grandis]
 gb|KCW88158.1| hypothetical protein EUGRSUZ_A00547 [Eucalyptus grandis]
Length=606

 Score =   193 bits (491),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 113/148 (76%), Positives = 126/148 (85%), Gaps = 3/148 (2%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTVHST---PVAFSSAEATLGRHLARRLVQIGVT  255
            MDT IG++ +CKP   DV + P    + +  +   P A  S ++T+GRHLARRLVQIGVT
Sbjct  1    MDTSIGALSSCKPPCNDVGSPPNGAASAIQGSAPGPAAVGSPDSTMGRHLARRLVQIGVT  60

Query  256  DVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLS  435
            DVFSVPGDFNLTLLDHLIAEPGL L+GCCNELNAGYAADGYARARGVGACVVTFTVGGLS
Sbjct  61   DVFSVPGDFNLTLLDHLIAEPGLNLVGCCNELNAGYAADGYARARGVGACVVTFTVGGLS  120

Query  436  VLNAIAGAYSENLPLICIVGGPNSNDYG  519
            VLNAIAGAYSENLP++CIVGGPNSNDYG
Sbjct  121  VLNAIAGAYSENLPVVCIVGGPNSNDYG  148



>emb|CDY22174.1| BnaC01g39270D [Brassica napus]
Length=287

 Score =   186 bits (472),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 124/149 (83%), Gaps = 10/149 (7%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDV--ANAPTIGVNTVHSTP--VAFSSAEATLGRHLARRLVQIGV  252
            MDT +GS++ CKP +GDV   N P      V S P  V   S+ ATLGRHLA RLV+IGV
Sbjct  1    MDTIVGSLDTCKPENGDVIRPNGP------VQSAPRSVISDSSSATLGRHLAHRLVEIGV  54

Query  253  TDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGL  432
             DVFSVPGDFNLTLLDHLIAEPGL LIGCCNELNAGYAADGYAR+RGVGACVVTFTVGGL
Sbjct  55   NDVFSVPGDFNLTLLDHLIAEPGLNLIGCCNELNAGYAADGYARSRGVGACVVTFTVGGL  114

Query  433  SVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            SV+NAIAGAY ENLPLICI+GGPNSNDYG
Sbjct  115  SVINAIAGAYGENLPLICIIGGPNSNDYG  143



>gb|AGA15799.1| pyruvate decarboxylase 5 [Diospyros kaki]
Length=193

 Score =   182 bits (463),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 125/155 (81%), Gaps = 16/155 (10%)
 Frame = +1

Query  85   MDTKIGSIE----------ACKPGSGDVANAPTIGVNTVHSTPVAFSSAEATLGRHLARR  234
            MDTKIG++E           C PG+G V+       N+  ST  A   +EATLGRHLARR
Sbjct  1    MDTKIGAVEVSPGPSSDAIGCLPGNGCVSTIQ----NSCPST--ALVPSEATLGRHLARR  54

Query  235  LVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVT  414
            LVQIG TDVFSVPGDFNLTLLDHLIAEPGL LIGCCNELNAGYAADG+AR RGVGACVVT
Sbjct  55   LVQIGATDVFSVPGDFNLTLLDHLIAEPGLNLIGCCNELNAGYAADGFARCRGVGACVVT  114

Query  415  FTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            FTVGGLSVLNAIAGAYSENLP+ICIVGGPNSNDYG
Sbjct  115  FTVGGLSVLNAIAGAYSENLPVICIVGGPNSNDYG  149



>ref|XP_007207128.1| hypothetical protein PRUPE_ppa003096mg [Prunus persica]
 gb|EMJ08327.1| hypothetical protein PRUPE_ppa003096mg [Prunus persica]
Length=605

 Score =   192 bits (488),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 127/147 (86%), Gaps = 2/147 (1%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTVHST--PVAFSSAEATLGRHLARRLVQIGVTD  258
            M T IGS+++CKP + +V   P  G  +VH +  P   +S++ATLGRHLARRLV+IGV D
Sbjct  1    MATSIGSLDSCKPSNNNVVCPPQNGTASVHDSHPPSTIASSDATLGRHLARRLVEIGVQD  60

Query  259  VFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSV  438
            VFSVPGDFNLTLLDHLIAEPGL  IGCCNELNAGYAADGYARARGVGACVVTFTVGGLSV
Sbjct  61   VFSVPGDFNLTLLDHLIAEPGLTNIGCCNELNAGYAADGYARARGVGACVVTFTVGGLSV  120

Query  439  LNAIAGAYSENLPLICIVGGPNSNDYG  519
            LNAIAGAYSENLP+ICIVGGPN+NDYG
Sbjct  121  LNAIAGAYSENLPVICIVGGPNTNDYG  147



>ref|XP_004302532.1| PREDICTED: pyruvate decarboxylase 2 [Fragaria vesca subsp. vesca]
Length=605

 Score =   192 bits (487),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 117/147 (80%), Positives = 126/147 (86%), Gaps = 2/147 (1%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTVHST--PVAFSSAEATLGRHLARRLVQIGVTD  258
            MDTKIGSI+ CK  S DV   P    +TV ++      SSA+ATLGRHLARRLVQIGVTD
Sbjct  1    MDTKIGSIDVCKAESHDVGCLPNGATSTVQNSVPSTTLSSADATLGRHLARRLVQIGVTD  60

Query  259  VFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSV  438
            VF+VPGDFNLTLLDHL+AEPGL  IGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSV
Sbjct  61   VFTVPGDFNLTLLDHLVAEPGLTNIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSV  120

Query  439  LNAIAGAYSENLPLICIVGGPNSNDYG  519
            LNAIAGA SENLP+ICIVGGPNSNDYG
Sbjct  121  LNAIAGACSENLPVICIVGGPNSNDYG  147



>gb|AAO72533.1| pyruvate decarboxylase 1 [Lotus corniculatus]
Length=606

 Score =   191 bits (486),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 124/148 (84%), Gaps = 3/148 (2%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTVHSTPV---AFSSAEATLGRHLARRLVQIGVT  255
            MD K+GS++  KP S DV +  T    T   + +   A SS +ATLGRHLARRL QIGVT
Sbjct  1    MDVKLGSLDTTKPASNDVVSCATANHTTAIQSSIPSTAVSSCDATLGRHLARRLAQIGVT  60

Query  256  DVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLS  435
            DVFSVPGDFNLTLLDHLIAEP L L+GCCNELNAGYAADGYARARGVGACVVTFTVGGLS
Sbjct  61   DVFSVPGDFNLTLLDHLIAEPQLNLVGCCNELNAGYAADGYARARGVGACVVTFTVGGLS  120

Query  436  VLNAIAGAYSENLPLICIVGGPNSNDYG  519
            VLNAIAGAYSENLPLICIVGGPNSNDYG
Sbjct  121  VLNAIAGAYSENLPLICIVGGPNSNDYG  148



>ref|XP_009123548.1| PREDICTED: pyruvate decarboxylase 1-like [Brassica rapa]
Length=600

 Score =   191 bits (485),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 119/149 (80%), Positives = 125/149 (84%), Gaps = 10/149 (7%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVA--NAPTIGVNTVHSTP--VAFSSAEATLGRHLARRLVQIGV  252
            MDT  GS++ CKP SGDV   N P      V STP  V   S+ ATLGRHLA RLV+IGV
Sbjct  1    MDTIAGSLDTCKPDSGDVVRPNGP------VQSTPRTVFTDSSNATLGRHLAHRLVEIGV  54

Query  253  TDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGL  432
             DVFSVPGDFNLTLLDHLIAEPGL LIGCCNELNAGYAADGYAR+RGVGACVVTFTVGGL
Sbjct  55   NDVFSVPGDFNLTLLDHLIAEPGLNLIGCCNELNAGYAADGYARSRGVGACVVTFTVGGL  114

Query  433  SVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            SV+NAIAGAYSENLPLICIVGGPNSNDYG
Sbjct  115  SVINAIAGAYSENLPLICIVGGPNSNDYG  143



>gb|AAX33300.1| pyruvate decarboxylase 1 [Petunia x hybrida]
Length=507

 Score =   189 bits (480),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 125/151 (83%), Gaps = 6/151 (4%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTVHS-TPVAF-----SSAEATLGRHLARRLVQI  246
            MD KIGSI+ CKP + +VA  PT    T+ + TP        S+ ++TLGRHLARRLVQ+
Sbjct  1    MDAKIGSIDTCKPTTNNVATLPTNNTVTISTHTPSTTIIPCNSTTDSTLGRHLARRLVQV  60

Query  247  GVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVG  426
            G+TDVF VPGDFNLTLLDHLI+EP L  IGCCNELNAGYAADGYAR RGVGACVVTFTVG
Sbjct  61   GITDVFGVPGDFNLTLLDHLISEPNLEFIGCCNELNAGYAADGYARPRGVGACVVTFTVG  120

Query  427  GLSVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            GLSVLNAIAGAYSENLPLICIVGGPNSNDYG
Sbjct  121  GLSVLNAIAGAYSENLPLICIVGGPNSNDYG  151



>ref|XP_008221277.1| PREDICTED: pyruvate decarboxylase 1-like [Prunus mume]
Length=605

 Score =   190 bits (482),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 126/147 (86%), Gaps = 2/147 (1%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTVHST--PVAFSSAEATLGRHLARRLVQIGVTD  258
            M T IGS ++CKP + +V   P  G  +VH +  P   +S++ATLGRHLARRLV+IGV D
Sbjct  1    MATSIGSQDSCKPTNNNVGCPPQNGTASVHGSHPPSTIASSDATLGRHLARRLVEIGVQD  60

Query  259  VFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSV  438
            VFSVPGDFNLTLLDHLIAEPGL  IGCCNELNAGYAADGYARARGVGACVVTFTVGGLSV
Sbjct  61   VFSVPGDFNLTLLDHLIAEPGLTNIGCCNELNAGYAADGYARARGVGACVVTFTVGGLSV  120

Query  439  LNAIAGAYSENLPLICIVGGPNSNDYG  519
            LNAIAGAYSENLP+ICIVGGPN+NDYG
Sbjct  121  LNAIAGAYSENLPVICIVGGPNTNDYG  147



>emb|CDY10495.1| BnaCnng03960D [Brassica napus]
Length=608

 Score =   189 bits (481),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 131/151 (87%), Gaps = 7/151 (5%)
 Frame = +1

Query  85   MDTKIGSIE-ACKPGSGDVANAPTIGV-----NTVHSTPVAFSSAEATLGRHLARRLVQI  246
            MDTKIGSI+ ACKP +GDV  +PT G      +TV ++ ++  S+EATLGRHL RRLVQ 
Sbjct  1    MDTKIGSIDDACKPKNGDVC-SPTNGTVASIEDTVPASGISVGSSEATLGRHLGRRLVQA  59

Query  247  GVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVG  426
            GV D+F+VPGDFNLTLLDHLIAEP L+ IGCCNELNAGYAADGYAR+RGVGACVVTFTVG
Sbjct  60   GVRDIFTVPGDFNLTLLDHLIAEPELKNIGCCNELNAGYAADGYARSRGVGACVVTFTVG  119

Query  427  GLSVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            GLSVLNAIAGAYSENLP+ICIVGGPNSND+G
Sbjct  120  GLSVLNAIAGAYSENLPVICIVGGPNSNDFG  150



>ref|XP_008362261.1| PREDICTED: pyruvate decarboxylase 2-like [Malus domestica]
Length=604

 Score =   189 bits (480),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 114/148 (77%), Positives = 127/148 (86%), Gaps = 5/148 (3%)
 Frame = +1

Query  85   MDTKIGSIEACKP---GSGDVANAPTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVT  255
            MDTKIGS++ CKP   G G + N   + + +  S P   +S++ATLG H+ARRLVQIGVT
Sbjct  1    MDTKIGSLDVCKPTCTGVGSLPNGAALAIQS--SAPSLINSSDATLGGHIARRLVQIGVT  58

Query  256  DVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLS  435
            DVF+VPGDFNLTLLDHLIAEPGL  IGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLS
Sbjct  59   DVFTVPGDFNLTLLDHLIAEPGLTNIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLS  118

Query  436  VLNAIAGAYSENLPLICIVGGPNSNDYG  519
            VLNAIAGAYSE+LPLICIVGGPNSNDYG
Sbjct  119  VLNAIAGAYSESLPLICIVGGPNSNDYG  146



>gb|AAL33553.1|AF436852_1 pyruvate decarboxylase [Cucumis melo]
Length=172

 Score =   178 bits (452),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 111/144 (77%), Positives = 122/144 (85%), Gaps = 3/144 (2%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTVHSTPV---AFSSAEATLGRHLARRLVQIGVT  255
            MDTKIGS++ CKP +  V       V T+ ++ V     +S++ATLGRHLARRLVQIGVT
Sbjct  1    MDTKIGSLDTCKPQNNVVCCPSNGSVCTIQNSVVPSTVVNSSDATLGRHLARRLVQIGVT  60

Query  256  DVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLS  435
            DVF+VPGDFNLTLLDHLIAEP L  IGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLS
Sbjct  61   DVFTVPGDFNLTLLDHLIAEPALNNIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLS  120

Query  436  VLNAIAGAYSENLPLICIVGGPNS  507
            VLNAIAGAYSENLPLICIVGGPNS
Sbjct  121  VLNAIAGAYSENLPLICIVGGPNS  144



>ref|XP_010920798.1| PREDICTED: pyruvate decarboxylase 1 [Elaeis guineensis]
Length=605

 Score =   188 bits (478),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 116/147 (79%), Positives = 124/147 (84%), Gaps = 2/147 (1%)
 Frame = +1

Query  85   MDTKIGSIEACKPGS--GDVANAPTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTD  258
            MDTKIGS++A    +  G V   P I  + +     A   AEATLGRHLARRLVQ+GV D
Sbjct  1    MDTKIGSVDAAAEATANGVVGLPPAIPCHPIIPVAPASGPAEATLGRHLARRLVQVGVHD  60

Query  259  VFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSV  438
            VFSVPGDFNLTLLDHL+AEPGLRL+GCCNELNAGYAADGYARARGVGACVVTFTVGGLSV
Sbjct  61   VFSVPGDFNLTLLDHLLAEPGLRLVGCCNELNAGYAADGYARARGVGACVVTFTVGGLSV  120

Query  439  LNAIAGAYSENLPLICIVGGPNSNDYG  519
            LNAIAGAYSENLPLICIVGGPNSNDYG
Sbjct  121  LNAIAGAYSENLPLICIVGGPNSNDYG  147



>ref|XP_009376417.1| PREDICTED: pyruvate decarboxylase 2 [Pyrus x bretschneideri]
Length=610

 Score =   188 bits (477),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 114/152 (75%), Positives = 126/152 (83%), Gaps = 7/152 (5%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTVHSTP-------VAFSSAEATLGRHLARRLVQ  243
            MDTKIGS++ CKP   DV + P    + + ST           +S++ATLGRH+ARRLVQ
Sbjct  1    MDTKIGSLDVCKPACTDVGSLPNGAASAIQSTAPSTVNSSSTVNSSDATLGRHIARRLVQ  60

Query  244  IGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTV  423
            IGVTDVF+VPGDFNLTLLDHLIAEPGL  IGCCNELNAGYAADGYAR+RGVGAC VTFTV
Sbjct  61   IGVTDVFTVPGDFNLTLLDHLIAEPGLTNIGCCNELNAGYAADGYARSRGVGACAVTFTV  120

Query  424  GGLSVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            GGLSVLNAIAGAYSENLPLICIVGGPNSND+G
Sbjct  121  GGLSVLNAIAGAYSENLPLICIVGGPNSNDHG  152



>ref|XP_010033533.1| PREDICTED: pyruvate decarboxylase 2 [Eucalyptus grandis]
 gb|KCW88161.1| hypothetical protein EUGRSUZ_A00549 [Eucalyptus grandis]
Length=606

 Score =   188 bits (477),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 110/148 (74%), Positives = 124/148 (84%), Gaps = 3/148 (2%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTVHST---PVAFSSAEATLGRHLARRLVQIGVT  255
            MDT IGS+ +CKP   DV + P      +  +   P   +S ++T+GRH+A RLVQIGVT
Sbjct  1    MDTGIGSLSSCKPPCNDVGSPPNGAAAAIQGSGPAPAVVASPDSTMGRHIAHRLVQIGVT  60

Query  256  DVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLS  435
            DVF+VPGDFNLTLLDHLIAEPGL L+GCCNELNAGYAADGYARARGVGACVVTFTVGGLS
Sbjct  61   DVFAVPGDFNLTLLDHLIAEPGLNLVGCCNELNAGYAADGYARARGVGACVVTFTVGGLS  120

Query  436  VLNAIAGAYSENLPLICIVGGPNSNDYG  519
            VLNAIAGAYSENLP++CIVGGPNSNDYG
Sbjct  121  VLNAIAGAYSENLPVVCIVGGPNSNDYG  148



>gb|KCW88160.1| hypothetical protein EUGRSUZ_A00549 [Eucalyptus grandis]
Length=614

 Score =   188 bits (477),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 110/148 (74%), Positives = 124/148 (84%), Gaps = 3/148 (2%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTVHST---PVAFSSAEATLGRHLARRLVQIGVT  255
            MDT IGS+ +CKP   DV + P      +  +   P   +S ++T+GRH+A RLVQIGVT
Sbjct  1    MDTGIGSLSSCKPPCNDVGSPPNGAAAAIQGSGPAPAVVASPDSTMGRHIAHRLVQIGVT  60

Query  256  DVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLS  435
            DVF+VPGDFNLTLLDHLIAEPGL L+GCCNELNAGYAADGYARARGVGACVVTFTVGGLS
Sbjct  61   DVFAVPGDFNLTLLDHLIAEPGLNLVGCCNELNAGYAADGYARARGVGACVVTFTVGGLS  120

Query  436  VLNAIAGAYSENLPLICIVGGPNSNDYG  519
            VLNAIAGAYSENLP++CIVGGPNSNDYG
Sbjct  121  VLNAIAGAYSENLPVVCIVGGPNSNDYG  148



>ref|XP_002308230.1| pyruvate decarboxylase family protein [Populus trichocarpa]
 gb|EEE91753.1| pyruvate decarboxylase family protein [Populus trichocarpa]
Length=605

 Score =   187 bits (476),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 125/147 (85%), Gaps = 2/147 (1%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTVHST--PVAFSSAEATLGRHLARRLVQIGVTD  258
            MDTKIGS + CKP S D+ N     V+TV ++      + +++TLGRHLARRLVQIGVTD
Sbjct  1    MDTKIGSPDTCKPTSNDMINPTNATVSTVQNSVSSTIINPSQSTLGRHLARRLVQIGVTD  60

Query  259  VFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSV  438
            VFSV GDFNL LLDHLIAEPGL LIGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSV
Sbjct  61   VFSVAGDFNLILLDHLIAEPGLNLIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSV  120

Query  439  LNAIAGAYSENLPLICIVGGPNSNDYG  519
            LNAIAGA SENLP+ICIVGGPNSNDYG
Sbjct  121  LNAIAGANSENLPVICIVGGPNSNDYG  147



>ref|NP_001284421.1| pyruvate decarboxylase 1 [Cucumis melo]
 gb|AIC36754.1| pyruvate/alpha-keto acid decarboxylase [Cucumis melo]
Length=606

 Score =   187 bits (476),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 126/148 (85%), Gaps = 3/148 (2%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTVHSTPV---AFSSAEATLGRHLARRLVQIGVT  255
            MDTKIGS++ CKP +  V       V T+ ++ V     +S++ATLGRHLARRLVQIGVT
Sbjct  1    MDTKIGSLDTCKPQNNVVCCPSNGSVCTIQNSVVPSTVVNSSDATLGRHLARRLVQIGVT  60

Query  256  DVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLS  435
            DVF+VPGDFNLTLLDHLIAEP L  IGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLS
Sbjct  61   DVFTVPGDFNLTLLDHLIAEPALNNIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLS  120

Query  436  VLNAIAGAYSENLPLICIVGGPNSNDYG  519
            VLNAIAGAYSENLPLICIVGGPNSNDYG
Sbjct  121  VLNAIAGAYSENLPLICIVGGPNSNDYG  148



>ref|XP_007134808.1| hypothetical protein PHAVU_010G078000g [Phaseolus vulgaris]
 gb|ESW06802.1| hypothetical protein PHAVU_010G078000g [Phaseolus vulgaris]
Length=605

 Score =   187 bits (475),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 127/147 (86%), Gaps = 2/147 (1%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTV-HSTPV-AFSSAEATLGRHLARRLVQIGVTD  258
            MDT IGS+++ KP + DV   P   V+ + +S P  A SS+EATLGRHLARRLVQ+GVTD
Sbjct  1    MDTNIGSLDSSKPANNDVGCPPNGTVSAIKNSVPASAISSSEATLGRHLARRLVQVGVTD  60

Query  259  VFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSV  438
            VFSVPGDFNLTLLDHLIAEP L  +GCCNELNAGYAADGYAR RGVGACVVTFTVGGLSV
Sbjct  61   VFSVPGDFNLTLLDHLIAEPQLTNVGCCNELNAGYAADGYARCRGVGACVVTFTVGGLSV  120

Query  439  LNAIAGAYSENLPLICIVGGPNSNDYG  519
            +NAIAGAYSENLPLICIVGGPN+ND+G
Sbjct  121  INAIAGAYSENLPLICIVGGPNTNDFG  147



>dbj|BAC23043.1| pyruvate decarboxylase [Solanum tuberosum]
Length=592

 Score =   187 bits (475),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 110/134 (82%), Positives = 117/134 (87%), Gaps = 0/134 (0%)
 Frame = +1

Query  118  KPGSGDVANAPTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLL  297
            KP   DV   PT+   T+H+  V F+S E+TLGRHLARRLVQ+GVTDVF VPGDFNLTLL
Sbjct  1    KPPHTDVGCLPTVNAVTIHNPAVPFNSPESTLGRHLARRLVQVGVTDVFGVPGDFNLTLL  60

Query  298  DHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLP  477
            DHLI EPGL  +GCCNELNAGYAADGYARARGVGACVVTFTVGGLSVLNAIAGAYSENLP
Sbjct  61   DHLIDEPGLNFVGCCNELNAGYAADGYARARGVGACVVTFTVGGLSVLNAIAGAYSENLP  120

Query  478  LICIVGGPNSNDYG  519
            LICIVGGPNSNDYG
Sbjct  121  LICIVGGPNSNDYG  134



>ref|XP_010253808.1| PREDICTED: pyruvate decarboxylase 1 [Nelumbo nucifera]
Length=647

 Score =   187 bits (476),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 123/151 (81%), Gaps = 7/151 (5%)
 Frame = +1

Query  82   VMDTKIGSIEACKPGSGDVANAPTIGV-----NTVHSTPVAFSSAEATLGRHLARRLVQI  246
            V    IG+I   KP S DV   P  G      N+V S   A  S+E+TLGRHLARRLVQI
Sbjct  41   VYSNDIGAINGFKPASNDVGCLPHHGAVVPVQNSVSSA--AIGSSESTLGRHLARRLVQI  98

Query  247  GVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVG  426
            GVTDVFSVPGDFNLTLLDHLIAEPGL LIGCCNELNAGYAADGYAR RGVGACVVTFTVG
Sbjct  99   GVTDVFSVPGDFNLTLLDHLIAEPGLNLIGCCNELNAGYAADGYARCRGVGACVVTFTVG  158

Query  427  GLSVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            GLS+LNAIAGAYSENLPLICIVGGPNSNDYG
Sbjct  159  GLSILNAIAGAYSENLPLICIVGGPNSNDYG  189



>ref|XP_003623316.1| Pyruvate decarboxylase isozyme [Medicago truncatula]
 gb|AES79534.1| pyruvate decarboxylase [Medicago truncatula]
Length=575

 Score =   186 bits (472),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 110/145 (76%), Positives = 121/145 (83%), Gaps = 0/145 (0%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVF  264
            M+T +GS++  KP S DV +              A ++++ATLGRHLARRLVQ+GVTDVF
Sbjct  1    METMLGSLDIAKPTSNDVVSCKQQNSTATIQPSTAIATSDATLGRHLARRLVQVGVTDVF  60

Query  265  SVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLN  444
            SVPGDFNLTLLDHLI EP L LIGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSVLN
Sbjct  61   SVPGDFNLTLLDHLINEPELNLIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLN  120

Query  445  AIAGAYSENLPLICIVGGPNSNDYG  519
            AIAGAYSENLPLICIVGGPNSNDYG
Sbjct  121  AIAGAYSENLPLICIVGGPNSNDYG  145



>ref|XP_004145248.1| PREDICTED: pyruvate decarboxylase isozyme 2-like [Cucumis sativus]
 ref|XP_004153721.1| PREDICTED: pyruvate decarboxylase isozyme 2-like [Cucumis sativus]
 gb|KGN65827.1| hypothetical protein Csa_1G532350 [Cucumis sativus]
Length=600

 Score =   186 bits (473),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 112/145 (77%), Positives = 125/145 (86%), Gaps = 3/145 (2%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVF  264
            MD  + ++++CKP + D+A+ P  G  T  S  V   S++ATLGRHLARRLVQIGV+DVF
Sbjct  1    MDVVVEALDSCKPFNNDIASLPQNGSLTPPSVTV---SSDATLGRHLARRLVQIGVSDVF  57

Query  265  SVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLN  444
            SVPGDFNLTLLDHLIAEPGL  IGCCNELNAGYAADGYAR RGVGACVVTFTVGGLSVLN
Sbjct  58   SVPGDFNLTLLDHLIAEPGLTNIGCCNELNAGYAADGYARRRGVGACVVTFTVGGLSVLN  117

Query  445  AIAGAYSENLPLICIVGGPNSNDYG  519
            AIAGAYSENLP+ICIVGGPN+NDYG
Sbjct  118  AIAGAYSENLPVICIVGGPNTNDYG  142



>ref|XP_004165846.1| PREDICTED: LOW QUALITY PROTEIN: pyruvate decarboxylase isozyme 
2-like [Cucumis sativus]
Length=600

 Score =   186 bits (473),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 112/145 (77%), Positives = 125/145 (86%), Gaps = 3/145 (2%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVF  264
            MD  + ++++CKP + D+A+ P  G  T  S  V   S++ATLGRHLARRLVQIGV+DVF
Sbjct  1    MDVVVEALDSCKPFNNDIASLPQNGSLTPPSVTV---SSDATLGRHLARRLVQIGVSDVF  57

Query  265  SVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLN  444
            SVPGDFNLTLLDHLIAEPGL  IGCCNELNAGYAADGYAR RGVGACVVTFTVGGLSVLN
Sbjct  58   SVPGDFNLTLLDHLIAEPGLTNIGCCNELNAGYAADGYARRRGVGACVVTFTVGGLSVLN  117

Query  445  AIAGAYSENLPLICIVGGPNSNDYG  519
            AIAGAYSENLP+ICIVGGPN+NDYG
Sbjct  118  AIAGAYSENLPVICIVGGPNTNDYG  142



>ref|XP_008779570.1| PREDICTED: pyruvate decarboxylase 2-like, partial [Phoenix dactylifera]
Length=200

 Score =   177 bits (448),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 110/146 (75%), Positives = 121/146 (83%), Gaps = 1/146 (1%)
 Frame = +1

Query  85   MDTKIGSIEA-CKPGSGDVANAPTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDV  261
            MDT IG+++   KP   DV + P    +          +AEATLGRHLARRLVQ+GV DV
Sbjct  1    MDTSIGTVDGVAKPVCNDVGSLPAAACHPTSPAAAPMCAAEATLGRHLARRLVQVGVNDV  60

Query  262  FSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVL  441
            FSVPGDFNLTLLDHL+AEPGL L+GCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSVL
Sbjct  61   FSVPGDFNLTLLDHLLAEPGLNLVGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVL  120

Query  442  NAIAGAYSENLPLICIVGGPNSNDYG  519
            NAIAGAYSENLP+ICIVGGPNSNDYG
Sbjct  121  NAIAGAYSENLPVICIVGGPNSNDYG  146



>gb|KHN18047.1| Pyruvate decarboxylase isozyme 2 [Glycine soja]
Length=607

 Score =   186 bits (472),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 114/149 (77%), Positives = 128/149 (86%), Gaps = 4/149 (3%)
 Frame = +1

Query  85   MDTKIGSI--EACKPGSGDVANAPTIGVNTVH-STP-VAFSSAEATLGRHLARRLVQIGV  252
            MDT IGS+  +ACKP + DV   P   V+ ++ S P    +S++ATLGRHLARRLVQ+GV
Sbjct  1    MDTNIGSLSLDACKPANNDVGCPPNGAVSAINPSVPATTMTSSDATLGRHLARRLVQVGV  60

Query  253  TDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGL  432
            TDVFSVPGDFNLTLLDHLIAEP L+ IGCCNELNAGYAADGYAR RGVGACVVTFTVGGL
Sbjct  61   TDVFSVPGDFNLTLLDHLIAEPQLKNIGCCNELNAGYAADGYARCRGVGACVVTFTVGGL  120

Query  433  SVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            SV+NAIAGAYSENLPLICIVGGPN+ND+G
Sbjct  121  SVINAIAGAYSENLPLICIVGGPNTNDFG  149



>ref|XP_003516954.1| PREDICTED: pyruvate decarboxylase 4 [Glycine max]
Length=607

 Score =   186 bits (472),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 114/149 (77%), Positives = 127/149 (85%), Gaps = 4/149 (3%)
 Frame = +1

Query  85   MDTKIGSI--EACKPGSGDVANAPTIGVNTVH-STP-VAFSSAEATLGRHLARRLVQIGV  252
            MDT IGS+  +ACKP + DV   P   V+ +  S P    +S++ATLGRHLARRLVQ+GV
Sbjct  1    MDTNIGSLSLDACKPANNDVGCPPNGAVSAIKPSVPATTMTSSDATLGRHLARRLVQVGV  60

Query  253  TDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGL  432
            TDVFSVPGDFNLTLLDHLIAEP L+ IGCCNELNAGYAADGYAR RGVGACVVTFTVGGL
Sbjct  61   TDVFSVPGDFNLTLLDHLIAEPQLKNIGCCNELNAGYAADGYARCRGVGACVVTFTVGGL  120

Query  433  SVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            SV+NAIAGAYSENLPLICIVGGPN+ND+G
Sbjct  121  SVINAIAGAYSENLPLICIVGGPNTNDFG  149



>ref|XP_003604737.1| Pyruvate decarboxylase isozyme [Medicago truncatula]
 gb|AES86934.1| pyruvate decarboxylase [Medicago truncatula]
Length=607

 Score =   186 bits (471),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 128/149 (86%), Gaps = 4/149 (3%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIG--VNTVHSTP--VAFSSAEATLGRHLARRLVQIGV  252
            MDT +GS+EACK    D+   PT    V+T+  +P   + +S+E+TLG HLARRLV++G+
Sbjct  1    MDTNLGSLEACKSPCNDIITTPTSNGTVSTIQKSPSTQSLASSESTLGSHLARRLVEVGI  60

Query  253  TDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGL  432
            TD+F+VPGDFNLTLLDHLIAEP L+ IGCCNELNAGYAADGYAR+RGVGACVVTFTVGGL
Sbjct  61   TDIFTVPGDFNLTLLDHLIAEPKLKNIGCCNELNAGYAADGYARSRGVGACVVTFTVGGL  120

Query  433  SVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            SV+NAIAGAYSENLP+ICIVGGPNSND+G
Sbjct  121  SVINAIAGAYSENLPVICIVGGPNSNDFG  149



>ref|XP_008457351.1| PREDICTED: pyruvate decarboxylase 2-like [Cucumis melo]
Length=600

 Score =   185 bits (469),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 111/145 (77%), Positives = 126/145 (87%), Gaps = 3/145 (2%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVF  264
            M+T + ++++CKP + D+A+ P  G  T  S  V   S+++TLGRHLARRLVQIGV+DVF
Sbjct  1    METVVEALDSCKPFNNDIASLPQNGSLTPPSVTV---SSDSTLGRHLARRLVQIGVSDVF  57

Query  265  SVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLN  444
            SVPGDFNLTLLDHLIAEPGL  IGCCNELNAGYAADGYAR RGVGACVVTFTVGGLSVLN
Sbjct  58   SVPGDFNLTLLDHLIAEPGLNNIGCCNELNAGYAADGYARCRGVGACVVTFTVGGLSVLN  117

Query  445  AIAGAYSENLPLICIVGGPNSNDYG  519
            AIAGAYSENLP+ICIVGGPN+NDYG
Sbjct  118  AIAGAYSENLPVICIVGGPNTNDYG  142



>ref|XP_003614223.1| Pyruvate decarboxylase isozyme [Medicago truncatula]
 gb|AES97181.1| pyruvate decarboxylase [Medicago truncatula]
Length=607

 Score =   184 bits (468),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 107/149 (72%), Positives = 128/149 (86%), Gaps = 4/149 (3%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIG--VNTVHSTP--VAFSSAEATLGRHLARRLVQIGV  252
            MDT +GS+EACK    D+   P+    V+T+  +P   + +S+E+TLG HLARRLV++G+
Sbjct  1    MDTNLGSLEACKSPCNDIITTPSSNGTVSTIQKSPSTQSLASSESTLGSHLARRLVEVGI  60

Query  253  TDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGL  432
            TD+F+VPGDFNLTLLDHLIAEP L+ IGCCNELNAGYAADGYAR+RGVGACVVTFTVGGL
Sbjct  61   TDIFTVPGDFNLTLLDHLIAEPKLKNIGCCNELNAGYAADGYARSRGVGACVVTFTVGGL  120

Query  433  SVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            SV+NAIAGAYSENLP+ICIVGGPNSND+G
Sbjct  121  SVINAIAGAYSENLPVICIVGGPNSNDFG  149



>ref|XP_009338952.1| PREDICTED: pyruvate decarboxylase 2-like [Pyrus x bretschneideri]
Length=606

 Score =   184 bits (467),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 109/148 (74%), Positives = 124/148 (84%), Gaps = 3/148 (2%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTVHST---PVAFSSAEATLGRHLARRLVQIGVT  255
            M T IGS+++ KP + +V   P  G  T+H +   P   +SA++TLGRHLARRLV+IGV 
Sbjct  1    MATSIGSLDSSKPANNNVGCPPQNGTATIHDSSHPPSTIASADSTLGRHLARRLVEIGVG  60

Query  256  DVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLS  435
            DVF+VPGDFNLTLLDHLIAEP L  IGCCNELNAGYAADGYAR RGVGACVVTFTVGGLS
Sbjct  61   DVFTVPGDFNLTLLDHLIAEPKLTNIGCCNELNAGYAADGYARERGVGACVVTFTVGGLS  120

Query  436  VLNAIAGAYSENLPLICIVGGPNSNDYG  519
            VLNAIAGAYSENLP+IC+VGGPN+NDYG
Sbjct  121  VLNAIAGAYSENLPVICVVGGPNTNDYG  148



>ref|XP_009369597.1| PREDICTED: pyruvate decarboxylase 2-like [Pyrus x bretschneideri]
Length=606

 Score =   184 bits (467),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 109/148 (74%), Positives = 124/148 (84%), Gaps = 3/148 (2%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTVHST---PVAFSSAEATLGRHLARRLVQIGVT  255
            M T IGS+++ KP + +V   P  G  T+H +   P   +SA++TLGRHLARRLV+IGV 
Sbjct  1    MATSIGSLDSSKPANNNVGCPPQNGTATIHDSSHPPSTIASADSTLGRHLARRLVEIGVG  60

Query  256  DVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLS  435
            DVF+VPGDFNLTLLDHLIAEP L  IGCCNELNAGYAADGYAR RGVGACVVTFTVGGLS
Sbjct  61   DVFTVPGDFNLTLLDHLIAEPKLTNIGCCNELNAGYAADGYARERGVGACVVTFTVGGLS  120

Query  436  VLNAIAGAYSENLPLICIVGGPNSNDYG  519
            VLNAIAGAYSENLP+IC+VGGPN+NDYG
Sbjct  121  VLNAIAGAYSENLPVICVVGGPNTNDYG  148



>ref|XP_008384777.1| PREDICTED: pyruvate decarboxylase 1-like isoform X2 [Malus domestica]
Length=606

 Score =   184 bits (467),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 109/148 (74%), Positives = 124/148 (84%), Gaps = 3/148 (2%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTVHST---PVAFSSAEATLGRHLARRLVQIGVT  255
            M T IGS+++ KP + +V   P  G  T+H +   P   +SA++TLGRHLARRLV+IGV 
Sbjct  1    MATNIGSLDSSKPANNNVGCPPQNGTATIHDSSHPPSTIASADSTLGRHLARRLVEIGVG  60

Query  256  DVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLS  435
            DVF+VPGDFNLTLLDHLIAEP L  IGCCNELNAGYAADGYAR RGVGACVVTFTVGGLS
Sbjct  61   DVFTVPGDFNLTLLDHLIAEPKLTNIGCCNELNAGYAADGYARERGVGACVVTFTVGGLS  120

Query  436  VLNAIAGAYSENLPLICIVGGPNSNDYG  519
            VLNAIAGAYSENLP+IC+VGGPN+NDYG
Sbjct  121  VLNAIAGAYSENLPVICVVGGPNTNDYG  148



>ref|XP_008384776.1| PREDICTED: pyruvate decarboxylase 2-like isoform X1 [Malus domestica]
Length=610

 Score =   184 bits (467),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 109/148 (74%), Positives = 124/148 (84%), Gaps = 3/148 (2%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTVHST---PVAFSSAEATLGRHLARRLVQIGVT  255
            M T IGS+++ KP + +V   P  G  T+H +   P   +SA++TLGRHLARRLV+IGV 
Sbjct  1    MATNIGSLDSSKPANNNVGCPPQNGTATIHDSSHPPSTIASADSTLGRHLARRLVEIGVG  60

Query  256  DVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLS  435
            DVF+VPGDFNLTLLDHLIAEP L  IGCCNELNAGYAADGYAR RGVGACVVTFTVGGLS
Sbjct  61   DVFTVPGDFNLTLLDHLIAEPKLTNIGCCNELNAGYAADGYARERGVGACVVTFTVGGLS  120

Query  436  VLNAIAGAYSENLPLICIVGGPNSNDYG  519
            VLNAIAGAYSENLP+IC+VGGPN+NDYG
Sbjct  121  VLNAIAGAYSENLPVICVVGGPNTNDYG  148



>ref|XP_010922580.1| PREDICTED: pyruvate decarboxylase 2-like [Elaeis guineensis]
Length=604

 Score =   184 bits (467),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 110/146 (75%), Positives = 121/146 (83%), Gaps = 1/146 (1%)
 Frame = +1

Query  85   MDTKIGSIE-ACKPGSGDVANAPTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDV  261
            MDT IGS++   KP   DV + P I  + +     +   A ATLGRHLARRLVQ+G  DV
Sbjct  1    MDTSIGSVDGVAKPICNDVGSLPAIACHPISPAAASICEAGATLGRHLARRLVQVGANDV  60

Query  262  FSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVL  441
            FSVPGDFNLTLLDHLIAEPGL +IGCCNELNAGYAADGYAR+RGVGACVVTF+VGGLSVL
Sbjct  61   FSVPGDFNLTLLDHLIAEPGLNIIGCCNELNAGYAADGYARSRGVGACVVTFSVGGLSVL  120

Query  442  NAIAGAYSENLPLICIVGGPNSNDYG  519
            NAIAGAYSENLP+ICIVGGPNSNDYG
Sbjct  121  NAIAGAYSENLPVICIVGGPNSNDYG  146



>gb|KJB21559.1| hypothetical protein B456_004G001200 [Gossypium raimondii]
Length=605

 Score =   184 bits (466),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 110/147 (75%), Positives = 126/147 (86%), Gaps = 2/147 (1%)
 Frame = +1

Query  85   MDTKIGS-IEACKPGSGDVANAPTIGVNTVHS-TPVAFSSAEATLGRHLARRLVQIGVTD  258
            MD+ IGS ++ CKP +G + N    G   + S  P +  +A+ATLGRHLARRLV+IGV D
Sbjct  1    MDSTIGSQLQTCKPSNGMLGNPAQNGATILDSNAPPSVVAADATLGRHLARRLVEIGVKD  60

Query  259  VFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSV  438
            VFSVPGDFNLTLLDHLIAEPGL+ IGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLS+
Sbjct  61   VFSVPGDFNLTLLDHLIAEPGLKNIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSI  120

Query  439  LNAIAGAYSENLPLICIVGGPNSNDYG  519
            +NAIAGAYSENLP+ICIVGGPN+NDYG
Sbjct  121  INAIAGAYSENLPVICIVGGPNTNDYG  147



>dbj|BAJ94428.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97512.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=606

 Score =   184 bits (466),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 111/150 (74%), Positives = 125/150 (83%), Gaps = 7/150 (5%)
 Frame = +1

Query  85   MDTKIGSIEACKPGS-----GDVANAPTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIG  249
            MDT IGS++   P +     G  A+AP   + + H  P A  + EA+LGRHLARRLVQ+G
Sbjct  1    MDTHIGSVDGPSPAAVNGAVGCPASAPGCPIMSSHPAPSA--AGEASLGRHLARRLVQVG  58

Query  250  VTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGG  429
            V+DVF+VPGDFNLTLLDHL+AEPGLRL+GCCNELNAGYAADGYARARGVGAC VTFTVGG
Sbjct  59   VSDVFAVPGDFNLTLLDHLVAEPGLRLVGCCNELNAGYAADGYARARGVGACAVTFTVGG  118

Query  430  LSVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            LSVLNAIAGAYSENLP+ICI GGPNSNDYG
Sbjct  119  LSVLNAIAGAYSENLPVICIAGGPNSNDYG  148



>gb|AEF33613.1| pyruvate decarboxylase [Salvia miltiorrhiza f. alba]
Length=605

 Score =   183 bits (464),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 128/147 (87%), Gaps = 2/147 (1%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGD-VANAPTIGV-NTVHSTPVAFSSAEATLGRHLARRLVQIGVTD  258
            M+TKIGS+  C   + + V   P+ GV +++  + VAF+SAEATLGRH+ARRLVQI V+D
Sbjct  1    METKIGSLNPCNSATCNGVGCLPSNGVVSSIKPSAVAFNSAEATLGRHIARRLVQIDVSD  60

Query  259  VFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSV  438
            VFSVPGDFNLTLLD LIAEPGL ++GCCNELNAGYAADGYARARGVGAC VTFTVGGLS+
Sbjct  61   VFSVPGDFNLTLLDDLIAEPGLNVVGCCNELNAGYAADGYARARGVGACAVTFTVGGLSI  120

Query  439  LNAIAGAYSENLPLICIVGGPNSNDYG  519
            LNAIAGAYSENLP+ICIVGGPNSNDYG
Sbjct  121  LNAIAGAYSENLPVICIVGGPNSNDYG  147



>ref|XP_008805101.1| PREDICTED: pyruvate decarboxylase 1-like [Phoenix dactylifera]
Length=604

 Score =   183 bits (464),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 109/146 (75%), Positives = 122/146 (84%), Gaps = 1/146 (1%)
 Frame = +1

Query  85   MDTKIGSIE-ACKPGSGDVANAPTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDV  261
            MDT IGS++   KP   DV + P I  + +     +   + ATLGRHLARRLVQ+G +DV
Sbjct  1    MDTSIGSVDGVVKPVCNDVGSLPAIACHPISPAVASICESGATLGRHLARRLVQVGASDV  60

Query  262  FSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVL  441
            FSVPGDFNLTLLDHLIAEPGL L+GCCNELNAGYAADGYAR+RGVGACVVTF+VGGLSVL
Sbjct  61   FSVPGDFNLTLLDHLIAEPGLTLVGCCNELNAGYAADGYARSRGVGACVVTFSVGGLSVL  120

Query  442  NAIAGAYSENLPLICIVGGPNSNDYG  519
            NAIAGAYSENLP+ICIVGGPNSNDYG
Sbjct  121  NAIAGAYSENLPVICIVGGPNSNDYG  146



>gb|ACL52480.1| unknown [Zea mays]
 tpg|DAA44861.1| TPA: pyruvate decarboxylase3 [Zea mays]
Length=448

 Score =   180 bits (457),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 112/148 (76%), Positives = 123/148 (83%), Gaps = 3/148 (2%)
 Frame = +1

Query  85   MDTKIGSIE--ACKPGSGDVANAPTIGVNTVHSTPVA-FSSAEATLGRHLARRLVQIGVT  255
            MDT IGS+   A     G  A+AP   + +  + P A  S+ EA+LGRHLARRLVQ+GV 
Sbjct  1    MDTHIGSVNGAASNQTVGCPASAPGCPMASTPAQPAATLSAGEASLGRHLARRLVQVGVN  60

Query  256  DVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLS  435
            DVF+VPGDFNLTLLDHLIAEPGLRL+GCCNELNAGYAADGYARARGVGAC VTFTVGGLS
Sbjct  61   DVFAVPGDFNLTLLDHLIAEPGLRLVGCCNELNAGYAADGYARARGVGACAVTFTVGGLS  120

Query  436  VLNAIAGAYSENLPLICIVGGPNSNDYG  519
            VLNAIAGAYSENLP+ICI GGPNSNDYG
Sbjct  121  VLNAIAGAYSENLPVICIAGGPNSNDYG  148



>gb|AGA15797.1| pyruvate decarboxylase 2 [Diospyros kaki]
Length=607

 Score =   183 bits (464),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 125/149 (84%), Gaps = 4/149 (3%)
 Frame = +1

Query  85   MDTKIGSIEACK-PGSGDVANAPTIG-VNTVHST--PVAFSSAEATLGRHLARRLVQIGV  252
            MDTKIG++E    P S  +   P  G V+T+ ++    A   +EATLGRHLARRLVQIG 
Sbjct  1    MDTKIGAVEVSPGPSSDAIGCLPGNGCVSTIQNSCPSTALVPSEATLGRHLARRLVQIGA  60

Query  253  TDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGL  432
            TDVFSVPGDFNLTLLDHLIAEPGL LIGCCNELNAGYAADG+AR RGVGACVVTFTVGGL
Sbjct  61   TDVFSVPGDFNLTLLDHLIAEPGLNLIGCCNELNAGYAADGFARCRGVGACVVTFTVGGL  120

Query  433  SVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            SVLNAIAGAYSENLP+ICIVGGPNSNDYG
Sbjct  121  SVLNAIAGAYSENLPVICIVGGPNSNDYG  149



>ref|XP_011094440.1| PREDICTED: pyruvate decarboxylase 1-like [Sesamum indicum]
Length=609

 Score =   183 bits (464),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 115/143 (80%), Positives = 124/143 (87%), Gaps = 4/143 (3%)
 Frame = +1

Query  103  SIEACKPGS-GDVANAPTIG-VNTVH--STPVAFSSAEATLGRHLARRLVQIGVTDVFSV  270
            S  + KP    DV   P+ G V+T+   S+ V F+SAE TLGRHLARRLVQIGV+DVFSV
Sbjct  9    SFHSSKPAPFNDVGALPSNGIVSTIQFQSSAVPFNSAEPTLGRHLARRLVQIGVSDVFSV  68

Query  271  PGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAI  450
            PGDFNLTLLDHLIAEPGL LIGCCNELNAGYAADGYARARGVGACVVTFTVGGLS+LNAI
Sbjct  69   PGDFNLTLLDHLIAEPGLNLIGCCNELNAGYAADGYARARGVGACVVTFTVGGLSILNAI  128

Query  451  AGAYSENLPLICIVGGPNSNDYG  519
            AGAYSENLP+ICIVGGPNSNDYG
Sbjct  129  AGAYSENLPVICIVGGPNSNDYG  151



>ref|XP_008344771.1| PREDICTED: pyruvate decarboxylase 1-like [Malus domestica]
Length=606

 Score =   182 bits (463),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 111/148 (75%), Positives = 125/148 (84%), Gaps = 3/148 (2%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTVHST---PVAFSSAEATLGRHLARRLVQIGVT  255
            M T IGS+++ KP +  V   P     T++ +   P A +SA++TLGRHLARRLV+IGV 
Sbjct  1    MATSIGSLDSLKPANNCVGCPPQNSATTIYDSSHPPSAIASADSTLGRHLARRLVEIGVG  60

Query  256  DVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLS  435
            DVFSVPGDFNLTLLDHLIAEPGL  IGCCNELNAGYAADGYARARGVGACVVTFTVGGLS
Sbjct  61   DVFSVPGDFNLTLLDHLIAEPGLTNIGCCNELNAGYAADGYARARGVGACVVTFTVGGLS  120

Query  436  VLNAIAGAYSENLPLICIVGGPNSNDYG  519
            VLNAIAGAYSENLP+IC+VGGPN+NDYG
Sbjct  121  VLNAIAGAYSENLPVICVVGGPNTNDYG  148



>ref|XP_004156618.1| PREDICTED: pyruvate decarboxylase isozyme 2-like [Cucumis sativus]
Length=605

 Score =   182 bits (463),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 123/147 (84%), Gaps = 2/147 (1%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTVHSTPVAFSSA--EATLGRHLARRLVQIGVTD  258
            MDTKIGS++ CKP +  V       V T+ ++  +   +  +ATLGRHLARRLVQIGVTD
Sbjct  1    MDTKIGSLDTCKPQNNVVCCPSNGSVCTIQNSVPSTVVSSSDATLGRHLARRLVQIGVTD  60

Query  259  VFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSV  438
            VF+VPGDFNLTLLDHLIAEP L  IGCCNELNAGYAADGYAR RGVGACVVTFTVGGLSV
Sbjct  61   VFTVPGDFNLTLLDHLIAEPALNNIGCCNELNAGYAADGYARCRGVGACVVTFTVGGLSV  120

Query  439  LNAIAGAYSENLPLICIVGGPNSNDYG  519
            LNAIAGAYSENLPLICIVGGPNSNDYG
Sbjct  121  LNAIAGAYSENLPLICIVGGPNSNDYG  147



>ref|XP_004137700.1| PREDICTED: pyruvate decarboxylase isozyme 2-like [Cucumis sativus]
 gb|KGN58736.1| hypothetical protein Csa_3G730980 [Cucumis sativus]
Length=605

 Score =   182 bits (463),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 123/147 (84%), Gaps = 2/147 (1%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTVHSTPVAFSSA--EATLGRHLARRLVQIGVTD  258
            MDTKIGS++ CKP +  V       V T+ ++  +   +  +ATLGRHLARRLVQIGVTD
Sbjct  1    MDTKIGSLDTCKPQNNVVCCPSNGSVCTIQNSVPSTVVSSSDATLGRHLARRLVQIGVTD  60

Query  259  VFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSV  438
            VF+VPGDFNLTLLDHLIAEP L  IGCCNELNAGYAADGYAR RGVGACVVTFTVGGLSV
Sbjct  61   VFTVPGDFNLTLLDHLIAEPALNNIGCCNELNAGYAADGYARCRGVGACVVTFTVGGLSV  120

Query  439  LNAIAGAYSENLPLICIVGGPNSNDYG  519
            LNAIAGAYSENLPLICIVGGPNSNDYG
Sbjct  121  LNAIAGAYSENLPLICIVGGPNSNDYG  147



>ref|XP_002465414.1| hypothetical protein SORBIDRAFT_01g038360 [Sorghum bicolor]
 gb|EER92412.1| hypothetical protein SORBIDRAFT_01g038360 [Sorghum bicolor]
Length=610

 Score =   182 bits (463),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 112/152 (74%), Positives = 125/152 (82%), Gaps = 7/152 (5%)
 Frame = +1

Query  85   MDTKIGSI--EACKPGSGDV----ANAPTIGVNTVHSTPVA-FSSAEATLGRHLARRLVQ  243
            MDT +GS+   A  P S D     A+AP   + +  + P +  S+ EA+LGRHLARRLVQ
Sbjct  1    MDTHVGSVNGSAAAPASNDTVGCPASAPGCPMASTPAQPASTLSAGEASLGRHLARRLVQ  60

Query  244  IGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTV  423
            +GV DVF+VPGDFNLTLLDHLIAEPGLRL+GCCNELNAGYAADGYARARGVGAC VTFTV
Sbjct  61   VGVNDVFAVPGDFNLTLLDHLIAEPGLRLVGCCNELNAGYAADGYARARGVGACAVTFTV  120

Query  424  GGLSVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            GGLSVLNAIAGAYSENLP+ICI GGPNSNDYG
Sbjct  121  GGLSVLNAIAGAYSENLPVICIAGGPNSNDYG  152



>tpg|DAA44862.1| TPA: pyruvate decarboxylase3 [Zea mays]
Length=470

 Score =   180 bits (457),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 112/148 (76%), Positives = 123/148 (83%), Gaps = 3/148 (2%)
 Frame = +1

Query  85   MDTKIGSIE--ACKPGSGDVANAPTIGVNTVHSTPVA-FSSAEATLGRHLARRLVQIGVT  255
            MDT IGS+   A     G  A+AP   + +  + P A  S+ EA+LGRHLARRLVQ+GV 
Sbjct  1    MDTHIGSVNGAASNQTVGCPASAPGCPMASTPAQPAATLSAGEASLGRHLARRLVQVGVN  60

Query  256  DVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLS  435
            DVF+VPGDFNLTLLDHLIAEPGLRL+GCCNELNAGYAADGYARARGVGAC VTFTVGGLS
Sbjct  61   DVFAVPGDFNLTLLDHLIAEPGLRLVGCCNELNAGYAADGYARARGVGACAVTFTVGGLS  120

Query  436  VLNAIAGAYSENLPLICIVGGPNSNDYG  519
            VLNAIAGAYSENLP+ICI GGPNSNDYG
Sbjct  121  VLNAIAGAYSENLPVICIAGGPNSNDYG  148



>ref|XP_010033427.1| PREDICTED: pyruvate decarboxylase 1-like [Eucalyptus grandis]
 gb|KCW88157.1| hypothetical protein EUGRSUZ_A00546 [Eucalyptus grandis]
Length=607

 Score =   182 bits (462),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 123/149 (83%), Gaps = 4/149 (3%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTVHSTPV----AFSSAEATLGRHLARRLVQIGV  252
            MDT +G + + KP S  + + P+   + + S  +    A  S +AT+GRH+ARRLVQIGV
Sbjct  1    MDTTVGDVNSRKPDSNGIGSPPSGAASVMQSLALPHALAAGSPDATMGRHIARRLVQIGV  60

Query  253  TDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGL  432
            TDVFSVPGDFNL LLDHLIAEPGL LIGCCNELNAGYAADGYAR RGVGACVVTFTVGGL
Sbjct  61   TDVFSVPGDFNLVLLDHLIAEPGLNLIGCCNELNAGYAADGYARTRGVGACVVTFTVGGL  120

Query  433  SVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            S+LNAIAGAYSENLP++CIVGGPNSNDYG
Sbjct  121  SMLNAIAGAYSENLPVVCIVGGPNSNDYG  149



>gb|EPS58298.1| pyruvate decarboxylase, partial [Genlisea aurea]
Length=589

 Score =   181 bits (460),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 105/121 (87%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = +1

Query  157  GVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIG  336
            GV TV S+ V FSS+EATLGRH+ARRLVQIG+ DVFSVPGDFNLTLLDHL+AEPGL L+G
Sbjct  11   GVCTVQSSAVPFSSSEATLGRHIARRLVQIGIRDVFSVPGDFNLTLLDHLLAEPGLNLVG  70

Query  337  CCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDY  516
            CCNE+NAGYAADGYARARGVGACVVTFTVGGLSV+NAIAGAYSENLP+ICIVGGPN+NDY
Sbjct  71   CCNEINAGYAADGYARARGVGACVVTFTVGGLSVINAIAGAYSENLPVICIVGGPNTNDY  130

Query  517  G  519
            G
Sbjct  131  G  131



>gb|EMT10366.1| Pyruvate decarboxylase isozyme 2 [Aegilops tauschii]
Length=406

 Score =   178 bits (452),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 121/146 (83%), Gaps = 5/146 (3%)
 Frame = +1

Query  85   MDTKIGSIEACKPG-SGDVANAPTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDV  261
            M+T IGS++  K   SG VA   T       S P    S EATLGRHLARRLVQ+GV DV
Sbjct  1    METGIGSVDGPKGAPSGAVACPATFPA----SAPTFVGSPEATLGRHLARRLVQVGVGDV  56

Query  262  FSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVL  441
            F+VPGDFNLTLLD+L+AEPGLRL+GCCNELNAGYAADGYARA+GVGAC VTFTVGGLSVL
Sbjct  57   FAVPGDFNLTLLDYLVAEPGLRLVGCCNELNAGYAADGYARAKGVGACAVTFTVGGLSVL  116

Query  442  NAIAGAYSENLPLICIVGGPNSNDYG  519
            NAIAGAYSENLPLICIVGGPNSNDYG
Sbjct  117  NAIAGAYSENLPLICIVGGPNSNDYG  142



>ref|XP_009391704.1| PREDICTED: pyruvate decarboxylase 1 [Musa acuminata subsp. malaccensis]
Length=606

 Score =   181 bits (459),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 122/156 (78%), Gaps = 19/156 (12%)
 Frame = +1

Query  85   MDTKIGSIEA-----------CKPGSGDVANAPTIGVNTVHSTPVAFSSAEATLGRHLAR  231
            MDTKIGS++A           C P     + AP        + P     A+ATLGRH+AR
Sbjct  1    MDTKIGSVDAAAETTANGVVGCPPAKPCCSVAP--------AAPTTAGPADATLGRHIAR  52

Query  232  RLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVV  411
            RLVQ+G  DVFSVPGDFNLTLLDHLIAEPGLRL+GCCNELNAGYAADGYARARGVGACVV
Sbjct  53   RLVQVGALDVFSVPGDFNLTLLDHLIAEPGLRLVGCCNELNAGYAADGYARARGVGACVV  112

Query  412  TFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            TFTVGGLSVLNAIAGAYSENLP+ICIVGGPNSNDYG
Sbjct  113  TFTVGGLSVLNAIAGAYSENLPVICIVGGPNSNDYG  148



>ref|XP_004984863.1| PREDICTED: pyruvate decarboxylase 2-like [Setaria italica]
Length=610

 Score =   181 bits (459),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 126/152 (83%), Gaps = 7/152 (5%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGD------VANAPTIGVNTVHSTPVA-FSSAEATLGRHLARRLVQ  243
            MDT IGS++    G+G+       A+AP   + +  + P A   + EA+LGRHLARRLVQ
Sbjct  1    MDTHIGSVDGPALGAGNGTVVGCPASAPGCPMASTPAQPAATLPAGEASLGRHLARRLVQ  60

Query  244  IGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTV  423
            +GV+DVF+VPGDFNLTLLDHLIAEPGLRL+GCCNELNAGYAADGYARARGVGAC VTFTV
Sbjct  61   VGVSDVFAVPGDFNLTLLDHLIAEPGLRLVGCCNELNAGYAADGYARARGVGACAVTFTV  120

Query  424  GGLSVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            GGLSVLNAIAGAYSENLP+ICI GGPNSNDYG
Sbjct  121  GGLSVLNAIAGAYSENLPVICIAGGPNSNDYG  152



>gb|AAL99745.1| pyruvate decarboxylase [Zea mays]
 tpg|DAA44860.1| TPA: pyruvate decarboxylase3 [Zea mays]
Length=605

 Score =   181 bits (458),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 112/148 (76%), Positives = 123/148 (83%), Gaps = 3/148 (2%)
 Frame = +1

Query  85   MDTKIGSIE--ACKPGSGDVANAPTIGVNTVHSTPVA-FSSAEATLGRHLARRLVQIGVT  255
            MDT IGS+   A     G  A+AP   + +  + P A  S+ EA+LGRHLARRLVQ+GV 
Sbjct  1    MDTHIGSVNGAASNQTVGCPASAPGCPMASTPAQPAATLSAGEASLGRHLARRLVQVGVN  60

Query  256  DVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLS  435
            DVF+VPGDFNLTLLDHLIAEPGLRL+GCCNELNAGYAADGYARARGVGAC VTFTVGGLS
Sbjct  61   DVFAVPGDFNLTLLDHLIAEPGLRLVGCCNELNAGYAADGYARARGVGACAVTFTVGGLS  120

Query  436  VLNAIAGAYSENLPLICIVGGPNSNDYG  519
            VLNAIAGAYSENLP+ICI GGPNSNDYG
Sbjct  121  VLNAIAGAYSENLPVICIAGGPNSNDYG  148



>ref|NP_001105052.1| pyruvate decarboxylase 3 [Zea mays]
 gb|AAL99744.1| pyruvate decarboxylase [Zea mays]
 gb|ACG43025.1| pyruvate decarboxylase isozyme 2 [Zea mays]
 gb|ACL54676.1| unknown [Zea mays]
 tpg|DAA44863.1| TPA: pyruvate decarboxylase3 [Zea mays]
Length=606

 Score =   181 bits (458),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 112/148 (76%), Positives = 123/148 (83%), Gaps = 3/148 (2%)
 Frame = +1

Query  85   MDTKIGSIE--ACKPGSGDVANAPTIGVNTVHSTPVA-FSSAEATLGRHLARRLVQIGVT  255
            MDT IGS+   A     G  A+AP   + +  + P A  S+ EA+LGRHLARRLVQ+GV 
Sbjct  1    MDTHIGSVNGAASNQTVGCPASAPGCPMASTPAQPAATLSAGEASLGRHLARRLVQVGVN  60

Query  256  DVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLS  435
            DVF+VPGDFNLTLLDHLIAEPGLRL+GCCNELNAGYAADGYARARGVGAC VTFTVGGLS
Sbjct  61   DVFAVPGDFNLTLLDHLIAEPGLRLVGCCNELNAGYAADGYARARGVGACAVTFTVGGLS  120

Query  436  VLNAIAGAYSENLPLICIVGGPNSNDYG  519
            VLNAIAGAYSENLP+ICI GGPNSNDYG
Sbjct  121  VLNAIAGAYSENLPVICIAGGPNSNDYG  148



>ref|XP_008775409.1| PREDICTED: pyruvate decarboxylase 1 isoform X2 [Phoenix dactylifera]
Length=600

 Score =   180 bits (457),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 126/149 (85%), Gaps = 6/149 (4%)
 Frame = +1

Query  85   MDTKIGSIE--ACKPGSGDVANAPTIGVNTVHSTPVAFSSA--EATLGRHLARRLVQIGV  252
            MDTK+GS++  A    +G V   P    + +   PVA +S   EATLGRHLARRLVQ+GV
Sbjct  1    MDTKVGSVDVAAEATANGLVGLPPAKPCHPI--IPVAPASGLGEATLGRHLARRLVQVGV  58

Query  253  TDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGL  432
             DVFSVPGDFNLTLLDHL+AEPGLRL+GCCNELNAGYAADGYARARGVGACVVTFTVGGL
Sbjct  59   NDVFSVPGDFNLTLLDHLLAEPGLRLVGCCNELNAGYAADGYARARGVGACVVTFTVGGL  118

Query  433  SVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            SVLNAIAGAYSENLP+ICIVGGPNSNDYG
Sbjct  119  SVLNAIAGAYSENLPVICIVGGPNSNDYG  147



>ref|XP_003558149.1| PREDICTED: pyruvate decarboxylase 2 [Brachypodium distachyon]
Length=608

 Score =   180 bits (457),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 108/150 (72%), Positives = 124/150 (83%), Gaps = 5/150 (3%)
 Frame = +1

Query  85   MDTKIGSIEACKPGS-----GDVANAPTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIG  249
            MDT+IGS++   P +     G  A+AP   + +    P A S+ +A+LGRHLARRLVQ+G
Sbjct  1    MDTRIGSVDGPSPAAVNGAVGCPASAPGCPIMSSQPAPAAGSAKDASLGRHLARRLVQVG  60

Query  250  VTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGG  429
            V+DVF+VPGDFNLTLLD L+AEPGL L+GCCNELNAGYAADGYARARGVGAC VTFTVGG
Sbjct  61   VSDVFAVPGDFNLTLLDDLVAEPGLNLVGCCNELNAGYAADGYARARGVGACAVTFTVGG  120

Query  430  LSVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            LSVLNAIAGAYSENLP+ICI GGPNSNDYG
Sbjct  121  LSVLNAIAGAYSENLPVICIAGGPNSNDYG  150



>ref|XP_008775408.1| PREDICTED: pyruvate decarboxylase 1 isoform X1 [Phoenix dactylifera]
Length=605

 Score =   180 bits (457),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 126/149 (85%), Gaps = 6/149 (4%)
 Frame = +1

Query  85   MDTKIGSIE--ACKPGSGDVANAPTIGVNTVHSTPVAFSSA--EATLGRHLARRLVQIGV  252
            MDTK+GS++  A    +G V   P    + +   PVA +S   EATLGRHLARRLVQ+GV
Sbjct  1    MDTKVGSVDVAAEATANGLVGLPPAKPCHPI--IPVAPASGLGEATLGRHLARRLVQVGV  58

Query  253  TDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGL  432
             DVFSVPGDFNLTLLDHL+AEPGLRL+GCCNELNAGYAADGYARARGVGACVVTFTVGGL
Sbjct  59   NDVFSVPGDFNLTLLDHLLAEPGLRLVGCCNELNAGYAADGYARARGVGACVVTFTVGGL  118

Query  433  SVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            SVLNAIAGAYSENLP+ICIVGGPNSNDYG
Sbjct  119  SVLNAIAGAYSENLPVICIVGGPNSNDYG  147



>ref|XP_003529168.1| PREDICTED: pyruvate decarboxylase 1 [Glycine max]
Length=607

 Score =   180 bits (457),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 111/149 (74%), Positives = 123/149 (83%), Gaps = 4/149 (3%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTVH----STPVAFSSAEATLGRHLARRLVQIGV  252
            MDT+IGS++A KP   DV +        +     +T +  +  ++TLG HLARRLV+IGV
Sbjct  1    MDTRIGSLDAAKPACNDVVSCNHTTSAAIQPCVPATVINGAGGDSTLGGHLARRLVEIGV  60

Query  253  TDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGL  432
            TDVFSVPGDFNLTLLDHLIAEP L L+GCCNELNAGYAADGYARARGVGACVVTFTVGGL
Sbjct  61   TDVFSVPGDFNLTLLDHLIAEPALNLVGCCNELNAGYAADGYARARGVGACVVTFTVGGL  120

Query  433  SVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            SVLNAIAGAYSENLPLICIVGGPNSNDYG
Sbjct  121  SVLNAIAGAYSENLPLICIVGGPNSNDYG  149



>ref|XP_003552267.1| PREDICTED: pyruvate decarboxylase 2 [Glycine max]
Length=608

 Score =   180 bits (456),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 124/154 (81%), Gaps = 13/154 (8%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDV---------ANAPTIGVNTVHSTPVAFSSAEATLGRHLARRL  237
            MDTKIGS++A KP S DV         A  P +    ++        +++TLG HLARRL
Sbjct  1    MDTKIGSLDAPKPNSNDVVSCNLTSSAAIQPCLPATVINGA----GCSDSTLGGHLARRL  56

Query  238  VQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTF  417
            V+IGVTDVFSVPGDFNLTLLDHLIAEP L L+GCCNELNAGYAADGYARARGVGACVVTF
Sbjct  57   VEIGVTDVFSVPGDFNLTLLDHLIAEPALHLVGCCNELNAGYAADGYARARGVGACVVTF  116

Query  418  TVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            TVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYG
Sbjct  117  TVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYG  150



>dbj|BAK04101.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=600

 Score =   179 bits (455),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 115/146 (79%), Positives = 121/146 (83%), Gaps = 5/146 (3%)
 Frame = +1

Query  85   MDTKIGSIEACKPG-SGDVANAPTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDV  261
            M+T IGS++  K   SG VA   T       S+P    S EATLGRHLARRLVQIGV DV
Sbjct  1    METGIGSVDGPKGAPSGAVACPATFPA----SSPTFIGSPEATLGRHLARRLVQIGVGDV  56

Query  262  FSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVL  441
            F+VPGDFNLTLLDHLIAEP LRL+GCCNELNAGYAADGYARARGVGAC VTFTVGGLSVL
Sbjct  57   FAVPGDFNLTLLDHLIAEPRLRLVGCCNELNAGYAADGYARARGVGACAVTFTVGGLSVL  116

Query  442  NAIAGAYSENLPLICIVGGPNSNDYG  519
            NAIAGAYSENLPLICIVGGPNSNDYG
Sbjct  117  NAIAGAYSENLPLICIVGGPNSNDYG  142



>ref|XP_004958794.1| PREDICTED: pyruvate decarboxylase 2-like [Setaria italica]
Length=605

 Score =   179 bits (454),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 113/148 (76%), Positives = 126/148 (85%), Gaps = 4/148 (3%)
 Frame = +1

Query  85   MDTKIGSIEACKPG-SGDVA--NAPTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVT  255
            M+T IGS++  +   SG VA   A   G   + S PV+ +  +ATLGRHLARRLVQ+GV+
Sbjct  1    METTIGSVDGHRAAASGAVACPAASAPGCPYLTSAPVS-TPGDATLGRHLARRLVQVGVS  59

Query  256  DVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLS  435
            DVF+VPGDFNLTLLDHLIAEPGLRL+GCCNELNAGYAADGYARARGVGAC VTFTVGGLS
Sbjct  60   DVFAVPGDFNLTLLDHLIAEPGLRLVGCCNELNAGYAADGYARARGVGACAVTFTVGGLS  119

Query  436  VLNAIAGAYSENLPLICIVGGPNSNDYG  519
            VLNAIAGAYSENLP+ICIVGGPNSNDYG
Sbjct  120  VLNAIAGAYSENLPVICIVGGPNSNDYG  147



>ref|XP_002530500.1| pyruvate decarboxylase, putative [Ricinus communis]
 gb|EEF31884.1| pyruvate decarboxylase, putative [Ricinus communis]
Length=607

 Score =   179 bits (454),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 126/149 (85%), Gaps = 4/149 (3%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTVHSTPVAFSSAEA----TLGRHLARRLVQIGV  252
            MDT IGSI+  KP + DV       V T+ S+ V+ SS  +    TLGRHLARRLVQ+GV
Sbjct  1    MDTNIGSIDTLKPTTTDVCCPANGAVCTLQSSTVSPSSIVSSPDSTLGRHLARRLVQVGV  60

Query  253  TDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGL  432
            TDVFSVPGDFNLTLLDHLIAEPGL +IGCCNELNAGYAADGYAR+RGVGACVVTFTVGGL
Sbjct  61   TDVFSVPGDFNLTLLDHLIAEPGLNVIGCCNELNAGYAADGYARSRGVGACVVTFTVGGL  120

Query  433  SVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            SVLNAIAGAYSENLP++CIVGGPNSNDYG
Sbjct  121  SVLNAIAGAYSENLPVVCIVGGPNSNDYG  149



>ref|XP_004294304.1| PREDICTED: pyruvate decarboxylase 2-like isoform X2 [Fragaria 
vesca subsp. vesca]
Length=604

 Score =   179 bits (454),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 124/146 (85%), Gaps = 1/146 (1%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTVHSTPVA-FSSAEATLGRHLARRLVQIGVTDV  261
            M T +GS+E  KP + +V   P  G + +   P++  S  ++TLGRHLARRLV+IGV+DV
Sbjct  1    MATGLGSLECIKPTNNNVGCPPQNGASALQDQPLSTISCPDSTLGRHLARRLVEIGVSDV  60

Query  262  FSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVL  441
            FSVPGDFNLTLLDHLIAEPGL  IGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSVL
Sbjct  61   FSVPGDFNLTLLDHLIAEPGLTNIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVL  120

Query  442  NAIAGAYSENLPLICIVGGPNSNDYG  519
            NAIAGAYSENLP+IC+VGGPN+ND+G
Sbjct  121  NAIAGAYSENLPVICVVGGPNTNDFG  146



>ref|NP_001055803.1| Os05g0469600 [Oryza sativa Japonica Group]
 sp|Q0DHF6.1|PDC1_ORYSJ RecName: Full=Pyruvate decarboxylase 1; Short=PDC [Oryza sativa 
Japonica Group]
 gb|AAT93945.1| putative pyruvate decarboxylase [Oryza sativa Japonica Group]
 dbj|BAF17717.1| Os05g0469600 [Oryza sativa Japonica Group]
 dbj|BAG94713.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94986.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64045.1| hypothetical protein OsJ_18874 [Oryza sativa Japonica Group]
Length=605

 Score =   179 bits (454),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 109/134 (81%), Positives = 117/134 (87%), Gaps = 1/134 (1%)
 Frame = +1

Query  118  KPGSGDVANAPTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLL  297
            KP    V + P +  N V + PV  S+A ATLGRHLARRLVQIG TDVF+VPGDFNLTLL
Sbjct  15   KPSCNSVGSLPVVSSNAVINPPVT-SAAGATLGRHLARRLVQIGATDVFAVPGDFNLTLL  73

Query  298  DHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLP  477
            D+LIAEPGL+LIGCCNELNAGYAADGYARARGVGAC VTFTVGGLSVLNAIAGAYSENLP
Sbjct  74   DYLIAEPGLKLIGCCNELNAGYAADGYARARGVGACAVTFTVGGLSVLNAIAGAYSENLP  133

Query  478  LICIVGGPNSNDYG  519
            +ICIVGGPNSNDYG
Sbjct  134  VICIVGGPNSNDYG  147



>ref|XP_011460964.1| PREDICTED: pyruvate decarboxylase 2-like isoform X1 [Fragaria 
vesca subsp. vesca]
Length=608

 Score =   179 bits (454),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 124/146 (85%), Gaps = 1/146 (1%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTVHSTPVA-FSSAEATLGRHLARRLVQIGVTDV  261
            M T +GS+E  KP + +V   P  G + +   P++  S  ++TLGRHLARRLV+IGV+DV
Sbjct  1    MATGLGSLECIKPTNNNVGCPPQNGASALQDQPLSTISCPDSTLGRHLARRLVEIGVSDV  60

Query  262  FSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVL  441
            FSVPGDFNLTLLDHLIAEPGL  IGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSVL
Sbjct  61   FSVPGDFNLTLLDHLIAEPGLTNIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVL  120

Query  442  NAIAGAYSENLPLICIVGGPNSNDYG  519
            NAIAGAYSENLP+IC+VGGPN+ND+G
Sbjct  121  NAIAGAYSENLPVICVVGGPNTNDFG  146



>ref|XP_007016910.1| Thiamine pyrophosphate dependent pyruvate decarboxylase family 
protein [Theobroma cacao]
 gb|EOY34529.1| Thiamine pyrophosphate dependent pyruvate decarboxylase family 
protein [Theobroma cacao]
Length=605

 Score =   179 bits (453),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 111/148 (75%), Positives = 126/148 (85%), Gaps = 4/148 (3%)
 Frame = +1

Query  85   MDTKIGS-IEACKPGSGDVANAPTIGVNTVHST--PVAFSSAEATLGRHLARRLVQIGVT  255
            MDT IGS +++CKP +  +   P  G  ++  +  P A SS +ATLGRHLA RLV+IGV 
Sbjct  1    MDTNIGSQLDSCKPANSILGCPPQNGSASIQDSHAPSAVSS-DATLGRHLAHRLVEIGVK  59

Query  256  DVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLS  435
            DVFSVPGDFNLTLLDHLIAEPGL+ IGCCNELNAGYAADGYARARGVGACVVTFTVGGLS
Sbjct  60   DVFSVPGDFNLTLLDHLIAEPGLKNIGCCNELNAGYAADGYARARGVGACVVTFTVGGLS  119

Query  436  VLNAIAGAYSENLPLICIVGGPNSNDYG  519
            ++NAIAGAYSENLP+ICIVGGPN+NDYG
Sbjct  120  IINAIAGAYSENLPVICIVGGPNTNDYG  147



>ref|XP_003623318.1| Pyruvate decarboxylase isozyme [Medicago truncatula]
 gb|AES79536.1| pyruvate decarboxylase [Medicago truncatula]
Length=605

 Score =   179 bits (453),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 109/148 (74%), Positives = 122/148 (82%), Gaps = 2/148 (1%)
 Frame = +1

Query  85   MDTKI-GSIEACKPGSGDVANAPTI-GVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTD  258
            MDT + GS++  KP + DV +     G   +  +  A SS  ATLGRHLARRLVQ+GVTD
Sbjct  1    MDTMLLGSLDLTKPTTNDVISCTKPNGTTVIQPSSTAISSTNATLGRHLARRLVQVGVTD  60

Query  259  VFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSV  438
            +FSVPGDFNLTLLD+LI EP L +IGCCNELNAGYAADGYAR+ GVGACVVTFTVGGLSV
Sbjct  61   IFSVPGDFNLTLLDYLIDEPKLNVIGCCNELNAGYAADGYARSCGVGACVVTFTVGGLSV  120

Query  439  LNAIAGAYSENLPLICIVGGPNSNDYGN  522
            LNAIAGAYSENLPLICIVGGPNSNDYG+
Sbjct  121  LNAIAGAYSENLPLICIVGGPNSNDYGS  148



>sp|A2Y5L9.1|PDC1_ORYSI RecName: Full=Pyruvate decarboxylase 1; Short=PDC [Oryza sativa 
Indica Group]
 gb|EAY98379.1| hypothetical protein OsI_20290 [Oryza sativa Indica Group]
Length=605

 Score =   179 bits (453),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 109/134 (81%), Positives = 116/134 (87%), Gaps = 1/134 (1%)
 Frame = +1

Query  118  KPGSGDVANAPTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLL  297
            KP    V + P +  N V   PV  S+A ATLGRHLARRLVQIG TDVF+VPGDFNLTLL
Sbjct  15   KPSCNSVGSLPVVSSNAVIHPPVT-SAAGATLGRHLARRLVQIGATDVFAVPGDFNLTLL  73

Query  298  DHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLP  477
            D+LIAEPGL+LIGCCNELNAGYAADGYARARGVGAC VTFTVGGLSVLNAIAGAYSENLP
Sbjct  74   DYLIAEPGLKLIGCCNELNAGYAADGYARARGVGACAVTFTVGGLSVLNAIAGAYSENLP  133

Query  478  LICIVGGPNSNDYG  519
            +ICIVGGPNSNDYG
Sbjct  134  VICIVGGPNSNDYG  147



>gb|AIE47264.1| pyruvate decarboxylase [Hevea brasiliensis]
Length=588

 Score =   178 bits (452),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 109/135 (81%), Positives = 117/135 (87%), Gaps = 6/135 (4%)
 Frame = +1

Query  115  CKPGSGDVANAPTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTL  294
            C P +G V+       N+V  +P   +S E+TLGRHLARRLVQIG+TDVFSVPGDFNLTL
Sbjct  2    CSPANGAVSTIQ----NSV--SPAVINSTESTLGRHLARRLVQIGITDVFSVPGDFNLTL  55

Query  295  LDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENL  474
            LDHLIAEPGL LIGCCNELNAGYAADGYAR RGVGACVVTFTVGGLSVLNAIAGAYSENL
Sbjct  56   LDHLIAEPGLNLIGCCNELNAGYAADGYARCRGVGACVVTFTVGGLSVLNAIAGAYSENL  115

Query  475  PLICIVGGPNSNDYG  519
            P+ICIVGGPNSNDYG
Sbjct  116  PVICIVGGPNSNDYG  130



>ref|XP_007140235.1| hypothetical protein PHAVU_008G095400g [Phaseolus vulgaris]
 gb|ESW12229.1| hypothetical protein PHAVU_008G095400g [Phaseolus vulgaris]
Length=606

 Score =   178 bits (451),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 112/148 (76%), Positives = 123/148 (83%), Gaps = 3/148 (2%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTVH-STPVAFSSA--EATLGRHLARRLVQIGVT  255
            MDTKIGS++  KP + D+ +        +H S P A  +   ++TLG HLARRLV+IGVT
Sbjct  1    MDTKIGSLDVAKPPTNDLVSCNHANATVIHPSVPSAVINGCGDSTLGGHLARRLVEIGVT  60

Query  256  DVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLS  435
            DVFSVPGDFNLTLLDHLIAEP L +IGCCNELNAGYAADGYARARGVGACVVTFTVGGLS
Sbjct  61   DVFSVPGDFNLTLLDHLIAEPALNVIGCCNELNAGYAADGYARARGVGACVVTFTVGGLS  120

Query  436  VLNAIAGAYSENLPLICIVGGPNSNDYG  519
            VLNAIAGA SENLPLICIVGGPNSNDYG
Sbjct  121  VLNAIAGANSENLPLICIVGGPNSNDYG  148



>ref|XP_009402387.1| PREDICTED: pyruvate decarboxylase 1-like [Musa acuminata subsp. 
malaccensis]
Length=605

 Score =   178 bits (451),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 112/150 (75%), Positives = 124/150 (83%), Gaps = 9/150 (6%)
 Frame = +1

Query  85   MDTKIGSIEAC-KPGSGDVANAPTIGVNTVHSTPVA----FSSAEATLGRHLARRLVQIG  249
            M+TKIGS++A  +  +  V  +P  G    H  P+A     S+ E TLG HLARRLVQ+G
Sbjct  1    METKIGSVDAAVEVKANGVVGSPPAG----HCYPIAPAVQASAPEKTLGSHLARRLVQVG  56

Query  250  VTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGG  429
              DVFS+PGDFNLTLLDHLIAEPGLRLIGCCNELNAGYAADGYARARGVGACVVTFTVGG
Sbjct  57   AHDVFSIPGDFNLTLLDHLIAEPGLRLIGCCNELNAGYAADGYARARGVGACVVTFTVGG  116

Query  430  LSVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            LSVLNAIAGAYSENLP+ICIVGGPNSND+G
Sbjct  117  LSVLNAIAGAYSENLPVICIVGGPNSNDFG  146



>gb|AAG22488.1|AF195868_1 pyruvate decarboxylase 1 [Vitis vinifera]
Length=575

 Score =   177 bits (450),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 104/113 (92%), Positives = 109/113 (96%), Gaps = 0/113 (0%)
 Frame = +1

Query  181  PVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNag  360
            P   SS+EATLGRHLARRLVQIGV+DVFSVPGDFNLTLLDHLIAEPGL+ IGCCNELNAG
Sbjct  5    PSVISSSEATLGRHLARRLVQIGVSDVFSVPGDFNLTLLDHLIAEPGLKNIGCCNELNAG  64

Query  361  yaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            YAADGYAR+RGVGACVVTFTVGGLSVLNAIAGAYSENLP+ICIVGGPNSNDYG
Sbjct  65   YAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSENLPVICIVGGPNSNDYG  117



>ref|XP_002276535.1| PREDICTED: pyruvate decarboxylase 1 isoform X2 [Vitis vinifera]
Length=607

 Score =   177 bits (450),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 111/149 (74%), Positives = 126/149 (85%), Gaps = 4/149 (3%)
 Frame = +1

Query  85   MDTKIGS-IEACKPGSGDVANAPTIG-VNTVHSTPVAF--SSAEATLGRHLARRLVQIGV  252
            MD KIGS +++CKP + DV +AP  G V+T+  +P     + + ATLG H+A RLVQIGV
Sbjct  1    MDNKIGSQLDSCKPANNDVGSAPQNGTVSTIQDSPSPAHPTGSRATLGSHIAHRLVQIGV  60

Query  253  TDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGL  432
             DVFSVPGDFNLTLLD +IAEPGL  IGCCNELNAGYAADGYARARGVGACVVTFTVGGL
Sbjct  61   NDVFSVPGDFNLTLLDCIIAEPGLNNIGCCNELNAGYAADGYARARGVGACVVTFTVGGL  120

Query  433  SVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            S+LNAIAGAYSENLP+ICIVGGPN+NDYG
Sbjct  121  SILNAIAGAYSENLPVICIVGGPNTNDYG  149



>ref|XP_010650884.1| PREDICTED: pyruvate decarboxylase 1 isoform X1 [Vitis vinifera]
Length=611

 Score =   177 bits (449),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 111/149 (74%), Positives = 126/149 (85%), Gaps = 4/149 (3%)
 Frame = +1

Query  85   MDTKIGS-IEACKPGSGDVANAPTIG-VNTVHSTPVAF--SSAEATLGRHLARRLVQIGV  252
            MD KIGS +++CKP + DV +AP  G V+T+  +P     + + ATLG H+A RLVQIGV
Sbjct  1    MDNKIGSQLDSCKPANNDVGSAPQNGTVSTIQDSPSPAHPTGSRATLGSHIAHRLVQIGV  60

Query  253  TDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGL  432
             DVFSVPGDFNLTLLD +IAEPGL  IGCCNELNAGYAADGYARARGVGACVVTFTVGGL
Sbjct  61   NDVFSVPGDFNLTLLDCIIAEPGLNNIGCCNELNAGYAADGYARARGVGACVVTFTVGGL  120

Query  433  SVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            S+LNAIAGAYSENLP+ICIVGGPN+NDYG
Sbjct  121  SILNAIAGAYSENLPVICIVGGPNTNDYG  149



>ref|XP_009399900.1| PREDICTED: pyruvate decarboxylase 2 [Musa acuminata subsp. malaccensis]
Length=607

 Score =   177 bits (449),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 113/149 (76%), Positives = 123/149 (83%), Gaps = 4/149 (3%)
 Frame = +1

Query  85   MDTKIGSIE--ACKPGSGDVANAPTIGVNTV--HSTPVAFSSAEATLGRHLARRLVQIGV  252
            MDT+IGS++  A    +G V   P     +V   +     + AEATLGRHLARRLVQ+G 
Sbjct  1    MDTRIGSVDGAAEAKANGVVGCPPAAQCCSVGPAAPASVAAIAEATLGRHLARRLVQVGA  60

Query  253  TDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGL  432
             DVF+VPGDFNLTLLDHLIAEPGLRLIGCCNELNAGYAADGYAR+RGVGACVVTFTVGGL
Sbjct  61   HDVFAVPGDFNLTLLDHLIAEPGLRLIGCCNELNAGYAADGYARSRGVGACVVTFTVGGL  120

Query  433  SVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            SVLNAIAGAYSENLPLICIVGGPNSNDYG
Sbjct  121  SVLNAIAGAYSENLPLICIVGGPNSNDYG  149



>ref|XP_011071825.1| PREDICTED: pyruvate decarboxylase 1-like [Sesamum indicum]
Length=605

 Score =   177 bits (448),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 112/149 (75%), Positives = 121/149 (81%), Gaps = 6/149 (4%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVA----NAPTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGV  252
            MDT + + E   P + +VA    N     V   H +P A  + +ATLGRH+ARRLVQIGV
Sbjct  1    MDTSLSNPEKINPTNTNVACPAGNGSVSTVQGSHQSPAA--NPDATLGRHVARRLVQIGV  58

Query  253  TDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGL  432
             DVFSVPGDFNLTLLDHLIAEPGL  IGCCNELNAGYAADGYARARGVGACVVTFTVGGL
Sbjct  59   EDVFSVPGDFNLTLLDHLIAEPGLNNIGCCNELNAGYAADGYARARGVGACVVTFTVGGL  118

Query  433  SVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            SVLNAIAGAYSENLPLICIVGGPN+NDYG
Sbjct  119  SVLNAIAGAYSENLPLICIVGGPNTNDYG  147



>dbj|BAC20138.1| pyruvate decarboxylase [Oryza sativa]
 gb|AAT93946.1| putative pyruvate decarboxylase [Oryza sativa Japonica Group]
 gb|EEE64046.1| hypothetical protein OsJ_18875 [Oryza sativa Japonica Group]
Length=605

 Score =   176 bits (447),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 108/134 (81%), Positives = 115/134 (86%), Gaps = 1/134 (1%)
 Frame = +1

Query  118  KPGSGDVANAPTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLL  297
            KP    V + P +    V   PV  S+A ATLGRHLARRLVQIG TDVF+VPGDFNLTLL
Sbjct  15   KPSCDSVGSLPAVSSKAVIHPPVT-SAAGATLGRHLARRLVQIGATDVFAVPGDFNLTLL  73

Query  298  DHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLP  477
            D+LIAEPGL+LIGCCNELNAGYAADGYARARGVGAC VTFTVGGLSVLNAIAGAYSENLP
Sbjct  74   DYLIAEPGLKLIGCCNELNAGYAADGYARARGVGACAVTFTVGGLSVLNAIAGAYSENLP  133

Query  478  LICIVGGPNSNDYG  519
            +ICIVGGPNSNDYG
Sbjct  134  VICIVGGPNSNDYG  147



>gb|EAY98380.1| hypothetical protein OsI_20291 [Oryza sativa Indica Group]
Length=605

 Score =   176 bits (447),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 108/134 (81%), Positives = 115/134 (86%), Gaps = 1/134 (1%)
 Frame = +1

Query  118  KPGSGDVANAPTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLL  297
            KP    V + P +    V   PV  S+A ATLGRHLARRLVQIG TDVF+VPGDFNLTLL
Sbjct  15   KPSCDSVGSLPAVSSKAVIHPPVT-SAAGATLGRHLARRLVQIGATDVFAVPGDFNLTLL  73

Query  298  DHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLP  477
            D+LIAEPGL+LIGCCNELNAGYAADGYARARGVGAC VTFTVGGLSVLNAIAGAYSENLP
Sbjct  74   DYLIAEPGLKLIGCCNELNAGYAADGYARARGVGACAVTFTVGGLSVLNAIAGAYSENLP  133

Query  478  LICIVGGPNSNDYG  519
            +ICIVGGPNSNDYG
Sbjct  134  VICIVGGPNSNDYG  147



>ref|XP_009384923.1| PREDICTED: pyruvate decarboxylase 1-like [Musa acuminata subsp. 
malaccensis]
Length=605

 Score =   176 bits (447),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 111/151 (74%), Positives = 124/151 (82%), Gaps = 11/151 (7%)
 Frame = +1

Query  85   MDTKIGSIEACKP--GSGDVANAPTIGVNTVHSTPVAFSSAEA----TLGRHLARRLVQI  246
            MDT+IGS++A      +G V + PT      H  P+A ++       TLGRHLARRLVQ+
Sbjct  1    MDTRIGSVDAAVETMANGSVGSPPT-----AHCHPIAPAAQAEAAEATLGRHLARRLVQV  55

Query  247  GVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVG  426
            GV DVF+VPGDFNLTLLDHLIAEPGLRL+GCCNELNAGYAADGYARARGVGAC VTFTVG
Sbjct  56   GVHDVFAVPGDFNLTLLDHLIAEPGLRLVGCCNELNAGYAADGYARARGVGACAVTFTVG  115

Query  427  GLSVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            GLSVLNAIAG+YSENLP+ICIVGGPNSNDYG
Sbjct  116  GLSVLNAIAGSYSENLPVICIVGGPNSNDYG  146



>sp|A2XFI3.2|PDC2_ORYSI RecName: Full=Pyruvate decarboxylase 2; Short=PDC [Oryza sativa 
Indica Group]
 gb|EEC75031.1| hypothetical protein OsI_11123 [Oryza sativa Indica Group]
Length=606

 Score =   176 bits (447),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = +1

Query  145  APTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGL  324
            A  +G     + P   S+ EA+LGRHLARRLVQ+GV+DVF+VPGDFNLTLLDHLIAEPGL
Sbjct  24   ASAVGCPMTSARPAPVSAGEASLGRHLARRLVQVGVSDVFAVPGDFNLTLLDHLIAEPGL  83

Query  325  RLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPN  504
            RL+GCCNELNAGYAADGYARARGVGAC VTFTVGGLSVLNAIAGAYSENLP+ICI GGPN
Sbjct  84   RLVGCCNELNAGYAADGYARARGVGACAVTFTVGGLSVLNAIAGAYSENLPVICIAGGPN  143

Query  505  SNDYG  519
            SNDYG
Sbjct  144  SNDYG  148



>ref|NP_001049811.1| Os03g0293500 [Oryza sativa Japonica Group]
 sp|Q10MW3.1|PDC2_ORYSJ RecName: Full=Pyruvate decarboxylase 2; Short=PDC [Oryza sativa 
Japonica Group]
 gb|ABF95411.1| Pyruvate decarboxylase isozyme 2, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF11725.1| Os03g0293500 [Oryza sativa Japonica Group]
 gb|ACA50507.1| pyruvate decarboxylase isozyme 2 [Oryza sativa Japonica Group]
 dbj|BAG95142.1| unnamed protein product [Oryza sativa Japonica Group]
Length=605

 Score =   176 bits (447),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = +1

Query  145  APTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGL  324
            A  +G     + P   S+ EA+LGRHLARRLVQ+GV+DVF+VPGDFNLTLLDHLIAEPGL
Sbjct  24   ASAVGCPMTSARPAPVSAGEASLGRHLARRLVQVGVSDVFAVPGDFNLTLLDHLIAEPGL  83

Query  325  RLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPN  504
            RL+GCCNELNAGYAADGYARARGVGAC VTFTVGGLSVLNAIAGAYSENLP+ICI GGPN
Sbjct  84   RLVGCCNELNAGYAADGYARARGVGACAVTFTVGGLSVLNAIAGAYSENLPVICIAGGPN  143

Query  505  SNDYG  519
            SNDYG
Sbjct  144  SNDYG  148



>ref|XP_010034573.1| PREDICTED: pyruvate decarboxylase 1-like [Eucalyptus grandis]
Length=609

 Score =   176 bits (447),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 106/156 (68%), Positives = 123/156 (79%), Gaps = 8/156 (5%)
 Frame = +1

Query  61   LNCSFVAVMDTKIGSIE---ACKPGSGDVANAPTIGVNTVHSTPVAFSSAEATLGRHLAR  231
            ++C   + MD+     +   AC P +G  +      + + H+     SS+EATLGRHLAR
Sbjct  1    MDCMVASPMDSSTPGADDHLACPPANGKCS-----PIQSSHAPSAPASSSEATLGRHLAR  55

Query  232  RLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVV  411
            RLV+IGV DVFSVPGDFNLTLLDHLIAEPGL  +GCCNELNAGYAADGYARARGV ACVV
Sbjct  56   RLVEIGVADVFSVPGDFNLTLLDHLIAEPGLNNVGCCNELNAGYAADGYARARGVSACVV  115

Query  412  TFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            TFTVGGLS++NAIAGAYSENLP+ICIVGGPN+NDYG
Sbjct  116  TFTVGGLSIINAIAGAYSENLPIICIVGGPNTNDYG  151



>ref|XP_002272615.1| PREDICTED: pyruvate decarboxylase 2 [Vitis vinifera]
 emb|CBI18254.3| unnamed protein product [Vitis vinifera]
Length=605

 Score =   176 bits (447),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 114/148 (77%), Positives = 125/148 (84%), Gaps = 4/148 (3%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNT---VHSTPVAFSSAEATLGRHLARRLVQIGVT  255
            MDTKI   +A  P + +V   P+ G+ +       P   SS+EATLGRHLARRLVQIGV+
Sbjct  1    MDTKISVTDASVPTNSNVG-CPSNGIVSSILSSVPPSVISSSEATLGRHLARRLVQIGVS  59

Query  256  DVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLS  435
            DVFSVPGDFNLTLLDHLIAEPGL+ IGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLS
Sbjct  60   DVFSVPGDFNLTLLDHLIAEPGLKNIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLS  119

Query  436  VLNAIAGAYSENLPLICIVGGPNSNDYG  519
            VLNAIAGAYSENLP+ICIVGGPNSNDYG
Sbjct  120  VLNAIAGAYSENLPVICIVGGPNSNDYG  147



>ref|XP_008775407.1| PREDICTED: pyruvate decarboxylase 2-like [Phoenix dactylifera]
Length=606

 Score =   176 bits (446),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 107/148 (72%), Positives = 124/148 (84%), Gaps = 3/148 (2%)
 Frame = +1

Query  85   MDTKIGSIEAC--KPGSGDVANAPTIGVN-TVHSTPVAFSSAEATLGRHLARRLVQIGVT  255
            M+TK+G ++A   +P +G V + P    +  V +TP +  +   TLGRHLARRLV++GV+
Sbjct  1    METKVGLVDATGKRPANGAVDSPPETPFHPIVPATPASGVATMGTLGRHLARRLVEVGVS  60

Query  256  DVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLS  435
            D F+VPGDFNLTLLDHLI EPGLR IGCCNELNAGYAADGYARARGVGACVVTFTVGGLS
Sbjct  61   DFFAVPGDFNLTLLDHLIEEPGLRFIGCCNELNAGYAADGYARARGVGACVVTFTVGGLS  120

Query  436  VLNAIAGAYSENLPLICIVGGPNSNDYG  519
            VLNAIAGAYSENLP+ICIVGGPNSND+G
Sbjct  121  VLNAIAGAYSENLPVICIVGGPNSNDFG  148



>ref|XP_010040425.1| PREDICTED: pyruvate decarboxylase 1-like, partial [Eucalyptus 
grandis]
Length=240

 Score =   167 bits (424),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 108/148 (73%), Positives = 120/148 (81%), Gaps = 5/148 (3%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTV---HSTPVAFSSAEATLGRHLARRLVQIGVT  255
            +D  +GS+E     S  VA  P  GV ++     +  A   +EATLG HLARRLV+IGV 
Sbjct  40   LDAHVGSLETSTLPS-KVAR-PHNGVASIVQPSYSIAALGPSEATLGYHLARRLVEIGVG  97

Query  256  DVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLS  435
            DVFSVPGDFNL+LLDHL+ EPGL LIGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLS
Sbjct  98   DVFSVPGDFNLSLLDHLVTEPGLNLIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLS  157

Query  436  VLNAIAGAYSENLPLICIVGGPNSNDYG  519
            V+NAIAGAYSENLPLICIVGGPNSNDYG
Sbjct  158  VINAIAGAYSENLPLICIVGGPNSNDYG  185



>gb|EYU42548.1| hypothetical protein MIMGU_mgv1a003111mg [Erythranthe guttata]
Length=607

 Score =   174 bits (442),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 110/149 (74%), Positives = 129/149 (87%), Gaps = 4/149 (3%)
 Frame = +1

Query  85   MDTKIGSIEAC-KPGSGDVA-NAPTIGVNTVHSTPVAFSSA--EATLGRHLARRLVQIGV  252
            M+T + +I++  KP +G++   A +  V+TVH +    SSA  EATLGRH+ARRLVQIGV
Sbjct  1    METVLSAIDSSSKPSNGNLGCPAGSRAVSTVHDSSHVPSSAAPEATLGRHVARRLVQIGV  60

Query  253  TDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGL  432
            +DVF+VPGDFNLTLLDHLIAEPGL  +GCCNELNAGYAADGYARARGVGACVVTFTVGGL
Sbjct  61   SDVFTVPGDFNLTLLDHLIAEPGLNNVGCCNELNAGYAADGYARARGVGACVVTFTVGGL  120

Query  433  SVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            S+LNA+AGAYSENLP+ICIVGGPN+NDYG
Sbjct  121  SLLNAVAGAYSENLPVICIVGGPNTNDYG  149



>gb|KCW52500.1| hypothetical protein EUGRSUZ_J01896 [Eucalyptus grandis]
Length=601

 Score =   174 bits (441),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 103/136 (76%), Positives = 115/136 (85%), Gaps = 5/136 (4%)
 Frame = +1

Query  112  ACKPGSGDVANAPTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLT  291
            AC P +G  +      + + H+     SS+EATLGRHLARRLV+IGV DVFSVPGDFNLT
Sbjct  13   ACPPANGKCS-----PIQSSHAPSAPASSSEATLGRHLARRLVEIGVADVFSVPGDFNLT  67

Query  292  LLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSEN  471
            LLDHLIAEPGL  +GCCNELNAGYAADGYARARGV ACVVTFTVGGLS++NAIAGAYSEN
Sbjct  68   LLDHLIAEPGLNNVGCCNELNAGYAADGYARARGVSACVVTFTVGGLSIINAIAGAYSEN  127

Query  472  LPLICIVGGPNSNDYG  519
            LP+ICIVGGPN+NDYG
Sbjct  128  LPIICIVGGPNTNDYG  143



>gb|EMT15339.1| hypothetical protein F775_43983 [Aegilops tauschii]
Length=605

 Score =   174 bits (441),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 110/150 (73%), Positives = 123/150 (82%), Gaps = 8/150 (5%)
 Frame = +1

Query  85   MDTKIGSIEACKPGS-----GDVANAPTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIG  249
            MDT +GS++   P +     G  A+AP  G   + S PV  S+ EA+LGRHLARRLVQ+G
Sbjct  1    MDTHVGSVDGPSPAAVNGAVGCPASAP--GCPIMSSHPVV-SAGEASLGRHLARRLVQVG  57

Query  250  VTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGG  429
            V+DVF+VPGDFNLTLLDHL+ EPGLRLIGCCN  NAGYAADGYARARGVGAC VTFTVGG
Sbjct  58   VSDVFAVPGDFNLTLLDHLVDEPGLRLIGCCNAPNAGYAADGYARARGVGACAVTFTVGG  117

Query  430  LSVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            LSVLNAIAGAYSENLP+ICI GGPNSNDYG
Sbjct  118  LSVLNAIAGAYSENLPVICIAGGPNSNDYG  147



>gb|AIE47265.1| pyruvate decarboxylase [Hevea brasiliensis]
Length=588

 Score =   174 bits (440),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 106/135 (79%), Positives = 117/135 (87%), Gaps = 6/135 (4%)
 Frame = +1

Query  115  CKPGSGDVANAPTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTL  294
            C P +G ++       N+V  +P  F+S ++TLGRHLARRLVQIG+ DVFSVPGDFNLTL
Sbjct  2    CSPANGAISTIQ----NSV--SPTVFNSPDSTLGRHLARRLVQIGINDVFSVPGDFNLTL  55

Query  295  LDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENL  474
            LDHLIAEPGL LIGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSVLNAIAGAYSENL
Sbjct  56   LDHLIAEPGLNLIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSENL  115

Query  475  PLICIVGGPNSNDYG  519
            P+ICIVGGPNSND G
Sbjct  116  PVICIVGGPNSNDNG  130



>gb|KHN22554.1| Pyruvate decarboxylase isozyme 2 [Glycine soja]
Length=603

 Score =   174 bits (440),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 104/137 (76%), Positives = 118/137 (86%), Gaps = 2/137 (1%)
 Frame = +1

Query  115  CKPGSGDVANAPTIGVNTVHST--PVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNL  288
            CK G+ DV   P   V+ + ++    A +S++ATLGRHLARRLVQ+GV DVFSVPGDFNL
Sbjct  9    CKSGNSDVGCPPNGTVSVIKNSVPATAITSSDATLGRHLARRLVQVGVKDVFSVPGDFNL  68

Query  289  TLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSE  468
            TLLDHLIAEP L+ +GCCNELNAGYAADGYAR RGVGACVVTFTVGGLSV+NAIAGAYSE
Sbjct  69   TLLDHLIAEPQLKNVGCCNELNAGYAADGYARCRGVGACVVTFTVGGLSVINAIAGAYSE  128

Query  469  NLPLICIVGGPNSNDYG  519
            NLPLICIVGGPN+ND+G
Sbjct  129  NLPLICIVGGPNTNDFG  145



>ref|XP_008654188.1| PREDICTED: pyruvate decarboxylase 3-like [Zea mays]
 tpg|DAA64245.1| TPA: hypothetical protein ZEAMMB73_651726 [Zea mays]
Length=609

 Score =   174 bits (440),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 106/150 (71%), Positives = 123/150 (82%), Gaps = 5/150 (3%)
 Frame = +1

Query  85   MDTK--IGSIEACKPGSGDVANAPTIGVNTVHSTPVAFSS---AEATLGRHLARRLVQIG  249
            MDT   +GS++  +P +      P  GV+   ++          +ATLGRHLARRLVQ+G
Sbjct  1    MDTSGIVGSVDGHRPAASGAVACPASGVSGFITSTGGGGEPPPRDATLGRHLARRLVQVG  60

Query  250  VTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGG  429
            V+DVF+VPGDFNLTLLDHLIAEPGLR++GCCNELNAGYAADGYARARGVGACVVTFTVGG
Sbjct  61   VSDVFAVPGDFNLTLLDHLIAEPGLRVVGCCNELNAGYAADGYARARGVGACVVTFTVGG  120

Query  430  LSVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            LSVLNAIAGAYSENLP++C+VGGPNSNDYG
Sbjct  121  LSVLNAIAGAYSENLPVVCVVGGPNSNDYG  150



>gb|ABJ99596.1| pyruvate decarboxylase [Lycoris aurea]
Length=605

 Score =   172 bits (437),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 119/147 (81%), Gaps = 2/147 (1%)
 Frame = +1

Query  85   MDTKIGSIEACKPG-SGDVANAPTIGVNTVHS-TPVAFSSAEATLGRHLARRLVQIGVTD  258
            M+T IGS++A KP  +G V + P+   + +    P A   +E TLG H+ARRLVQ+GV D
Sbjct  1    METSIGSVDAAKPAPNGMVGSPPSATAHPITPCLPAAAIPSECTLGGHVARRLVQVGVRD  60

Query  259  VFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSV  438
             F VPGDFNLTLLDHLIAEPGL  +GCCNELNAGYAADGYARA GVGACVVTFTVGGLSV
Sbjct  61   FFGVPGDFNLTLLDHLIAEPGLNYVGCCNELNAGYAADGYARAHGVGACVVTFTVGGLSV  120

Query  439  LNAIAGAYSENLPLICIVGGPNSNDYG  519
            LNAIAGAYSENLPLICI GGPNSND+G
Sbjct  121  LNAIAGAYSENLPLICIAGGPNSNDFG  147



>ref|XP_003520410.1| PREDICTED: pyruvate decarboxylase 1-like [Glycine max]
Length=603

 Score =   172 bits (436),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 103/137 (75%), Positives = 117/137 (85%), Gaps = 2/137 (1%)
 Frame = +1

Query  115  CKPGSGDVANAPTIGVNTVHST--PVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNL  288
            CK G+ DV   P   V+ + ++    A +S++ATLGRHLARRLVQ+GV DVFSVPGDFNL
Sbjct  9    CKSGNSDVGCPPNGTVSVIKNSVPATAITSSDATLGRHLARRLVQVGVKDVFSVPGDFNL  68

Query  289  TLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSE  468
            TLLDHLIAEP L+ +GCCNELNAGYAADGYAR RGVGAC VTFTVGGLSV+NAIAGAYSE
Sbjct  69   TLLDHLIAEPQLKNVGCCNELNAGYAADGYARCRGVGACAVTFTVGGLSVINAIAGAYSE  128

Query  469  NLPLICIVGGPNSNDYG  519
            NLPLICIVGGPN+ND+G
Sbjct  129  NLPLICIVGGPNTNDFG  145



>gb|AIE47263.1| pyruvate decarboxylase [Hevea brasiliensis]
Length=589

 Score =   172 bits (435),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 101/113 (89%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = +1

Query  181  PVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNag  360
            PV  S+   TLGRHLARRLV+IGV+DVFSVPGDFNLTLLDHLIAEPGL +IGCCNELNAG
Sbjct  19   PVPGSACTGTLGRHLARRLVEIGVSDVFSVPGDFNLTLLDHLIAEPGLNVIGCCNELNAG  78

Query  361  yaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            YAADGYAR+RGVGACVVTFTVGGLSV+NAIAGAYSENLPLICIVGGPNSNDYG
Sbjct  79   YAADGYARSRGVGACVVTFTVGGLSVINAIAGAYSENLPLICIVGGPNSNDYG  131



>ref|XP_011096418.1| PREDICTED: pyruvate decarboxylase 1 [Sesamum indicum]
Length=585

 Score =   171 bits (434),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 101/113 (89%), Positives = 105/113 (93%), Gaps = 0/113 (0%)
 Frame = +1

Query  181  PVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNag  360
            PV   S+  TLGRHLARRLVQIGV DVFSVPGDFNLTLLDHLI EPGL L+GCCNELNAG
Sbjct  15   PVPAISSSGTLGRHLARRLVQIGVRDVFSVPGDFNLTLLDHLIEEPGLNLVGCCNELNAG  74

Query  361  yaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            YAADGYARA+GVGACVVTFTVGGLSVLNAIAGAYSENLP+ICIVGGPNSNDYG
Sbjct  75   YAADGYARAKGVGACVVTFTVGGLSVLNAIAGAYSENLPVICIVGGPNSNDYG  127



>gb|KCW49436.1| hypothetical protein EUGRSUZ_K02968 [Eucalyptus grandis]
Length=616

 Score =   171 bits (434),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 110/149 (74%), Positives = 123/149 (83%), Gaps = 5/149 (3%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTV---HSTPVAFSSAEATLGRHLARRLVQIGVT  255
            +D  +GS+E     S  VA  P  GV ++     + VA   +EATLG HLARRLV+IGV 
Sbjct  40   LDAHVGSLETSALSS-KVAR-PHNGVASIVQPSCSIVALGPSEATLGSHLARRLVEIGVG  97

Query  256  DVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLS  435
            DVFSVPGDFNL+LLDHL+AEPGL LIGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLS
Sbjct  98   DVFSVPGDFNLSLLDHLLAEPGLNLIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLS  157

Query  436  VLNAIAGAYSENLPLICIVGGPNSNDYGN  522
            V+NAIAGAYSENLPLICIVGGPNSNDYG+
Sbjct  158  VINAIAGAYSENLPLICIVGGPNSNDYGS  186



>emb|CDO99368.1| unnamed protein product [Coffea canephora]
Length=610

 Score =   171 bits (433),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 106/152 (70%), Positives = 115/152 (76%), Gaps = 7/152 (5%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTVHST-------PVAFSSAEATLGRHLARRLVQ  243
            MD+ +  I++CKP        P    N            P      EATLGRH+A RLV+
Sbjct  1    MDSILSPIDSCKPAENKNVGCPATNGNVSAVEASSSSHPPSMIVGPEATLGRHIAHRLVE  60

Query  244  IGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTV  423
            IGV D+FSVPGDFNLTLLDHLIAEPGL  IGCCNELNAGYAADGYARARGVGACVVTFTV
Sbjct  61   IGVNDIFSVPGDFNLTLLDHLIAEPGLNNIGCCNELNAGYAADGYARARGVGACVVTFTV  120

Query  424  GGLSVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            GGLSVLNAIAGAYSENLP+ICIVGGPN+NDYG
Sbjct  121  GGLSVLNAIAGAYSENLPVICIVGGPNTNDYG  152



>ref|XP_010039167.1| PREDICTED: pyruvate decarboxylase 1-like [Eucalyptus grandis]
 gb|KCW49437.1| hypothetical protein EUGRSUZ_K02968 [Eucalyptus grandis]
Length=644

 Score =   171 bits (434),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 110/149 (74%), Positives = 123/149 (83%), Gaps = 5/149 (3%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTV---HSTPVAFSSAEATLGRHLARRLVQIGVT  255
            +D  +GS+E     S  VA  P  GV ++     + VA   +EATLG HLARRLV+IGV 
Sbjct  40   LDAHVGSLETSALSS-KVAR-PHNGVASIVQPSCSIVALGPSEATLGSHLARRLVEIGVG  97

Query  256  DVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLS  435
            DVFSVPGDFNL+LLDHL+AEPGL LIGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLS
Sbjct  98   DVFSVPGDFNLSLLDHLLAEPGLNLIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLS  157

Query  436  VLNAIAGAYSENLPLICIVGGPNSNDYGN  522
            V+NAIAGAYSENLPLICIVGGPNSNDYG+
Sbjct  158  VINAIAGAYSENLPLICIVGGPNSNDYGS  186



>gb|KDP21067.1| hypothetical protein JCGZ_21538 [Jatropha curcas]
Length=589

 Score =   171 bits (432),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 101/112 (90%), Positives = 106/112 (95%), Gaps = 0/112 (0%)
 Frame = +1

Query  184  VAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagy  363
            VA  +   TLGRHLARRLV+IGV+DVFSVPGDFNLTLLDHLIAEPGL L+GCCNELNAGY
Sbjct  20   VAGKTCSGTLGRHLARRLVEIGVSDVFSVPGDFNLTLLDHLIAEPGLNLVGCCNELNAGY  79

Query  364  aadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            AADGYARARGVGACVVTFTVGGLSVLNAIAGAYSENLP+ICIVGGPNSNDYG
Sbjct  80   AADGYARARGVGACVVTFTVGGLSVLNAIAGAYSENLPVICIVGGPNSNDYG  131



>gb|ABJ99597.1| pyruvate decarboxylase [Lycoris aurea]
Length=605

 Score =   171 bits (432),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 105/149 (70%), Positives = 117/149 (79%), Gaps = 6/149 (4%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTVHST----PVAFSSAEATLGRHLARRLVQIGV  252
            M+T IGS++A KP    +  +P    +T H      P A   +E TLG H+ARRLVQ+GV
Sbjct  1    METSIGSVDAAKPAPNGMVGSPP--SSTAHPITPCLPAAAIPSECTLGGHVARRLVQVGV  58

Query  253  TDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGL  432
             D F VPGDFNLTLLDHLIAEPGL  +GCCNELNAGYAADGYARA GVGACVVTFTVGGL
Sbjct  59   RDFFGVPGDFNLTLLDHLIAEPGLNYVGCCNELNAGYAADGYARAHGVGACVVTFTVGGL  118

Query  433  SVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            SVLNAIAGAYSENLPLICI GGPNS+D+G
Sbjct  119  SVLNAIAGAYSENLPLICIAGGPNSSDFG  147



>gb|AIE47262.1| pyruvate decarboxylase [Hevea brasiliensis]
Length=589

 Score =   170 bits (431),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 103/117 (88%), Positives = 110/117 (94%), Gaps = 2/117 (2%)
 Frame = +1

Query  175  STP--VAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNE  348
            STP  V  S++  TLGRHLARRLV+IGV+DVFSVPGDFNLTLLDHLIAEPGL LIGCCNE
Sbjct  15   STPARVPGSASTGTLGRHLARRLVEIGVSDVFSVPGDFNLTLLDHLIAEPGLNLIGCCNE  74

Query  349  LNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            LNAGYAADGYAR+RGVGACVVTFTVGGLSV+NAIAGAYSENLP+ICIVGGPNSNDYG
Sbjct  75   LNAGYAADGYARSRGVGACVVTFTVGGLSVINAIAGAYSENLPVICIVGGPNSNDYG  131



>ref|XP_004506726.1| PREDICTED: pyruvate decarboxylase isozyme 2-like [Cicer arietinum]
Length=605

 Score =   171 bits (432),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 121/147 (82%), Gaps = 2/147 (1%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTVHSTPVAFSSAEATLGR--HLARRLVQIGVTD  258
            MDT +GS+EACKP   D+A      V+T+  +  + S + +      HLARRLV++G+TD
Sbjct  1    MDTNLGSLEACKPTCNDIACPQDGKVSTIQKSVSSQSLSSSESTLGSHLARRLVEVGITD  60

Query  259  VFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSV  438
            VF+VPGDFNLTLLDHLIAEP L+ IGCCNELNAGYAADGYAR +GVGACVVTFTVGGLSV
Sbjct  61   VFTVPGDFNLTLLDHLIAEPKLKNIGCCNELNAGYAADGYARCKGVGACVVTFTVGGLSV  120

Query  439  LNAIAGAYSENLPLICIVGGPNSNDYG  519
            +NAIAGAYSENLP+ICIVGGPNSND+G
Sbjct  121  INAIAGAYSENLPVICIVGGPNSNDFG  147



>gb|KJB57438.1| hypothetical protein B456_009G164100 [Gossypium raimondii]
Length=408

 Score =   167 bits (423),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 99/113 (88%), Positives = 105/113 (93%), Gaps = 0/113 (0%)
 Frame = +1

Query  181  PVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNag  360
            PV   ++  TLGRHLARRLV+IGV DVFSVPGDFNLTLLDHLIAEP L L+GCCNELNAG
Sbjct  19   PVRGDASSGTLGRHLARRLVEIGVKDVFSVPGDFNLTLLDHLIAEPELNLVGCCNELNAG  78

Query  361  yaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            YAADGYARA+GVGACVVTFTVGGLSVLNAIAGAYSENLP+ICIVGGPNSNDYG
Sbjct  79   YAADGYARAKGVGACVVTFTVGGLSVLNAIAGAYSENLPVICIVGGPNSNDYG  131



>ref|XP_006350849.1| PREDICTED: pyruvate decarboxylase 2-like [Solanum tuberosum]
Length=613

 Score =   170 bits (431),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 102/129 (79%), Positives = 114/129 (88%), Gaps = 1/129 (1%)
 Frame = +1

Query  133  DVANAPTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIA  312
            D AN  T  +   HS+ V  +S +ATLGRHLARRL++IGV DVFSVPGDFNLTLLDHLIA
Sbjct  2    DNANGTTSCIQNSHSSSV-IASPDATLGRHLARRLLEIGVEDVFSVPGDFNLTLLDHLIA  60

Query  313  EPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIV  492
            EP L+ +GCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSV+NAIAGAYSENLP+ICIV
Sbjct  61   EPRLKNVGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVINAIAGAYSENLPIICIV  120

Query  493  GGPNSNDYG  519
            GGPN+NDYG
Sbjct  121  GGPNTNDYG  129



>gb|AAA68290.1| pyruvate decarboxylase 1 [Oryza sativa Indica Group]
 gb|AAC49442.1| pyruvate decarboxylase [Oryza sativa Indica Group]
Length=602

 Score =   170 bits (430),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 93/134 (69%), Positives = 101/134 (75%), Gaps = 3/134 (2%)
 Frame = +1

Query  118  KPGSGDVANAPTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLL  297
            KP    V + P +  N V   PV  S+A ATLGRHLARRLVQIG TDVF+VPGDFNLTLL
Sbjct  15   KPSCNSVGSLPVVSSNAVIHPPVT-SAARATLGRHLARRLVQIGATDVFAVPGDFNLTLL  73

Query  298  DHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLP  477
            D+LIAEPGL+LI CCNELN          AR +    VTFTVGGLSVLNAIAGAYSENLP
Sbjct  74   DYLIAEPGLKLIACCNELN--AGYAADGYARALVGAFVTFTVGGLSVLNAIAGAYSENLP  131

Query  478  LICIVGGPNSNDYG  519
            +ICIVGGPNSNDYG
Sbjct  132  VICIVGGPNSNDYG  145



>ref|XP_009607456.1| PREDICTED: pyruvate decarboxylase 1 [Nicotiana tomentosiformis]
Length=578

 Score =   169 bits (429),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 102/116 (88%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  172  HSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNEL  351
            +S P +      TLGRHLARRLVQIGV DVFSVPGDFNLTLLDHLIAEP L LIGCCNEL
Sbjct  5    NSVPASSPCGIGTLGRHLARRLVQIGVKDVFSVPGDFNLTLLDHLIAEPELNLIGCCNEL  64

Query  352  NagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            NAGYAADGYARA+GVGACVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYG
Sbjct  65   NAGYAADGYARAKGVGACVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYG  120



>sp|A2YQ76.2|PDC3_ORYSI RecName: Full=Pyruvate decarboxylase 3; Short=PDC [Oryza sativa 
Indica Group]
Length=587

 Score =   169 bits (429),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 99/109 (91%), Positives = 105/109 (96%), Gaps = 0/109 (0%)
 Frame = +1

Query  193  SSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaad  372
            SS +ATLG HLARRLVQ+GV+DVF+VPGDFNLTLLDHLIAEPGLR++GCCNELNAGYAAD
Sbjct  20   SSGDATLGGHLARRLVQVGVSDVFAVPGDFNLTLLDHLIAEPGLRVVGCCNELNAGYAAD  79

Query  373  gyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            GYARARGVGAC VTFTVGGLSVLNAI GAYSENLPLICIVGGPNSNDYG
Sbjct  80   GYARARGVGACAVTFTVGGLSVLNAIGGAYSENLPLICIVGGPNSNDYG  128



>ref|XP_009801931.1| PREDICTED: pyruvate decarboxylase 1 isoform X1 [Nicotiana sylvestris]
 ref|XP_009801932.1| PREDICTED: pyruvate decarboxylase 1 isoform X2 [Nicotiana sylvestris]
Length=578

 Score =   169 bits (429),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 101/116 (87%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  172  HSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNEL  351
            +S P +      TLGRHLARRLVQIGV DVFSVPGDFNLTLLDHLIAEP L LIGCCNEL
Sbjct  5    NSVPASSPCGIGTLGRHLARRLVQIGVKDVFSVPGDFNLTLLDHLIAEPELNLIGCCNEL  64

Query  352  NagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            NAGY+ADGYARA+GVGACVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYG
Sbjct  65   NAGYSADGYARAKGVGACVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYG  120



>ref|NP_001060727.1| Os07g0693100 [Oryza sativa Japonica Group]
 sp|Q0D3D2.1|PDC3_ORYSJ RecName: Full=Pyruvate decarboxylase 3; Short=PDC [Oryza sativa 
Japonica Group]
 dbj|BAC75566.1| pyruvate decarboxylase isozyme 3 [Oryza sativa Japonica Group]
 dbj|BAC77042.1| pyruvate decarboxylase 3 [Oryza sativa Japonica Group]
 dbj|BAF22641.1| Os07g0693100 [Oryza sativa Japonica Group]
 dbj|BAG94604.1| unnamed protein product [Oryza sativa Japonica Group]
Length=587

 Score =   169 bits (429),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 99/109 (91%), Positives = 105/109 (96%), Gaps = 0/109 (0%)
 Frame = +1

Query  193  SSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaad  372
            SS +ATLG HLARRLVQ+GV+DVF+VPGDFNLTLLDHLIAEPGLR++GCCNELNAGYAAD
Sbjct  20   SSGDATLGGHLARRLVQVGVSDVFAVPGDFNLTLLDHLIAEPGLRVVGCCNELNAGYAAD  79

Query  373  gyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            GYARARGVGAC VTFTVGGLSVLNAI GAYSENLPLICIVGGPNSNDYG
Sbjct  80   GYARARGVGACAVTFTVGGLSVLNAIGGAYSENLPLICIVGGPNSNDYG  128



>gb|KCW44287.1| hypothetical protein EUGRSUZ_L02272 [Eucalyptus grandis]
Length=468

 Score =   168 bits (425),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 120/149 (81%), Gaps = 5/149 (3%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAPTIGVNTV---HSTPVAFSSAEATLGRHLARRLVQIGVT  255
            +D  +GS+E     S  VA  P  GV ++     +  A   +EATLG HLARRLV+IGV 
Sbjct  40   LDAHVGSLETSTLPS-KVAR-PHNGVASIVQPSYSIAALGPSEATLGYHLARRLVEIGVG  97

Query  256  DVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLS  435
            DVFSVPGDFNL+LLDHL+ EPGL LIGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLS
Sbjct  98   DVFSVPGDFNLSLLDHLVTEPGLNLIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLS  157

Query  436  VLNAIAGAYSENLPLICIVGGPNSNDYGN  522
            V+NAIAGAYSENLPLICIVGGPNSNDYG 
Sbjct  158  VINAIAGAYSENLPLICIVGGPNSNDYGR  186



>ref|XP_004232952.1| PREDICTED: pyruvate decarboxylase 1 [Solanum lycopersicum]
Length=587

 Score =   169 bits (429),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 101/115 (88%), Positives = 104/115 (90%), Gaps = 0/115 (0%)
 Frame = +1

Query  175  STPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELN  354
            S P +      TLGRHLARRLVQIGV DVFSVPGDFNLTLLDHLIAEP L LIGCCNELN
Sbjct  15   SVPASSPCGAGTLGRHLARRLVQIGVKDVFSVPGDFNLTLLDHLIAEPELNLIGCCNELN  74

Query  355  agyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            AGYAADGYARA+GVGACVVTFTVGGLSVLNAIAGAYSENLP+ICIVGGPNSNDYG
Sbjct  75   AGYAADGYARAKGVGACVVTFTVGGLSVLNAIAGAYSENLPVICIVGGPNSNDYG  129



>ref|XP_004134669.1| PREDICTED: pyruvate decarboxylase isozyme 1-like [Cucumis sativus]
 ref|XP_004155547.1| PREDICTED: pyruvate decarboxylase isozyme 1-like [Cucumis sativus]
 gb|KGN49289.1| Pyruvate decarboxylase [Cucumis sativus]
Length=589

 Score =   169 bits (429),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 100/115 (87%), Positives = 108/115 (94%), Gaps = 0/115 (0%)
 Frame = +1

Query  175  STPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELN  354
            S PVA +++  TLG HLARRLV+IGV+DVFSVPGDFNLTLLDHLI+EP L LIGCCNELN
Sbjct  17   SVPVAPNASSGTLGSHLARRLVEIGVSDVFSVPGDFNLTLLDHLISEPQLNLIGCCNELN  76

Query  355  agyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            AGYAADGYARA+GVGACVVTFTVGGLSVLNAIAGAYSENLP+ICIVGGPNSNDYG
Sbjct  77   AGYAADGYARAKGVGACVVTFTVGGLSVLNAIAGAYSENLPVICIVGGPNSNDYG  131



>ref|XP_010448857.1| PREDICTED: pyruvate decarboxylase 2-like, partial [Camelina sativa]
Length=644

 Score =   170 bits (430),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 103/117 (88%), Positives = 110/117 (94%), Gaps = 2/117 (2%)
 Frame = +1

Query  169  VHSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNE  348
            +HST +  S  +ATLGR+LARRLV+IGVTDVFSVPGDFNLTLLDHLIAEP L+LIGCCNE
Sbjct  72   LHSTTI--SPCDATLGRYLARRLVEIGVTDVFSVPGDFNLTLLDHLIAEPDLKLIGCCNE  129

Query  349  LNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            LNAGYAADGYAR+RGVGACVVTFTVGGLSVLNAIAGA SENLPLICIVGGPNSNDYG
Sbjct  130  LNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGANSENLPLICIVGGPNSNDYG  186



>ref|XP_010279076.1| PREDICTED: pyruvate decarboxylase 1-like [Nelumbo nucifera]
Length=589

 Score =   169 bits (428),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 98/109 (90%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = +1

Query  193  SSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaad  372
            SS+  TLGRHLARRLVQIG+ DVFSVPGDFNLTLLDHL+AEP L LIGCCNELNAGYAAD
Sbjct  23   SSSSGTLGRHLARRLVQIGIHDVFSVPGDFNLTLLDHLVAEPELSLIGCCNELNAGYAAD  82

Query  373  gyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            GYARA+GVGACVVTFTVGGLSVLNA+AGAYSENLP+ICIVGGPNSNDYG
Sbjct  83   GYARAKGVGACVVTFTVGGLSVLNAVAGAYSENLPVICIVGGPNSNDYG  131



>gb|KJB57437.1| hypothetical protein B456_009G164100 [Gossypium raimondii]
Length=537

 Score =   168 bits (426),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 99/113 (88%), Positives = 105/113 (93%), Gaps = 0/113 (0%)
 Frame = +1

Query  181  PVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNag  360
            PV   ++  TLGRHLARRLV+IGV DVFSVPGDFNLTLLDHLIAEP L L+GCCNELNAG
Sbjct  19   PVRGDASSGTLGRHLARRLVEIGVKDVFSVPGDFNLTLLDHLIAEPELNLVGCCNELNAG  78

Query  361  yaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            YAADGYARA+GVGACVVTFTVGGLSVLNAIAGAYSENLP+ICIVGGPNSNDYG
Sbjct  79   YAADGYARAKGVGACVVTFTVGGLSVLNAIAGAYSENLPVICIVGGPNSNDYG  131



>gb|KJB57436.1| hypothetical protein B456_009G164100 [Gossypium raimondii]
Length=539

 Score =   168 bits (425),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 99/113 (88%), Positives = 105/113 (93%), Gaps = 0/113 (0%)
 Frame = +1

Query  181  PVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNag  360
            PV   ++  TLGRHLARRLV+IGV DVFSVPGDFNLTLLDHLIAEP L L+GCCNELNAG
Sbjct  19   PVRGDASSGTLGRHLARRLVEIGVKDVFSVPGDFNLTLLDHLIAEPELNLVGCCNELNAG  78

Query  361  yaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            YAADGYARA+GVGACVVTFTVGGLSVLNAIAGAYSENLP+ICIVGGPNSNDYG
Sbjct  79   YAADGYARAKGVGACVVTFTVGGLSVLNAIAGAYSENLPVICIVGGPNSNDYG  131



>gb|KJB57434.1| hypothetical protein B456_009G164100 [Gossypium raimondii]
Length=589

 Score =   168 bits (426),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 99/113 (88%), Positives = 105/113 (93%), Gaps = 0/113 (0%)
 Frame = +1

Query  181  PVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNag  360
            PV   ++  TLGRHLARRLV+IGV DVFSVPGDFNLTLLDHLIAEP L L+GCCNELNAG
Sbjct  19   PVRGDASSGTLGRHLARRLVEIGVKDVFSVPGDFNLTLLDHLIAEPELNLVGCCNELNAG  78

Query  361  yaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            YAADGYARA+GVGACVVTFTVGGLSVLNAIAGAYSENLP+ICIVGGPNSNDYG
Sbjct  79   YAADGYARAKGVGACVVTFTVGGLSVLNAIAGAYSENLPVICIVGGPNSNDYG  131



>ref|XP_007026638.1| Thiamine pyrophosphate dependent pyruvate decarboxylase family 
protein [Theobroma cacao]
 gb|EOY07140.1| Thiamine pyrophosphate dependent pyruvate decarboxylase family 
protein [Theobroma cacao]
Length=362

 Score =   164 bits (416),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 97/114 (85%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = +1

Query  178  TPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNa  357
            +P   +S+EATLGRHLARRLV +GVTDVFSVPGDFNLTLLDHLIAE  L LIGCCNEL A
Sbjct  24   SPTVINSSEATLGRHLARRLVHVGVTDVFSVPGDFNLTLLDHLIAELELNLIGCCNELKA  83

Query  358  gyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            GYAADGYA +RGVGACVVTFTVGGLSVLN IAGAYSE+LPLICIVGGPNSND+G
Sbjct  84   GYAADGYAWSRGVGACVVTFTVGGLSVLNGIAGAYSESLPLICIVGGPNSNDFG  137



>sp|P51850.1|PDC1_PEA RecName: Full=Pyruvate decarboxylase 1; Short=PDC [Pisum sativum]
 emb|CAA91444.1| pyruvate decarboxylase [Pisum sativum]
Length=593

 Score =   168 bits (425),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 97/113 (86%), Positives = 105/113 (93%), Gaps = 0/113 (0%)
 Frame = +1

Query  181  PVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNag  360
            P+  SS + T+GRHLARRLV+IGV DVFSVPGDFNLTLLDHLIAEP L L+GCCNELNAG
Sbjct  23   PLRPSSCDGTMGRHLARRLVEIGVRDVFSVPGDFNLTLLDHLIAEPELNLVGCCNELNAG  82

Query  361  yaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            YAADGY RA+GVGACVVTFTVGGLS+LNAIAGAYSENLP+ICIVGGPNSNDYG
Sbjct  83   YAADGYGRAKGVGACVVTFTVGGLSILNAIAGAYSENLPVICIVGGPNSNDYG  135



>ref|XP_010277737.1| PREDICTED: pyruvate decarboxylase 1 [Nelumbo nucifera]
Length=589

 Score =   168 bits (425),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 98/109 (90%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = +1

Query  193  SSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaad  372
            S++  TLGRHLARRLVQIGV DVFSVPGDFNLTLLDHLIAEP L +IGCCNELNAGYAAD
Sbjct  23   SASSGTLGRHLARRLVQIGVRDVFSVPGDFNLTLLDHLIAEPDLNVIGCCNELNAGYAAD  82

Query  373  gyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            GYAR +GVGACVVTFTVGGLSVLNAIAGAYSENLP+ICIVGGPNSNDYG
Sbjct  83   GYARFKGVGACVVTFTVGGLSVLNAIAGAYSENLPVICIVGGPNSNDYG  131



>ref|NP_001284406.1| pyruvate decarboxylase [Cucumis melo]
 gb|AIC36755.1| pyruvate decarboxylase [Cucumis melo]
Length=590

 Score =   167 bits (424),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 99/115 (86%), Positives = 107/115 (93%), Gaps = 0/115 (0%)
 Frame = +1

Query  175  STPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELN  354
            S PVA +++  TLG HLARRLV+IG +DVFSVPGDFNLTLLDHLI+EP L LIGCCNELN
Sbjct  17   SVPVAPNASSGTLGSHLARRLVEIGASDVFSVPGDFNLTLLDHLISEPQLNLIGCCNELN  76

Query  355  agyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            AGYAADGYARA+GVGACVVTFTVGGLSVLNAIAGAYSENLP+ICIVGGPNSNDYG
Sbjct  77   AGYAADGYARAKGVGACVVTFTVGGLSVLNAIAGAYSENLPVICIVGGPNSNDYG  131



>gb|KHG03537.1| Pyruvate decarboxylase isozyme 1 [Gossypium arboreum]
Length=601

 Score =   167 bits (424),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 99/113 (88%), Positives = 105/113 (93%), Gaps = 0/113 (0%)
 Frame = +1

Query  181  PVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNag  360
            PV   ++  TLGRHLARRLV+IGV DVFSVPGDFNLTLLDHLIAEP L L+GCCNELNAG
Sbjct  19   PVRGHASTGTLGRHLARRLVEIGVKDVFSVPGDFNLTLLDHLIAEPELNLVGCCNELNAG  78

Query  361  yaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            YAADGYARA+GVGACVVTFTVGGLSVLNAIAGAYSENLP+ICIVGGPNSNDYG
Sbjct  79   YAADGYARAKGVGACVVTFTVGGLSVLNAIAGAYSENLPVICIVGGPNSNDYG  131



>ref|XP_006843656.1| hypothetical protein AMTR_s00007p00179930 [Amborella trichopoda]
 gb|ERN05331.1| hypothetical protein AMTR_s00007p00179930 [Amborella trichopoda]
Length=606

 Score =   167 bits (423),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 121/147 (82%), Gaps = 2/147 (1%)
 Frame = +1

Query  85   MDTKIGSIEACKPGSGDVANAP-TIGVNTVHSTPVAFSSAEAT-LGRHLARRLVQIGVTD  258
            MD  IGSI+  K  + +V   P    V+ + S+    S +  + LGRH+ARRLVQ+GVTD
Sbjct  1    MDMTIGSIDTVKAENNNVGFPPCPFPVSAIQSSTSPTSVSSDSTLGRHVARRLVQVGVTD  60

Query  259  VFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSV  438
            VFSVPGDFNLTLLDHLIAEP L L+GCCNELNAGYAADG+ARA+GVGACVVTFTVGGLSV
Sbjct  61   VFSVPGDFNLTLLDHLIAEPCLNLVGCCNELNAGYAADGFARAKGVGACVVTFTVGGLSV  120

Query  439  LNAIAGAYSENLPLICIVGGPNSNDYG  519
            +NAIAGAYSENLP+ICIVGGPNSNDYG
Sbjct  121  INAIAGAYSENLPVICIVGGPNSNDYG  147



>gb|KDO77807.1| hypothetical protein CISIN_1g007800mg [Citrus sinensis]
Length=431

 Score =   165 bits (417),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 98/113 (87%), Positives = 104/113 (92%), Gaps = 0/113 (0%)
 Frame = +1

Query  181  PVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNag  360
            PV   ++  TLGRHLARRLV+IG  DVFSVPGDFNLTLLDHLIAEP L L+GCCNELNAG
Sbjct  19   PVRGGASVGTLGRHLARRLVEIGAKDVFSVPGDFNLTLLDHLIAEPELNLVGCCNELNAG  78

Query  361  yaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            YAADGYAR+RGVGACVVTFTVGGLSVLNAIAGAYSENLP+ICIVGGPNSNDYG
Sbjct  79   YAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSENLPVICIVGGPNSNDYG  131



>ref|XP_008779842.1| PREDICTED: pyruvate decarboxylase 2-like [Phoenix dactylifera]
Length=216

 Score =   159 bits (402),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 117/147 (80%), Gaps = 12/147 (8%)
 Frame = +1

Query  85   MDTKIGSIEA-CKPGSGDVANAPTIGVNTVHSTPVA-FSSAEATLGRHLARRLVQIGVTD  258
            MDT IG+++   KP +   A  PT       S P A   +AEATLGRHLARRLVQ GV D
Sbjct  1    MDTSIGTVDGVAKPAA---ACHPT-------SPPAAPMCAAEATLGRHLARRLVQGGVND  50

Query  259  VFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSV  438
            VF VP    LTLLDHL+AEPGL L+GCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSV
Sbjct  51   VFYVPDASILTLLDHLLAEPGLNLVGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSV  110

Query  439  LNAIAGAYSENLPLICIVGGPNSNDYG  519
            LNAIAGAYSENLP+ICIVGGPNSNDYG
Sbjct  111  LNAIAGAYSENLPVICIVGGPNSNDYG  137



>ref|XP_002275486.1| PREDICTED: pyruvate decarboxylase 1 [Vitis vinifera]
 emb|CBI30661.3| unnamed protein product [Vitis vinifera]
Length=577

 Score =   167 bits (422),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 100/108 (93%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = +1

Query  196  SAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadg  375
            S   TLG HLARRLVQIGV DVFSVPGDFNLTLLDHLIAEPGL L+GCCNELNAGYAADG
Sbjct  12   SCSGTLGGHLARRLVQIGVRDVFSVPGDFNLTLLDHLIAEPGLNLVGCCNELNAGYAADG  71

Query  376  yarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            YARARGVGACVVTFTVGGLSVLNAIAGAYSENLP+ICIVGGPNSNDYG
Sbjct  72   YARARGVGACVVTFTVGGLSVLNAIAGAYSENLPVICIVGGPNSNDYG  119



>ref|XP_010279075.1| PREDICTED: pyruvate decarboxylase 1-like [Nelumbo nucifera]
Length=589

 Score =   167 bits (422),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 97/112 (87%), Positives = 104/112 (93%), Gaps = 0/112 (0%)
 Frame = +1

Query  184  VAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagy  363
            V  SS+  TLGRHLARRLVQIG+ DVFSVPGDFNLTLLDHL+AEP L LIGCCNELNAGY
Sbjct  20   VRASSSSGTLGRHLARRLVQIGIRDVFSVPGDFNLTLLDHLVAEPELNLIGCCNELNAGY  79

Query  364  aadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            AADGY RA+GVGACVVTFTVGGLSVLNAIAGAYSE+LP+ICIVGGPNSND+G
Sbjct  80   AADGYVRAKGVGACVVTFTVGGLSVLNAIAGAYSEDLPVICIVGGPNSNDFG  131



>ref|XP_007025439.1| Thiamine pyrophosphate dependent pyruvate decarboxylase family 
protein isoform 3 [Theobroma cacao]
 gb|EOY28061.1| Thiamine pyrophosphate dependent pyruvate decarboxylase family 
protein isoform 3 [Theobroma cacao]
Length=406

 Score =   164 bits (415),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 97/113 (86%), Positives = 104/113 (92%), Gaps = 0/113 (0%)
 Frame = +1

Query  181  PVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNag  360
            PV   ++  TLGR+LARRLV+IGV DVFSVPGDFNLTLLDHLIAEP L LIGCCNELNAG
Sbjct  19   PVCGGASRGTLGRYLARRLVEIGVKDVFSVPGDFNLTLLDHLIAEPELNLIGCCNELNAG  78

Query  361  yaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            YAADGYAR++GVGACVVTFTVGGLS LNAIAGAYSENLP+ICIVGGPNSNDYG
Sbjct  79   YAADGYARSKGVGACVVTFTVGGLSALNAIAGAYSENLPVICIVGGPNSNDYG  131



>ref|XP_004485877.1| PREDICTED: pyruvate decarboxylase isozyme 1-like [Cicer arietinum]
Length=584

 Score =   167 bits (422),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 96/108 (89%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = +1

Query  196  SAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadg  375
            S + T+GRHLARRLV+IGV DVFSVPGDFNLTLLDHLIAEP L L+GCCNELNAGYAADG
Sbjct  19   SCDGTMGRHLARRLVEIGVRDVFSVPGDFNLTLLDHLIAEPQLNLVGCCNELNAGYAADG  78

Query  376  yarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            YARA+GVGACVVTFTVGGLS+LNAIAGAYSENLP+ICIVGGPNSNDYG
Sbjct  79   YARAKGVGACVVTFTVGGLSILNAIAGAYSENLPVICIVGGPNSNDYG  126



>ref|XP_010052217.1| PREDICTED: pyruvate decarboxylase 1 [Eucalyptus grandis]
 gb|KCW76156.1| hypothetical protein EUGRSUZ_D00535 [Eucalyptus grandis]
Length=582

 Score =   167 bits (422),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 97/104 (93%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = +1

Query  208  TLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyara  387
            TLG HLARRLV+IGV+DVFSVPGDFNLTLLDHLIAEPGL L+GCCNELNAGYAADGYARA
Sbjct  21   TLGSHLARRLVEIGVSDVFSVPGDFNLTLLDHLIAEPGLNLVGCCNELNAGYAADGYARA  80

Query  388  rgvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            +GVGACVVTFTVGGLSVLNAIAGAYSENLP+ICIVGGPNSNDYG
Sbjct  81   KGVGACVVTFTVGGLSVLNAIAGAYSENLPVICIVGGPNSNDYG  124



>ref|XP_007025440.1| Thiamine pyrophosphate dependent pyruvate decarboxylase family 
protein isoform 4 [Theobroma cacao]
 gb|EOY28062.1| Thiamine pyrophosphate dependent pyruvate decarboxylase family 
protein isoform 4 [Theobroma cacao]
Length=455

 Score =   164 bits (416),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 97/113 (86%), Positives = 104/113 (92%), Gaps = 0/113 (0%)
 Frame = +1

Query  181  PVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNag  360
            PV   ++  TLGR+LARRLV+IGV DVFSVPGDFNLTLLDHLIAEP L LIGCCNELNAG
Sbjct  19   PVCGGASRGTLGRYLARRLVEIGVKDVFSVPGDFNLTLLDHLIAEPELNLIGCCNELNAG  78

Query  361  yaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            YAADGYAR++GVGACVVTFTVGGLS LNAIAGAYSENLP+ICIVGGPNSNDYG
Sbjct  79   YAADGYARSKGVGACVVTFTVGGLSALNAIAGAYSENLPVICIVGGPNSNDYG  131



>ref|XP_011046076.1| PREDICTED: pyruvate decarboxylase 1-like [Populus euphratica]
Length=582

 Score =   166 bits (420),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 99/113 (88%), Positives = 104/113 (92%), Gaps = 0/113 (0%)
 Frame = +1

Query  181  PVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNag  360
            PV   +   TLG HLARRLV+IGV+DVFSVPGDFNLTLLDHLI EPGL LIGCCNELNAG
Sbjct  12   PVPGHTFSGTLGYHLARRLVEIGVSDVFSVPGDFNLTLLDHLIDEPGLNLIGCCNELNAG  71

Query  361  yaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            YAADGYARA+GVGACVVTFTVGGLSVLNAIAGAYSENLP+ICIVGGPNSNDYG
Sbjct  72   YAADGYARAKGVGACVVTFTVGGLSVLNAIAGAYSENLPIICIVGGPNSNDYG  124



>ref|XP_009773011.1| PREDICTED: pyruvate decarboxylase 2 isoform X2 [Nicotiana sylvestris]
Length=588

 Score =   166 bits (421),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 97/109 (89%), Positives = 105/109 (96%), Gaps = 0/109 (0%)
 Frame = +1

Query  193  SSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaad  372
            ++ +ATLGRHLARRLV+IG+ DVFSVPGDFNLTLLDHLIAEP L+ IGCCNELNAGYAAD
Sbjct  22   ANTDATLGRHLARRLVEIGIQDVFSVPGDFNLTLLDHLIAEPRLKNIGCCNELNAGYAAD  81

Query  373  gyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            GYARARGVGACVVTFTVGGLSVLNAIAGAYSENLP+ICIVGGPN+NDYG
Sbjct  82   GYARARGVGACVVTFTVGGLSVLNAIAGAYSENLPVICIVGGPNTNDYG  130



>ref|XP_003522062.1| PREDICTED: pyruvate decarboxylase 1-like, partial [Glycine max]
Length=583

 Score =   166 bits (420),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 105/109 (96%), Gaps = 0/109 (0%)
 Frame = +1

Query  193  SSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaad  372
            +S++ATLGRHLARRLVQ+GV DVFSVPGDFNLTLLDHLIAEP L+ +GCCNELNAGYAAD
Sbjct  17   TSSDATLGRHLARRLVQVGVKDVFSVPGDFNLTLLDHLIAEPQLKNVGCCNELNAGYAAD  76

Query  373  gyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            GYAR RGVGACVVTFTVGGLSV+NAIAGAYSENLPLICIVGGPN+ND+G
Sbjct  77   GYARCRGVGACVVTFTVGGLSVINAIAGAYSENLPLICIVGGPNTNDFG  125



>ref|XP_009773010.1| PREDICTED: pyruvate decarboxylase 2 isoform X1 [Nicotiana sylvestris]
Length=614

 Score =   166 bits (421),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 102/130 (78%), Positives = 114/130 (88%), Gaps = 2/130 (2%)
 Frame = +1

Query  130  GDVANAPTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLI  309
            G VA   +   ++  S+ +A  + +ATLGRHLARRLV+IG+ DVFSVPGDFNLTLLDHLI
Sbjct  3    GSVAKGTSCIQDSQSSSVIA--NTDATLGRHLARRLVEIGIQDVFSVPGDFNLTLLDHLI  60

Query  310  AEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICI  489
            AEP L+ IGCCNELNAGYAADGYARARGVGACVVTFTVGGLSVLNAIAGAYSENLP+ICI
Sbjct  61   AEPRLKNIGCCNELNAGYAADGYARARGVGACVVTFTVGGLSVLNAIAGAYSENLPVICI  120

Query  490  VGGPNSNDYG  519
            VGGPN+NDYG
Sbjct  121  VGGPNTNDYG  130



>ref|XP_009594221.1| PREDICTED: pyruvate decarboxylase 2 isoform X2 [Nicotiana tomentosiformis]
Length=588

 Score =   166 bits (420),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 97/109 (89%), Positives = 105/109 (96%), Gaps = 0/109 (0%)
 Frame = +1

Query  193  SSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaad  372
            ++ +ATLGRHLARRLV+IG+ DVFSVPGDFNLTLLDHLIAEP L+ IGCCNELNAGYAAD
Sbjct  22   ANTDATLGRHLARRLVEIGIQDVFSVPGDFNLTLLDHLIAEPRLKNIGCCNELNAGYAAD  81

Query  373  gyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            GYARARGVGACVVTFTVGGLSVLNAIAGAYSENLP+ICIVGGPN+NDYG
Sbjct  82   GYARARGVGACVVTFTVGGLSVLNAIAGAYSENLPVICIVGGPNTNDYG  130



>ref|XP_010323135.1| PREDICTED: pyruvate decarboxylase 2 [Solanum lycopersicum]
Length=586

 Score =   166 bits (420),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 98/120 (82%), Positives = 109/120 (91%), Gaps = 1/120 (1%)
 Frame = +1

Query  160  VNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGC  339
            +   HS+ V  +S +A LGRHLARRLV+IGV DVFSVPGDFNLTLLDHLIAEP L+ +GC
Sbjct  10   IQNSHSSSV-IASPDANLGRHLARRLVEIGVEDVFSVPGDFNLTLLDHLIAEPRLKNVGC  68

Query  340  CNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            CNELNAGYAADGYAR+RGVGACVVTFTVGGLSV+NAIAGAYSENLP+ICIVGGPN+NDYG
Sbjct  69   CNELNAGYAADGYARSRGVGACVVTFTVGGLSVINAIAGAYSENLPIICIVGGPNTNDYG  128



>ref|XP_009594220.1| PREDICTED: pyruvate decarboxylase 2 isoform X1 [Nicotiana tomentosiformis]
Length=614

 Score =   166 bits (420),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 102/130 (78%), Positives = 114/130 (88%), Gaps = 2/130 (2%)
 Frame = +1

Query  130  GDVANAPTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLI  309
            G VA   +   ++  S+ +A  + +ATLGRHLARRLV+IG+ DVFSVPGDFNLTLLDHLI
Sbjct  3    GSVAKGTSCIQDSQSSSVIA--NTDATLGRHLARRLVEIGIQDVFSVPGDFNLTLLDHLI  60

Query  310  AEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICI  489
            AEP L+ IGCCNELNAGYAADGYARARGVGACVVTFTVGGLSVLNAIAGAYSENLP+ICI
Sbjct  61   AEPRLKNIGCCNELNAGYAADGYARARGVGACVVTFTVGGLSVLNAIAGAYSENLPVICI  120

Query  490  VGGPNSNDYG  519
            VGGPN+NDYG
Sbjct  121  VGGPNTNDYG  130



>ref|XP_010037690.1| PREDICTED: pyruvate decarboxylase 1-like [Eucalyptus grandis]
 gb|KCW49438.1| hypothetical protein EUGRSUZ_K02969 [Eucalyptus grandis]
Length=644

 Score =   166 bits (421),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 108/148 (73%), Positives = 120/148 (81%), Gaps = 5/148 (3%)
 Frame = +1

Query  88   DTKIGSIEACKPGSGDVANAPTIGVNTV---HSTPVAFSSAEATLGRHLARRLVQIGVTD  258
            D ++GS+E     S  VA  P  GV ++     +  A   +EATLG HLARRLV+IGV D
Sbjct  41   DARVGSLETSTLPS-KVAR-PHNGVASIVQPSYSIAALGPSEATLGCHLARRLVEIGVGD  98

Query  259  VFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSV  438
            VFSVPGDFNL+LLDHL+ EPGL LIGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSV
Sbjct  99   VFSVPGDFNLSLLDHLVTEPGLNLIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSV  158

Query  439  LNAIAGAYSENLPLICIVGGPNSNDYGN  522
            +NAIAGAYSENLPLICIVGGPNSNDYG 
Sbjct  159  INAIAGAYSENLPLICIVGGPNSNDYGR  186



>sp|P51846.1|PDC2_TOBAC RecName: Full=Pyruvate decarboxylase 2; Short=NtPDC2 [Nicotiana 
tabacum]
 emb|CAA57448.1| pyruvate decarboxylase [Nicotiana tabacum]
Length=614

 Score =   166 bits (420),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 102/130 (78%), Positives = 114/130 (88%), Gaps = 2/130 (2%)
 Frame = +1

Query  130  GDVANAPTIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLI  309
            G VA   +   ++  S+ +A  + +ATLGRHLARRLV+IG+ DVFSVPGDFNLTLLDHLI
Sbjct  3    GSVAKGTSCIQDSQSSSVIA--NTDATLGRHLARRLVEIGIQDVFSVPGDFNLTLLDHLI  60

Query  310  AEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICI  489
            AEP L+ IGCCNELNAGYAADGYARARGVGACVVTFTVGGLSVLNAIAGAYSENLP+ICI
Sbjct  61   AEPRLKNIGCCNELNAGYAADGYARARGVGACVVTFTVGGLSVLNAIAGAYSENLPVICI  120

Query  490  VGGPNSNDYG  519
            VGGPN+NDYG
Sbjct  121  VGGPNTNDYG  130



>gb|KDO77805.1| hypothetical protein CISIN_1g007800mg [Citrus sinensis]
Length=585

 Score =   166 bits (419),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 98/113 (87%), Positives = 104/113 (92%), Gaps = 0/113 (0%)
 Frame = +1

Query  181  PVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNag  360
            PV   ++  TLGRHLARRLV+IG  DVFSVPGDFNLTLLDHLIAEP L L+GCCNELNAG
Sbjct  19   PVRGGASVGTLGRHLARRLVEIGAKDVFSVPGDFNLTLLDHLIAEPELNLVGCCNELNAG  78

Query  361  yaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            YAADGYAR+RGVGACVVTFTVGGLSVLNAIAGAYSENLP+ICIVGGPNSNDYG
Sbjct  79   YAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSENLPVICIVGGPNSNDYG  131



>gb|KDO77806.1| hypothetical protein CISIN_1g007800mg [Citrus sinensis]
Length=545

 Score =   165 bits (418),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 98/113 (87%), Positives = 104/113 (92%), Gaps = 0/113 (0%)
 Frame = +1

Query  181  PVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNag  360
            PV   ++  TLGRHLARRLV+IG  DVFSVPGDFNLTLLDHLIAEP L L+GCCNELNAG
Sbjct  19   PVRGGASVGTLGRHLARRLVEIGAKDVFSVPGDFNLTLLDHLIAEPELNLVGCCNELNAG  78

Query  361  yaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            YAADGYAR+RGVGACVVTFTVGGLSVLNAIAGAYSENLP+ICIVGGPNSNDYG
Sbjct  79   YAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSENLPVICIVGGPNSNDYG  131



>gb|KDO77804.1| hypothetical protein CISIN_1g007800mg [Citrus sinensis]
Length=589

 Score =   166 bits (419),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 98/113 (87%), Positives = 104/113 (92%), Gaps = 0/113 (0%)
 Frame = +1

Query  181  PVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNag  360
            PV   ++  TLGRHLARRLV+IG  DVFSVPGDFNLTLLDHLIAEP L L+GCCNELNAG
Sbjct  19   PVRGGASVGTLGRHLARRLVEIGAKDVFSVPGDFNLTLLDHLIAEPELNLVGCCNELNAG  78

Query  361  yaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            YAADGYAR+RGVGACVVTFTVGGLSVLNAIAGAYSENLP+ICIVGGPNSNDYG
Sbjct  79   YAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSENLPVICIVGGPNSNDYG  131



>ref|NP_001275795.1| pyruvate decarboxylase [Citrus sinensis]
 gb|AAZ05069.1| pyruvate decarboxylase [Citrus sinensis]
Length=589

 Score =   166 bits (419),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 98/113 (87%), Positives = 104/113 (92%), Gaps = 0/113 (0%)
 Frame = +1

Query  181  PVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNag  360
            PV   ++  TLGRHLARRLV+IG  DVFSVPGDFNLTLLDHLIAEP L L+GCCNELNAG
Sbjct  19   PVRGGASVGTLGRHLARRLVEIGAKDVFSVPGDFNLTLLDHLIAEPELNLVGCCNELNAG  78

Query  361  yaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            YAADGYAR+RGVGACVVTFTVGGLSVLNAIAGAYSENLP+ICIVGGPNSNDYG
Sbjct  79   YAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSENLPVICIVGGPNSNDYG  131



>ref|XP_010040424.1| PREDICTED: pyruvate decarboxylase 1-like [Eucalyptus grandis]
 gb|KCW45221.1| hypothetical protein EUGRSUZ_L01136 [Eucalyptus grandis]
Length=644

 Score =   166 bits (419),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 107/148 (72%), Positives = 119/148 (80%), Gaps = 5/148 (3%)
 Frame = +1

Query  88   DTKIGSIEACKPGSGDVANAPTIGVNTV---HSTPVAFSSAEATLGRHLARRLVQIGVTD  258
            D ++GS+E     S  VA  P  GV ++     +  A   +EATLG HLARRLV+IGV D
Sbjct  41   DARVGSLETSTLPS-KVAR-PHNGVASIVQPSYSIAALGPSEATLGCHLARRLVEIGVGD  98

Query  259  VFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSV  438
            VFSVPGDFNL+LLDH + EPGL LIGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSV
Sbjct  99   VFSVPGDFNLSLLDHFVTEPGLNLIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSV  158

Query  439  LNAIAGAYSENLPLICIVGGPNSNDYGN  522
            +NAIAGAYSENLPLICIVGGPNSNDYG 
Sbjct  159  INAIAGAYSENLPLICIVGGPNSNDYGR  186



>ref|XP_007025438.1| Pyruvate decarboxylase-2 isoform 2 [Theobroma cacao]
 gb|EOY28060.1| Pyruvate decarboxylase-2 isoform 2 [Theobroma cacao]
Length=590

 Score =   165 bits (418),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 97/113 (86%), Positives = 104/113 (92%), Gaps = 0/113 (0%)
 Frame = +1

Query  181  PVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNag  360
            PV   ++  TLGR+LARRLV+IGV DVFSVPGDFNLTLLDHLIAEP L LIGCCNELNAG
Sbjct  19   PVCGGASRGTLGRYLARRLVEIGVKDVFSVPGDFNLTLLDHLIAEPELNLIGCCNELNAG  78

Query  361  yaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            YAADGYAR++GVGACVVTFTVGGLS LNAIAGAYSENLP+ICIVGGPNSNDYG
Sbjct  79   YAADGYARSKGVGACVVTFTVGGLSALNAIAGAYSENLPVICIVGGPNSNDYG  131



>gb|KCW45220.1| hypothetical protein EUGRSUZ_L01136 [Eucalyptus grandis]
Length=640

 Score =   166 bits (419),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 107/148 (72%), Positives = 119/148 (80%), Gaps = 5/148 (3%)
 Frame = +1

Query  88   DTKIGSIEACKPGSGDVANAPTIGVNTV---HSTPVAFSSAEATLGRHLARRLVQIGVTD  258
            D ++GS+E     S  VA  P  GV ++     +  A   +EATLG HLARRLV+IGV D
Sbjct  41   DARVGSLETSTLPS-KVAR-PHNGVASIVQPSYSIAALGPSEATLGCHLARRLVEIGVGD  98

Query  259  VFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSV  438
            VFSVPGDFNL+LLDH + EPGL LIGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSV
Sbjct  99   VFSVPGDFNLSLLDHFVTEPGLNLIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSV  158

Query  439  LNAIAGAYSENLPLICIVGGPNSNDYGN  522
            +NAIAGAYSENLPLICIVGGPNSNDYG 
Sbjct  159  INAIAGAYSENLPLICIVGGPNSNDYGR  186



>ref|XP_007025437.1| Pyruvate decarboxylase-2 isoform 1 [Theobroma cacao]
 gb|EOY28059.1| Pyruvate decarboxylase-2 isoform 1 [Theobroma cacao]
Length=589

 Score =   165 bits (418),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 97/113 (86%), Positives = 104/113 (92%), Gaps = 0/113 (0%)
 Frame = +1

Query  181  PVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNag  360
            PV   ++  TLGR+LARRLV+IGV DVFSVPGDFNLTLLDHLIAEP L LIGCCNELNAG
Sbjct  19   PVCGGASRGTLGRYLARRLVEIGVKDVFSVPGDFNLTLLDHLIAEPELNLIGCCNELNAG  78

Query  361  yaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            YAADGYAR++GVGACVVTFTVGGLS LNAIAGAYSENLP+ICIVGGPNSNDYG
Sbjct  79   YAADGYARSKGVGACVVTFTVGGLSALNAIAGAYSENLPVICIVGGPNSNDYG  131



>gb|KCW45222.1| hypothetical protein EUGRSUZ_L01136 [Eucalyptus grandis]
Length=653

 Score =   165 bits (418),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 107/148 (72%), Positives = 119/148 (80%), Gaps = 5/148 (3%)
 Frame = +1

Query  88   DTKIGSIEACKPGSGDVANAPTIGVNTV---HSTPVAFSSAEATLGRHLARRLVQIGVTD  258
            D ++GS+E     S  VA  P  GV ++     +  A   +EATLG HLARRLV+IGV D
Sbjct  41   DARVGSLETSTLPS-KVAR-PHNGVASIVQPSYSIAALGPSEATLGCHLARRLVEIGVGD  98

Query  259  VFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSV  438
            VFSVPGDFNL+LLDH + EPGL LIGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSV
Sbjct  99   VFSVPGDFNLSLLDHFVTEPGLNLIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSV  158

Query  439  LNAIAGAYSENLPLICIVGGPNSNDYGN  522
            +NAIAGAYSENLPLICIVGGPNSNDYG 
Sbjct  159  INAIAGAYSENLPLICIVGGPNSNDYGR  186



>gb|AAO42252.1| putative pyruvate decarboxylase [Arabidopsis thaliana]
Length=564

 Score =   165 bits (417),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 97/106 (92%), Positives = 102/106 (96%), Gaps = 0/106 (0%)
 Frame = +1

Query  202  EATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgya  381
            E+TLGRHL+RRLVQ GVTDVFSVPGDFNLTLLDHLIAEP L  IGCCNELNAGYAADGYA
Sbjct  1    ESTLGRHLSRRLVQAGVTDVFSVPGDFNLTLLDHLIAEPELNNIGCCNELNAGYAADGYA  60

Query  382  rargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            R+RGVGACVVTFTVGGLSVLNAIAGAYSENLP+ICIVGGPNSND+G
Sbjct  61   RSRGVGACVVTFTVGGLSVLNAIAGAYSENLPVICIVGGPNSNDFG  106



>ref|XP_010924891.1| PREDICTED: pyruvate decarboxylase 1-like [Elaeis guineensis]
Length=577

 Score =   165 bits (417),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 97/104 (93%), Positives = 101/104 (97%), Gaps = 0/104 (0%)
 Frame = +1

Query  208  TLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyara  387
            TLGRHLARRLVQIGV DVFSVPGDFNLTLLDHLIAEP L L+GCCNELNAGYAADGYARA
Sbjct  16   TLGRHLARRLVQIGVRDVFSVPGDFNLTLLDHLIAEPELNLVGCCNELNAGYAADGYARA  75

Query  388  rgvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            RGVGACVVTFTVGGLSV+NAIAG+YSENLP+ICIVGGPNSNDYG
Sbjct  76   RGVGACVVTFTVGGLSVINAIAGSYSENLPIICIVGGPNSNDYG  119



>ref|XP_008225205.1| PREDICTED: pyruvate decarboxylase 1 [Prunus mume]
Length=573

 Score =   164 bits (416),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 99/109 (91%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = +1

Query  193  SSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaad  372
            +S+  TLGRHLARRLV+IGV DVFSVPGDFNLTLLDHL+AEPGL LIGCCNELNAGYAAD
Sbjct  7    ASSTGTLGRHLARRLVEIGVHDVFSVPGDFNLTLLDHLLAEPGLNLIGCCNELNAGYAAD  66

Query  373  gyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            GYARARGVGACVVTFTVGGLSVLNAIAGA SENLP+ICIVGGPNSNDYG
Sbjct  67   GYARARGVGACVVTFTVGGLSVLNAIAGACSENLPVICIVGGPNSNDYG  115



>gb|AAA68289.1| pyruvate decarboxylase [Oryza sativa Indica Group]
Length=585

 Score =   164 bits (416),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 97/109 (89%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = +1

Query  193  SSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaad  372
            SS +ATLG HLARRLVQ+GV+DVF+VPGDFNLTLLD+LIAEPGL ++GCCNELNAGYAAD
Sbjct  20   SSGDATLGGHLARRLVQVGVSDVFAVPGDFNLTLLDYLIAEPGLSVVGCCNELNAGYAAD  79

Query  373  gyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            GYARARGVGAC VTFTVGGLSVLNAI GAYSENLPLICIVGGPNSNDYG
Sbjct  80   GYARARGVGACAVTFTVGGLSVLNAIGGAYSENLPLICIVGGPNSNDYG  128



>ref|XP_004961783.1| PREDICTED: pyruvate decarboxylase 1-like [Setaria italica]
Length=610

 Score =   164 bits (416),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 96/104 (92%), Positives = 101/104 (97%), Gaps = 0/104 (0%)
 Frame = +1

Query  208  TLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyara  387
            TLGRHLARRLVQIG TDVF+VPGDFNLTLLD+LIAEPGL L+GCCNELNAGYAADGYAR+
Sbjct  49   TLGRHLARRLVQIGATDVFAVPGDFNLTLLDYLIAEPGLNLVGCCNELNAGYAADGYARS  108

Query  388  rgvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            RGVGAC VTFTVGGLSVLNAIAGAYSENLP+ICIVGGPNSNDYG
Sbjct  109  RGVGACAVTFTVGGLSVLNAIAGAYSENLPVICIVGGPNSNDYG  152



>ref|XP_003542972.1| PREDICTED: pyruvate decarboxylase 1-like [Glycine max]
Length=589

 Score =   164 bits (416),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = +1

Query  193  SSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaad  372
            S+ + TLGRHLARRL + GV DVFSVPGDFNLTLLDHLIAEP L L+GCCNELNAGYAAD
Sbjct  23   SAFDGTLGRHLARRLAETGVRDVFSVPGDFNLTLLDHLIAEPSLNLVGCCNELNAGYAAD  82

Query  373  gyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            GYARA+GVGACVVTFTVGGLSVLNAIAGAYSENLP+ICIVGGPNSNDYG
Sbjct  83   GYARAKGVGACVVTFTVGGLSVLNAIAGAYSENLPVICIVGGPNSNDYG  131



>ref|XP_010686333.1| PREDICTED: pyruvate decarboxylase 1 [Beta vulgaris subsp. vulgaris]
Length=581

 Score =   164 bits (416),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 96/105 (91%), Positives = 100/105 (95%), Gaps = 0/105 (0%)
 Frame = +1

Query  205  ATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyar  384
            +TLG HL RRL QIGVTDVFSVPGDFNLTLLDHLIAEP L L+GCCNELNAGYAADGYAR
Sbjct  19   STLGHHLGRRLAQIGVTDVFSVPGDFNLTLLDHLIAEPQLNLVGCCNELNAGYAADGYAR  78

Query  385  argvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            A+GVGACVVTFTVGGLSVLNAIAGAYSENLP+ICIVGGPNSNDYG
Sbjct  79   AKGVGACVVTFTVGGLSVLNAIAGAYSENLPVICIVGGPNSNDYG  123



>ref|XP_008244071.1| PREDICTED: pyruvate decarboxylase 2-like [Prunus mume]
Length=613

 Score =   164 bits (416),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 106/152 (70%), Positives = 122/152 (80%), Gaps = 8/152 (5%)
 Frame = +1

Query  85   MDTKIGSIEAC--KPGSGDVANAPTIGVNTV-----HSTPVAFSSAEATLGRHLARRLVQ  243
            MDTK G+++ C  K    DV   P   V ++     +S P + +S+ A+LG +LARRL+Q
Sbjct  1    MDTKNGALDVCNKKTTRTDVVLNPQHDVGSISTMQKYSVPSS-NSSNASLGSYLARRLLQ  59

Query  244  IGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTV  423
            IGVTDVFSVPGD NLTLLDHLIAEPGL  I CCNELNAGYAADGY R+RGVG+CVVTFTV
Sbjct  60   IGVTDVFSVPGDSNLTLLDHLIAEPGLTNICCCNELNAGYAADGYGRSRGVGSCVVTFTV  119

Query  424  GGLSVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            GGLSVLNAIAGAYSE+LP+ICIVGGPNSNDYG
Sbjct  120  GGLSVLNAIAGAYSEDLPVICIVGGPNSNDYG  151



>ref|XP_002305755.2| pyruvate decarboxylase family protein [Populus trichocarpa]
 gb|EEE86266.2| pyruvate decarboxylase family protein [Populus trichocarpa]
Length=582

 Score =   164 bits (415),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 98/113 (87%), Positives = 103/113 (91%), Gaps = 0/113 (0%)
 Frame = +1

Query  181  PVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNag  360
            PV   +   TLG HLARRLV+IGV+DVFSVPGDFNLTLLDHLI EP L LIGCCNELNAG
Sbjct  12   PVPGHTFSGTLGHHLARRLVEIGVSDVFSVPGDFNLTLLDHLIDEPELNLIGCCNELNAG  71

Query  361  yaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            YAADGYARA+GVGACVVTFTVGGLSVLNAIAGAYSENLP+ICIVGGPNSNDYG
Sbjct  72   YAADGYARAKGVGACVVTFTVGGLSVLNAIAGAYSENLPIICIVGGPNSNDYG  124



>ref|XP_002870930.1| pyruvate decarboxylase-3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47189.1| pyruvate decarboxylase-3 [Arabidopsis lyrata subsp. lyrata]
Length=592

 Score =   164 bits (415),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 113/133 (85%), Gaps = 4/133 (3%)
 Frame = +1

Query  133  DVANAPTIGVNTVH----STPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLD  300
            DV + P+  V T+     +T     S++ATLGRHLARRLVQ GV+D+FSVPGDFNL+LLD
Sbjct  2    DVGSLPSNSVATIQDSAPTTAAILGSSQATLGRHLARRLVQAGVSDIFSVPGDFNLSLLD  61

Query  301  HLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPL  480
             LIA+P L  IGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSVLNAIAGAYSENLP+
Sbjct  62   QLIADPELNNIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSENLPV  121

Query  481  ICIVGGPNSNDYG  519
            ICIVGGPNSND+G
Sbjct  122  ICIVGGPNSNDFG  134



>ref|XP_009386639.1| PREDICTED: pyruvate decarboxylase 1-like [Musa acuminata subsp. 
malaccensis]
Length=579

 Score =   164 bits (414),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 94/104 (90%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +1

Query  208  TLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyara  387
            TLGRHLARRLVQ+GV DVF+VPGDFNLTLLDHLIAEP L L+GCCNELNAGYAADGYARA
Sbjct  18   TLGRHLARRLVQVGVRDVFAVPGDFNLTLLDHLIAEPQLNLVGCCNELNAGYAADGYARA  77

Query  388  rgvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYG  519
             GVGACVVTFTVGGLSV+NAIAG+YSENLP+ICIVGGPNSNDYG
Sbjct  78   SGVGACVVTFTVGGLSVINAIAGSYSENLPIICIVGGPNSNDYG  121



>ref|XP_011027712.1| PREDICTED: pyruvate decarboxylase 1-like [Populus euphratica]
Length=593

 Score =   164 bits (415),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 97/104 (93%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +1

Query  208  TLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyara  387
            TLG HLARRLV+IGV DVFSVPGDFNLTLLDHLIAEP L LIGCCNELNAGYAADGYARA
Sbjct  32   TLGSHLARRLVEIGVRDVFSVPGDFNLTLLDHLIAEPELNLIGCCNELNAGYAADGYARA  91

Query  388  rgvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            +GVGACVVTFTVGGLSVLNAIAGAYSENLP+ICIVGGPNSNDYG
Sbjct  92   KGVGACVVTFTVGGLSVLNAIAGAYSENLPIICIVGGPNSNDYG  135



>emb|CDO96745.1| unnamed protein product [Coffea canephora]
Length=584

 Score =   164 bits (414),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 99/124 (80%), Positives = 108/124 (87%), Gaps = 4/124 (3%)
 Frame = +1

Query  160  VNTVHSTPVAFSSAEA----TLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLR  327
            +  +H + +   SA+A    +LG HLA+RLVQIGV DVFSVPGDFNL LLDHLIAEP L 
Sbjct  3    IQAIHGSGITACSAQAPAGGSLGSHLAKRLVQIGVKDVFSVPGDFNLALLDHLIAEPELN  62

Query  328  LIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNS  507
            LIGCCNELNAGYAADGYARA+GVGACVVTFTVGGLSVLNAIAGAYSENLP+ICIVGGPNS
Sbjct  63   LIGCCNELNAGYAADGYARAKGVGACVVTFTVGGLSVLNAIAGAYSENLPVICIVGGPNS  122

Query  508  NDYG  519
            NDYG
Sbjct  123  NDYG  126



>ref|XP_010912563.1| PREDICTED: pyruvate decarboxylase 1 [Elaeis guineensis]
Length=577

 Score =   162 bits (411),  Expect(2) = 8e-44, Method: Compositional matrix adjust.
 Identities = 96/107 (90%), Positives = 102/107 (95%), Gaps = 0/107 (0%)
 Frame = +1

Query  199  AEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgy  378
            A  TLGRHLA+RLVQIGV DVFSVPGDFNLTLLDHLIAEP L L+GCCNELNAGYAADGY
Sbjct  13   AAGTLGRHLAQRLVQIGVRDVFSVPGDFNLTLLDHLIAEPELNLVGCCNELNAGYAADGY  72

Query  379  arargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            ARARGVGACVVTF+VGGLSV+NAIAG+YSENLP+ICIVGGPNSNDYG
Sbjct  73   ARARGVGACVVTFSVGGLSVINAIAGSYSENLPIICIVGGPNSNDYG  119


 Score = 41.2 bits (95),  Expect(2) = 8e-44, Method: Composition-based stats.
 Identities = 17/22 (77%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = +2

Query  500  PTRTTTGTNRILHHTIGLPDFT  565
            P     GTNRILHHTIGLPDFT
Sbjct  113  PNSNDYGTNRILHHTIGLPDFT  134



>emb|CAG30578.1| pyruvate decarboxylase isozyme 1 [Lotus japonicus]
Length=580

 Score =   164 bits (414),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 97/115 (84%), Positives = 105/115 (91%), Gaps = 0/115 (0%)
 Frame = +1

Query  175  STPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELN  354
            ++P   S+ + TLG HLARRLV+IGV DVFSVPGDFNLTLLDHLI EP L +IGCCNELN
Sbjct  8    TSPPPPSAFDGTLGHHLARRLVEIGVRDVFSVPGDFNLTLLDHLIGEPQLNVIGCCNELN  67

Query  355  agyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            AGYAADGYARA+GVGACVVTFTVGGLSVLNAIAGAYSENLP+ICIVGGPNSNDYG
Sbjct  68   AGYAADGYARAKGVGACVVTFTVGGLSVLNAIAGAYSENLPVICIVGGPNSNDYG  122



>ref|XP_011045902.1| PREDICTED: pyruvate decarboxylase 1 [Populus euphratica]
Length=593

 Score =   163 bits (413),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 97/104 (93%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +1

Query  208  TLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyara  387
            TLG HLARRLV+IGV DVFSVPGDFNLTLLDHLIAEP L LIGCCNELNAGYAADGYARA
Sbjct  32   TLGSHLARRLVEIGVRDVFSVPGDFNLTLLDHLIAEPELNLIGCCNELNAGYAADGYARA  91

Query  388  rgvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            +GVGACVVTFTVGGLSVLNAIAGAYSENLP+ICIVGGPNSNDYG
Sbjct  92   KGVGACVVTFTVGGLSVLNAIAGAYSENLPIICIVGGPNSNDYG  135



>ref|XP_006449474.1| hypothetical protein CICLE_v10014703mg [Citrus clementina]
 gb|ESR62714.1| hypothetical protein CICLE_v10014703mg [Citrus clementina]
Length=589

 Score =   162 bits (411),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 102/130 (78%), Positives = 110/130 (85%), Gaps = 1/130 (1%)
 Frame = +1

Query  133  DVANAP-TIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLI  309
            D ANA  + G  +    PV   ++  TLGRHLARRLV+IG  DVFSVPGDFNLTLLDHLI
Sbjct  2    DTANAMGSTGQPSSAPAPVRGGASVGTLGRHLARRLVEIGAKDVFSVPGDFNLTLLDHLI  61

Query  310  AEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICI  489
            AEP L L+GCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSVLNAIAGAYSENLP+ICI
Sbjct  62   AEPELNLVGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSENLPVICI  121

Query  490  VGGPNSNDYG  519
            VGGPNSND G
Sbjct  122  VGGPNSNDCG  131


 Score = 40.8 bits (94),  Expect(2) = 1e-43, Method: Composition-based stats.
 Identities = 17/22 (77%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = +2

Query  500  PTRTTTGTNRILHHTIGLPDFT  565
            P     GTNRILHHTIGLPDFT
Sbjct  125  PNSNDCGTNRILHHTIGLPDFT  146



>ref|XP_007213938.1| hypothetical protein PRUPE_ppa003458mg [Prunus persica]
 gb|EMJ15137.1| hypothetical protein PRUPE_ppa003458mg [Prunus persica]
Length=573

 Score =   163 bits (413),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 98/109 (90%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = +1

Query  193  SSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaad  372
            +++  TLGRHLARRLV+IGV DVFSVPGDFNLTLLDHL+AEPGL LIGCCNELNAGYAAD
Sbjct  7    ANSTGTLGRHLARRLVEIGVHDVFSVPGDFNLTLLDHLLAEPGLNLIGCCNELNAGYAAD  66

Query  373  gyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            GYARARGVGACVVTFTVGGLSVLNAIAGA SENLP+ICIVGGPNSNDYG
Sbjct  67   GYARARGVGACVVTFTVGGLSVLNAIAGACSENLPVICIVGGPNSNDYG  115



>gb|AAX33299.1| pyruvate decarboxylase 2 [Petunia x hybrida]
Length=588

 Score =   163 bits (413),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 94/104 (90%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +1

Query  208  TLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyara  387
            TLGRHLARRLV+IG+ DVFSVPGDFNLTLLDHLIAEP L+ IGCCNELNAGYAADGYAR 
Sbjct  27   TLGRHLARRLVEIGIEDVFSVPGDFNLTLLDHLIAEPKLKNIGCCNELNAGYAADGYARE  86

Query  388  rgvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            RG+GACVVTFTVGGLSVLNAIAGAYSENLP+ICIVGGPN+NDYG
Sbjct  87   RGIGACVVTFTVGGLSVLNAIAGAYSENLPVICIVGGPNTNDYG  130



>ref|NP_195753.1| pyruvate decarboxylase-3 [Arabidopsis thaliana]
 sp|Q9M039.1|PDC3_ARATH RecName: Full=Pyruvate decarboxylase 3; Short=AtPDC3 [Arabidopsis 
thaliana]
 emb|CAB81916.1| pyruvate decarboxylase-like protein [Arabidopsis thaliana]
 gb|AAP21263.1| At5g01330 [Arabidopsis thaliana]
 dbj|BAE99688.1| pyruvate decarboxylase-like protein [Arabidopsis thaliana]
 gb|AED90328.1| pyruvate decarboxylase-3 [Arabidopsis thaliana]
Length=592

 Score =   163 bits (412),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 102/133 (77%), Positives = 113/133 (85%), Gaps = 4/133 (3%)
 Frame = +1

Query  133  DVANAPTIGVNTVH-STPVA---FSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLD  300
            DV + P+ GV T+  S P A     S+ ATLGRHL+RRLVQ GVTD+F+VPGDFNL+LLD
Sbjct  2    DVRSLPSNGVATIQDSAPTAATILGSSAATLGRHLSRRLVQAGVTDIFTVPGDFNLSLLD  61

Query  301  HLIAEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPL  480
             LIA P L  IGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSVLNAIAGAYSENLP+
Sbjct  62   QLIANPELNNIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSENLPV  121

Query  481  ICIVGGPNSNDYG  519
            ICIVGGPNSND+G
Sbjct  122  ICIVGGPNSNDFG  134



>ref|XP_010108431.1| Pyruvate decarboxylase isozyme 1 [Morus notabilis]
 gb|EXC19459.1| Pyruvate decarboxylase isozyme 1 [Morus notabilis]
Length=589

 Score =   163 bits (412),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = +1

Query  193  SSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaad  372
            +S   TLGRHLARRL++IG  DVFSVPGDFNLTLLDHLIAEP L LIGCCNELNAGYAAD
Sbjct  23   ASWSGTLGRHLARRLIEIGARDVFSVPGDFNLTLLDHLIAEPELNLIGCCNELNAGYAAD  82

Query  373  gyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            GYAR+RGVGACVVTFTVGGLSV+NAIAGAYSENLP+ICIVGGPNSND+G
Sbjct  83   GYARSRGVGACVVTFTVGGLSVINAIAGAYSENLPVICIVGGPNSNDFG  131



>ref|XP_010257091.1| PREDICTED: pyruvate decarboxylase 1-like [Nelumbo nucifera]
Length=580

 Score =   163 bits (412),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = +1

Query  193  SSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaad  372
            +S+  TLGRH+A RLV+IG+TDVFSVPGDFNL LLDHLIA+PGL LIGCCNELNAGYAAD
Sbjct  14   ASSGPTLGRHIAHRLVEIGITDVFSVPGDFNLILLDHLIAQPGLNLIGCCNELNAGYAAD  73

Query  373  gyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            GYAR+RGVGACVVTFTVGGLSV+NAIAGAYSENLP+ICIVGGPNSNDYG
Sbjct  74   GYARSRGVGACVVTFTVGGLSVINAIAGAYSENLPVICIVGGPNSNDYG  122



>ref|XP_006449473.1| hypothetical protein CICLE_v10014703mg [Citrus clementina]
 gb|ESR62713.1| hypothetical protein CICLE_v10014703mg [Citrus clementina]
Length=545

 Score =   162 bits (410),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 102/130 (78%), Positives = 110/130 (85%), Gaps = 1/130 (1%)
 Frame = +1

Query  133  DVANAP-TIGVNTVHSTPVAFSSAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLI  309
            D ANA  + G  +    PV   ++  TLGRHLARRLV+IG  DVFSVPGDFNLTLLDHLI
Sbjct  2    DTANAMGSTGQPSSAPAPVRGGASVGTLGRHLARRLVEIGAKDVFSVPGDFNLTLLDHLI  61

Query  310  AEPGLRLIGCCNELNagyaadgyarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICI  489
            AEP L L+GCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSVLNAIAGAYSENLP+ICI
Sbjct  62   AEPELNLVGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSENLPVICI  121

Query  490  VGGPNSNDYG  519
            VGGPNSND G
Sbjct  122  VGGPNSNDCG  131



>ref|XP_007148065.1| hypothetical protein PHAVU_006G177600g [Phaseolus vulgaris]
 gb|ESW20059.1| hypothetical protein PHAVU_006G177600g [Phaseolus vulgaris]
Length=584

 Score =   162 bits (410),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 97/108 (90%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = +1

Query  196  SAEATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadg  375
            S + TLG HLARRLV+IGV DVFSVPGDFNLTLLDHLIAEP L L+GCCNELNAGYAADG
Sbjct  19   SFDGTLGCHLARRLVEIGVRDVFSVPGDFNLTLLDHLIAEPRLNLVGCCNELNAGYAADG  78

Query  376  yarargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            YARARGVGACVVTFTVGGLSVLNAIAGAYSENLP+IC+VGGPNSNDYG
Sbjct  79   YARARGVGACVVTFTVGGLSVLNAIAGAYSENLPVICVVGGPNSNDYG  126



>ref|XP_002522545.1| pyruvate decarboxylase, putative [Ricinus communis]
 gb|EEF39845.1| pyruvate decarboxylase, putative [Ricinus communis]
Length=589

 Score =   162 bits (409),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 96/104 (92%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +1

Query  208  TLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyara  387
            TLG HLARRLV+IGV DVFSVPGDFNLTLLDHLIAEP L LIGCCNELNAGYAADGYAR+
Sbjct  28   TLGGHLARRLVEIGVKDVFSVPGDFNLTLLDHLIAEPELNLIGCCNELNAGYAADGYARS  87

Query  388  rgvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            RGVGACVVTFTVGGLSV+NAIAGAYSENLP+ICIVGGPNSNDYG
Sbjct  88   RGVGACVVTFTVGGLSVINAIAGAYSENLPVICIVGGPNSNDYG  131



>ref|XP_002439941.1| hypothetical protein SORBIDRAFT_09g023060 [Sorghum bicolor]
 gb|EES18371.1| hypothetical protein SORBIDRAFT_09g023060 [Sorghum bicolor]
Length=609

 Score =   162 bits (409),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 94/103 (91%), Positives = 100/103 (97%), Gaps = 0/103 (0%)
 Frame = +1

Query  211  LGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgyarar  390
            LGRHLARRLVQIG +DVF+VPGDFNLTLLD+LIAEPGL L+GCCNELNAGYAADGYAR+R
Sbjct  49   LGRHLARRLVQIGASDVFAVPGDFNLTLLDYLIAEPGLSLVGCCNELNAGYAADGYARSR  108

Query  391  gvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            GVGAC VTFTVGGLSVLNAIAGAYSENLP+ICIVGGPNSNDYG
Sbjct  109  GVGACAVTFTVGGLSVLNAIAGAYSENLPVICIVGGPNSNDYG  151



>ref|XP_003593734.1| Pyruvate decarboxylase [Medicago truncatula]
 gb|AES63985.1| pyruvate decarboxylase [Medicago truncatula]
Length=582

 Score =   161 bits (408),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 94/106 (89%), Positives = 101/106 (95%), Gaps = 0/106 (0%)
 Frame = +1

Query  202  EATLGRHLARRLVQIGVTDVFSVPGDFNLTLLDHLIAEPGLRLIGCCNELNagyaadgya  381
            + T+G HLARRLV+IGV DVFSVPGDFNLTLLDHLIAEP L L+GCCNELNAGYAADGYA
Sbjct  19   DGTMGGHLARRLVEIGVRDVFSVPGDFNLTLLDHLIAEPELNLVGCCNELNAGYAADGYA  78

Query  382  rargvgaCVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYG  519
            RA+GVGACVVTFTVGGLS+LNAIAGAYSENLP+ICIVGGPNSNDYG
Sbjct  79   RAKGVGACVVTFTVGGLSILNAIAGAYSENLPVICIVGGPNSNDYG  124



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 658693633920