BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002B20

Length=576
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_002285452.1|  PREDICTED: pre-mRNA-processing factor 19           300   1e-95   Vitis vinifera
ref|XP_011091239.1|  PREDICTED: pre-mRNA-processing factor 19-like      296   3e-94   Sesamum indicum [beniseed]
ref|XP_009759667.1|  PREDICTED: U-box domain-containing protein 7...    296   3e-94   Nicotiana sylvestris
ref|XP_003555746.1|  PREDICTED: U-box domain-containing protein 72      294   1e-93   Glycine max [soybeans]
gb|KHN24878.1|  U-box domain-containing protein 72                      294   1e-93   Glycine soja [wild soybean]
ref|XP_006342411.1|  PREDICTED: LOW QUALITY PROTEIN: pre-mRNA-pro...    294   1e-93   
ref|XP_009759666.1|  PREDICTED: U-box domain-containing protein 7...    294   2e-93   Nicotiana sylvestris
ref|XP_009594689.1|  PREDICTED: pre-mRNA-processing factor 19 hom...    293   2e-93   Nicotiana tomentosiformis
ref|XP_007145817.1|  hypothetical protein PHAVU_007G270500g             293   2e-93   Phaseolus vulgaris [French bean]
ref|XP_003535988.1|  PREDICTED: U-box domain-containing protein 7...    291   2e-92   Glycine max [soybeans]
gb|EYU43746.1|  hypothetical protein MIMGU_mgv1a004422mg                290   6e-92   Erythranthe guttata [common monkey flower]
ref|XP_002311694.1|  transducin family protein                          288   2e-91   Populus trichocarpa [western balsam poplar]
ref|XP_011029750.1|  PREDICTED: pre-mRNA-processing factor 19 hom...    288   2e-91   Populus euphratica
gb|KHG28464.1|  Pre-mRNA-processing factor 19 -like protein             286   1e-90   Gossypium arboreum [tree cotton]
emb|CDO99306.1|  unnamed protein product                                286   2e-90   Coffea canephora [robusta coffee]
gb|KJB38355.1|  hypothetical protein B456_006G251300                    286   2e-90   Gossypium raimondii
gb|AFK41051.1|  unknown                                                 285   5e-90   Medicago truncatula
ref|XP_009775901.1|  PREDICTED: pre-mRNA-processing factor 19 hom...    285   6e-90   Nicotiana sylvestris
gb|KDP33313.1|  hypothetical protein JCGZ_12862                         284   1e-89   Jatropha curcas
gb|KJB12604.1|  hypothetical protein B456_002G026500                    281   1e-89   Gossypium raimondii
ref|XP_007035246.1|  MOS4-associated complex 3A                         283   3e-89   
ref|XP_006354435.1|  PREDICTED: U-box domain-containing protein 7...    283   3e-89   Solanum tuberosum [potatoes]
gb|KJB12606.1|  hypothetical protein B456_002G026500                    280   3e-89   Gossypium raimondii
gb|KJB38357.1|  hypothetical protein B456_006G251300                    282   5e-89   Gossypium raimondii
gb|KJB12602.1|  hypothetical protein B456_002G026500                    280   5e-89   Gossypium raimondii
ref|XP_010670940.1|  PREDICTED: pre-mRNA-processing factor 19           282   5e-89   Beta vulgaris subsp. vulgaris [field beet]
gb|EPS73033.1|  hypothetical protein M569_01722                         280   7e-89   Genlisea aurea
ref|XP_004247768.1|  PREDICTED: U-box domain-containing protein 72      281   8e-89   Solanum lycopersicum
ref|XP_008245266.1|  PREDICTED: U-box domain-containing protein 7...    281   1e-88   Prunus mume [ume]
gb|KJB12605.1|  hypothetical protein B456_002G026500                    280   1e-88   Gossypium raimondii
gb|KDO43336.1|  hypothetical protein CISIN_1g009763mg                   280   2e-88   Citrus sinensis [apfelsine]
gb|KJB12601.1|  hypothetical protein B456_002G026500                    280   3e-88   Gossypium raimondii
ref|XP_006420336.1|  hypothetical protein CICLE_v10004724mg             280   5e-88   Citrus clementina [clementine]
ref|XP_004296409.1|  PREDICTED: pre-mRNA-processing factor 19-like      279   1e-87   Fragaria vesca subsp. vesca
ref|XP_004497808.1|  PREDICTED: pre-mRNA-processing factor 19 hom...    279   1e-87   Cicer arietinum [garbanzo]
ref|XP_007221798.1|  hypothetical protein PRUPE_ppa003451mg             280   2e-87   
ref|XP_006418122.1|  hypothetical protein EUTSA_v10007366mg             278   2e-87   Eutrema salsugineum [saltwater cress]
ref|XP_011041438.1|  PREDICTED: pre-mRNA-processing factor 19 hom...    277   5e-87   Populus euphratica
gb|KHG10431.1|  Pre-mRNA-processing factor 19 -like protein             276   8e-87   Gossypium arboreum [tree cotton]
ref|XP_002314503.2|  transducin family protein                          276   9e-87   
gb|KFK42789.1|  hypothetical protein AALP_AA1G039400                    276   1e-86   Arabis alpina [alpine rockcress]
ref|XP_002528359.1|  Pre-mRNA-splicing factor, putative                 276   2e-86   Ricinus communis
emb|CDY23752.1|  BnaC04g43700D                                          275   2e-86   Brassica napus [oilseed rape]
gb|KFK42788.1|  hypothetical protein AALP_AA1G039400                    275   2e-86   Arabis alpina [alpine rockcress]
ref|XP_010542962.1|  PREDICTED: pre-mRNA-processing factor 19 hom...    275   2e-86   Tarenaya hassleriana [spider flower]
ref|XP_002889510.1|  transducin family protein                          275   3e-86   Arabidopsis lyrata subsp. lyrata
ref|XP_009357978.1|  PREDICTED: U-box domain-containing protein 7...    274   3e-86   Pyrus x bretschneideri [bai li]
ref|XP_008340661.1|  PREDICTED: U-box domain-containing protein 7...    273   4e-86   
ref|XP_009357977.1|  PREDICTED: U-box domain-containing protein 7...    274   6e-86   Pyrus x bretschneideri [bai li]
ref|XP_010023847.1|  PREDICTED: pre-mRNA-processing factor 19 hom...    274   6e-86   Eucalyptus grandis [rose gum]
ref|XP_008340660.1|  PREDICTED: U-box domain-containing protein 7...    274   8e-86   
ref|XP_003590128.1|  Pre-mRNA-processing factor-like protein            273   1e-85   
emb|CDY37731.1|  BnaA04g19370D                                          273   2e-85   Brassica napus [oilseed rape]
ref|XP_010469490.1|  PREDICTED: pre-mRNA-processing factor 19 hom...    273   2e-85   
ref|XP_008362339.1|  PREDICTED: U-box domain-containing protein 7...    273   2e-85   
ref|XP_010413886.1|  PREDICTED: pre-mRNA-processing factor 19 hom...    273   2e-85   Camelina sativa [gold-of-pleasure]
ref|XP_010522453.1|  PREDICTED: pre-mRNA-processing factor 19 hom...    273   2e-85   Tarenaya hassleriana [spider flower]
ref|NP_563708.1|  MOS4-associated complex 3A                            273   3e-85   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009334193.1|  PREDICTED: U-box domain-containing protein 7...    272   3e-85   Pyrus x bretschneideri [bai li]
ref|NP_001030958.1|  MOS4-associated complex 3A                         273   3e-85   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010413887.1|  PREDICTED: pre-mRNA-processing factor 19 hom...    272   3e-85   Camelina sativa [gold-of-pleasure]
ref|XP_010509903.1|  PREDICTED: pre-mRNA-processing factor 19 hom...    272   5e-85   Camelina sativa [gold-of-pleasure]
ref|XP_010469491.1|  PREDICTED: pre-mRNA-processing factor 19 hom...    271   8e-85   
ref|XP_006410473.1|  hypothetical protein EUTSA_v10016510mg             271   8e-85   Eutrema salsugineum [saltwater cress]
ref|XP_006307243.1|  hypothetical protein CARUB_v10008852mg             271   1e-84   Capsella rubella
ref|XP_009141306.1|  PREDICTED: pre-mRNA-processing factor 19 hom...    270   2e-84   Brassica rapa
ref|XP_010089218.1|  U-box domain-containing protein 72                 270   7e-84   
ref|NP_001031471.1|  U-box protein MAC3B                                268   8e-84   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010483893.1|  PREDICTED: pre-mRNA-processing factor 19 hom...    268   9e-84   Camelina sativa [gold-of-pleasure]
ref|XP_008801251.1|  PREDICTED: U-box domain-containing protein 7...    268   1e-83   Phoenix dactylifera
ref|XP_006854430.1|  hypothetical protein AMTR_s00039p00212570          269   1e-83   Amborella trichopoda
ref|XP_002881277.1|  transducin family protein                          269   1e-83   
gb|KJB28535.1|  hypothetical protein B456_005G053600                    268   1e-83   Gossypium raimondii
gb|AAB80652.1|  putative PRP19-like spliceosomal protein                268   2e-83   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009119290.1|  PREDICTED: pre-mRNA-processing factor 19 hom...    268   2e-83   Brassica rapa
ref|NP_850206.4|  U-box protein MAC3B                                   268   2e-83   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008438467.1|  PREDICTED: U-box domain-containing protein 72      267   3e-83   Cucumis melo [Oriental melon]
emb|CDX89818.1|  BnaA10g02640D                                          267   3e-83   
ref|XP_010934240.1|  PREDICTED: pre-mRNA-processing factor 19-like      266   6e-83   
ref|XP_010920296.1|  PREDICTED: pre-mRNA-processing factor 19-like      266   8e-83   Elaeis guineensis
ref|XP_004134043.1|  PREDICTED: U-box domain-containing protein 7...    266   9e-83   Cucumis sativus [cucumbers]
ref|XP_009382203.1|  PREDICTED: U-box domain-containing protein 7...    265   2e-82   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010457499.1|  PREDICTED: pre-mRNA-processing factor 19 hom...    265   3e-82   Camelina sativa [gold-of-pleasure]
ref|XP_006410472.1|  hypothetical protein EUTSA_v10016510mg             264   6e-82   
emb|CDY19484.1|  BnaC04g11150D                                          266   8e-82   Brassica napus [oilseed rape]
ref|XP_006294009.1|  hypothetical protein CARUB_v10022997mg             263   8e-82   Capsella rubella
ref|XP_009143870.1|  PREDICTED: pre-mRNA-processing factor 19 hom...    263   1e-81   Brassica rapa
ref|XP_010475111.1|  PREDICTED: pre-mRNA-processing factor 19 hom...    263   2e-81   Camelina sativa [gold-of-pleasure]
ref|XP_008785160.1|  PREDICTED: U-box domain-containing protein 7...    261   1e-80   Phoenix dactylifera
emb|CDY18239.1|  BnaC05g02620D                                          259   8e-80   Brassica napus [oilseed rape]
gb|ADE76270.1|  unknown                                                 257   2e-79   Picea sitchensis
ref|XP_002464506.1|  hypothetical protein SORBIDRAFT_01g019790          257   3e-79   
gb|EEC67131.1|  hypothetical protein OsI_33953                          253   4e-78   Oryza sativa Indica Group [Indian rice]
ref|XP_010276202.1|  PREDICTED: U-box domain-containing protein 7...    253   9e-78   Nelumbo nucifera [Indian lotus]
ref|NP_001064804.1|  Os10g0466300                                       253   1e-77   
gb|ADE75987.1|  unknown                                                 252   3e-77   Picea sitchensis
ref|XP_009411388.1|  PREDICTED: U-box domain-containing protein 72      252   3e-77   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMT08986.1|  Pre-mRNA-processing factor 19-2-like protein            245   5e-77   
ref|XP_003574025.1|  PREDICTED: U-box domain-containing protein 72      250   1e-76   Brachypodium distachyon [annual false brome]
ref|XP_004982929.1|  PREDICTED: U-box domain-containing protein 7...    249   5e-76   Setaria italica
ref|NP_001150622.1|  pre-mRNA-splicing factor 19                        248   9e-76   Zea mays [maize]
ref|XP_009111097.1|  PREDICTED: LOW QUALITY PROTEIN: pre-mRNA-pro...    247   2e-75   Brassica rapa
emb|CDY15510.1|  BnaA08g27940D                                          247   3e-75   Brassica napus [oilseed rape]
ref|NP_001130751.1|  uncharacterized protein LOC100191855               245   1e-74   Zea mays [maize]
gb|AGH13207.1|  PUB1                                                    244   4e-74   Triticum aestivum [Canadian hard winter wheat]
gb|EMS65878.1|  U-box domain-containing protein 72                      245   7e-74   Triticum urartu
ref|XP_003558846.1|  PREDICTED: U-box domain-containing protein 7...    241   3e-73   Brachypodium distachyon [annual false brome]
ref|XP_001763879.1|  predicted protein                                  232   1e-69   
ref|XP_009605789.1|  PREDICTED: pre-mRNA-processing factor 19 hom...    219   2e-69   Nicotiana tomentosiformis
ref|XP_001754673.1|  predicted protein                                  230   4e-69   
ref|XP_002966895.1|  ubiquitin-protein ligase, PUB59                    228   2e-68   
ref|XP_002961116.1|  ubiquitin-protein ligase, PUB59                    228   4e-68   Selaginella moellendorffii
gb|EMS55665.1|  U-box domain-containing protein 72                      226   6e-67   Triticum urartu
ref|XP_004172579.1|  PREDICTED: pre-mRNA-processing factor 19 hom...    209   2e-63   
emb|CAN68859.1|  hypothetical protein VITISV_023023                     201   3e-61   Vitis vinifera
ref|XP_011013445.1|  PREDICTED: pre-mRNA-processing factor 19-like      206   2e-60   Populus euphratica
gb|AFW70863.1|  hypothetical protein ZEAMMB73_121693                    184   4e-54   
gb|KIZ01721.1|  pre-mRNA-processing factor 19                           186   5e-54   Monoraphidium neglectum
ref|XP_006661845.1|  PREDICTED: U-box domain-containing protein 7...    186   1e-52   
ref|XP_005643652.1|  spliceosome component, nuclear pre-mRNA spli...    186   2e-52   Coccomyxa subellipsoidea C-169
gb|EMT10525.1|  DEAD-box ATP-dependent RNA helicase 29                  191   4e-52   
gb|AAB70423.1|  F19P19.2                                                184   3e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_642890.1|  WD40 repeat-containing protein                        182   7e-51   Dictyostelium discoideum AX4
ref|XP_009594697.1|  PREDICTED: U-box domain-containing protein 7...    181   1e-50   
ref|XP_002500515.1|  predicted protein                                  180   3e-50   Micromonas commoda
ref|XP_009759668.1|  PREDICTED: U-box domain-containing protein 7...    180   4e-50   Nicotiana sylvestris
ref|XP_003283650.1|  hypothetical protein DICPUDRAFT_96440              180   5e-50   Dictyostelium purpureum
ref|XP_001426454.1|  hypothetical protein                               179   7e-50   Paramecium tetraurelia strain d4-2
ref|XP_009041163.1|  hypothetical protein AURANDRAFT_39132              179   9e-50   Aureococcus anophagefferens
ref|XP_009040599.1|  hypothetical protein AURANDRAFT_55101              175   4e-49   Aureococcus anophagefferens
gb|EAR89590.2|  Pre-mRNA-processing factor, putative                    177   4e-49   Tetrahymena thermophila SB210
ref|XP_001701820.1|  spliceosome component, nuclear pre-mRNA spli...    177   5e-49   Chlamydomonas reinhardtii
gb|EXX73176.1|  E3 ubiquitin-protein ligase PRP19                       177   7e-49   Rhizophagus irregularis DAOM 197198w
ref|XP_002340278.1|  cell cycle control protein (Cwf8), putative        174   4e-48   Talaromyces stipitatus ATCC 10500
ref|XP_001456947.1|  hypothetical protein                               174   7e-48   Paramecium tetraurelia strain d4-2
ref|XP_009011512.1|  hypothetical protein HELRODRAFT_186274             174   8e-48   Helobdella robusta
gb|ELR09720.1|  hypothetical protein GMDG_04206                         173   8e-48   Pseudogymnoascus destructans 20631-21
gb|EPZ30796.1|  U box domain-containing protein                         164   9e-48   Rozella allomycis CSF55
ref|XP_002340279.1|  cell cycle control protein (Cwf8), putative        174   9e-48   Talaromyces stipitatus ATCC 10500
ref|XP_001455246.1|  hypothetical protein                               173   1e-47   Paramecium tetraurelia strain d4-2
gb|KFZ15491.1|  hypothetical protein V501_02685                         172   1e-47   Pseudogymnoascus sp. VKM F-4519 (FW-2642)
gb|ETW32415.1|  hypothetical protein PFFCH_00153                        174   1e-47   Plasmodium falciparum FCH/4
gb|AFW68634.1|  hypothetical protein ZEAMMB73_254634                    172   2e-47   
gb|KFY76130.1|  hypothetical protein V499_04060                         172   2e-47   Pseudogymnoascus sp. VKM F-103
ref|XP_001009835.1|  hypothetical protein TTHERM_00161050               174   2e-47   
gb|KGO75749.1|  Zinc finger, RING/FYVE/PHD-type                         172   2e-47   Penicillium italicum
emb|CDO62513.1|  pre-mRNA-processing factor 19, putative                173   2e-47   Plasmodium reichenowi
ref|XP_002567398.1|  Pc21g03340                                         172   2e-47   Penicillium rubens Wisconsin 54-1255
ref|XP_001437995.1|  hypothetical protein                               172   2e-47   Paramecium tetraurelia strain d4-2
ref|XP_002848472.1|  cell cycle control protein cwf8                    172   3e-47   Microsporum canis CBS 113480
gb|EEH09948.1|  cell cycle control protein                              172   3e-47   Histoplasma capsulatum G186AR
gb|EGC44417.1|  ubiquitin-protein ligase E4                             172   3e-47   Histoplasma capsulatum H88
emb|CEG80296.1|  Putative Pre-mRNA-processing factor 19                 170   3e-47   Rhizopus microsporus
gb|KFX51269.1|  Pre-mRNA-splicing factor cwf8                           171   4e-47   Talaromyces marneffei PM1
ref|XP_001351160.1|  PRP19-like protein, putative                       172   5e-47   Plasmodium falciparum 3D7
gb|EUR80965.1|  hypothetical protein PFBG_00330                         172   5e-47   Plasmodium falciparum 7G8
emb|CBK23997.2|  unnamed protein product                                171   6e-47   Blastocystis hominis
emb|CEI90047.1|  Putative Pre-mRNA-processing factor 19                 171   7e-47   Rhizopus microsporus
gb|KFM80282.1|  Pre-mRNA-processing factor 19                           162   7e-47   Stegodyphus mimosarum
gb|KGO60216.1|  Zinc finger, RING/FYVE/PHD-type                         171   8e-47   Penicillium expansum
ref|XP_010762278.1|  hypothetical protein PADG_06901                    171   8e-47   Paracoccidioides brasiliensis Pb18
gb|KGO41547.1|  Zinc finger, RING/FYVE/PHD-type                         171   8e-47   Penicillium expansum
dbj|GAM34593.1|  hypothetical protein TCE0_015f02271                    171   8e-47   Talaromyces cellulolyticus
ref|XP_002795874.1|  cell cycle control protein cwf8                    171   9e-47   Paracoccidioides lutzii Pb01
gb|KFH68916.1|  hypothetical protein MVEG_05720                         171   9e-47   Mortierella verticillata NRRL 6337
ref|XP_002948553.1|  hypothetical protein VOLCADRAFT_80185              171   9e-47   Volvox carteri f. nagariensis
gb|EKV05742.1|  Cell cycle control protein (Cwf8), putative             170   1e-46   Penicillium digitatum Pd1
gb|EZF27930.1|  hypothetical protein H100_00174                         168   1e-46   Trichophyton rubrum MR850
gb|KFZ10979.1|  hypothetical protein V502_07803                         170   1e-46   Pseudogymnoascus sp. VKM F-4520 (FW-2644)
gb|KFY35697.1|  hypothetical protein V494_05699                         170   1e-46   Pseudogymnoascus sp. VKM F-4513 (FW-928)
gb|ESA02174.1|  hypothetical protein GLOINDRAFT_6770                    171   2e-46   
dbj|GAM20395.1|  hypothetical protein SAMD00019534_035700               170   2e-46   Acytostelium subglobosum LB1
emb|CDM31028.1|  Zinc finger, RING/FYVE/PHD-type                        170   2e-46   Penicillium roqueforti FM164
gb|KFY22183.1|  hypothetical protein V493_06788                         169   2e-46   Pseudogymnoascus sp. VKM F-4281 (FW-2241)
gb|EER38786.1|  ubiquitin-protein ligase E4                             169   2e-46   Histoplasma capsulatum H143
emb|CEG68152.1|  Putative Pre-mRNA-processing factor 19                 170   3e-46   Rhizopus microsporus
ref|XP_008625985.1|  pre-mRNA-processing factor 19                      170   3e-46   Plasmodium vinckei vinckei
ref|XP_003698766.1|  PREDICTED: pre-mRNA-processing factor 19           170   3e-46   Apis florea [dwarf honeybee]
ref|XP_392284.2|  PREDICTED: pre-mRNA-processing factor 19              169   3e-46   Apis mellifera [bee]
gb|EUD70798.1|  pre-mRNA-processing factor 19                           169   3e-46   Plasmodium vinckei petteri
ref|XP_007839473.1|  hypothetical protein PFICI_12701                   169   3e-46   Pestalotiopsis fici W106-1
ref|XP_743082.1|  hypothetical protein                                  169   3e-46   Plasmodium chabaudi chabaudi
ref|XP_003394205.1|  PREDICTED: pre-mRNA-processing factor 19-like      169   3e-46   
gb|KIW64512.1|  hypothetical protein PV04_09440                         169   3e-46   Phialophora americana
ref|XP_005843657.1|  hypothetical protein CHLNCDRAFT_140025             169   3e-46   Chlorella variabilis
ref|XP_007873530.1|  hypothetical protein PNEG_01576                    169   4e-46   Pneumocystis murina B123
dbj|GAD93209.1|  cell cycle control protein                             169   4e-46   Byssochlamys spectabilis No. 5
ref|XP_008473784.1|  PREDICTED: pre-mRNA-processing factor 19-like      161   4e-46   
gb|EGD96657.1|  cell cycle control protein                              169   5e-46   Trichophyton tonsurans CBS 112818
ref|XP_001542335.1|  conserved hypothetical protein                     169   5e-46   Histoplasma capsulatum NAm1
gb|EPS32364.1|  hypothetical protein PDE_07324                          169   5e-46   Penicillium oxalicum 114-2
ref|XP_001552539.1|  hypothetical protein BC1G_08404                    169   5e-46   Botrytis cinerea B05.10
ref|XP_007285232.1|  cell cycle control protein                         169   5e-46   
gb|EFA82568.1|  WD40 repeat-containing protein                          169   5e-46   Heterostelium album PN500
gb|EQB48268.1|  hypothetical protein CGLO_12519                         168   6e-46   Colletotrichum gloeosporioides Cg-14
gb|EQL37776.1|  pre-mRNA-processing factor 19                           168   6e-46   Blastomyces dermatitidis ATCC 26199
gb|EEQ89951.1|  cell cycle control protein                              168   6e-46   Blastomyces dermatitidis ER-3
ref|XP_002621271.1|  cell cycle control protein                         168   6e-46   Blastomyces gilchristii SLH14081
gb|EGE80994.1|  cell cycle control protein                              168   6e-46   Blastomyces dermatitidis ATCC 18188
ref|XP_001239734.1|  hypothetical protein CIMG_09355                    168   6e-46   Coccidioides immitis RS
ref|XP_787949.3|  PREDICTED: pre-mRNA-processing factor 19              169   7e-46   
ref|XP_003231017.1|  cell cycle control protein                         169   8e-46   Trichophyton rubrum CBS 118892
ref|XP_003067278.1|  WD domain, G-beta repeat containing protein        168   8e-46   Coccidioides posadasii C735 delta SOWgp
gb|EZF32247.1|  hypothetical protein H101_04159                         169   8e-46   Trichophyton interdigitale H6
emb|CCF46222.1|  hypothetical protein CH063_03812                       168   9e-46   Colletotrichum higginsianum
gb|ESZ95262.1|  putative Pre-mRNA-processing factor 19 like protein     168   9e-46   Sclerotinia borealis F-4128
ref|XP_003701647.1|  PREDICTED: pre-mRNA-processing factor 19           168   1e-45   Megachile rotundata
ref|XP_970005.1|  PREDICTED: pre-mRNA-processing factor 19              167   1e-45   Tribolium castaneum [rust-red flour beetle]
ref|XP_007597798.1|  hypothetical protein CFIO01_11021                  167   2e-45   
ref|XP_730217.1|  hypothetical protein                                  167   2e-45   Plasmodium yoelii
gb|KFG80204.1|  cell cycle control protein                              167   2e-45   Metarhizium anisopliae
dbj|GAA90727.1|  cell cycle control protein                             167   2e-45   Aspergillus kawachii IFO 4308
gb|KID78304.1|  cell cycle control protein                              167   2e-45   Metarhizium brunneum ARSEF 3297
gb|KID92673.1|  cell cycle control protein                              167   2e-45   Metarhizium guizhouense ARSEF 977
ref|XP_007818610.1|  cell cycle control protein                         167   2e-45   Metarhizium robertsii ARSEF 23
ref|XP_001401121.1|  cell cycle control protein (Cwf8)                  167   2e-45   Aspergillus niger CBS 513.88
gb|KIE01641.1|  cell cycle control protein                              167   3e-45   Metarhizium majus ARSEF 297
emb|CDS05955.1|  hypothetical protein LRAMOSA08483                      167   3e-45   Lichtheimia ramosa
gb|EFQ36117.1|  hypothetical protein GLRG_11261                         166   3e-45   Colletotrichum graminicola M1.001
ref|XP_680256.1|  hypothetical protein                                  167   3e-45   Plasmodium berghei ANKA
ref|XP_003170434.1|  cell cycle control protein cwf8                    166   3e-45   Nannizzia gypsea CBS 118893
ref|XP_003716887.1|  cell cycle control protein                         167   3e-45   Magnaporthe oryzae 70-15
ref|XP_001595475.1|  hypothetical protein SS1G_03564                    166   3e-45   Sclerotinia sclerotiorum 1980 UF-70
ref|XP_664510.1|  hypothetical protein AN6906.2                         166   5e-45   Aspergillus nidulans FGSC A4
gb|KFY85883.1|  hypothetical protein V500_08057                         168   5e-45   Pseudogymnoascus sp. VKM F-4518 (FW-2643)
ref|XP_011127669.1|  hypothetical protein AOL_s00215g165                165   8e-45   Arthrobotrys oligospora ATCC 24927
gb|KDO43335.1|  hypothetical protein CISIN_1g009763mg                   166   8e-45   Citrus sinensis [apfelsine]
ref|XP_002734121.1|  PREDICTED: pre-mRNA-processing factor 19           166   8e-45   Saccoglossus kowalevskii
emb|CDH60390.1|  pre-mrna-processing factor 19                          166   9e-45   Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_002340280.1|  cell cycle control protein (Cwf8), putative        165   1e-44   Talaromyces stipitatus ATCC 10500
emb|CCG82061.1|  putative Cell cycle control protein                    167   1e-44   Taphrina deformans PYCC 5710
ref|XP_002145102.1|  cell cycle control protein (Cwf8), putative        168   1e-44   Talaromyces marneffei ATCC 18224
gb|ENN74961.1|  hypothetical protein YQE_08537                          165   1e-44   Dendroctonus ponderosae
ref|XP_007807925.1|  cell cycle control protein                         165   1e-44   Metarhizium acridum CQMa 102
ref|XP_005102524.1|  PREDICTED: LOW QUALITY PROTEIN: pre-mRNA-pro...    165   1e-44   
ref|XP_005835857.1|  hypothetical protein GUITHDRAFT_93577              165   2e-44   Guillardia theta CCMP2712
gb|EXK40135.1|  pre-mRNA-processing factor 19                           164   2e-44   Fusarium oxysporum f. sp. melonis 26406
gb|EXA45673.1|  pre-mRNA-processing factor 19                           164   2e-44   Fusarium oxysporum f. sp. pisi HDV247
gb|EWZ38067.1|  pre-mRNA-processing factor 19                           164   2e-44   Fusarium oxysporum Fo47
gb|EGU87554.1|  hypothetical protein FOXB_01936                         164   2e-44   Fusarium oxysporum Fo5176
emb|CCT69373.1|  related to non-snRNP spliceosome component (pre-...    164   2e-44   Fusarium fujikuroi IMI 58289
ref|XP_004222194.1|  WD domain G-beta repeat domain containing pr...    164   2e-44   Plasmodium cynomolgi strain B
ref|XP_008712665.1|  hypothetical protein HMPREF1541_09770              164   2e-44   Cyphellophora europaea CBS 101466
gb|EWY91404.1|  pre-mRNA-processing factor 19                           164   2e-44   Fusarium oxysporum FOSC 3-a
gb|EFN66997.1|  Pre-mRNA-processing factor 19                           164   3e-44   Camponotus floridanus
gb|KHO01235.1|  cell cycle control protein                              164   3e-44   Metarhizium album ARSEF 1941
emb|CEJ91799.1|  Putative Cell cycle control protein cwf8               164   3e-44   Torrubiella hemipterigena
gb|KGQ10077.1|  Pre-mRNA-processing factor 19                           164   3e-44   Beauveria bassiana D1-5
gb|ENH86632.1|  cell cycle control protein                              164   3e-44   
ref|XP_008730521.1|  hypothetical protein G647_07987                    164   3e-44   Cladophialophora carrionii CBS 160.54
gb|KDD75836.1|  Prp19/Pso4-like protein                                 155   3e-44   Helicosporidium sp. ATCC 50920
ref|XP_011056574.1|  PREDICTED: pre-mRNA-processing factor 19           164   3e-44   Acromyrmex echinatior
ref|XP_008595762.1|  cell cycle control protein cwf8                    164   3e-44   Beauveria bassiana ARSEF 2860
ref|XP_009222769.1|  spliceosome component                              164   3e-44   Gaeumannomyces tritici R3-111a-1
gb|EFX80977.1|  hypothetical protein DAPPUDRAFT_303758                  164   3e-44   Daphnia pulex
gb|KIL96025.1|  hypothetical protein FAVG1_00764                        164   4e-44   Fusarium avenaceum
ref|XP_003247938.1|  PREDICTED: pre-mRNA-processing factor 19           164   4e-44   Acyrthosiphon pisum
gb|KIW90870.1|  hypothetical protein Z519_08653                         164   4e-44   Cladophialophora bantiana CBS 173.52
ref|XP_003056173.1|  predicted protein                                  164   4e-44   Micromonas pusilla CCMP1545
gb|EWG49486.1|  pre-mRNA-processing factor 19                           163   4e-44   Fusarium verticillioides 7600
ref|XP_011258220.1|  PREDICTED: pre-mRNA-processing factor 19           164   5e-44   Camponotus floridanus
gb|KFY57628.1|  hypothetical protein V496_06371                         163   5e-44   Pseudogymnoascus sp. VKM F-4515 (FW-2607)
ref|XP_001639467.1|  predicted protein                                  164   6e-44   Nematostella vectensis
ref|XP_007584015.1|  putative cell cycle control protein                163   6e-44   
gb|KDB12528.1|  cell cycle control protein                              163   6e-44   Ustilaginoidea virens
ref|XP_002841136.1|  hypothetical protein                               164   6e-44   Tuber melanosporum Mel28
gb|EHA27910.1|  WD-40 repeat protein                                    162   7e-44   Aspergillus niger ATCC 1015
ref|XP_008210979.1|  PREDICTED: pre-mRNA-processing factor 19-like      159   7e-44   
gb|KEY72425.1|  hypothetical protein S7711_01091                        162   8e-44   Stachybotrys chartarum IBT 7711
gb|KFA54299.1|  hypothetical protein S40293_04846                       162   8e-44   Stachybotrys chartarum IBT 40293
ref|XP_007785029.1|  hypothetical protein W97_08972                     162   8e-44   Coniosporium apollinis CBS 100218
ref|XP_001728133.1|  cell cycle control protein                         162   9e-44   Neurospora crassa OR74A
ref|XP_002599552.1|  hypothetical protein BRAFLDRAFT_121774             163   9e-44   Branchiostoma floridae
ref|XP_008557005.1|  PREDICTED: pre-mRNA-processing factor 19           163   9e-44   
gb|KIN04243.1|  hypothetical protein OIDMADRAFT_178288                  162   1e-43   Oidiodendron maius Zn
gb|KFA66026.1|  hypothetical protein S40285_03694                       162   1e-43   Stachybotrys chlorohalonata IBT 40285
gb|EPB92846.1|  hypothetical protein HMPREF1544_00285                   163   1e-43   Mucor circinelloides f. circinelloides 1006PhL
gb|EWZ82636.1|  pre-mRNA-processing factor 19                           162   1e-43   Fusarium oxysporum f. sp. lycopersici MN25
emb|CEP09201.1|  hypothetical protein                                   162   1e-43   Parasitella parasitica
ref|XP_004996037.1|  hypothetical protein PTSG_03452                    162   1e-43   
ref|XP_011506467.1|  PREDICTED: pre-mRNA-processing factor 19           162   1e-43   
ref|XP_007289687.1|  ubiquitin-protein ligase E4                        162   1e-43   
ref|XP_001824196.1|  cell cycle control protein (Cwf8)                  162   1e-43   
ref|XP_003350345.1|  hypothetical protein SMAC_02058                    162   1e-43   
ref|XP_002381289.1|  cell cycle control protein (Cwf8), putative        162   1e-43   
gb|KIW33498.1|  hypothetical protein PV07_00344                         162   1e-43   
ref|XP_002258960.1|  hypothetical protein                               162   1e-43   
ref|XP_008817739.1|  pre-mRNA-processing factor 19                      162   1e-43   
ref|XP_009850464.1|  hypothetical protein NEUTE1DRAFT_145973            162   1e-43   
ref|XP_011318660.1|  hypothetical protein FGSG_02706                    162   2e-43   
ref|XP_009257897.1|  hypothetical protein FPSE_06504                    162   2e-43   
ref|XP_001215335.1|  conserved hypothetical protein                     162   2e-43   
ref|XP_011166575.1|  PREDICTED: pre-mRNA-processing factor 19           162   2e-43   
gb|KIY04004.1|  hypothetical protein Z520_00696                         162   2e-43   
ref|XP_001650919.1|  AAEL015199-PA                                      162   2e-43   
ref|XP_007761190.1|  pre-mRNA-processing factor 19                      161   2e-43   
ref|XP_011107459.1|  hypothetical protein H072_1467                     161   2e-43   
gb|ETN59627.1|  wd-repeat protein                                       162   2e-43   
ref|XP_011140499.1|  PREDICTED: pre-mRNA-processing factor 19           161   3e-43   
gb|EDP52087.1|  cell cycle control protein (Cwf8), putative             161   3e-43   
gb|KEY77882.1|  cell cycle control protein Cwf8                         161   3e-43   
ref|XP_006667363.1|  cell cycle control protein                         161   4e-43   
ref|XP_753303.1|  cell cycle control protein (Cwf8)                     161   4e-43   
gb|AAW26299.1|  SJCHGC06229 protein                                     162   4e-43   
ref|XP_003045176.1|  predicted protein                                  160   4e-43   
emb|CCX34447.1|  Similar to Pre-mRNA-processing factor 19 homolog...    160   4e-43   
ref|XP_001259336.1|  cell cycle control protein (Cwf8), putative        160   5e-43   
ref|XP_009170736.1|  hypothetical protein T265_07048                    162   5e-43   
ref|XP_007922907.1|  hypothetical protein MYCFIDRAFT_84506              160   5e-43   
dbj|GAN08501.1|  cell cycle control protein cwf8                        160   5e-43   
emb|CDX86629.1|  BnaC08g00740D                                          161   6e-43   
emb|CCE27477.1|  related to non-snRNP spliceosome component (pre-...    160   7e-43   
dbj|GAA35974.2|  pre-mRNA-processing factor 19                          161   7e-43   
ref|XP_001613106.1|  WD domain, G-beta repeat domain containing p...    160   7e-43   
gb|ELU08451.1|  hypothetical protein CAPTEDRAFT_184443                  160   8e-43   
ref|XP_002163985.1|  PREDICTED: pre-mRNA-processing factor 19-like      160   8e-43   
gb|EHJ74005.1|  wd-repeat protein                                       160   8e-43   
gb|KFY81908.1|  hypothetical protein V498_08687                         162   9e-43   
gb|ERS97395.1|  hypothetical protein HMPREF1624_05562                   160   9e-43   
ref|XP_004030813.1|  nucleotide binding ubiquitin-protein ligase,...    151   1e-42   
gb|KIH89782.1|  pre-mRNA-processing factor 19                           160   1e-42   
gb|EYE92971.1|  putative cell cycle control protein                     159   1e-42   
gb|KEQ64029.1|  cell cycle control protein                              159   1e-42   
ref|XP_308568.4|  AGAP007217-PA                                         160   1e-42   
ref|XP_005708128.1|  nucleotide binding / ubiquitin-protein ligase      160   1e-42   
ref|XP_004367929.1|  hypothetical protein ACA1_289060                   160   1e-42   
ref|XP_008368345.1|  PREDICTED: pre-mRNA-processing factor 19 hom...    149   2e-42   
gb|EIE91863.1|  hypothetical protein RO3G_16574                         159   2e-42   
gb|EIE90762.1|  hypothetical protein RO3G_15473                         157   2e-42   
gb|KIW03850.1|  hypothetical protein PV09_05149                         159   2e-42   
dbj|BAN21021.1|  WD-repeat protein                                      159   2e-42   
ref|XP_009494888.1|  hypothetical protein H696_02706                    159   2e-42   
gb|EDM12852.1|  PRP19/PSO4 pre-mRNA processing factor 19 homolog ...    150   2e-42   
ref|XP_001416612.1|  predicted protein                                  159   2e-42   
ref|XP_011350730.1|  PREDICTED: LOW QUALITY PROTEIN: pre-mRNA-pro...    159   2e-42   
gb|KEQ84490.1|  cell cycle control protein                              159   2e-42   
ref|XP_004360339.1|  WD40 repeat-containing protein                     159   3e-42   
gb|KDN61410.1|  hypothetical protein CSUB01_00731                       162   3e-42   
ref|XP_007789925.1|  putative cell cycle control protein                158   3e-42   
gb|KEF53525.1|  pre-mRNA-processing factor 19                           159   3e-42   
gb|EMF15051.1|  cell cycle control protein                              158   3e-42   
gb|ACO15013.1|  Pre-mRNA-processing factor 19                           159   3e-42   
emb|CDS21668.1|  pre mRNA processing factor 19                          159   3e-42   
ref|XP_011448715.1|  PREDICTED: pre-mRNA-processing factor 19-like      159   3e-42   
ref|XP_003385193.1|  PREDICTED: pre-mRNA-processing factor 19-like      159   4e-42   
gb|KEQ73701.1|  WD40 repeat-like protein                                158   4e-42   
emb|CDI97389.1|  pre mRNA processing factor 19                          159   4e-42   
ref|XP_004921563.1|  PREDICTED: pre-mRNA-processing factor 19-lik...    158   4e-42   
ref|XP_001861543.1|  cell cycle control protein cwf8                    158   4e-42   
ref|XP_004921562.1|  PREDICTED: pre-mRNA-processing factor 19-lik...    158   4e-42   
ref|XP_009177959.1|  hypothetical protein T265_16154                    149   5e-42   
ref|XP_006679289.1|  hypothetical protein BATDEDRAFT_88622              158   5e-42   
gb|ETS03709.1|  cell cycle control protein                              157   6e-42   
ref|XP_007750407.1|  pre-mRNA-processing factor 19                      157   7e-42   
ref|XP_008083640.1|  WD40 repeat-like protein                           157   7e-42   
ref|XP_002115210.1|  hypothetical protein TRIADDRAFT_64168              157   8e-42   
ref|XP_006963652.1|  predicted protein                                  157   9e-42   
gb|EIT79503.1|  mRNA splicing factor                                    157   1e-41   
gb|KEQ94491.1|  hypothetical protein AUEXF2481DRAFT_5974                157   1e-41   
gb|EFX05750.1|  cell cycle control protein                              160   1e-41   
ref|XP_011308847.1|  PREDICTED: pre-mRNA-processing factor 19           157   1e-41   
gb|EHK46654.1|  hypothetical protein TRIATDRAFT_307447                  156   1e-41   
emb|CDS28534.1|  pre mRNA processing factor 19                          157   1e-41   
ref|XP_009860605.1|  PREDICTED: uncharacterized protein LOC100176108    161   1e-41   
ref|XP_003078075.1|  transducin family protein / WD-40 repeat fam...    156   2e-41   
ref|XP_003738725.1|  PREDICTED: pre-mRNA-processing factor 19-like      157   2e-41   
ref|XP_009656919.1|  cell cycle control protein cwf8                    156   2e-41   
gb|KIV93288.1|  hypothetical protein PV10_04514                         156   2e-41   
gb|EDM12850.1|  PRP19/PSO4 pre-mRNA processing factor 19 homolog ...    150   2e-41   
emb|CBJ28011.1|  conserved unknown protein                              156   3e-41   
dbj|BAE88166.1|  unnamed protein product                                149   4e-41   
gb|KDR20058.1|  Pre-mRNA-processing factor 19                           155   4e-41   
ref|XP_007912379.1|  putative cell cycle control protein                155   5e-41   
ref|XP_004537576.1|  PREDICTED: pre-mRNA-processing factor 19-like      155   5e-41   
ref|XP_011208770.1|  PREDICTED: pre-mRNA-processing factor 19           155   6e-41   
gb|KHE83770.1|  Diaminopimelate epimerase-like protein                  157   7e-41   
ref|XP_004364132.1|  Nmp200-prov protein                                155   7e-41   
ref|NP_001005435.1|  pre-mRNA processing factor 19                      154   8e-41   
gb|EGZ72427.1|  Diaminopimelate epimerase-like protein                  157   9e-41   
gb|KIW59868.1|  hypothetical protein PV05_00134                         154   1e-40   
gb|KEZ40867.1|  Cell cycle control protein                              154   1e-40   
gb|EHK20624.1|  hypothetical protein TRIVIDRAFT_77634                   154   1e-40   
gb|EPE06458.1|  cell cycle control protein                              154   1e-40   
gb|EZA46855.1|  Pre-mRNA-processing factor                              154   1e-40   
ref|XP_011177834.1|  PREDICTED: pre-mRNA-processing factor 19           154   2e-40   
gb|KIL70954.1|  hypothetical protein M378DRAFT_116365                   154   2e-40   
gb|EHL03687.1|  putative Pre-mRNA-processing factor 19 like protein     155   2e-40   
emb|CAJ81768.1|  PRP19/PSO4 pre-mRNA processing factor 19 homolog...    154   2e-40   
ref|XP_007802012.1|  hypothetical protein EPUS_06097                    157   2e-40   
ref|XP_009051549.1|  hypothetical protein LOTGIDRAFT_103711             154   2e-40   
gb|EMD88084.1|  hypothetical protein COCHEDRAFT_1197163                 153   3e-40   
gb|EME47540.1|  hypothetical protein DOTSEDRAFT_69479                   153   3e-40   
ref|XP_002619054.1|  hypothetical protein CLUG_00213                    153   3e-40   
emb|CCO27883.1|  pre-mRNA-processing factor 19                          144   3e-40   
ref|XP_003840236.1|  hypothetical protein LEMA_P110220.1                156   3e-40   
ref|XP_007674479.1|  hypothetical protein BAUCODRAFT_32416              153   3e-40   
ref|XP_007688738.1|  hypothetical protein COCMIDRAFT_97376              152   4e-40   
dbj|GAM88956.1|  hypothetical protein ANO11243_069900                   152   4e-40   
ref|XP_001905484.1|  hypothetical protein                               152   4e-40   
ref|NP_001080892.1|  pre-mRNA processing factor 19                      153   4e-40   
ref|XP_007234256.1|  PREDICTED: pre-mRNA-processing factor 19-like      152   4e-40   
gb|EUN29494.1|  hypothetical protein COCVIDRAFT_24529                   152   5e-40   
ref|XP_001936095.1|  ubiquitin-protein ligase E4                        152   5e-40   
ref|XP_007717204.1|  hypothetical protein COCCADRAFT_109016             152   5e-40   
ref|XP_007699438.1|  hypothetical protein COCSADRAFT_88462              152   5e-40   
ref|XP_003303252.1|  hypothetical protein PTT_15394                     152   5e-40   
ref|XP_003662518.1|  hypothetical protein MYCTH_107891                  155   6e-40   
gb|EWC48146.1|  hypothetical protein DRE_02250                          152   6e-40   
ref|XP_009594705.1|  PREDICTED: U-box domain-containing protein 7...    152   7e-40   
ref|NP_001034420.1|  pre-mRNA-processing factor 19                      152   7e-40   
ref|XP_009153652.1|  pre-mRNA-processing factor 19                      152   8e-40   
ref|XP_001806113.1|  hypothetical protein SNOG_15981                    152   8e-40   
ref|XP_008025148.1|  hypothetical protein SETTUDRAFT_41801              152   8e-40   
gb|KFH42593.1|  Pre-mRNA-splicing factor-like protein                   152   9e-40   
ref|XP_006011709.1|  PREDICTED: pre-mRNA-processing factor 19-lik...    152   9e-40   
ref|XP_008157811.1|  PREDICTED: pre-mRNA-processing factor 19           152   1e-39   
ref|XP_006108917.1|  PREDICTED: pre-mRNA-processing factor 19-like      151   1e-39   
emb|CCF75055.1|  unnamed protein product                                152   1e-39   
ref|XP_005865703.1|  PREDICTED: pre-mRNA-processing factor 19           151   1e-39   
ref|XP_009759669.1|  PREDICTED: U-box domain-containing protein 7...    150   1e-39   
ref|XP_005309691.1|  PREDICTED: pre-mRNA-processing factor 19           151   2e-39   
ref|XP_007431470.1|  PREDICTED: pre-mRNA-processing factor 19           151   2e-39   
ref|XP_008838944.1|  PREDICTED: pre-mRNA-processing factor 19 iso...    151   2e-39   
ref|XP_005046605.1|  PREDICTED: pre-mRNA-processing factor 19           151   2e-39   
ref|XP_003224160.1|  PREDICTED: pre-mRNA-processing factor 19           151   2e-39   
gb|KIK26558.1|  hypothetical protein PISMIDRAFT_94703                   142   2e-39   
ref|XP_005529018.1|  PREDICTED: pre-mRNA-processing factor 19           151   2e-39   
ref|XP_006993891.1|  PREDICTED: pre-mRNA-processing factor 19           151   2e-39   
ref|XP_006264655.1|  PREDICTED: pre-mRNA-processing factor 19           151   2e-39   
gb|KIX08732.1|  hypothetical protein Z518_03389                         151   2e-39   
ref|XP_007071858.1|  PREDICTED: pre-mRNA-processing factor 19           151   2e-39   
ref|XP_002191472.1|  PREDICTED: pre-mRNA-processing factor 19           151   2e-39   
gb|EPY50230.1|  ubiquitin-protein ligase E4                             151   2e-39   
ref|XP_460499.2|  DEHA2F03058p                                          151   2e-39   
ref|XP_010562552.1|  PREDICTED: pre-mRNA-processing factor 19           151   2e-39   
gb|ACC59785.1|  PRP19/PSO4 pre-mRNA processing factor 19-like pro...    151   2e-39   
ref|XP_003854891.1|  hypothetical protein MYCGRDRAFT_107996             154   2e-39   
ref|XP_002821747.1|  PREDICTED: pre-mRNA-processing factor 19           150   2e-39   
ref|XP_004874327.1|  PREDICTED: pre-mRNA-processing factor 19 iso...    151   2e-39   
ref|NP_001121929.1|  pre-mRNA-processing factor 19                      151   2e-39   
ref|XP_004646784.1|  PREDICTED: pre-mRNA-processing factor 19           150   2e-39   
gb|ETN71206.1|  WD domain, G-beta repeat protein                        150   2e-39   
ref|NP_001069108.1|  pre-mRNA-processing factor 19                      150   2e-39   
ref|XP_003802729.1|  PREDICTED: pre-mRNA-processing factor 19           150   2e-39   
ref|XP_004446538.1|  PREDICTED: pre-mRNA-processing factor 19           150   2e-39   
ref|XP_005511130.1|  PREDICTED: pre-mRNA-processing factor 19           150   2e-39   
ref|XP_004714986.1|  PREDICTED: pre-mRNA-processing factor 19           150   2e-39   
ref|XP_004667744.1|  PREDICTED: pre-mRNA-processing factor 19 iso...    150   2e-39   
ref|XP_003774058.1|  PREDICTED: pre-mRNA-processing factor 19           150   2e-39   
ref|XP_003465990.1|  PREDICTED: pre-mRNA-processing factor 19 iso...    150   2e-39   
ref|XP_003419420.1|  PREDICTED: pre-mRNA-processing factor 19           150   2e-39   
ref|NP_598890.1|  pre-mRNA-processing factor 19 isoform 2               150   3e-39   
ref|NP_055317.1|  pre-mRNA-processing factor 19                         150   3e-39   
ref|XP_006899908.1|  PREDICTED: pre-mRNA-processing factor 19           150   3e-39   
ref|XP_008583829.1|  PREDICTED: pre-mRNA-processing factor 19           150   3e-39   
ref|XP_853782.1|  PREDICTED: pre-mRNA-processing factor 19 isoform 1    150   3e-39   
ref|XP_006911304.1|  PREDICTED: pre-mRNA-processing factor 19           150   3e-39   
ref|XP_006231077.1|  PREDICTED: pre-mRNA-processing factor 19 iso...    150   3e-39   
ref|XP_006875050.1|  PREDICTED: pre-mRNA-processing factor 19           150   3e-39   
ref|XP_002755428.1|  PREDICTED: pre-mRNA-processing factor 19 iso...    150   3e-39   
ref|XP_005331591.1|  PREDICTED: pre-mRNA-processing factor 19           150   3e-39   
ref|XP_001367659.1|  PREDICTED: pre-mRNA-processing factor 19           150   3e-39   
gb|EDL41391.1|  PRP19/PSO4 pre-mRNA processing factor 19 homolog ...    150   3e-39   
ref|XP_007108277.1|  PREDICTED: pre-mRNA-processing factor 19           150   4e-39   
ref|XP_501420.1|  YALI0C03982p                                          142   4e-39   
gb|EPX73278.1|  ubiquitin-protein ligase E4                             150   4e-39   
ref|XP_004683452.1|  PREDICTED: pre-mRNA-processing factor 19           150   5e-39   
ref|XP_002928702.1|  PREDICTED: pre-mRNA-processing factor 19           150   5e-39   
ref|XP_001501711.1|  PREDICTED: pre-mRNA-processing factor 19           150   5e-39   
emb|CDQ89686.1|  unnamed protein product                                148   5e-39   
ref|NP_958875.1|  pre-mRNA-processing factor 19                         150   5e-39   
ref|XP_005981800.1|  PREDICTED: pre-mRNA-processing factor 19           150   5e-39   
ref|XP_010746969.1|  PREDICTED: pre-mRNA-processing factor 19           150   5e-39   
ref|XP_008291358.1|  PREDICTED: pre-mRNA-processing factor 19           150   5e-39   
ref|XP_008325291.1|  PREDICTED: pre-mRNA-processing factor 19           150   6e-39   
ref|XP_010769984.1|  PREDICTED: pre-mRNA-processing factor 19           150   6e-39   
ref|XP_003444775.1|  PREDICTED: pre-mRNA-processing factor 19-like      149   7e-39   
ref|XP_006697513.1|  hypothetical protein CTHT_0072540                  149   7e-39   
ref|XP_004545452.1|  PREDICTED: pre-mRNA-processing factor 19-like      149   7e-39   
ref|XP_007378305.1|  WD40 repeat-like protein                           149   9e-39   
ref|XP_007266007.1|  Prp19-domain-containing protein                    149   1e-38   
ref|XP_002584268.1|  conserved hypothetical protein                     148   1e-38   
emb|CDQ72609.1|  unnamed protein product                                149   1e-38   
gb|ETO25091.1|  hypothetical protein RFI_12051                          143   1e-38   
ref|NP_594874.1|  ubiquitin-protein ligase E4                           149   1e-38   
gb|KIY45481.1|  WD40 repeat-like protein                                149   1e-38   
ref|XP_002175864.1|  ubiquitin-protein ligase E4                        148   2e-38   
ref|XP_010889939.1|  PREDICTED: pre-mRNA-processing factor 19 iso...    148   2e-38   
emb|CCF53827.1|  probable PRP19-non-snRNP spliceosome component r...    149   2e-38   
emb|CDQ57732.1|  unnamed protein product                                148   2e-38   
ref|XP_001610616.1|  WD domain, G-beta repeat containing protein        148   2e-38   
dbj|BAN64415.1|  WD domain, G-beta repeat containing protein            148   2e-38   
gb|KHJ46976.1|  u-box domain protein                                    148   2e-38   
gb|KFD53545.1|  hypothetical protein M513_05461                         148   2e-38   
gb|KFB48716.1|  AGAP007217-PA-like protein                              148   3e-38   
gb|KHN81211.1|  Pre-mRNA-processing factor 19 -like protein             151   3e-38   
gb|EMP24423.1|  Pre-mRNA-processing factor 19                           148   3e-38   
gb|EUB61014.1|  Pre-mRNA-processing factor                              148   3e-38   
emb|CEL58318.1|  pre-mRNA-processing factor 19                          148   3e-38   
gb|ELU36294.1|  nuclear matrix protein                                  147   3e-38   



>ref|XP_002285452.1| PREDICTED: pre-mRNA-processing factor 19 [Vitis vinifera]
 emb|CBI23714.3| unnamed protein product [Vitis vinifera]
Length=524

 Score =   300 bits (767),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 140/159 (88%), Positives = 150/159 (94%), Gaps = 0/159 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            MNCS+SGEVPEEPVVS KSGLLFEKRLIERHISDYGKCP+TGEPLTMDDIVPI+TGKIVK
Sbjct  1    MNCSMSGEVPEEPVVSKKSGLLFEKRLIERHISDYGKCPITGEPLTMDDIVPIQTGKIVK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRPVQAASIPGMLGMFQIEWD LMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK
Sbjct  61   PRPVQAASIPGMLGMFQIEWDGLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAAE  576
            ERDEAR LLAQ++RQ+P + +  +A NA+ LSNGKRAAE
Sbjct  121  ERDEARSLLAQSERQIPMSMSTATAVNASALSNGKRAAE  159



>ref|XP_011091239.1| PREDICTED: pre-mRNA-processing factor 19-like [Sesamum indicum]
Length=525

 Score =   296 bits (757),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 140/159 (88%), Positives = 147/159 (92%), Gaps = 0/159 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            MNCSISGEVPEEPVVS  SGLLFEKRLIERHISDYGKCP+TGEPLTMDDIVP+KTGKIVK
Sbjct  1    MNCSISGEVPEEPVVSKSSGLLFEKRLIERHISDYGKCPITGEPLTMDDIVPVKTGKIVK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRPVQAASIPGMLGMFQIEWD LMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK
Sbjct  61   PRPVQAASIPGMLGMFQIEWDGLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAAE  576
            ERDEAR LLAQA+RQ+P +AA  +A     LSNGKRAA+
Sbjct  121  ERDEARALLAQAERQIPMSAAAPNAVTDAALSNGKRAAD  159



>ref|XP_009759667.1| PREDICTED: U-box domain-containing protein 72-like isoform X2 
[Nicotiana sylvestris]
Length=521

 Score =   296 bits (757),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 141/159 (89%), Positives = 147/159 (92%), Gaps = 1/159 (1%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            MNCSISGEVPE PVVS KSGL+FEKRLIERHISDYGKCPVTGEPLTMDDI+P+KTGKIVK
Sbjct  1    MNCSISGEVPEVPVVSMKSGLIFEKRLIERHISDYGKCPVTGEPLTMDDIIPVKTGKIVK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRPVQAASIPGMLGMFQIEWD LMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK
Sbjct  61   PRPVQAASIPGMLGMFQIEWDGLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAAE  576
            ERDEAR LLAQA+RQ+P  AA  +A N   LSNGKRAAE
Sbjct  121  ERDEARALLAQAERQVP-VAATTTATNGDALSNGKRAAE  158



>ref|XP_003555746.1| PREDICTED: U-box domain-containing protein 72 [Glycine max]
Length=525

 Score =   294 bits (753),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 141/159 (89%), Positives = 144/159 (91%), Gaps = 0/159 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            MNCSISGEVPEEPVVS  SGLLFEKRLIERHISDYGKCP+TGEPLTMDDIVPIKTGKIVK
Sbjct  1    MNCSISGEVPEEPVVSRNSGLLFEKRLIERHISDYGKCPITGEPLTMDDIVPIKTGKIVK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRPVQAASIPGMLGMFQ EWD LMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK
Sbjct  61   PRPVQAASIPGMLGMFQNEWDGLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAAE  576
            ERDEAR LLAQA+RQ P +A      NA  LSNGKRAAE
Sbjct  121  ERDEARSLLAQAERQFPVSAPNAITANAPVLSNGKRAAE  159



>gb|KHN24878.1| U-box domain-containing protein 72 [Glycine soja]
Length=525

 Score =   294 bits (753),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 141/159 (89%), Positives = 144/159 (91%), Gaps = 0/159 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            MNCSISGEVPEEPVVS  SGLLFEKRLIERHISDYGKCP+TGEPLTMDDIVPIKTGKIVK
Sbjct  1    MNCSISGEVPEEPVVSRNSGLLFEKRLIERHISDYGKCPITGEPLTMDDIVPIKTGKIVK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRPVQAASIPGMLGMFQ EWD LMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK
Sbjct  61   PRPVQAASIPGMLGMFQNEWDGLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAAE  576
            ERDEAR LLAQA+RQ P +A      NA  LSNGKRAAE
Sbjct  121  ERDEARSLLAQAERQFPVSAPNAITANAPVLSNGKRAAE  159



>ref|XP_006342411.1| PREDICTED: LOW QUALITY PROTEIN: pre-mRNA-processing factor 19 
homolog 1-like [Solanum tuberosum]
Length=521

 Score =   294 bits (752),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 141/159 (89%), Positives = 145/159 (91%), Gaps = 1/159 (1%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLT DDI+P+KTGKIVK
Sbjct  1    MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTTDDIIPVKTGKIVK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRPVQAASIPGMLGMFQIEWD LMLSNF LEQQLHTARQELSHALYQHDAACRVIARLKK
Sbjct  61   PRPVQAASIPGMLGMFQIEWDGLMLSNFVLEQQLHTARQELSHALYQHDAACRVIARLKK  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAAE  576
            ERDEARELLAQA+RQ+P AA   SA N   LS G RA E
Sbjct  121  ERDEARELLAQAERQVPMAATT-SAANGAALSYGNRATE  158



>ref|XP_009759666.1| PREDICTED: U-box domain-containing protein 72-like isoform X1 
[Nicotiana sylvestris]
Length=523

 Score =   294 bits (752),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 140/158 (89%), Positives = 146/158 (92%), Gaps = 1/158 (1%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            MNCSISGEVPE PVVS KSGL+FEKRLIERHISDYGKCPVTGEPLTMDDI+P+KTGKIVK
Sbjct  1    MNCSISGEVPEVPVVSMKSGLIFEKRLIERHISDYGKCPVTGEPLTMDDIIPVKTGKIVK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRPVQAASIPGMLGMFQIEWD LMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK
Sbjct  61   PRPVQAASIPGMLGMFQIEWDGLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAA  573
            ERDEAR LLAQA+RQ+P  AA  +A N   LSNGKRAA
Sbjct  121  ERDEARALLAQAERQVP-VAATTTATNGDALSNGKRAA  157



>ref|XP_009594689.1| PREDICTED: pre-mRNA-processing factor 19 homolog 1-like isoform 
X1 [Nicotiana tomentosiformis]
Length=522

 Score =   293 bits (751),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 140/159 (88%), Positives = 147/159 (92%), Gaps = 1/159 (1%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            MNCSISGEVPE+PVVS KSGL+FEKRLIERHISDYGKCPVTGEPLT DDI+P+KTGKIVK
Sbjct  1    MNCSISGEVPEDPVVSMKSGLIFEKRLIERHISDYGKCPVTGEPLTKDDIIPVKTGKIVK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRPVQAASIPGMLGMFQIEWD LMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK
Sbjct  61   PRPVQAASIPGMLGMFQIEWDGLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAAE  576
            ERDEAR LLAQA+RQ+P  AA  +A N   LSNGKRAAE
Sbjct  121  ERDEARALLAQAERQVP-MAATTTAPNGAALSNGKRAAE  158



>ref|XP_007145817.1| hypothetical protein PHAVU_007G270500g [Phaseolus vulgaris]
 gb|ESW17811.1| hypothetical protein PHAVU_007G270500g [Phaseolus vulgaris]
Length=525

 Score =   293 bits (751),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 141/159 (89%), Positives = 144/159 (91%), Gaps = 0/159 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            MNCSISGEVPEEPVVS  SGLLFEKRLIERHISDYGKCP+TGEPLTMDDIVPIKTGKIVK
Sbjct  1    MNCSISGEVPEEPVVSRNSGLLFEKRLIERHISDYGKCPITGEPLTMDDIVPIKTGKIVK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRPVQAASIPGMLGMFQ EWD LMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK
Sbjct  61   PRPVQAASIPGMLGMFQNEWDGLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAAE  576
            ERDEAR LLAQA+RQ P +A      NA  LSNGKRAAE
Sbjct  121  ERDEARSLLAQAERQYPVSALNAPPANAPVLSNGKRAAE  159



>ref|XP_003535988.1| PREDICTED: U-box domain-containing protein 72-like [Glycine max]
 gb|KHN41538.1| U-box domain-containing protein 72 [Glycine soja]
Length=525

 Score =   291 bits (745),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 138/159 (87%), Positives = 144/159 (91%), Gaps = 0/159 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            MNCSISGEVPE+PVVS  SGLLFEKRLIERHISDYGKCP+TGEPLTMDDIVPIKTGKIVK
Sbjct  1    MNCSISGEVPEDPVVSRNSGLLFEKRLIERHISDYGKCPITGEPLTMDDIVPIKTGKIVK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRPVQAASIPGMLGMFQ EWD LMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK
Sbjct  61   PRPVQAASIPGMLGMFQNEWDGLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAAE  576
            ERDEAR +LAQA+RQ P++A      N   LSNGKRAAE
Sbjct  121  ERDEARSVLAQAERQFPASAPNAITANDPVLSNGKRAAE  159



>gb|EYU43746.1| hypothetical protein MIMGU_mgv1a004422mg [Erythranthe guttata]
Length=528

 Score =   290 bits (742),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 137/159 (86%), Positives = 144/159 (91%), Gaps = 0/159 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            MNCSISGEVPEEPVVS  SGLLFEKRLIERHI DYGKCP+TGEPLT+DDIVPIKTGKIVK
Sbjct  1    MNCSISGEVPEEPVVSKTSGLLFEKRLIERHILDYGKCPITGEPLTVDDIVPIKTGKIVK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRPVQAASIPGMLGMFQIEWD LMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK
Sbjct  61   PRPVQAASIPGMLGMFQIEWDGLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAAE  576
            ERDEA   LAQA+R +P++ AM  A NA  L+NGKRA E
Sbjct  121  ERDEAWAFLAQAERHVPASEAMPDAVNAAALANGKRAIE  159



>ref|XP_002311694.1| transducin family protein [Populus trichocarpa]
 gb|EEE89061.1| transducin family protein [Populus trichocarpa]
Length=524

 Score =   288 bits (738),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 135/159 (85%), Positives = 147/159 (92%), Gaps = 0/159 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M+CSISGEVPE+PVVS KSGLL+EKRLIERHIS+YGKCP+TGEPLTMDDIVP+KTGKIVK
Sbjct  1    MHCSISGEVPEQPVVSKKSGLLYEKRLIERHISEYGKCPITGEPLTMDDIVPVKTGKIVK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PR VQ ASIPGMLGMFQ EWD LMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK
Sbjct  61   PRTVQTASIPGMLGMFQNEWDGLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAAE  576
            ERDEAR LLAQA+RQ+P +A+    +NA+ LSNGKRAAE
Sbjct  121  ERDEARSLLAQAERQIPMSASEAVTENASVLSNGKRAAE  159



>ref|XP_011029750.1| PREDICTED: pre-mRNA-processing factor 19 homolog 2-like isoform 
X1 [Populus euphratica]
 ref|XP_011029751.1| PREDICTED: pre-mRNA-processing factor 19 homolog 2-like isoform 
X2 [Populus euphratica]
Length=524

 Score =   288 bits (738),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 135/159 (85%), Positives = 147/159 (92%), Gaps = 0/159 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M+CSISGEVPE+PVVS KSGLL+EKRLIERHIS+YGKCP+TGEPLTMDDIVP+KTGKIVK
Sbjct  1    MHCSISGEVPEQPVVSKKSGLLYEKRLIERHISEYGKCPITGEPLTMDDIVPVKTGKIVK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PR VQ ASIPGMLGMFQ EWD LMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK
Sbjct  61   PRTVQTASIPGMLGMFQNEWDGLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAAE  576
            ERDEAR LLAQA+RQ+P +A+    +NA+ LSNGKRAAE
Sbjct  121  ERDEARSLLAQAERQIPMSASEAVTENASVLSNGKRAAE  159



>gb|KHG28464.1| Pre-mRNA-processing factor 19 -like protein [Gossypium arboreum]
Length=524

 Score =   286 bits (732),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 138/159 (87%), Positives = 146/159 (92%), Gaps = 1/159 (1%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            MNCSISGEVPEEPVVSTKSGLL+EKRLIERHISDYGKCPVTGE LTMDDIVP+KTGKIVK
Sbjct  1    MNCSISGEVPEEPVVSTKSGLLYEKRLIERHISDYGKCPVTGEALTMDDIVPVKTGKIVK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PR + AASIPGMLGMFQ EWD+LMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK
Sbjct  61   PRSLTAASIPGMLGMFQNEWDALMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAAE  576
            ERDEAR LLAQA+RQ P  A+  +A N + LSNGKRAAE
Sbjct  121  ERDEARSLLAQAERQAPLPASAATA-NVSALSNGKRAAE  158



>emb|CDO99306.1| unnamed protein product [Coffea canephora]
Length=531

 Score =   286 bits (732),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 143/161 (89%), Positives = 149/161 (93%), Gaps = 2/161 (1%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            MNCSISGEVPEEPVVS KSGLL+EKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK
Sbjct  1    MNCSISGEVPEEPVVSKKSGLLYEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK
Sbjct  61   PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  120

Query  460  ERDEARELLAQADRQL--PSAAAMESADNATTLSNGKRAAE  576
            ERDEAR +LAQA+RQ+   +A    +A NA  LSNGKRAAE
Sbjct  121  ERDEARAILAQAERQMPAAAAPVPAAAANAAALSNGKRAAE  161



>gb|KJB38355.1| hypothetical protein B456_006G251300 [Gossypium raimondii]
Length=524

 Score =   286 bits (731),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 138/159 (87%), Positives = 146/159 (92%), Gaps = 1/159 (1%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            MNCSISGEVPEEPVVSTKSGLL+EKRLIERHISDYGKCPVTGE LTMDDIVP+KTGKIVK
Sbjct  1    MNCSISGEVPEEPVVSTKSGLLYEKRLIERHISDYGKCPVTGEVLTMDDIVPVKTGKIVK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PR + AASIPGMLGMFQ EWD+LMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK
Sbjct  61   PRSLTAASIPGMLGMFQNEWDALMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAAE  576
            ERDEAR LLAQA+RQ P  A+  +A N + LSNGKRAAE
Sbjct  121  ERDEARSLLAQAERQAPLPASAATA-NVSALSNGKRAAE  158



>gb|AFK41051.1| unknown [Medicago truncatula]
Length=521

 Score =   285 bits (728),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 135/159 (85%), Positives = 141/159 (89%), Gaps = 0/159 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            MNCSISGEVP+EPVVS  SGLLFEKRLIERHI D+GKCPVTGEPLTMDDIVPIKTGKIVK
Sbjct  1    MNCSISGEVPDEPVVSKSSGLLFEKRLIERHIMDFGKCPVTGEPLTMDDIVPIKTGKIVK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRPVQAASIPGMLGMFQ EWD LMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK
Sbjct  61   PRPVQAASIPGMLGMFQNEWDGLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAAE  576
            ERDEAR +LAQA+RQ P +       NA   SNGKRAA+
Sbjct  121  ERDEARSILAQAERQFPISTPNSVTANAPVHSNGKRAAD  159



>ref|XP_009775901.1| PREDICTED: pre-mRNA-processing factor 19 homolog 1-like [Nicotiana 
sylvestris]
Length=521

 Score =   285 bits (728),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 140/159 (88%), Positives = 146/159 (92%), Gaps = 2/159 (1%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            MNCSISGEVPE+PVVS KSGLL+EKRLIERHISDYGKCPVTGEPLT DDI+P+KTGKIVK
Sbjct  1    MNCSISGEVPEDPVVSKKSGLLYEKRLIERHISDYGKCPVTGEPLTADDIIPVKTGKIVK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRPVQAASIPGMLGMFQIEWD LMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK
Sbjct  61   PRPVQAASIPGMLGMFQIEWDGLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAAE  576
            ERDEAR LLAQA+RQ+P AA       AT LSNGKRAAE
Sbjct  121  ERDEARGLLAQAERQIPMAATTAVG--ATALSNGKRAAE  157



>gb|KDP33313.1| hypothetical protein JCGZ_12862 [Jatropha curcas]
Length=529

 Score =   284 bits (727),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 134/159 (84%), Positives = 144/159 (91%), Gaps = 0/159 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M+CSISGEVPEEPVVS KSGLL+EKRLIE HISDYGKCP+TGEPLTMDDIVP+KTGKIVK
Sbjct  1    MHCSISGEVPEEPVVSKKSGLLYEKRLIEMHISDYGKCPITGEPLTMDDIVPVKTGKIVK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PR VQ ASIPGMLGMFQ EWD LMLSNFALEQQLHTARQELSHALYQHDAACRVIARL+K
Sbjct  61   PRTVQTASIPGMLGMFQNEWDGLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLRK  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAAE  576
            ERDEAR LLAQA+RQ+P+ A   +  N + LSNGKRAAE
Sbjct  121  ERDEARSLLAQAERQIPALATAAAPVNTSALSNGKRAAE  159



>gb|KJB12604.1| hypothetical protein B456_002G026500 [Gossypium raimondii]
Length=415

 Score =   281 bits (718),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 133/159 (84%), Positives = 145/159 (91%), Gaps = 1/159 (1%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            MNCSISGEVPEEPVVS KSGLL+EKRLIERHI+DYGKCPVTG+PLTMDDIVP+KTGKIVK
Sbjct  1    MNCSISGEVPEEPVVSKKSGLLYEKRLIERHIADYGKCPVTGDPLTMDDIVPVKTGKIVK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            P+ + AASIPGMLGMFQ EWD+LMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK
Sbjct  61   PKSLTAASIPGMLGMFQNEWDALMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAAE  576
            ERDEAR LLAQA+RQ P  A+  +A N + LSNGKR +E
Sbjct  121  ERDEARSLLAQAERQAPLPASAATA-NVSALSNGKRVSE  158



>ref|XP_007035246.1| MOS4-associated complex 3A [Theobroma cacao]
 gb|EOY06172.1| MOS4-associated complex 3A [Theobroma cacao]
Length=523

 Score =   283 bits (724),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 136/159 (86%), Positives = 145/159 (91%), Gaps = 1/159 (1%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            MNCSISGEVPEEPVVS KSGLL+EKRLIERHISDYGKCPVTGEPLTMDDIVP+KTGKIVK
Sbjct  1    MNCSISGEVPEEPVVSKKSGLLYEKRLIERHISDYGKCPVTGEPLTMDDIVPVKTGKIVK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PR + AASIPGMLGMFQ EWD+LMLSNFALEQQLH ARQELSHALYQHDAACRVIARLKK
Sbjct  61   PRSLTAASIPGMLGMFQNEWDALMLSNFALEQQLHAARQELSHALYQHDAACRVIARLKK  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAAE  576
            ERDEAR LLAQA+RQ P  A+  +A N + L+NGKRAAE
Sbjct  121  ERDEARSLLAQAERQAPLPASAVTA-NVSALTNGKRAAE  158



>ref|XP_006354435.1| PREDICTED: U-box domain-containing protein 72-like [Solanum tuberosum]
Length=521

 Score =   283 bits (724),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 138/159 (87%), Positives = 145/159 (91%), Gaps = 2/159 (1%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            MNCSISGEVPE+PVVS KSGLLFEKRLIERHISDYGKCP+TGEPLT DDI+P+KTGKIVK
Sbjct  1    MNCSISGEVPEDPVVSKKSGLLFEKRLIERHISDYGKCPITGEPLTADDIIPVKTGKIVK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRPVQAASIPGMLGMFQIEWD LMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK
Sbjct  61   PRPVQAASIPGMLGMFQIEWDGLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAAE  576
            ERDEAR LLAQA+RQ+P AA        T +SNGKRAAE
Sbjct  121  ERDEARGLLAQAERQIPMAATTAVG--TTAVSNGKRAAE  157



>gb|KJB12606.1| hypothetical protein B456_002G026500 [Gossypium raimondii]
Length=446

 Score =   280 bits (717),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 133/159 (84%), Positives = 145/159 (91%), Gaps = 1/159 (1%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            MNCSISGEVPEEPVVS KSGLL+EKRLIERHI+DYGKCPVTG+PLTMDDIVP+KTGKIVK
Sbjct  1    MNCSISGEVPEEPVVSKKSGLLYEKRLIERHIADYGKCPVTGDPLTMDDIVPVKTGKIVK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            P+ + AASIPGMLGMFQ EWD+LMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK
Sbjct  61   PKSLTAASIPGMLGMFQNEWDALMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAAE  576
            ERDEAR LLAQA+RQ P  A+  +A N + LSNGKR +E
Sbjct  121  ERDEARSLLAQAERQAPLPASAATA-NVSALSNGKRVSE  158



>gb|KJB38357.1| hypothetical protein B456_006G251300 [Gossypium raimondii]
Length=522

 Score =   282 bits (722),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 136/159 (86%), Positives = 145/159 (91%), Gaps = 1/159 (1%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            MNCSISGEVPEEPVVSTKSGLL+EKRLIERHISDYGKCPVTGE LTMDDIVP+KTGKIVK
Sbjct  1    MNCSISGEVPEEPVVSTKSGLLYEKRLIERHISDYGKCPVTGEVLTMDDIVPVKTGKIVK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PR + AASIPGMLGMFQ EWD+LMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK
Sbjct  61   PRSLTAASIPGMLGMFQNEWDALMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAAE  576
            ERDEAR LLAQA+RQ P  A+  +A N + LSNGKR +E
Sbjct  121  ERDEARSLLAQAERQAPLPASAATA-NVSALSNGKRESE  158



>gb|KJB12602.1| hypothetical protein B456_002G026500 [Gossypium raimondii]
Length=462

 Score =   280 bits (717),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 133/159 (84%), Positives = 145/159 (91%), Gaps = 1/159 (1%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            MNCSISGEVPEEPVVS KSGLL+EKRLIERHI+DYGKCPVTG+PLTMDDIVP+KTGKIVK
Sbjct  1    MNCSISGEVPEEPVVSKKSGLLYEKRLIERHIADYGKCPVTGDPLTMDDIVPVKTGKIVK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            P+ + AASIPGMLGMFQ EWD+LMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK
Sbjct  61   PKSLTAASIPGMLGMFQNEWDALMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAAE  576
            ERDEAR LLAQA+RQ P  A+  +A N + LSNGKR +E
Sbjct  121  ERDEARSLLAQAERQAPLPASAATA-NVSALSNGKRVSE  158



>ref|XP_010670940.1| PREDICTED: pre-mRNA-processing factor 19 [Beta vulgaris subsp. 
vulgaris]
Length=525

 Score =   282 bits (722),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 133/159 (84%), Positives = 146/159 (92%), Gaps = 0/159 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            MNCSISGEVPEEPVVS KSGLLFEKRLIERHISDYGKCPVTGEPL++DDIV +K GKIVK
Sbjct  1    MNCSISGEVPEEPVVSKKSGLLFEKRLIERHISDYGKCPVTGEPLSLDDIVSVKAGKIVK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRPVQAASIPGM+GMFQ EWDSLMLSNFALEQQL+TARQELSHALYQHDAACRVIARLKK
Sbjct  61   PRPVQAASIPGMIGMFQNEWDSLMLSNFALEQQLNTARQELSHALYQHDAACRVIARLKK  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAAE  576
            ERDEAR LLAQA+RQ+P + A  ++ +A  +SNGKR A+
Sbjct  121  ERDEARSLLAQAERQMPISGATGNSIHAPVMSNGKRGAD  159



>gb|EPS73033.1| hypothetical protein M569_01722, partial [Genlisea aurea]
Length=457

 Score =   280 bits (716),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M CSISGEVPEEPVVS +SGL+FEKRLIERHISDY KCPVTGEPLT DDIVPIKTG IVK
Sbjct  13   MICSISGEVPEEPVVSKRSGLIFEKRLIERHISDYAKCPVTGEPLTADDIVPIKTGNIVK  72

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PR VQAASIPGMLGMFQIEWD+LMLSNF+LEQQLH ARQELSHALYQHDAACRVIARLKK
Sbjct  73   PRSVQAASIPGMLGMFQIEWDALMLSNFSLEQQLHAARQELSHALYQHDAACRVIARLKK  132

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAAE  576
            ERDEAR LLAQA+RQ+P+  A+ +  N   +SNGKR AE
Sbjct  133  ERDEARTLLAQAERQIPAHMAVPNGPNVAAVSNGKRVAE  171



>ref|XP_004247768.1| PREDICTED: U-box domain-containing protein 72 [Solanum lycopersicum]
Length=521

 Score =   281 bits (720),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 137/159 (86%), Positives = 144/159 (91%), Gaps = 2/159 (1%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            MNCSISGEVPE+PVVS KSGLLFEKRLIERHISDYGKCP+TGEPLT DDI+P+KTGKIVK
Sbjct  1    MNCSISGEVPEDPVVSKKSGLLFEKRLIERHISDYGKCPITGEPLTADDIIPVKTGKIVK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRPVQAASIPGMLGMFQIEWD LMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK
Sbjct  61   PRPVQAASIPGMLGMFQIEWDGLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAAE  576
            ERDEAR LLAQA+RQ+P AA        T +SNGKR AE
Sbjct  121  ERDEARGLLAQAERQIPMAATTAVG--TTAVSNGKRVAE  157



>ref|XP_008245266.1| PREDICTED: U-box domain-containing protein 72-like [Prunus mume]
Length=523

 Score =   281 bits (720),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 145/159 (91%), Gaps = 0/159 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            MNCSISGEVPEEPVVS KSGLLFEKRLIERHIS+YGKCP+TGEPLT DDIVP++TGKIV+
Sbjct  1    MNCSISGEVPEEPVVSKKSGLLFEKRLIERHISEYGKCPITGEPLTADDIVPVRTGKIVR  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP QAASIPGMLGMFQ+EWDSLML+NFA+EQQLHTARQELSHALYQHDAACRVIARLKK
Sbjct  61   PRPAQAASIPGMLGMFQLEWDSLMLANFAMEQQLHTARQELSHALYQHDAACRVIARLKK  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAAE  576
            ERDEAR LLA A+RQ+P +A    A NA+  SNGK AA+
Sbjct  121  ERDEARSLLALAERQIPMSAPSTVAANASVHSNGKPAAD  159



>gb|KJB12605.1| hypothetical protein B456_002G026500 [Gossypium raimondii]
Length=488

 Score =   280 bits (717),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 133/159 (84%), Positives = 145/159 (91%), Gaps = 1/159 (1%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            MNCSISGEVPEEPVVS KSGLL+EKRLIERHI+DYGKCPVTG+PLTMDDIVP+KTGKIVK
Sbjct  1    MNCSISGEVPEEPVVSKKSGLLYEKRLIERHIADYGKCPVTGDPLTMDDIVPVKTGKIVK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            P+ + AASIPGMLGMFQ EWD+LMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK
Sbjct  61   PKSLTAASIPGMLGMFQNEWDALMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAAE  576
            ERDEAR LLAQA+RQ P  A+  +A N + LSNGKR +E
Sbjct  121  ERDEARSLLAQAERQAPLPASAATA-NVSALSNGKRVSE  158



>gb|KDO43336.1| hypothetical protein CISIN_1g009763mg [Citrus sinensis]
Length=504

 Score =   280 bits (716),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 136/159 (86%), Positives = 141/159 (89%), Gaps = 1/159 (1%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            MNCSISGEVPEEPVVS  SGLLFEKRLIERHI DYGKCPVTGEPLTMDDIVPIKTGKIVK
Sbjct  1    MNCSISGEVPEEPVVSKNSGLLFEKRLIERHILDYGKCPVTGEPLTMDDIVPIKTGKIVK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP+ AASIPGMLGMFQ EWD LMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK
Sbjct  61   PRPLTAASIPGMLGMFQNEWDGLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAAE  576
            ERDEAR LLAQ++RQ+  A +     NA  LSNGKRA E
Sbjct  121  ERDEARSLLAQSERQIMPAESTAVTSNA-ALSNGKRAPE  158



>gb|KJB12601.1| hypothetical protein B456_002G026500 [Gossypium raimondii]
 gb|KJB12603.1| hypothetical protein B456_002G026500 [Gossypium raimondii]
Length=523

 Score =   280 bits (716),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 133/159 (84%), Positives = 145/159 (91%), Gaps = 1/159 (1%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            MNCSISGEVPEEPVVS KSGLL+EKRLIERHI+DYGKCPVTG+PLTMDDIVP+KTGKIVK
Sbjct  1    MNCSISGEVPEEPVVSKKSGLLYEKRLIERHIADYGKCPVTGDPLTMDDIVPVKTGKIVK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            P+ + AASIPGMLGMFQ EWD+LMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK
Sbjct  61   PKSLTAASIPGMLGMFQNEWDALMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAAE  576
            ERDEAR LLAQA+RQ P  A+  +A N + LSNGKR +E
Sbjct  121  ERDEARSLLAQAERQAPLPASAATA-NVSALSNGKRVSE  158



>ref|XP_006420336.1| hypothetical protein CICLE_v10004724mg [Citrus clementina]
 ref|XP_006489640.1| PREDICTED: pre-mRNA-processing factor 19 homolog 2-like [Citrus 
sinensis]
 gb|ESR33576.1| hypothetical protein CICLE_v10004724mg [Citrus clementina]
 gb|KDO43334.1| hypothetical protein CISIN_1g009763mg [Citrus sinensis]
Length=526

 Score =   280 bits (715),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 136/159 (86%), Positives = 141/159 (89%), Gaps = 1/159 (1%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            MNCSISGEVPEEPVVS  SGLLFEKRLIERHI DYGKCPVTGEPLTMDDIVPIKTGKIVK
Sbjct  1    MNCSISGEVPEEPVVSKNSGLLFEKRLIERHILDYGKCPVTGEPLTMDDIVPIKTGKIVK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP+ AASIPGMLGMFQ EWD LMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK
Sbjct  61   PRPLTAASIPGMLGMFQNEWDGLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAAE  576
            ERDEAR LLAQ++RQ+  A +     NA  LSNGKRA E
Sbjct  121  ERDEARSLLAQSERQIMPAESTAVTSNA-ALSNGKRAPE  158



>ref|XP_004296409.1| PREDICTED: pre-mRNA-processing factor 19-like [Fragaria vesca 
subsp. vesca]
Length=523

 Score =   279 bits (713),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 140/159 (88%), Gaps = 0/159 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            MNCSISGEVPEEPVVS KSGLLFEKRLIERHIS+YGKCPVTGE LT DDIVP+KTGKIV+
Sbjct  1    MNCSISGEVPEEPVVSKKSGLLFEKRLIERHISEYGKCPVTGEALTADDIVPVKTGKIVR  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRPVQAASIPGMLGMFQ EWDSLMLSNFA+E+QLHTARQELSHALYQHDAACRVIARLKK
Sbjct  61   PRPVQAASIPGMLGMFQNEWDSLMLSNFAMEKQLHTARQELSHALYQHDAACRVIARLKK  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAAE  576
            ERDEAR LLAQADRQ+P +       NA   SNG + A 
Sbjct  121  ERDEARSLLAQADRQIPMSTPAAVVGNAPVHSNGTQVAN  159



>ref|XP_004497808.1| PREDICTED: pre-mRNA-processing factor 19 homolog 2-like [Cicer 
arietinum]
Length=535

 Score =   279 bits (713),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 137/158 (87%), Gaps = 0/158 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            MNCSISGEVPEEPVVS  SGLLFEKRLIERHI DYGKCPVTG PLT+DDIVPIKTGKIVK
Sbjct  1    MNCSISGEVPEEPVVSKSSGLLFEKRLIERHIVDYGKCPVTGAPLTLDDIVPIKTGKIVK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRPVQAASIPGMLGMFQ EWD LMLSNFALEQQLH ARQELSHALYQHDAACRVIARL K
Sbjct  61   PRPVQAASIPGMLGMFQNEWDGLMLSNFALEQQLHAARQELSHALYQHDAACRVIARLTK  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAA  573
            ERDEAR  LA A+RQ P +A      NA  +SNGKRAA
Sbjct  121  ERDEARSFLALAERQFPISATNAVTANAPVVSNGKRAA  158



>ref|XP_007221798.1| hypothetical protein PRUPE_ppa003451mg [Prunus persica]
 gb|EMJ22997.1| hypothetical protein PRUPE_ppa003451mg [Prunus persica]
Length=573

 Score =   280 bits (715),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 131/159 (82%), Positives = 145/159 (91%), Gaps = 0/159 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            MNCSISGEVPE+PVVS KSGLLFEKRLIERHIS+YGKCP+TGEPLT DDIVP++TGKIV+
Sbjct  51   MNCSISGEVPEDPVVSKKSGLLFEKRLIERHISEYGKCPITGEPLTADDIVPVRTGKIVR  110

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP QAASIPGMLGMFQ+EWDSLML+NFA+EQQLHTARQELSHALYQHDAACRVIARLKK
Sbjct  111  PRPAQAASIPGMLGMFQLEWDSLMLANFAMEQQLHTARQELSHALYQHDAACRVIARLKK  170

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAAE  576
            ERDEAR LLA A+RQ+P +A    A NA+  SNGK AA+
Sbjct  171  ERDEARSLLALAERQIPMSAPSTIAANASVHSNGKPAAD  209



>ref|XP_006418122.1| hypothetical protein EUTSA_v10007366mg [Eutrema salsugineum]
 gb|ESQ36475.1| hypothetical protein EUTSA_v10007366mg [Eutrema salsugineum]
Length=522

 Score =   278 bits (710),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 133/159 (84%), Positives = 144/159 (91%), Gaps = 2/159 (1%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            MNC+ISGEVPEEPVVSTKSGLL+EKRLIERHISDYGKCPVTGEP T+ DIVPIKTGKIVK
Sbjct  1    MNCAISGEVPEEPVVSTKSGLLYEKRLIERHISDYGKCPVTGEPHTITDIVPIKTGKIVK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            P+P+  ASIPG+LG FQ EWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK
Sbjct  61   PKPLHTASIPGLLGTFQTEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAAE  576
            ERDEAR+LLA+A+R LP  AA E A +   LSNGKRAA+
Sbjct  121  ERDEARQLLAEAERHLP--AAPEVATDNAGLSNGKRAAD  157



>ref|XP_011041438.1| PREDICTED: pre-mRNA-processing factor 19 homolog 2-like [Populus 
euphratica]
Length=524

 Score =   277 bits (708),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 129/159 (81%), Positives = 143/159 (90%), Gaps = 0/159 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M+CSISGEVP EPVVS +SGLL+EKRLIERH+S+YGKCP+TGEPLTMDD+VP++TGKIVK
Sbjct  1    MHCSISGEVPGEPVVSKRSGLLYEKRLIERHVSEYGKCPITGEPLTMDDVVPVETGKIVK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PR VQ ASIPGMLGMFQ EWD LMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK
Sbjct  61   PRTVQTASIPGMLGMFQNEWDGLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAAE  576
            ERDEAR LLAQA+RQ+P   +     NA+ LSNGKRAA+
Sbjct  121  ERDEARSLLAQAERQIPMFTSEAVTANASVLSNGKRAAK  159



>gb|KHG10431.1| Pre-mRNA-processing factor 19 -like protein [Gossypium arboreum]
Length=519

 Score =   276 bits (707),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 133/159 (84%), Positives = 143/159 (90%), Gaps = 5/159 (3%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            MNCSISGEVPEEPVVS KSGLL+EKRLIERHI+DYGKCPVTGEPLTM+DIVP+KTGKIVK
Sbjct  1    MNCSISGEVPEEPVVSKKSGLLYEKRLIERHIADYGKCPVTGEPLTMEDIVPVKTGKIVK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PR + AASIPGMLGMFQ EWD+LMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK
Sbjct  61   PRSLTAASIPGMLGMFQNEWDALMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAAE  576
            ERDEAR LLAQA+RQ P  A+       T +SNGKRA+E
Sbjct  121  ERDEARSLLAQAERQAPLPASA-----VTAVSNGKRASE  154



>ref|XP_002314503.2| transducin family protein [Populus trichocarpa]
 gb|EEF00674.2| transducin family protein [Populus trichocarpa]
Length=524

 Score =   276 bits (707),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 129/159 (81%), Positives = 143/159 (90%), Gaps = 0/159 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M+CSISGEVP EPVVS +SG+L+EKRLIERHIS+YGKCP+TGEPLTMDD+VP++TGKIVK
Sbjct  1    MHCSISGEVPGEPVVSKRSGILYEKRLIERHISEYGKCPITGEPLTMDDVVPVETGKIVK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PR VQ ASIPGMLGMFQ EWD LMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK
Sbjct  61   PRTVQTASIPGMLGMFQNEWDGLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAAE  576
            ERDEAR LLAQA+RQ+P   +     NA+ LSNGKRAA+
Sbjct  121  ERDEARSLLAQAERQVPMFTSEAVTANASVLSNGKRAAK  159



>gb|KFK42789.1| hypothetical protein AALP_AA1G039400 [Arabis alpina]
Length=522

 Score =   276 bits (706),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 131/159 (82%), Positives = 143/159 (90%), Gaps = 2/159 (1%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            MNC+ISGEVPEEPVVSTKSGLL+EKRLIERHISDYGKCPVTGEP TMDDIV IKTGKIVK
Sbjct  1    MNCAISGEVPEEPVVSTKSGLLYEKRLIERHISDYGKCPVTGEPHTMDDIVAIKTGKIVK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            P+P+  ASIPG+LG FQ EWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK
Sbjct  61   PKPLHTASIPGLLGTFQTEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAAE  576
            ERDE+R+LLA A+RQLPS   + +A+ A   SNGKRA +
Sbjct  121  ERDESRQLLADAERQLPSVPEVTTANAAH--SNGKRAVD  157



>ref|XP_002528359.1| Pre-mRNA-splicing factor, putative [Ricinus communis]
 gb|EEF34031.1| Pre-mRNA-splicing factor, putative [Ricinus communis]
Length=531

 Score =   276 bits (705),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M+CSISGEVPEEPVVS KSGLLFEKRLIERHISDYGKCP+T EPLT+DDIVP+K GKIVK
Sbjct  1    MHCSISGEVPEEPVVSKKSGLLFEKRLIERHISDYGKCPITSEPLTLDDIVPMKAGKIVK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PR +Q+ASIPGMLGMFQ EWD LMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK
Sbjct  61   PRTIQSASIPGMLGMFQNEWDGLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAA  573
            ERDEAR LLAQADRQ+P +    + +NA   SNGKRAA
Sbjct  121  ERDEARSLLAQADRQIPLSVTAAATENAYAASNGKRAA  158



>emb|CDY23752.1| BnaC04g43700D [Brassica napus]
Length=525

 Score =   275 bits (704),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 128/158 (81%), Positives = 144/158 (91%), Gaps = 2/158 (1%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            MNC+ISGEVPEEPVVSTKSGLLFE+RLIERHISDYGKCPVTGEPLT+DD+VPIKTGK++K
Sbjct  1    MNCAISGEVPEEPVVSTKSGLLFERRLIERHISDYGKCPVTGEPLTIDDVVPIKTGKVIK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            P+PV  ASIPG+LG FQ EWD LMLSNFALEQQLHTARQELSHALYQHD+ACRVIARLKK
Sbjct  61   PKPVHTASIPGLLGTFQNEWDGLMLSNFALEQQLHTARQELSHALYQHDSACRVIARLKK  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAA  573
            ERDEAR+LLA+ +R +P+A    +A+ A  LSNGKRAA
Sbjct  121  ERDEARQLLAEVERHIPAAPEAVTANAA--LSNGKRAA  156



>gb|KFK42788.1| hypothetical protein AALP_AA1G039400 [Arabis alpina]
Length=523

 Score =   275 bits (704),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 142/158 (90%), Gaps = 2/158 (1%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            MNC+ISGEVPEEPVVSTKSGLL+EKRLIERHISDYGKCPVTGEP TMDDIV IKTGKIVK
Sbjct  1    MNCAISGEVPEEPVVSTKSGLLYEKRLIERHISDYGKCPVTGEPHTMDDIVAIKTGKIVK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            P+P+  ASIPG+LG FQ EWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK
Sbjct  61   PKPLHTASIPGLLGTFQTEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAA  573
            ERDE+R+LLA A+RQLPS   + +A+ A   SNGKR A
Sbjct  121  ERDESRQLLADAERQLPSVPEVTTANAAH--SNGKRVA  156



>ref|XP_010542962.1| PREDICTED: pre-mRNA-processing factor 19 homolog 1-like [Tarenaya 
hassleriana]
Length=522

 Score =   275 bits (704),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 129/159 (81%), Positives = 146/159 (92%), Gaps = 2/159 (1%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            MNC+ISGEVPEEPVVSTKSGLLFE+RLIE HIS+YGKCPVTGEPLTMDDIVPIKTGK+VK
Sbjct  1    MNCAISGEVPEEPVVSTKSGLLFERRLIESHISEYGKCPVTGEPLTMDDIVPIKTGKVVK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            P+P+  ASIPG+LGMFQ EWDSLMLSNFALEQQLH ARQELSHALYQHDAACRVIARLKK
Sbjct  61   PKPLHTASIPGLLGMFQNEWDSLMLSNFALEQQLHAARQELSHALYQHDAACRVIARLKK  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAAE  576
            ERDE+R LLA+A+RQ+P+A    +A+ A  L+NGKRA++
Sbjct  121  ERDESRALLAEAERQIPAAQQAITANAA--LTNGKRASD  157



>ref|XP_002889510.1| transducin family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65769.1| transducin family protein [Arabidopsis lyrata subsp. lyrata]
Length=522

 Score =   275 bits (703),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 130/159 (82%), Positives = 143/159 (90%), Gaps = 2/159 (1%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            MNC+ISGEVPE+PVVS KSGLL+EKRLIERHISDYGKCPVTGEP T+DDIVPIKTGKIVK
Sbjct  1    MNCAISGEVPEDPVVSKKSGLLYEKRLIERHISDYGKCPVTGEPHTLDDIVPIKTGKIVK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            P+P+  ASIPG+LG FQ EWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK
Sbjct  61   PKPLHTASIPGLLGTFQTEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAAE  576
            ERDE+R+LLA+A+RQLP  AA E A +   LSNGKR  +
Sbjct  121  ERDESRQLLAEAERQLP--AAPEVATSNAALSNGKRGID  157



>ref|XP_009357978.1| PREDICTED: U-box domain-containing protein 72-like isoform X2 
[Pyrus x bretschneideri]
Length=481

 Score =   274 bits (700),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 130/159 (82%), Positives = 144/159 (91%), Gaps = 1/159 (1%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            MNC++SGEVPEEPVVS KSGLLFEKRLIERHIS+YGKCPVTGEPLT DDIVP++TGKIV+
Sbjct  1    MNCALSGEVPEEPVVSKKSGLLFEKRLIERHISEYGKCPVTGEPLTADDIVPVQTGKIVR  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP QAASIPGMLGMFQ+EWDSLML+NFA+E+QLHTARQELSHALYQHDAACRVIARLKK
Sbjct  61   PRPAQAASIPGMLGMFQLEWDSLMLANFAMEKQLHTARQELSHALYQHDAACRVIARLKK  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAAE  576
            ERDEAR LLAQA+RQ+P AA    A NA+  SNG   A+
Sbjct  121  ERDEARSLLAQAERQIP-AAQSAVAVNASVHSNGMPVAD  158



>ref|XP_008340661.1| PREDICTED: U-box domain-containing protein 72 isoform X2 [Malus 
domestica]
Length=481

 Score =   273 bits (699),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 128/159 (81%), Positives = 145/159 (91%), Gaps = 1/159 (1%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            MNC++SGEVPEEPVVS KSGLLFEKRLIERHIS+YGKCPVTGEPL  DDIVP++TGKIV+
Sbjct  1    MNCALSGEVPEEPVVSKKSGLLFEKRLIERHISEYGKCPVTGEPLXADDIVPVQTGKIVR  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP QAASIPGMLGMFQ+EWDSLML+NFA+E+QLHTARQELSHALYQHDAACRVIARLKK
Sbjct  61   PRPAQAASIPGMLGMFQLEWDSLMLANFAMEKQLHTARQELSHALYQHDAACRVIARLKK  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAAE  576
            ERDEAR LLAQA+RQ+P+A ++  A NA+  SNG   A+
Sbjct  121  ERDEARSLLAQAERQIPAAQSV-VAXNASVHSNGTPVAD  158



>ref|XP_009357977.1| PREDICTED: U-box domain-containing protein 72-like isoform X1 
[Pyrus x bretschneideri]
Length=521

 Score =   274 bits (701),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 130/159 (82%), Positives = 144/159 (91%), Gaps = 1/159 (1%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            MNC++SGEVPEEPVVS KSGLLFEKRLIERHIS+YGKCPVTGEPLT DDIVP++TGKIV+
Sbjct  1    MNCALSGEVPEEPVVSKKSGLLFEKRLIERHISEYGKCPVTGEPLTADDIVPVQTGKIVR  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP QAASIPGMLGMFQ+EWDSLML+NFA+E+QLHTARQELSHALYQHDAACRVIARLKK
Sbjct  61   PRPAQAASIPGMLGMFQLEWDSLMLANFAMEKQLHTARQELSHALYQHDAACRVIARLKK  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAAE  576
            ERDEAR LLAQA+RQ+P AA    A NA+  SNG   A+
Sbjct  121  ERDEARSLLAQAERQIP-AAQSAVAVNASVHSNGMPVAD  158



>ref|XP_010023847.1| PREDICTED: pre-mRNA-processing factor 19 homolog 1-like [Eucalyptus 
grandis]
 gb|KCW60227.1| hypothetical protein EUGRSUZ_H02940 [Eucalyptus grandis]
Length=524

 Score =   274 bits (701),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 126/158 (80%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            MNCSISGEVPEEPVVSTKSG +FE+RLIER++SDYGKCPV+GEPLTMDD++P+K GKIVK
Sbjct  1    MNCSISGEVPEEPVVSTKSGHVFERRLIERYVSDYGKCPVSGEPLTMDDVLPVKMGKIVK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP+QAASIPG+L +FQ EWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK
Sbjct  61   PRPLQAASIPGLLSIFQNEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAA  573
            ERDEAR LLA A+RQ+P  A+ + A NA  +SNG++A+
Sbjct  121  ERDEARSLLALAERQIPMTASSDIAVNAPAMSNGRKAS  158



>ref|XP_008340660.1| PREDICTED: U-box domain-containing protein 72 isoform X1 [Malus 
domestica]
Length=521

 Score =   274 bits (700),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 128/159 (81%), Positives = 145/159 (91%), Gaps = 1/159 (1%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            MNC++SGEVPEEPVVS KSGLLFEKRLIERHIS+YGKCPVTGEPL  DDIVP++TGKIV+
Sbjct  1    MNCALSGEVPEEPVVSKKSGLLFEKRLIERHISEYGKCPVTGEPLXADDIVPVQTGKIVR  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP QAASIPGMLGMFQ+EWDSLML+NFA+E+QLHTARQELSHALYQHDAACRVIARLKK
Sbjct  61   PRPAQAASIPGMLGMFQLEWDSLMLANFAMEKQLHTARQELSHALYQHDAACRVIARLKK  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAAE  576
            ERDEAR LLAQA+RQ+P+A ++  A NA+  SNG   A+
Sbjct  121  ERDEARSLLAQAERQIPAAQSV-VAXNASVHSNGTPVAD  158



>ref|XP_003590128.1| Pre-mRNA-processing factor-like protein [Medicago truncatula]
 gb|AES60379.1| Pre-mRNA-processing factor [Medicago truncatula]
Length=519

 Score =   273 bits (698),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 130/156 (83%), Positives = 137/156 (88%), Gaps = 0/156 (0%)
 Frame = +1

Query  109  SISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVKPRP  288
            + SGEVP+EPVVS  SGLLFEKRLIERHI D+GKCPVTGEPLTMDDIVPIKTGKIVKPRP
Sbjct  2    NFSGEVPDEPVVSKSSGLLFEKRLIERHIMDFGKCPVTGEPLTMDDIVPIKTGKIVKPRP  61

Query  289  VQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKKERD  468
            VQAASIPGMLGMFQ EWD LMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKKERD
Sbjct  62   VQAASIPGMLGMFQNEWDGLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKKERD  121

Query  469  EARELLAQADRQLPSAAAMESADNATTLSNGKRAAE  576
            EAR +LAQA+RQ P +       NA   SNGKRAA+
Sbjct  122  EARSILAQAERQFPISTPNSVTANAPVHSNGKRAAD  157



>emb|CDY37731.1| BnaA04g19370D [Brassica napus]
Length=525

 Score =   273 bits (699),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/158 (81%), Positives = 143/158 (91%), Gaps = 2/158 (1%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            MNC+ISGEVPEEPVVSTKSGLLFE+RLIERHI DYGKCPVTGEPLT+DDIVPIKTGK++K
Sbjct  1    MNCAISGEVPEEPVVSTKSGLLFERRLIERHILDYGKCPVTGEPLTIDDIVPIKTGKVIK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            P+PV  ASIPG+LG FQ EWD LMLSNFALEQQLHTARQELSHALYQHD+ACRVIARLKK
Sbjct  61   PKPVHTASIPGLLGTFQNEWDGLMLSNFALEQQLHTARQELSHALYQHDSACRVIARLKK  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAA  573
            ERDEAR+LLA+ +R +P+A    +A+ A  LSNGKRAA
Sbjct  121  ERDEARQLLAEVERHIPAAPEAVTANAA--LSNGKRAA  156



>ref|XP_010469490.1| PREDICTED: pre-mRNA-processing factor 19 homolog 2-like isoform 
X1 [Camelina sativa]
Length=527

 Score =   273 bits (698),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 129/158 (82%), Positives = 142/158 (90%), Gaps = 2/158 (1%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            MNC+ISGEVP EPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLT+DDIVPIKTG+I+K
Sbjct  1    MNCAISGEVPAEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTIDDIVPIKTGEIIK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            P+ +Q ASIPGMLG FQ EWD LMLSN+ALEQQLHTARQELSHALYQHD+ACRVIARLKK
Sbjct  61   PKTLQTASIPGMLGTFQNEWDGLMLSNYALEQQLHTARQELSHALYQHDSACRVIARLKK  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAA  573
            ERDEAR+LLA+ +R +P  AA E+     TLSNGKRAA
Sbjct  121  ERDEARQLLAEVERHIP--AAPEAVTANATLSNGKRAA  156



>ref|XP_008362339.1| PREDICTED: U-box domain-containing protein 72-like [Malus domestica]
Length=521

 Score =   273 bits (698),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 126/159 (79%), Positives = 144/159 (91%), Gaps = 2/159 (1%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            MNC++SGEVPEEPVVS KSGLLFEKRLIERHIS+YGKCPVTGEPLT DDI+P++TGKIV+
Sbjct  1    MNCALSGEVPEEPVVSKKSGLLFEKRLIERHISEYGKCPVTGEPLTADDIIPVQTGKIVR  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP QAASIPGMLGMFQ+EWDSLML+NFA+E+QLHTARQELSHALYQHDAACRVIARLKK
Sbjct  61   PRPAQAASIPGMLGMFQLEWDSLMLANFAMEKQLHTARQELSHALYQHDAACRVIARLKK  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAAE  576
            ERDEAR LLAQA+RQ+P+ + + +  NA   SNG   A+
Sbjct  121  ERDEARSLLAQAERQIPAQSTVTA--NAAVHSNGTPVAD  157



>ref|XP_010413886.1| PREDICTED: pre-mRNA-processing factor 19 homolog 2-like isoform 
X1 [Camelina sativa]
Length=527

 Score =   273 bits (698),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/158 (81%), Positives = 143/158 (91%), Gaps = 2/158 (1%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            MNC+ISGEVP EPVVSTKSGLLFE+RLIERHISDYGKCPVTGEPLT+DDIVPIKTG+I+K
Sbjct  1    MNCAISGEVPAEPVVSTKSGLLFERRLIERHISDYGKCPVTGEPLTIDDIVPIKTGEIIK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            P+ +Q ASIPGMLG FQ EWD LMLSN+ALEQQLHTARQELSHALYQHD+ACRVIARLKK
Sbjct  61   PKTLQTASIPGMLGTFQNEWDGLMLSNYALEQQLHTARQELSHALYQHDSACRVIARLKK  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAA  573
            ERDEAR+LLA+ +R +P  AA E+   + TLSNGKRAA
Sbjct  121  ERDEARQLLAEVERHIP--AAPEAVTASATLSNGKRAA  156



>ref|XP_010522453.1| PREDICTED: pre-mRNA-processing factor 19 homolog 2-like [Tarenaya 
hassleriana]
Length=526

 Score =   273 bits (697),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/159 (81%), Positives = 144/159 (91%), Gaps = 2/159 (1%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            MNC+ISGEVPEEPVVSTKSGLLFE+RLIERHIS+YGKCPVTGEPL MDDIV IKTGK+ K
Sbjct  1    MNCAISGEVPEEPVVSTKSGLLFERRLIERHISEYGKCPVTGEPLAMDDIVTIKTGKVAK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            P+P+  ASIPG+LGMFQ EWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK
Sbjct  61   PKPLHTASIPGLLGMFQNEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAAE  576
            ERDEAR LLA+ +RQ+P+A  + +A+ A  +SNGKR A+
Sbjct  121  ERDEARALLAEVERQIPAAPQVMTANVA--ISNGKRGAD  157



>ref|NP_563708.1| MOS4-associated complex 3A [Arabidopsis thaliana]
 sp|Q94BR4.1|PR19A_ARATH RecName: Full=Pre-mRNA-processing factor 19 homolog 1; AltName: 
Full=MOS4-associated complex protein 3A; Short=MAC protein 
3A; AltName: Full=Plant U-box protein 59; AltName: Full=U-box 
domain-containing protein 59 [Arabidopsis thaliana]
 gb|AAK64044.1| putative pre-mRNA splicing factor PRP19 [Arabidopsis thaliana]
 gb|AAN13133.1| putative pre-mRNA splicing factor PRP19 [Arabidopsis thaliana]
 gb|AEE27707.1| MOS4-associated complex 3A [Arabidopsis thaliana]
Length=523

 Score =   273 bits (697),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 129/159 (81%), Positives = 142/159 (89%), Gaps = 2/159 (1%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            MNC+ISGEVPEEPVVS KSGLL+EKRLI+ HISDYGKCPVTGEP T+DDIVPIKTGKIVK
Sbjct  1    MNCAISGEVPEEPVVSKKSGLLYEKRLIQTHISDYGKCPVTGEPHTLDDIVPIKTGKIVK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            P+P+  ASIPG+LG FQ EWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK
Sbjct  61   PKPLHTASIPGLLGTFQTEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAAE  576
            ERDE+R+LLA+A+RQLP  AA E A +   LSNGKR  +
Sbjct  121  ERDESRQLLAEAERQLP--AAPEVATSNAALSNGKRGID  157



>ref|XP_009334193.1| PREDICTED: U-box domain-containing protein 72-like [Pyrus x bretschneideri]
 ref|XP_009334204.1| PREDICTED: U-box domain-containing protein 72-like [Pyrus x bretschneideri]
Length=520

 Score =   272 bits (696),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 126/159 (79%), Positives = 145/159 (91%), Gaps = 2/159 (1%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            MNC++SGEVPEEPVVS KSGLLFEKRLIERHIS+YGKCPVTGEPLT +DI+P++TGKIV+
Sbjct  1    MNCALSGEVPEEPVVSKKSGLLFEKRLIERHISEYGKCPVTGEPLTAEDIIPVQTGKIVR  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP QAASIPGMLGMFQ+EWDSLML+NFA+E+QLHTARQELSHALYQHDAACRVIARLKK
Sbjct  61   PRPAQAASIPGMLGMFQLEWDSLMLANFAMEKQLHTARQELSHALYQHDAACRVIARLKK  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAAE  576
            ERDEAR LLAQA+RQ+P+ +A+ +  NA   SNG   A+
Sbjct  121  ERDEARSLLAQAERQIPAQSAVTA--NAAVHSNGTPVAD  157



>ref|NP_001030958.1| MOS4-associated complex 3A [Arabidopsis thaliana]
 gb|AEE27708.1| MOS4-associated complex 3A [Arabidopsis thaliana]
Length=523

 Score =   273 bits (697),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 129/159 (81%), Positives = 142/159 (89%), Gaps = 2/159 (1%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            MNC+ISGEVPEEPVVS KSGLL+EKRLI+ HISDYGKCPVTGEP T+DDIVPIKTGKIVK
Sbjct  1    MNCAISGEVPEEPVVSKKSGLLYEKRLIQTHISDYGKCPVTGEPHTLDDIVPIKTGKIVK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            P+P+  ASIPG+LG FQ EWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK
Sbjct  61   PKPLHTASIPGLLGTFQTEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAAE  576
            ERDE+R+LLA+A+RQLP  AA E A +   LSNGKR  +
Sbjct  121  ERDESRQLLAEAERQLP--AAPEVATSNAALSNGKRGID  157



>ref|XP_010413887.1| PREDICTED: pre-mRNA-processing factor 19 homolog 2-like isoform 
X2 [Camelina sativa]
Length=525

 Score =   272 bits (696),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 128/159 (81%), Positives = 143/159 (90%), Gaps = 2/159 (1%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            MNC+ISGEVP EPVVSTKSGLLFE+RLIERHISDYGKCPVTGEPLT+DDIVPIKTG+I+K
Sbjct  1    MNCAISGEVPAEPVVSTKSGLLFERRLIERHISDYGKCPVTGEPLTIDDIVPIKTGEIIK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            P+ +Q ASIPGMLG FQ EWD LMLSN+ALEQQLHTARQELSHALYQHD+ACRVIARLKK
Sbjct  61   PKTLQTASIPGMLGTFQNEWDGLMLSNYALEQQLHTARQELSHALYQHDSACRVIARLKK  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAAE  576
            ERDEAR+LLA+ +R +P  AA E+   + TLSNGKRA E
Sbjct  121  ERDEARQLLAEVERHIP--AAPEAVTASATLSNGKRADE  157



>ref|XP_010509903.1| PREDICTED: pre-mRNA-processing factor 19 homolog 2 [Camelina 
sativa]
Length=527

 Score =   272 bits (695),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 128/158 (81%), Positives = 142/158 (90%), Gaps = 2/158 (1%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            MNC+ISGEVP EPVVSTKSGLLFE+RLIERHISDYGKCPVTGEPLT+DDIVPIKTG+I+K
Sbjct  1    MNCAISGEVPAEPVVSTKSGLLFERRLIERHISDYGKCPVTGEPLTIDDIVPIKTGEIIK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            P+ +Q ASIPGMLG FQ EWD LMLSN+ALEQQLHTARQELSHALYQHD+ACRVIARLKK
Sbjct  61   PKTLQTASIPGMLGTFQNEWDGLMLSNYALEQQLHTARQELSHALYQHDSACRVIARLKK  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAA  573
            ERDEAR+LLA+ +R +P  AA E+     TLSNGKRAA
Sbjct  121  ERDEARQLLAEVERHIP--AAPEAVTANATLSNGKRAA  156



>ref|XP_010469491.1| PREDICTED: pre-mRNA-processing factor 19 homolog 2-like isoform 
X2 [Camelina sativa]
Length=525

 Score =   271 bits (694),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 128/159 (81%), Positives = 141/159 (89%), Gaps = 2/159 (1%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            MNC+ISGEVP EPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLT+DDIVPIKTG+I+K
Sbjct  1    MNCAISGEVPAEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTIDDIVPIKTGEIIK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            P+ +Q ASIPGMLG FQ EWD LMLSN+ALEQQLHTARQELSHALYQHD+ACRVIARLKK
Sbjct  61   PKTLQTASIPGMLGTFQNEWDGLMLSNYALEQQLHTARQELSHALYQHDSACRVIARLKK  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAAE  576
            ERDEAR+LLA+ +R +P  AA E+     TLSNGKR  E
Sbjct  121  ERDEARQLLAEVERHIP--AAPEAVTANATLSNGKRGDE  157



>ref|XP_006410473.1| hypothetical protein EUTSA_v10016510mg [Eutrema salsugineum]
 gb|ESQ51926.1| hypothetical protein EUTSA_v10016510mg [Eutrema salsugineum]
Length=525

 Score =   271 bits (694),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 125/158 (79%), Positives = 142/158 (90%), Gaps = 2/158 (1%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            MNC+ISGE+PEEPVVSTKSGLLFE+RLIERHISDYGKCPVTGEPL++DDIVPIKTGKI+K
Sbjct  1    MNCTISGEIPEEPVVSTKSGLLFERRLIERHISDYGKCPVTGEPLSIDDIVPIKTGKIIK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            P+P+  ASIPG+LG FQ EWD LMLSNFALEQQLHTARQELSHALYQHD+ACRVIARLKK
Sbjct  61   PKPLHTASIPGLLGTFQNEWDGLMLSNFALEQQLHTARQELSHALYQHDSACRVIARLKK  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAA  573
            ERDEAR+LLA+ +R +P  A  E+   +  +SNGKRAA
Sbjct  121  ERDEARQLLAEVERHIP--AVPEAVITSAAMSNGKRAA  156



>ref|XP_006307243.1| hypothetical protein CARUB_v10008852mg [Capsella rubella]
 gb|EOA40141.1| hypothetical protein CARUB_v10008852mg [Capsella rubella]
Length=522

 Score =   271 bits (693),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 127/159 (80%), Positives = 142/159 (89%), Gaps = 2/159 (1%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            MNC+ISGEVPEEPV+S KSGLL+EKRLIERHISDYGKCPVTGEP T+DDIV IKTGKIVK
Sbjct  1    MNCAISGEVPEEPVISVKSGLLYEKRLIERHISDYGKCPVTGEPHTLDDIVHIKTGKIVK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            P+P+  ASIPG+LG FQ EWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK
Sbjct  61   PKPLHTASIPGLLGTFQTEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAAE  576
            ERDE+R+LLA A+RQLP+   + + + A  LSNGKRA +
Sbjct  121  ERDESRQLLADAERQLPAVPEVSTGNAA--LSNGKRAID  157



>ref|XP_009141306.1| PREDICTED: pre-mRNA-processing factor 19 homolog 2 [Brassica 
rapa]
Length=525

 Score =   270 bits (691),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 127/158 (80%), Positives = 142/158 (90%), Gaps = 2/158 (1%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            MNC+ISGEVPEE VVSTKSGLLFE+RLIERHI DYGKCPVTGEPLT+DDIVPIKTGK++K
Sbjct  1    MNCAISGEVPEEAVVSTKSGLLFERRLIERHILDYGKCPVTGEPLTIDDIVPIKTGKVIK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            P+PV  ASIPG+LG FQ EWD LMLSNFALEQQLHTARQELSHALYQHD+ACRVIARLKK
Sbjct  61   PKPVHTASIPGLLGTFQNEWDGLMLSNFALEQQLHTARQELSHALYQHDSACRVIARLKK  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAA  573
            ERDEAR+LLA+ +R +P+A    +A+ A  LSNGKRAA
Sbjct  121  ERDEARQLLAEVERHIPAAPEAVTANAA--LSNGKRAA  156



>ref|XP_010089218.1| U-box domain-containing protein 72 [Morus notabilis]
 gb|EXB37496.1| U-box domain-containing protein 72 [Morus notabilis]
Length=572

 Score =   270 bits (691),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 130/154 (84%), Positives = 138/154 (90%), Gaps = 2/154 (1%)
 Frame = +1

Query  112  ISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVKPRPV  291
            ISGEVPEEPVVS KSGLLFEKRLIERHISDYGKCP+TGEPLTMDD+VPIKTGKIV+PRPV
Sbjct  56   ISGEVPEEPVVSAKSGLLFEKRLIERHISDYGKCPITGEPLTMDDLVPIKTGKIVRPRPV  115

Query  292  QAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKKERDE  471
            QAASIPGMLGMFQ EWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKKERDE
Sbjct  116  QAASIPGMLGMFQTEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKKERDE  175

Query  472  ARELLAQADRQLPSAAAMESADNATTLSNGKRAA  573
            AR LLAQ +R +P  A+     NA  + NG+ AA
Sbjct  176  ARSLLAQVERHVPMPASAPIVVNA--VGNGRTAA  207



>ref|NP_001031471.1| U-box protein MAC3B [Arabidopsis thaliana]
 gb|AEC08819.1| U-box protein MAC3B [Arabidopsis thaliana]
Length=485

 Score =   268 bits (684),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 126/158 (80%), Positives = 142/158 (90%), Gaps = 2/158 (1%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            MNC+ISGEVP EPVVSTKSGLLFE+RLIERHISDYGKCPVTGEPLT+DDIVPIKTG+I+K
Sbjct  1    MNCAISGEVPVEPVVSTKSGLLFERRLIERHISDYGKCPVTGEPLTIDDIVPIKTGEIIK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            P+ +  ASIPG+LG FQ EWD LMLSNFALEQQLHTARQELSHALYQHD+ACRVIARLKK
Sbjct  61   PKTLHTASIPGLLGTFQNEWDGLMLSNFALEQQLHTARQELSHALYQHDSACRVIARLKK  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAA  573
            ERDEAR+LLA+ +R +P+A    +A+ A  LSNGKRAA
Sbjct  121  ERDEARQLLAEVERHIPAAPEAVTANAA--LSNGKRAA  156



>ref|XP_010483893.1| PREDICTED: pre-mRNA-processing factor 19 homolog 1 [Camelina 
sativa]
Length=522

 Score =   268 bits (686),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 126/159 (79%), Positives = 144/159 (91%), Gaps = 2/159 (1%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            MNC+ISGEVPEEPVVS KSGLL+EKRLIERHISDYGKCPVTGEP T++DIVPIKTGKIVK
Sbjct  1    MNCAISGEVPEEPVVSKKSGLLYEKRLIERHISDYGKCPVTGEPHTLEDIVPIKTGKIVK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            P+ + AASIPG+LG FQ EWDSL+LSNF+LEQQLHTARQELSHALYQHDAACRVIARLK 
Sbjct  61   PKALHAASIPGLLGAFQTEWDSLILSNFSLEQQLHTARQELSHALYQHDAACRVIARLKN  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAAE  576
            ERDE+R+LLA+A+RQLP+   + +A+ A  LSNGKRA +
Sbjct  121  ERDESRQLLAEAERQLPAVPEVSTANAA--LSNGKRAMD  157



>ref|XP_008801251.1| PREDICTED: U-box domain-containing protein 72-like [Phoenix dactylifera]
Length=526

 Score =   268 bits (686),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 131/160 (82%), Positives = 146/160 (91%), Gaps = 3/160 (2%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M C+ISGEVPEEPV+S KSGLLFE+RLIER+I+DYGKCPVT E LTMDDI+P+KT K+VK
Sbjct  1    MICAISGEVPEEPVLSKKSGLLFERRLIERYIADYGKCPVTKEELTMDDILPVKTNKVVK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP+QAASIPG+LGMFQ EWD+LMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK
Sbjct  61   PRPLQAASIPGLLGMFQNEWDALMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTL-SNGKRAAE  576
            ERDEAR LLAQA+RQ+PS+ A  SA NA  + SNGKRAAE
Sbjct  121  ERDEARILLAQAERQIPSSIA--SAANANNIVSNGKRAAE  158



>ref|XP_006854430.1| hypothetical protein AMTR_s00039p00212570 [Amborella trichopoda]
 gb|ERN15897.1| hypothetical protein AMTR_s00039p00212570 [Amborella trichopoda]
Length=534

 Score =   269 bits (687),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 126/159 (79%), Positives = 141/159 (89%), Gaps = 0/159 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M C++SG  PE+PVVS KSGLLFEKRLIERHI DYGKCPVTGEPLTMDDIV +KT K VK
Sbjct  1    MFCAVSGVTPEDPVVSKKSGLLFEKRLIERHILDYGKCPVTGEPLTMDDIVSVKTNKAVK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP+QAASIPGMLG+FQ EWD+LMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK
Sbjct  61   PRPLQAASIPGMLGLFQNEWDALMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAAE  576
            ERDEAR LLAQA+RQ+P+ A+  ++ +   +SNGKR AE
Sbjct  121  ERDEARALLAQAERQIPTTASDAASMHTAVVSNGKRVAE  159



>ref|XP_002881277.1| transducin family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57536.1| transducin family protein [Arabidopsis lyrata subsp. lyrata]
Length=552

 Score =   269 bits (688),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 126/158 (80%), Positives = 143/158 (91%), Gaps = 2/158 (1%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            MNC+ISGEVP+EPVVSTKSGLLFE+RLIERHISDYGKCPVTGEPLT+DDIVPIKTG+I+K
Sbjct  1    MNCAISGEVPKEPVVSTKSGLLFERRLIERHISDYGKCPVTGEPLTIDDIVPIKTGEIIK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            P+ +  ASIPG+LG FQ EWD LMLSNFALEQQLHTARQELSHALYQHD+ACRVIARLKK
Sbjct  61   PKTLHTASIPGLLGTFQNEWDGLMLSNFALEQQLHTARQELSHALYQHDSACRVIARLKK  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAA  573
            ERDEAR+LLA+ +R +P+A    +A+ A  LSNGKRAA
Sbjct  121  ERDEARQLLAEVERHIPAAPEAVTANAA--LSNGKRAA  156



>gb|KJB28535.1| hypothetical protein B456_005G053600 [Gossypium raimondii]
Length=519

 Score =   268 bits (685),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 130/159 (82%), Positives = 141/159 (89%), Gaps = 5/159 (3%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            MNCSISGE+PE+PVVS KSGLL+EKRLIERHI+DYGKCPVTGE LTM+DIVPIKTGK VK
Sbjct  1    MNCSISGELPEDPVVSKKSGLLYEKRLIERHIADYGKCPVTGEALTMEDIVPIKTGKNVK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PR + AASIPGMLGMFQ EWD+LMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK
Sbjct  61   PRSLTAASIPGMLGMFQNEWDALMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAAE  576
            ERDEAR LLAQA+RQ P  A+       T +SNGKRA+E
Sbjct  121  ERDEARSLLAQAERQAPLPASA-----ITAVSNGKRASE  154



>gb|AAB80652.1| putative PRP19-like spliceosomal protein [Arabidopsis thaliana]
Length=540

 Score =   268 bits (686),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 126/158 (80%), Positives = 142/158 (90%), Gaps = 2/158 (1%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            MNC+ISGEVP EPVVSTKSGLLFE+RLIERHISDYGKCPVTGEPLT+DDIVPIKTG+I+K
Sbjct  1    MNCAISGEVPVEPVVSTKSGLLFERRLIERHISDYGKCPVTGEPLTIDDIVPIKTGEIIK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            P+ +  ASIPG+LG FQ EWD LMLSNFALEQQLHTARQELSHALYQHD+ACRVIARLKK
Sbjct  61   PKTLHTASIPGLLGTFQNEWDGLMLSNFALEQQLHTARQELSHALYQHDSACRVIARLKK  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAA  573
            ERDEAR+LLA+ +R +P+A    +A+ A  LSNGKRAA
Sbjct  121  ERDEARQLLAEVERHIPAAPEAVTANAA--LSNGKRAA  156



>ref|XP_009119290.1| PREDICTED: pre-mRNA-processing factor 19 homolog 1 [Brassica 
rapa]
Length=522

 Score =   268 bits (684),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 127/159 (80%), Positives = 140/159 (88%), Gaps = 2/159 (1%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            MNC+ISGEVP EPVVS KSGLL+EKRLIE HISD+GKCPVTGEP T+DDIV +KTGKIVK
Sbjct  1    MNCAISGEVPVEPVVSKKSGLLYEKRLIETHISDFGKCPVTGEPHTIDDIVAVKTGKIVK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            P+P+  ASIPG+LG FQ EWD LMLSNF+LEQQLHTARQELSHALYQHDAACRVIARLKK
Sbjct  61   PKPLHTASIPGLLGTFQTEWDGLMLSNFSLEQQLHTARQELSHALYQHDAACRVIARLKK  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAAE  576
            ERDEAR+LLA+ +RQLP  AA E A    TLSNGKRAA+
Sbjct  121  ERDEARQLLAEGERQLP--AAPEVASENVTLSNGKRAAD  157



>ref|NP_850206.4| U-box protein MAC3B [Arabidopsis thaliana]
 ref|NP_850207.4| U-box protein MAC3B [Arabidopsis thaliana]
 sp|O22785.3|PR19B_ARATH RecName: Full=Pre-mRNA-processing factor 19 homolog 2; AltName: 
Full=MOS4-associated complex protein 3B; Short=MAC protein 
3B; AltName: Full=Plant U-box protein 60; AltName: Full=U-box 
domain-containing protein 60 [Arabidopsis thaliana]
 gb|ACO38702.1| truncated MOS4-associated complex protein 3B [Arabidopsis thaliana]
 gb|AEC08817.1| U-box protein MAC3B [Arabidopsis thaliana]
 gb|AEC08818.1| U-box protein MAC3B [Arabidopsis thaliana]
Length=525

 Score =   268 bits (684),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 126/158 (80%), Positives = 142/158 (90%), Gaps = 2/158 (1%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            MNC+ISGEVP EPVVSTKSGLLFE+RLIERHISDYGKCPVTGEPLT+DDIVPIKTG+I+K
Sbjct  1    MNCAISGEVPVEPVVSTKSGLLFERRLIERHISDYGKCPVTGEPLTIDDIVPIKTGEIIK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            P+ +  ASIPG+LG FQ EWD LMLSNFALEQQLHTARQELSHALYQHD+ACRVIARLKK
Sbjct  61   PKTLHTASIPGLLGTFQNEWDGLMLSNFALEQQLHTARQELSHALYQHDSACRVIARLKK  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAA  573
            ERDEAR+LLA+ +R +P+A    +A+ A  LSNGKRAA
Sbjct  121  ERDEARQLLAEVERHIPAAPEAVTANAA--LSNGKRAA  156



>ref|XP_008438467.1| PREDICTED: U-box domain-containing protein 72 [Cucumis melo]
Length=522

 Score =   267 bits (683),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 129/159 (81%), Positives = 139/159 (87%), Gaps = 2/159 (1%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            MNCSISGE+PEEPVVS  SGLLFEKRLIERHI DYGKCPVTGEPL++DDIVPIKTGKIVK
Sbjct  1    MNCSISGEIPEEPVVSRNSGLLFEKRLIERHILDYGKCPVTGEPLSIDDIVPIKTGKIVK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PR  QAASIPGMLGMFQ EWD L+LSNFALEQQLHTARQELSHALYQHDAACRVIARLKK
Sbjct  61   PR--QAASIPGMLGMFQNEWDVLVLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  118

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAAE  576
            ERDEAR LLAQA+RQ+P ++   S++      NGKR  E
Sbjct  119  ERDEARSLLAQAERQMPLSSTSFSSNAGAVNVNGKRVNE  157



>emb|CDX89818.1| BnaA10g02640D [Brassica napus]
Length=522

 Score =   267 bits (683),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 127/159 (80%), Positives = 140/159 (88%), Gaps = 2/159 (1%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            MNC+ISGEVP EPVVS KSGLL+EKRLIE HISD+GKCPVTGEP T+DDIV +KTGKIVK
Sbjct  1    MNCAISGEVPVEPVVSKKSGLLYEKRLIETHISDFGKCPVTGEPHTIDDIVAVKTGKIVK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            P+P+  ASIPG+LG FQ EWD LMLSNF+LEQQLHTARQELSHALYQHDAACRVIARLKK
Sbjct  61   PKPLHTASIPGLLGSFQTEWDGLMLSNFSLEQQLHTARQELSHALYQHDAACRVIARLKK  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAAE  576
            ERDEAR+LLA+ +RQLP  AA E A    TLSNGKRAA+
Sbjct  121  ERDEARQLLAEGERQLP--AAPEVASENVTLSNGKRAAD  157



>ref|XP_010934240.1| PREDICTED: pre-mRNA-processing factor 19-like [Elaeis guineensis]
Length=509

 Score =   266 bits (680),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 130/160 (81%), Positives = 143/160 (89%), Gaps = 3/160 (2%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M C+ISGEVPEEPV+S KSGLLFE+RLIERHI+DY KCPVT E LTMDDI+P+KT K  K
Sbjct  1    MICAISGEVPEEPVLSKKSGLLFERRLIERHIADYAKCPVTKEALTMDDILPVKTNKAAK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP+QAASIPG+LGMFQ EWD+LMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK
Sbjct  61   PRPLQAASIPGLLGMFQNEWDALMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTL-SNGKRAAE  576
            ERDEAR LLAQA+RQ+PS  +M SA NA  + SNGKRAAE
Sbjct  121  ERDEARMLLAQAERQIPS--SMASAANANNIVSNGKRAAE  158



>ref|XP_010920296.1| PREDICTED: pre-mRNA-processing factor 19-like [Elaeis guineensis]
Length=526

 Score =   266 bits (680),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 130/160 (81%), Positives = 145/160 (91%), Gaps = 3/160 (2%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M C+ISGEVPEEPV+S KSGLLFE+RLIER+I+DYGKCPVT E LTMDDI+P+KT K+VK
Sbjct  1    MICAISGEVPEEPVLSKKSGLLFERRLIERYIADYGKCPVTKEELTMDDILPVKTNKVVK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP+QAASIPG+LGMFQ EWD+LMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK
Sbjct  61   PRPLQAASIPGLLGMFQNEWDALMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTL-SNGKRAAE  576
            ERDEAR LLAQA+RQ+P + A  SA NA  + SNGKRAAE
Sbjct  121  ERDEARMLLAQAERQIPLSIA--SAANANNIVSNGKRAAE  158



>ref|XP_004134043.1| PREDICTED: U-box domain-containing protein 72-like [Cucumis sativus]
 gb|KGN56819.1| hypothetical protein Csa_3G134680 [Cucumis sativus]
Length=522

 Score =   266 bits (680),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 129/159 (81%), Positives = 139/159 (87%), Gaps = 2/159 (1%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            MNCSISGE+PEEPVVS  SGLLFEKRLIERHI DYGKCPVTGEPL++DDIVPIKTGKIVK
Sbjct  1    MNCSISGEIPEEPVVSRNSGLLFEKRLIERHILDYGKCPVTGEPLSIDDIVPIKTGKIVK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PR  QAASIPGMLGMFQ EWD L+LSNFALEQQLHTARQELSHALYQHDAACRVIARLKK
Sbjct  61   PR--QAASIPGMLGMFQNEWDVLVLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  118

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAAE  576
            ERDEAR LLA A+RQ+P ++   S++ A    NGKR  E
Sbjct  119  ERDEARSLLALAERQMPLSSTSFSSNAAAVNVNGKRVNE  157



>ref|XP_009382203.1| PREDICTED: U-box domain-containing protein 72-like [Musa acuminata 
subsp. malaccensis]
Length=526

 Score =   265 bits (677),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 130/160 (81%), Positives = 144/160 (90%), Gaps = 3/160 (2%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M C+ISGEVPEEPVVS KSGLLFE+RLIE HI+ +GKCPVT E LT+DD+VP+KT K+VK
Sbjct  1    MICAISGEVPEEPVVSKKSGLLFERRLIEHHIASHGKCPVTKEDLTIDDLVPVKTNKVVK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP+QAASIPG+LGMFQ EWD+LMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK
Sbjct  61   PRPLQAASIPGLLGMFQNEWDALMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTL-SNGKRAAE  576
            ERDEAR LLAQA+RQ+P   A  SA NATT+ SNGKRAAE
Sbjct  121  ERDEARVLLAQAERQIPLLTA--SAANATTIVSNGKRAAE  158



>ref|XP_010457499.1| PREDICTED: pre-mRNA-processing factor 19 homolog 1-like [Camelina 
sativa]
Length=522

 Score =   265 bits (676),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 125/159 (79%), Positives = 142/159 (89%), Gaps = 2/159 (1%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            MNC+ISGEVPE PVVS KSGLL+EKRLIERHISDYGKCPVTGEP T++DIVPIKTGKIVK
Sbjct  1    MNCAISGEVPEVPVVSKKSGLLYEKRLIERHISDYGKCPVTGEPHTLEDIVPIKTGKIVK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            P+ + AASIPG+LG FQ EWDSL+LSNF+LEQQLHTARQELSHALYQHDAACRVIARLK 
Sbjct  61   PKALHAASIPGLLGAFQTEWDSLILSNFSLEQQLHTARQELSHALYQHDAACRVIARLKN  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAAE  576
            ERDE+R+LLA+A+RQLP+     +A+ A  LSNGKRA +
Sbjct  121  ERDESRQLLAEAERQLPAVPEASTANAA--LSNGKRAMD  157



>ref|XP_006410472.1| hypothetical protein EUTSA_v10016510mg [Eutrema salsugineum]
 gb|ESQ51925.1| hypothetical protein EUTSA_v10016510mg [Eutrema salsugineum]
Length=522

 Score =   264 bits (674),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 122/163 (75%), Positives = 141/163 (87%), Gaps = 7/163 (4%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            MNC+ISGE+PEEPVVSTKSGLLFE+RLIERHISDYGKCPVTGEPL++DDIVPIKTGKI+K
Sbjct  1    MNCTISGEIPEEPVVSTKSGLLFERRLIERHISDYGKCPVTGEPLSIDDIVPIKTGKIIK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            P+P+  ASIPG+LG FQ EWD LMLSNFALEQQLHTARQELSHALYQHD+ACRVIARLKK
Sbjct  61   PKPLHTASIPGLLGTFQNEWDGLMLSNFALEQQLHTARQELSHALYQHDSACRVIARLKK  120

Query  460  ERDEARELLAQADRQLP-------SAAAMESADNATTLSNGKR  567
            ERDEAR+LLA+ +R +P       ++AAM +A  A  +  G +
Sbjct  121  ERDEARQLLAEVERHIPAVPEAVITSAAMSNAAGAEEMGPGAK  163



>emb|CDY19484.1| BnaC04g11150D [Brassica napus]
Length=609

 Score =   266 bits (679),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 126/160 (79%), Positives = 141/160 (88%), Gaps = 2/160 (1%)
 Frame = +1

Query  97   TMNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIV  276
            TMNC+ISGEVPE PVVSTKSGLLFEKRLIE HISDYGKCPVTGEPLT+DDIVPIK+GK++
Sbjct  84   TMNCAISGEVPEVPVVSTKSGLLFEKRLIESHISDYGKCPVTGEPLTIDDIVPIKSGKVI  143

Query  277  KPRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLK  456
            KP+ +  ASIPG+LG FQ EWD LMLSNFALEQQLHTARQELSHALYQHD+ACRVIARLK
Sbjct  144  KPKLLHTASIPGLLGTFQNEWDGLMLSNFALEQQLHTARQELSHALYQHDSACRVIARLK  203

Query  457  KERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAAE  576
            KERDEAR+LLA+ +R +P  AA E+      LSNGKRAA+
Sbjct  204  KERDEARQLLAEVERHIP--AAPEAVTANAPLSNGKRAAD  241



>ref|XP_006294009.1| hypothetical protein CARUB_v10022997mg [Capsella rubella]
 gb|EOA26907.1| hypothetical protein CARUB_v10022997mg [Capsella rubella]
Length=525

 Score =   263 bits (673),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 124/158 (78%), Positives = 139/158 (88%), Gaps = 2/158 (1%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            MNC+ISGEVPEEPV+STKSGLLFE+RLIERHISD GKCPVTGEPLT++DIVPIK GKI+K
Sbjct  1    MNCAISGEVPEEPVISTKSGLLFERRLIERHISDNGKCPVTGEPLTIEDIVPIKAGKIIK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            P+ +  ASIPGMLG FQ EWD LML+NFALEQQLHTARQELSHALYQHD+ACRVIARLKK
Sbjct  61   PKTLHTASIPGMLGTFQNEWDGLMLTNFALEQQLHTARQELSHALYQHDSACRVIARLKK  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAA  573
            ERDEAR+LLA+ +R +P  AA E+      LSNGKRAA
Sbjct  121  ERDEARQLLAEVERHIP--AAPEAVTANANLSNGKRAA  156



>ref|XP_009143870.1| PREDICTED: pre-mRNA-processing factor 19 homolog 2-like [Brassica 
rapa]
 emb|CDY17165.1| BnaA05g10230D [Brassica napus]
Length=525

 Score =   263 bits (672),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 125/158 (79%), Positives = 139/158 (88%), Gaps = 2/158 (1%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            MNC+ISGEVPE PVVSTKSGLLFE+RLIE HISDYGKCPVTGEPLT+DDIVPIKTGK++K
Sbjct  1    MNCAISGEVPEVPVVSTKSGLLFERRLIETHISDYGKCPVTGEPLTIDDIVPIKTGKVLK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            P+ +  ASIPG+LG FQ EWD LMLSNFALEQQLHTARQELSHALYQHD+ACRVIARLKK
Sbjct  61   PKLLHTASIPGLLGTFQNEWDGLMLSNFALEQQLHTARQELSHALYQHDSACRVIARLKK  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAA  573
            ERDEAR+LLA+ +R +P  AA E+      LSNGKRAA
Sbjct  121  ERDEARQLLAEVERHIP--AAPEAVTANAPLSNGKRAA  156



>ref|XP_010475111.1| PREDICTED: pre-mRNA-processing factor 19 homolog 1-like [Camelina 
sativa]
Length=522

 Score =   263 bits (671),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 123/159 (77%), Positives = 143/159 (90%), Gaps = 2/159 (1%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            MNC+ISGEVPEEPVVS KSGLL+EKRLIERHI D+GKCPVTGEP T++DIVPIKTGKIVK
Sbjct  1    MNCAISGEVPEEPVVSKKSGLLYEKRLIERHILDFGKCPVTGEPHTIEDIVPIKTGKIVK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            P+ + A+SIPG+LG FQ EWDSL+LSNF+LEQQLHTARQELSHALYQHDAACRVIARLK 
Sbjct  61   PKALHASSIPGLLGAFQTEWDSLILSNFSLEQQLHTARQELSHALYQHDAACRVIARLKN  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAAE  576
            ERDE+R+LLA+A+RQLP+   + +A+ A  LSNGKRA +
Sbjct  121  ERDESRQLLAEAERQLPAVPEVSTANAA--LSNGKRAMD  157



>ref|XP_008785160.1| PREDICTED: U-box domain-containing protein 72-like [Phoenix dactylifera]
Length=526

 Score =   261 bits (666),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 125/159 (79%), Positives = 141/159 (89%), Gaps = 1/159 (1%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M C+ISGEVPEEPV+S +SGLLFE+RLIERHI+DYGKCPVT E LTMDDI+P+KT K  +
Sbjct  1    MICAISGEVPEEPVLSKESGLLFERRLIERHIADYGKCPVTKEELTMDDILPVKTNKAAR  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PR +QAASIPG+LGMFQ EWD+LMLSNFALEQQLHT RQELSHALYQHDAACRVIARLKK
Sbjct  61   PRSLQAASIPGLLGMFQNEWDALMLSNFALEQQLHTVRQELSHALYQHDAACRVIARLKK  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAAE  576
            ERDEAR LLAQA+RQ+PS+ A  SA+    +SNGKRAAE
Sbjct  121  ERDEARMLLAQAERQIPSSMAY-SANANNIVSNGKRAAE  158



>emb|CDY18239.1| BnaC05g02620D [Brassica napus]
Length=551

 Score =   259 bits (662),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 123/157 (78%), Positives = 142/157 (90%), Gaps = 2/157 (1%)
 Frame = +1

Query  106  CSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVKPR  285
            C++SGEVP EPVVS KSGLL+EKRLIE HISD+GKCPVTGEP T+DDIV +KTGKIVKP+
Sbjct  32   CAVSGEVPVEPVVSKKSGLLYEKRLIETHISDFGKCPVTGEPHTIDDIVAVKTGKIVKPK  91

Query  286  PVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKKER  465
            P+  ASIPG+LG FQ EWD LMLSNF+LEQQLHTARQELSHALYQHDAACRVIARLKKE 
Sbjct  92   PLHTASIPGLLGTFQTEWDGLMLSNFSLEQQLHTARQELSHALYQHDAACRVIARLKKEG  151

Query  466  DEARELLAQADRQLPSAAAMESADNATTLSNGKRAAE  576
            DEAR+LL++A+RQLP+A A+ + +NA TLSNGKRAA+
Sbjct  152  DEARQLLSEAERQLPAAPAV-ATENA-TLSNGKRAAD  186



>gb|ADE76270.1| unknown [Picea sitchensis]
Length=523

 Score =   257 bits (657),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 120/159 (75%), Positives = 139/159 (87%), Gaps = 0/159 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M C+ISG  PEEPVVS +SGLLFEKRL+E+HI++YG CPVTGE L+ DD+VP+KT K VK
Sbjct  1    MFCAISGSTPEEPVVSKRSGLLFEKRLVEKHIAEYGTCPVTGESLSTDDLVPVKTPKAVK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP+QAASIPGMLG+FQ EWD++MLSN+ALEQQLHTARQELSHALYQHDAACRVIARLKK
Sbjct  61   PRPLQAASIPGMLGLFQNEWDAVMLSNYALEQQLHTARQELSHALYQHDAACRVIARLKK  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAAE  576
            ERDEAR LLAQADRQ+P   +  +A NA+ +SNGKR  E
Sbjct  121  ERDEARALLAQADRQIPMLPSNLAAVNASAVSNGKRDLE  159



>ref|XP_002464506.1| hypothetical protein SORBIDRAFT_01g019790 [Sorghum bicolor]
 gb|EER91504.1| hypothetical protein SORBIDRAFT_01g019790 [Sorghum bicolor]
Length=535

 Score =   257 bits (657),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 123/159 (77%), Positives = 140/159 (88%), Gaps = 2/159 (1%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M C+ISGEVP+EPVVS KSGLLFE+RLIER++ D+GKCPVT E LTMDDIVP+KT K+VK
Sbjct  1    MICAISGEVPDEPVVSKKSGLLFERRLIERYVEDHGKCPVTKEDLTMDDIVPVKTNKVVK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP+QAASIPG+LG+FQ EWD+LMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK
Sbjct  61   PRPLQAASIPGLLGIFQNEWDALMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAAE  576
            ERDEAR LLA A+RQ+P  A++  A     +SNGKRA E
Sbjct  121  ERDEARALLALAERQIP--ASVPGAAPVAVVSNGKRAME  157



>gb|EEC67131.1| hypothetical protein OsI_33953 [Oryza sativa Indica Group]
Length=502

 Score =   253 bits (647),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 122/159 (77%), Positives = 139/159 (87%), Gaps = 2/159 (1%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M C+ISGEVP+EPVVS KSGLLFE+RL+ER+I D+GKCPVT E LTMDDIV +KT K+VK
Sbjct  1    MICAISGEVPDEPVVSKKSGLLFERRLVERYIEDHGKCPVTKEELTMDDIVAVKTNKVVK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PR +QAASIPG+LGMFQ EWD++MLS+FALEQQLHTARQELSHALYQHDAACRVIARLKK
Sbjct  61   PRQLQAASIPGLLGMFQNEWDAIMLSSFALEQQLHTARQELSHALYQHDAACRVIARLKK  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAAE  576
            ERDEAR LLAQA+RQ+P  A+M  A     +SNGKRA E
Sbjct  121  ERDEARALLAQAERQIP--ASMAGAAPTAVVSNGKRAFE  157



>ref|XP_010276202.1| PREDICTED: U-box domain-containing protein 72-like [Nelumbo nucifera]
Length=522

 Score =   253 bits (646),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 130/159 (82%), Positives = 141/159 (89%), Gaps = 1/159 (1%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M CSISG VPEEP +S KSGLLFEKRLIE H++DYGKCPVTGEPLTMDDIVPIKT +IVK
Sbjct  1    MFCSISGVVPEEPAISKKSGLLFEKRLIEHHVADYGKCPVTGEPLTMDDIVPIKTSRIVK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PR  QAASIPG+LGMFQ EWD LMLS FALEQQLH ARQELSHALYQHDAACRVIARLKK
Sbjct  61   PRSSQAASIPGLLGMFQNEWDGLMLSTFALEQQLHMARQELSHALYQHDAACRVIARLKK  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAAE  576
            ERDEAR LLAQA+RQ+P +A+  +A NA+ LSNGKRAAE
Sbjct  121  ERDEARSLLAQAERQIPMSASAAAA-NASALSNGKRAAE  158



>ref|NP_001064804.1| Os10g0466300 [Oryza sativa Japonica Group]
 sp|Q9AV81.1|PRP19_ORYSJ RecName: Full=Pre-mRNA-processing factor 19; AltName: Full=Plant 
U-box protein 72; Short=OsPUB72; AltName: Full=U-box domain-containing 
protein 72 [Oryza sativa Japonica Group]
 gb|AAK27816.1|AC022457_19 putative WD-repeat containing protein [Oryza sativa Japonica 
Group]
 gb|AAP54192.1| PRP19/PSO4, putative, expressed [Oryza sativa Japonica Group]
 gb|ABG66129.1| PRP19/PSO4, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF26718.1| Os10g0466300 [Oryza sativa Japonica Group]
 dbj|BAG89200.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE51104.1| hypothetical protein OsJ_31829 [Oryza sativa Japonica Group]
Length=527

 Score =   253 bits (646),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 122/159 (77%), Positives = 139/159 (87%), Gaps = 2/159 (1%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M C+ISGEVP+EPVVS KSGLLFE+RL+ER+I D+GKCPVT E LTMDDIV +KT K+VK
Sbjct  1    MICAISGEVPDEPVVSKKSGLLFERRLVERYIEDHGKCPVTKEELTMDDIVAVKTNKVVK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PR +QAASIPG+LGMFQ EWD++MLS+FALEQQLHTARQELSHALYQHDAACRVIARLKK
Sbjct  61   PRQLQAASIPGLLGMFQNEWDAIMLSSFALEQQLHTARQELSHALYQHDAACRVIARLKK  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAAE  576
            ERDEAR LLAQA+RQ+P  A+M  A     +SNGKRA E
Sbjct  121  ERDEARALLAQAERQIP--ASMAGAAPTAVVSNGKRAFE  157



>gb|ADE75987.1| unknown [Picea sitchensis]
Length=523

 Score =   252 bits (643),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 118/159 (74%), Positives = 137/159 (86%), Gaps = 0/159 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M C+ISG  PEEPVVS +SGLLFEKRL+E+HI++YG CPVTGE L+ DD+VP+KT K VK
Sbjct  1    MFCAISGSTPEEPVVSKRSGLLFEKRLVEKHIAEYGTCPVTGESLSTDDLVPVKTPKAVK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
             RP+QAASIPGMLG+FQ EWD++MLSN+ LEQQLHTARQELSHALYQHDAACRVIARLKK
Sbjct  61   LRPLQAASIPGMLGLFQNEWDAVMLSNYTLEQQLHTARQELSHALYQHDAACRVIARLKK  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAAE  576
            ERDEAR LLAQADRQ+P   +  +A NA+ +SNGKR  E
Sbjct  121  ERDEARALLAQADRQIPMLPSNLAAVNASAVSNGKRDLE  159



>ref|XP_009411388.1| PREDICTED: U-box domain-containing protein 72 [Musa acuminata 
subsp. malaccensis]
Length=526

 Score =   252 bits (643),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 122/159 (77%), Positives = 142/159 (89%), Gaps = 1/159 (1%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M C+ISGEVPE+PV+S KSGLLFE+RLIE HI+ +GKCP+T E LTMDD++P+KT K+VK
Sbjct  1    MICAISGEVPEDPVLSKKSGLLFERRLIEHHIASHGKCPITKEELTMDDLIPVKTNKVVK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP+QAASIPG+LGMFQ EWD+LMLS+FALEQQLHTARQELSHALYQHDAACRVIARLKK
Sbjct  61   PRPLQAASIPGLLGMFQNEWDALMLSSFALEQQLHTARQELSHALYQHDAACRVIARLKK  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAAE  576
            ERDEAR LLAQA+RQ+P   A  +A+  T +SNGKRAAE
Sbjct  121  ERDEARMLLAQAERQIP-LLAASAANATTAVSNGKRAAE  158



>gb|EMT08986.1| Pre-mRNA-processing factor 19-2-like protein [Aegilops tauschii]
Length=324

 Score =   245 bits (626),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 118/160 (74%), Positives = 137/160 (86%), Gaps = 2/160 (1%)
 Frame = +1

Query  97   TMNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIV  276
            T    +SGEVP+EPVVS +SGLLFE+RLIER+I D+GKCPVT E L+MDDIV +KT K+V
Sbjct  38   TFGPEVSGEVPDEPVVSKRSGLLFERRLIERYIEDHGKCPVTKEELSMDDIVLVKTNKVV  97

Query  277  KPRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLK  456
            +PRP+QAASIPG+LG+FQ EWD+LMLSNFALEQQLHTARQELSHALYQHDAACRVIARLK
Sbjct  98   RPRPLQAASIPGLLGIFQNEWDALMLSNFALEQQLHTARQELSHALYQHDAACRVIARLK  157

Query  457  KERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAAE  576
            KERDE+R LLA A+RQ+P  A+M     A  +SNGKRA E
Sbjct  158  KERDESRALLALAERQIP--ASMAGVAPAAVVSNGKRAME  195



>ref|XP_003574025.1| PREDICTED: U-box domain-containing protein 72 [Brachypodium distachyon]
Length=527

 Score =   250 bits (638),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 121/159 (76%), Positives = 138/159 (87%), Gaps = 2/159 (1%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M C+ISGEVPEEPVVS  SGLLFE+RLIER+I D+GKCPVT + L+MDDIV +KT K+VK
Sbjct  1    MICAISGEVPEEPVVSKSSGLLFERRLIERYIEDHGKCPVTKQDLSMDDIVLVKTNKVVK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP+QAASIPG+LG+FQ EWD+LMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK
Sbjct  61   PRPLQAASIPGLLGIFQNEWDALMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAAE  576
            ERDE+R LLA A+RQ+P  A+M     A  +SNGKRA E
Sbjct  121  ERDESRALLALAERQIP--ASMAGDVPAAVVSNGKRAME  157



>ref|XP_004982929.1| PREDICTED: U-box domain-containing protein 72-like [Setaria italica]
Length=526

 Score =   249 bits (635),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 122/159 (77%), Positives = 142/159 (89%), Gaps = 2/159 (1%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M C+ISGEVP+EPVVS KSGLLFE+RLIER++ D+GKCPVT E LTMDDIVP+KT K+VK
Sbjct  1    MICAISGEVPDEPVVSKKSGLLFERRLIERYVEDHGKCPVTKEELTMDDIVPVKTNKVVK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP+QAASIPG+LG+FQ EWD+LMLSN++LEQQLHTARQELSHALYQHDAACRVIARLKK
Sbjct  61   PRPLQAASIPGLLGIFQNEWDALMLSNYSLEQQLHTARQELSHALYQHDAACRVIARLKK  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAAE  576
            ERDEAR LLAQA+RQ+P++ A  +   A  +SNGKRA E
Sbjct  121  ERDEARTLLAQAERQIPASVAAAAP--AAVVSNGKRATE  157



>ref|NP_001150622.1| pre-mRNA-splicing factor 19 [Zea mays]
 ref|XP_008678422.1| PREDICTED: pre-mRNA-splicing factor 19 isoform X1 [Zea mays]
 gb|ACG39790.1| pre-mRNA-splicing factor 19 [Zea mays]
 gb|ACN34262.1| unknown [Zea mays]
 tpg|DAA49697.1| TPA: pre-mRNA-splicing factor 19 isoform 1 [Zea mays]
 tpg|DAA49698.1| TPA: pre-mRNA-splicing factor 19 isoform 2 [Zea mays]
Length=526

 Score =   248 bits (633),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 122/159 (77%), Positives = 141/159 (89%), Gaps = 2/159 (1%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M C+ISGEVP+EPVVS KSGLLFE+RLIER+I D+GKCP+T + LTMDDIVP+ T K+VK
Sbjct  1    MICAISGEVPDEPVVSKKSGLLFERRLIERYIEDHGKCPITKDELTMDDIVPVNTNKVVK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP+QAASIPG+LG+FQ EWD+LMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK
Sbjct  61   PRPLQAASIPGLLGIFQNEWDALMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAAE  576
            ERDEAR LLAQA+RQ+P++ A  +   A  +SNGKRA E
Sbjct  121  ERDEARALLAQAERQIPASVAGAAP--AAVVSNGKRAME  157



>ref|XP_009111097.1| PREDICTED: LOW QUALITY PROTEIN: pre-mRNA-processing factor 19 
homolog 1-like [Brassica rapa]
Length=523

 Score =   247 bits (631),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 122/160 (76%), Positives = 141/160 (88%), Gaps = 3/160 (2%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            MNC++SGEVP EPVVS K+GLL+EKRLIERHISDYGKCPVTGE  T+ DIV IKTGKI+K
Sbjct  1    MNCAVSGEVPVEPVVSKKTGLLYEKRLIERHISDYGKCPVTGELHTIADIVAIKTGKIIK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFAL-EQQLHTARQELSHALYQHDAACRVIARLK  456
            P+P+  ASIPG+LG FQ EWDSLML+NF+L EQQLH+ARQELSHALYQHDAACRVIARLK
Sbjct  61   PKPLHTASIPGLLGSFQTEWDSLMLTNFSLEEQQLHSARQELSHALYQHDAACRVIARLK  120

Query  457  KERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAAE  576
            KERDEAR+LL++A+RQLP+A    +A    TLSNGKRAA+
Sbjct  121  KERDEARQLLSEAERQLPAAPEAATA--NATLSNGKRAAD  158



>emb|CDY15510.1| BnaA08g27940D [Brassica napus]
Length=550

 Score =   247 bits (631),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 121/156 (78%), Positives = 139/156 (89%), Gaps = 2/156 (1%)
 Frame = +1

Query  109  SISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVKPRP  288
            ++SGEVP EP+VS K+GLL+EKRLIERHISDYGKCPVTGE  T+DDIV IKTGKIVKP+P
Sbjct  32   AVSGEVPVEPMVSKKTGLLYEKRLIERHISDYGKCPVTGELHTIDDIVSIKTGKIVKPKP  91

Query  289  VQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKKERD  468
            +  ASIPG+LG FQ EWDSLML+NF+LEQQLHTARQELSHALYQHDAACRVIARLKKERD
Sbjct  92   LHTASIPGLLGAFQTEWDSLMLTNFSLEQQLHTARQELSHALYQHDAACRVIARLKKERD  151

Query  469  EARELLAQADRQLPSAAAMESADNATTLSNGKRAAE  576
            EAR+LL++A+RQLP+A    +A    TLSNGKRAA+
Sbjct  152  EARQLLSEAERQLPAAPEAATA--NATLSNGKRAAD  185



>ref|NP_001130751.1| uncharacterized protein LOC100191855 [Zea mays]
 gb|ACF79093.1| unknown [Zea mays]
 gb|AFW68633.1| hypothetical protein ZEAMMB73_254634 [Zea mays]
Length=526

 Score =   245 bits (626),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 122/159 (77%), Positives = 139/159 (87%), Gaps = 2/159 (1%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M C+ISGEVP+EPVVS KSGLLFE+RLIER+I D+GKCP T E LTMDDIVP+KT  IVK
Sbjct  1    MICAISGEVPDEPVVSKKSGLLFERRLIERYIEDHGKCPATKEDLTMDDIVPVKTNTIVK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP+QAASIPG+LG+FQ EWD+LMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK
Sbjct  61   PRPLQAASIPGLLGIFQNEWDALMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAAE  576
            ERD+AR LLAQA+RQ+P++ A  +   A  +SNGKR  E
Sbjct  121  ERDDARALLAQAERQIPASVAGAAP--AAVVSNGKRVIE  157



>gb|AGH13207.1| PUB1 [Triticum aestivum]
Length=531

 Score =   244 bits (622),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 120/159 (75%), Positives = 138/159 (87%), Gaps = 2/159 (1%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M C+ISGEVPE+PV+STKSGLLFE+RLI+R+I D+GKCPVT E L MDD+V +KT KI K
Sbjct  1    MICAISGEVPEDPVLSTKSGLLFERRLIQRYIEDHGKCPVTKEELAMDDLVTVKTNKIPK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP+QAAS+PG+LGMFQ EWD+LMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK
Sbjct  61   PRPLQAASVPGLLGMFQNEWDALMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAAE  576
            ERDE+R LLAQA+RQ+P +AA  +   A T  NGK A E
Sbjct  121  ERDESRTLLAQAERQIPISAAGPAPVAAVT--NGKGALE  157



>gb|EMS65878.1| U-box domain-containing protein 72 [Triticum urartu]
Length=619

 Score =   245 bits (626),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 118/160 (74%), Positives = 137/160 (86%), Gaps = 2/160 (1%)
 Frame = +1

Query  97   TMNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIV  276
            T    +SGEVP+EPVVS +SGLLFE+RLIER+I D+GKCPVT E L+MDDIV +KT K+V
Sbjct  38   TFGPEVSGEVPDEPVVSKRSGLLFERRLIERYIEDHGKCPVTKEELSMDDIVLVKTNKVV  97

Query  277  KPRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLK  456
            +PRP+QAASIPG+LG+FQ EWD+LMLSNFALEQQLHTARQELSHALYQHDAACRVIARLK
Sbjct  98   RPRPLQAASIPGLLGIFQNEWDALMLSNFALEQQLHTARQELSHALYQHDAACRVIARLK  157

Query  457  KERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAAE  576
            KERDE+R LLA A+RQ+P  A+M     A  +SNGKRA E
Sbjct  158  KERDESRALLALAERQIP--ASMAGVAPAAVVSNGKRAME  195



>ref|XP_003558846.1| PREDICTED: U-box domain-containing protein 72-like [Brachypodium 
distachyon]
Length=527

 Score =   241 bits (616),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 135/159 (85%), Gaps = 2/159 (1%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M C+ISGEVPEEPVVS  SGLLFE+RLIER+I D+GKCPVT + L MDD+V +KT KI K
Sbjct  1    MICAISGEVPEEPVVSKNSGLLFERRLIERYIEDHGKCPVTKDELAMDDLVAVKTNKITK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP+QAAS+PG+LGMFQ EWD+LMLSNFALEQQLHT+RQELSHALYQHDAACRVIARLKK
Sbjct  61   PRPLQAASVPGLLGMFQNEWDALMLSNFALEQQLHTSRQELSHALYQHDAACRVIARLKK  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAAE  576
            ERDE+R LLAQA+RQ+P +AA  +     T  NGK A +
Sbjct  121  ERDESRTLLAQAERQIPISAAGAAPVAVVT--NGKIALD  157



>ref|XP_001763879.1| predicted protein [Physcomitrella patens]
 gb|EDQ71283.1| predicted protein [Physcomitrella patens]
Length=522

 Score =   232 bits (591),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 113/159 (71%), Positives = 134/159 (84%), Gaps = 1/159 (1%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M CSISG  PE+PVVS KSGLLFE+RLI +HI+D G  PVTGE L+ +D++ IKT K VK
Sbjct  1    MFCSISGVTPEDPVVSRKSGLLFERRLILKHIADNGTDPVTGEVLSAEDLISIKTNKAVK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP+QAASIPGMLG+FQ EWD+++LSN+ALEQQLHTARQELSHALYQHDAACRVIARLKK
Sbjct  61   PRPLQAASIPGMLGLFQNEWDAVVLSNYALEQQLHTARQELSHALYQHDAACRVIARLKK  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAAE  576
            ERDEARE+L +++RQ P+A A+      T+ SNGKRA E
Sbjct  121  ERDEAREVLLKSERQAPAAGAVPVTAPITS-SNGKRAPE  158



>ref|XP_009605789.1| PREDICTED: pre-mRNA-processing factor 19 homolog 1-like [Nicotiana 
tomentosiformis]
Length=118

 Score =   219 bits (557),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 101/107 (94%), Positives = 104/107 (97%), Gaps = 0/107 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            MNCSISGEVPE+PVVS KSGLLFEKRLIERHISDYGKCPVTGEPLT DDI+P+KTGKIVK
Sbjct  1    MNCSISGEVPEDPVVSKKSGLLFEKRLIERHISDYGKCPVTGEPLTADDIIPVKTGKIVK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQ  420
            PRPVQAASIPGMLGMFQIEWD LMLSNFALEQQLHTARQELSHALYQ
Sbjct  61   PRPVQAASIPGMLGMFQIEWDGLMLSNFALEQQLHTARQELSHALYQ  107



>ref|XP_001754673.1| predicted protein [Physcomitrella patens]
 gb|EDQ80643.1| predicted protein [Physcomitrella patens]
Length=522

 Score =   230 bits (587),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 114/159 (72%), Positives = 134/159 (84%), Gaps = 1/159 (1%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M CSISG  PE+PVVS KSGLLFE+RLI +H++D G  PVTGE +++DD++ IKT K VK
Sbjct  1    MFCSISGVTPEDPVVSRKSGLLFERRLIFKHLADNGTDPVTGEAMSVDDLISIKTNKAVK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP+QAASIPGMLG+FQ EWD+++LSN+ALEQQLHTARQELSHALYQHDAACRVIARLKK
Sbjct  61   PRPLQAASIPGMLGLFQNEWDAVVLSNYALEQQLHTARQELSHALYQHDAACRVIARLKK  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAAE  576
            ERDEARELL +A+RQ P+A    +A    T SNGKRA E
Sbjct  121  ERDEARELLLKAERQAPTAGPAPAAAPTVT-SNGKRAPE  158



>ref|XP_002966895.1| ubiquitin-protein ligase, PUB59 [Selaginella moellendorffii]
 gb|EFJ31494.1| ubiquitin-protein ligase, PUB59 [Selaginella moellendorffii]
Length=520

 Score =   228 bits (582),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 111/159 (70%), Positives = 131/159 (82%), Gaps = 4/159 (3%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M C+ISG  PEEPV+S +SGLLFE+RLIE+H+++ G CPVTGE LT +D++P+KT K VK
Sbjct  1    MFCAISGLTPEEPVISKRSGLLFERRLIEKHLAENGTCPVTGESLTEEDLLPVKTNKAVK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRPV A SIPGMLGMFQ EWD+++LSN+ LEQQL+ ARQELSHALYQHDAACRVIARLK 
Sbjct  61   PRPVTATSIPGMLGMFQNEWDAVVLSNYHLEQQLNNARQELSHALYQHDAACRVIARLKT  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAAE  576
            ERD+AR LLAQA+ Q P  AA+  AD  T  SNGKR AE
Sbjct  121  ERDDARTLLAQAELQRP--AALPEADAVT--SNGKREAE  155



>ref|XP_002961116.1| ubiquitin-protein ligase, PUB59 [Selaginella moellendorffii]
 gb|EFJ38655.1| ubiquitin-protein ligase, PUB59 [Selaginella moellendorffii]
Length=517

 Score =   228 bits (581),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 111/159 (70%), Positives = 131/159 (82%), Gaps = 4/159 (3%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M C+ISG  PEEPV+S +SGLLFE+RLIE+H+++ G CPVTGE LT +D++P+KT K VK
Sbjct  1    MFCAISGLTPEEPVISKRSGLLFERRLIEKHLAENGTCPVTGESLTEEDLLPVKTNKAVK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRPV A SIPGMLGMFQ EWD+++LSN+ LEQQL+ ARQELSHALYQHDAACRVIARLK 
Sbjct  61   PRPVTATSIPGMLGMFQNEWDAVVLSNYHLEQQLNNARQELSHALYQHDAACRVIARLKT  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAAE  576
            ERD+AR LLAQA+ Q P  AA+  AD  T  SNGKR AE
Sbjct  121  ERDDARTLLAQAELQRP--AALPEADAVT--SNGKREAE  155



>gb|EMS55665.1| U-box domain-containing protein 72 [Triticum urartu]
Length=588

 Score =   226 bits (577),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 119/189 (63%), Positives = 136/189 (72%), Gaps = 34/189 (18%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHI----------------------------  195
            M C+ISGEVPE+PV+STKSGLLFE+RLI R+I                            
Sbjct  1    MICAISGEVPEDPVLSTKSGLLFERRLIRRYIEVTTVSPALGFASGARPCAWAFFPDFVL  60

Query  196  ----SDYGKCPVTGEPLTMDDIVPIKTGKIVKPRPVQAASIPGMLGMFQIEWDSLMLSNF  363
                 D+GKCPVT E L MDD+V +KT KI KPRP+QAAS+PG+LGMFQ EWD+LMLSNF
Sbjct  61   VLVPQDHGKCPVTKEELAMDDLVTVKTNKIPKPRPLQAASVPGLLGMFQNEWDALMLSNF  120

Query  364  ALEQQLHTARQELSHALYQHDAACRVIARLKKERDEARELLAQADRQLPSAAAMESADNA  543
            ALEQQLHTARQELSHALYQHDAACRVIARLKKERDE+R LLAQA+RQ+P +AA  +   A
Sbjct  121  ALEQQLHTARQELSHALYQHDAACRVIARLKKERDESRTLLAQAERQIPISAAGPAPVAA  180

Query  544  TTLSNGKRA  570
             T  NGKR 
Sbjct  181  VT--NGKRG  187



>ref|XP_004172579.1| PREDICTED: pre-mRNA-processing factor 19 homolog 2-like, partial 
[Cucumis sativus]
Length=297

 Score =   209 bits (533),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 101/129 (78%), Positives = 111/129 (86%), Gaps = 2/129 (2%)
 Frame = +1

Query  190  HISDYGKCPVTGEPLTMDDIVPIKTGKIVKPRPVQAASIPGMLGMFQIEWDSLMLSNFAL  369
            H+ DYGKCPVTGEPL++DDIVPIKTGKIVKPR  QAASIPGMLGMFQ EWD L+LSNFAL
Sbjct  7    HLQDYGKCPVTGEPLSIDDIVPIKTGKIVKPR--QAASIPGMLGMFQNEWDVLVLSNFAL  64

Query  370  EQQLHTARQELSHALYQHDAACRVIARLKKERDEARELLAQADRQLPSAAAMESADNATT  549
            EQQLHTARQELSHALYQHDAACRVIARLKKERDEAR LLA A+RQ+P ++   S++ A  
Sbjct  65   EQQLHTARQELSHALYQHDAACRVIARLKKERDEARSLLALAERQMPLSSTSFSSNAAAV  124

Query  550  LSNGKRAAE  576
              NGKR  E
Sbjct  125  NVNGKRVNE  133



>emb|CAN68859.1| hypothetical protein VITISV_023023 [Vitis vinifera]
Length=209

 Score =   201 bits (511),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 96/103 (93%), Positives = 99/103 (96%), Gaps = 2/103 (2%)
 Frame = +1

Query  112  ISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVKPRPV  291
            +SGEVPEEPVVS KSGLLFEKRLIERH  DYGKCP+TGEPLTMDDIVPI+TGKIVKPRPV
Sbjct  71   LSGEVPEEPVVSKKSGLLFEKRLIERH--DYGKCPITGEPLTMDDIVPIQTGKIVKPRPV  128

Query  292  QAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQ  420
            QAASIPGMLGMFQIEWD LMLSNFALEQQLHTARQELSHALYQ
Sbjct  129  QAASIPGMLGMFQIEWDGLMLSNFALEQQLHTARQELSHALYQ  171



>ref|XP_011013445.1| PREDICTED: pre-mRNA-processing factor 19-like [Populus euphratica]
Length=432

 Score =   206 bits (523),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 92/107 (86%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M+CSISGEVP EPVVS +SGLL+EKRLIERH+S+YGKCP+TGEPLTMDD+VP++TGKIVK
Sbjct  1    MHCSISGEVPGEPVVSKRSGLLYEKRLIERHVSEYGKCPITGEPLTMDDVVPVETGKIVK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQ  420
            PR VQ ASIPGMLGMFQ EWD LMLSNFALEQQLHTARQELSHALYQ
Sbjct  61   PRTVQTASIPGMLGMFQNEWDGLMLSNFALEQQLHTARQELSHALYQ  107



>gb|AFW70863.1| hypothetical protein ZEAMMB73_121693 [Zea mays]
Length=264

 Score =   184 bits (468),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 100/120 (83%), Gaps = 0/120 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M  +ISGEVP+EPVVS  SGLLFE+RLIER+I D+ KCP+T E LTMDDIVPIKT K+VK
Sbjct  1    MIYAISGEVPDEPVVSKMSGLLFERRLIERYIEDHSKCPITKEELTMDDIVPIKTNKVVK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP+QA SIPG+LG+FQ EWD LMLSNFALE+QLHTARQELSHALYQ     + + RL K
Sbjct  61   PRPLQATSIPGLLGIFQNEWDVLMLSNFALERQLHTARQELSHALYQARGLKKHLKRLNK  120



>gb|KIZ01721.1| pre-mRNA-processing factor 19, partial [Monoraphidium neglectum]
Length=347

 Score =   186 bits (473),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 102/129 (79%), Gaps = 0/129 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M C+ISG VPEEPVVS K+G +FE+RLIE+++ + GKCPVT   L+ DD++P+ T K VK
Sbjct  1    MFCAISGTVPEEPVVSKKTGHVFERRLIEKYVQETGKCPVTQAELSQDDLLPLATNKTVK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PR   A SIPG+LG+F  EWD+LML   AL Q LHT+RQELSHALYQHDAACRVIARL +
Sbjct  61   PRATPATSIPGLLGLFHDEWDALMLETHALRQALHTSRQELSHALYQHDAACRVIARLMR  120

Query  460  ERDEARELL  486
            ERDEAR  L
Sbjct  121  ERDEARGAL  129



>ref|XP_006661845.1| PREDICTED: U-box domain-containing protein 72-like [Oryza brachyantha]
Length=481

 Score =   186 bits (473),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 90/113 (80%), Positives = 100/113 (88%), Gaps = 2/113 (2%)
 Frame = +1

Query  238  MDDIVPIKTGKIVKPRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALY  417
            MDDIVP+KT K+VKPRP+QAASIPG+LGMFQ EWD+LMLS+FALEQQLHTARQELSHALY
Sbjct  1    MDDIVPVKTNKVVKPRPLQAASIPGLLGMFQNEWDALMLSSFALEQQLHTARQELSHALY  60

Query  418  QHDAACRVIARLKKERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAAE  576
            QHDAACRVIARLKKERDEAR LLAQA+RQ+P  A+M  A     +SNGKRA E
Sbjct  61   QHDAACRVIARLKKERDEARALLAQAERQIP--ASMAGAAPTAVVSNGKRAFE  111



>ref|XP_005643652.1| spliceosome component, nuclear pre-mRNA splicing factor [Coccomyxa 
subellipsoidea C-169]
 gb|EIE19108.1| spliceosome component, nuclear pre-mRNA splicing factor [Coccomyxa 
subellipsoidea C-169]
Length=510

 Score =   186 bits (472),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 92/159 (58%), Positives = 115/159 (72%), Gaps = 11/159 (7%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M CSISG VPEEPV++  +G LFEKRLIE+H+ + GK P+TGEP +++D++P+KT K VK
Sbjct  1    MFCSISGTVPEEPVINRSNGQLFEKRLIEKHVQETGKDPITGEPASLEDLLPVKTNKAVK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP  A SIPG+LG+F  EWD+LML +      L  +RQELSHALYQ DAACRVIARL +
Sbjct  61   PRPSAATSIPGLLGLFHNEWDALMLESHQQRIALIQSRQELSHALYQQDAACRVIARLTR  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAAE  576
            ERDEAR        QL +A A+  +D    L+NGKR AE
Sbjct  121  ERDEARS-------QLENAVAVARSD----LANGKRTAE  148



>gb|EMT10525.1| DEAD-box ATP-dependent RNA helicase 29 [Aegilops tauschii]
Length=1295

 Score =   191 bits (485),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 94/124 (76%), Positives = 106/124 (85%), Gaps = 2/124 (2%)
 Frame = +1

Query  199  DYGKCPVTGEPLTMDDIVPIKTGKIVKPRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQ  378
            D+GKCPVT E L MDD+V +KT KI KPRP+QAAS+PG+LGMFQ EWD+LMLSNFALEQQ
Sbjct  773  DHGKCPVTKEELAMDDLVTVKTNKIPKPRPLQAASVPGLLGMFQNEWDALMLSNFALEQQ  832

Query  379  LHTARQELSHALYQHDAACRVIARLKKERDEARELLAQADRQLPSAAAMESADNATTLSN  558
            LHTARQELSHALYQHDAACRVIARLKKERDE+R LLAQA+RQ+P +AA  +   A T  N
Sbjct  833  LHTARQELSHALYQHDAACRVIARLKKERDESRTLLAQAERQIPISAAGPAPVAAVT--N  890

Query  559  GKRA  570
            GKR 
Sbjct  891  GKRG  894



>gb|AAB70423.1| F19P19.2 [Arabidopsis thaliana]
Length=580

 Score =   184 bits (468),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 112/226 (50%), Positives = 129/226 (57%), Gaps = 71/226 (31%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYG------------------------  207
            MNC+ISGEVPEEPVVS KSGLL+EKRLI+ HIS +                         
Sbjct  1    MNCAISGEVPEEPVVSKKSGLLYEKRLIQTHISLFSLLHLSICCRYFLNTDFVVIIYRLL  60

Query  208  --KCPVTGEP------LTMDDIVPIKTGK--------------IVKPRPVQAASIPGMLG  321
               C + G        + +  + P K G+              IVKP+P+  ASIPG+LG
Sbjct  61   LVPCRIMGNARLLVSHILLMTLFPSKLGRNLFKPDSISGTILQIVKPKPLHTASIPGLLG  120

Query  322  MFQI------------EWDSLMLSNFALEQQLHTARQELSHALY-----------QHDAA  432
             FQ             EWDSLMLSNFALEQQLHTARQELSHALY           QHDAA
Sbjct  121  TFQTDHIELKWMNLIWEWDSLMLSNFALEQQLHTARQELSHALYQVIDGGYTFPLQHDAA  180

Query  433  CRVIARLKKERDEARELLAQADRQLPSAAAMESADNATTLSNGKRA  570
            CRVIARLKKERDE+R+LLA+A+RQLP  AA E A +   LSNGKR 
Sbjct  181  CRVIARLKKERDESRQLLAEAERQLP--AAPEVATSNAALSNGKRG  224



>ref|XP_642890.1| WD40 repeat-containing protein [Dictyostelium discoideum AX4]
 sp|Q7KWK5.1|PRP19_DICDI RecName: Full=Pre-mRNA-processing factor 19; AltName: Full=PRP19/PSO4 
homolog [Dictyostelium discoideum]
 gb|EAL68903.1| WD40 repeat-containing protein [Dictyostelium discoideum AX4]
Length=514

 Score =   182 bits (462),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 83/132 (63%), Positives = 100/132 (76%), Gaps = 0/132 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M C+ISG   EEPV+STK+G ++EKRLIE++I   GK P TGEPL + D++ +K GK VK
Sbjct  1    MICAISGSTTEEPVISTKTGNVYEKRLIEKYIDTNGKEPTTGEPLGLSDLITVKIGKTVK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP  A SIP ML +FQ EWDSLML  F L+QQ  T RQEL+H++YQ+DAACRVIARL K
Sbjct  61   PRPTTATSIPSMLQLFQNEWDSLMLETFTLKQQHETVRQELAHSMYQYDAACRVIARLVK  120

Query  460  ERDEARELLAQA  495
            ERD AR  LA A
Sbjct  121  ERDAARSALANA  132



>ref|XP_009594697.1| PREDICTED: U-box domain-containing protein 72-like isoform X2 
[Nicotiana tomentosiformis]
Length=485

 Score =   181 bits (459),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 89/103 (86%), Positives = 93/103 (90%), Gaps = 1/103 (1%)
 Frame = +1

Query  268  KIVKPRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIA  447
            +IVKPRPVQAASIPGMLGMFQIEWD LMLSNFALEQQLHTARQELSHALYQHDAACRVIA
Sbjct  20   QIVKPRPVQAASIPGMLGMFQIEWDGLMLSNFALEQQLHTARQELSHALYQHDAACRVIA  79

Query  448  RLKKERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAAE  576
            RLKKERDEAR LLAQA+RQ+P  AA  +A N   LSNGKRAAE
Sbjct  80   RLKKERDEARALLAQAERQVP-MAATTTAPNGAALSNGKRAAE  121



>ref|XP_002500515.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO61773.1| predicted protein [Micromonas sp. RCC299]
Length=493

 Score =   180 bits (456),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 83/140 (59%), Positives = 104/140 (74%), Gaps = 0/140 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M CSISG  PE+PV+S+K+G L+E+ LI + + + G+CPVT  P+T++D++P+K+   VK
Sbjct  1    MFCSISGTTPEDPVISSKTGHLYERSLITKALQETGECPVTKTPMTLEDLLPVKSSTTVK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PR   AASIPG+L +F  EWD+LML    L   LH  RQELSHALYQHDAACRVI+RL K
Sbjct  61   PRTTAAASIPGLLSIFHNEWDALMLETHELRVDLHGTRQELSHALYQHDAACRVISRLMK  120

Query  460  ERDEARELLAQADRQLPSAA  519
            ERDEARE LA A    PSAA
Sbjct  121  ERDEAREALANARAAGPSAA  140



>ref|XP_009759668.1| PREDICTED: U-box domain-containing protein 72-like isoform X3 
[Nicotiana sylvestris]
Length=486

 Score =   180 bits (456),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 88/102 (86%), Positives = 92/102 (90%), Gaps = 1/102 (1%)
 Frame = +1

Query  268  KIVKPRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIA  447
            +IVKPRPVQAASIPGMLGMFQIEWD LMLSNFALEQQLHTARQELSHALYQHDAACRVIA
Sbjct  20   QIVKPRPVQAASIPGMLGMFQIEWDGLMLSNFALEQQLHTARQELSHALYQHDAACRVIA  79

Query  448  RLKKERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAA  573
            RLKKERDEAR LLAQA+RQ+P  AA  +A N   LSNGKRAA
Sbjct  80   RLKKERDEARALLAQAERQVP-VAATTTATNGDALSNGKRAA  120



>ref|XP_003283650.1| hypothetical protein DICPUDRAFT_96440 [Dictyostelium purpureum]
 gb|EGC39783.1| hypothetical protein DICPUDRAFT_96440 [Dictyostelium purpureum]
Length=508

 Score =   180 bits (456),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 83/139 (60%), Positives = 102/139 (73%), Gaps = 0/139 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M CSISG  PEEPV+S K+G ++EKRLIE++I   GK P TGEPL++ D+V IK GK VK
Sbjct  1    MICSISGSTPEEPVISIKTGNVYEKRLIEKYIDTNGKEPTTGEPLSLQDLVAIKVGKTVK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP  A SIP ML +FQ EWD+LML  + L+QQ  + R EL+H++YQ+DAACRVIARL K
Sbjct  61   PRPATATSIPSMLQLFQNEWDALMLETYTLKQQHESIRLELAHSMYQYDAACRVIARLVK  120

Query  460  ERDEARELLAQADRQLPSA  516
            ERD AR  LA     +P A
Sbjct  121  ERDAARAALANVHNIIPQA  139



>ref|XP_001426454.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK59056.1| unnamed protein product [Paramecium tetraurelia]
Length=486

 Score =   179 bits (454),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 81/150 (54%), Positives = 104/150 (69%), Gaps = 0/150 (0%)
 Frame = +1

Query  106  CSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVKPR  285
            C++SGE+ E PV+S  SG ++EKRLIE+HI   G CP+TG PL  DD++ +K  K+ KPR
Sbjct  7    CALSGELIETPVISKVSGHIYEKRLIEKHIESTGTCPITGRPLNFDDLIEVKVAKVQKPR  66

Query  286  PVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKKER  465
            PV A SIP +L + Q EWD+L+L  F L+Q L   R EL+HALYQHDAACRVIA+L KER
Sbjct  67   PVTATSIPSLLSLLQNEWDALLLEQFQLKQHLEQVRHELTHALYQHDAACRVIAKLIKER  126

Query  466  DEARELLAQADRQLPSAAAMESADNATTLS  555
            D+AR  LAQ   +L     +E+ D    LS
Sbjct  127  DQARIELAQLQNKLNHKVEVETNDVTEKLS  156



>ref|XP_009041163.1| hypothetical protein AURANDRAFT_39132 [Aureococcus anophagefferens]
 gb|EGB04178.1| hypothetical protein AURANDRAFT_39132 [Aureococcus anophagefferens]
Length=497

 Score =   179 bits (454),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 84/156 (54%), Positives = 110/156 (71%), Gaps = 1/156 (1%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHI-SDYGKCPVTGEPLTMDDIVPIKTGKIV  276
            M C+ISGEVP EPV+S  SG +FE+RLIE+ + +  G CPVTG  L++ D++P++    V
Sbjct  1    MFCNISGEVPREPVISKTSGHVFERRLIEKSLEASKGVCPVTGNELSVSDLLPVEANLAV  60

Query  277  KPRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLK  456
            +PRP+ A S+PGML MFQ EWD +ML    ++QQLH  R+ELSHALYQHDAACRVIARL 
Sbjct  61   RPRPLTATSLPGMLAMFQNEWDDVMLETHVIKQQLHATRKELSHALYQHDAACRVIARLV  120

Query  457  KERDEARELLAQADRQLPSAAAMESADNATTLSNGK  564
             ERDEA+ L+A+  R L      E + N   +S G+
Sbjct  121  NERDEAQRLVAELQRSLAGKLTSEISSNRPNISKGE  156



>ref|XP_009040599.1| hypothetical protein AURANDRAFT_55101, partial [Aureococcus anophagefferens]
 gb|EGB04685.1| hypothetical protein AURANDRAFT_55101, partial [Aureococcus anophagefferens]
Length=388

 Score =   175 bits (443),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 103/137 (75%), Gaps = 1/137 (1%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHI-SDYGKCPVTGEPLTMDDIVPIKTGKIV  276
            M C+ISGEVP EPV+S  SG +FE+RLIE+ + +  G CPVTG  L++ D++P++    V
Sbjct  1    MFCNISGEVPREPVISKTSGHVFERRLIEKSLEASKGVCPVTGNELSVSDLLPVEANLAV  60

Query  277  KPRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLK  456
            +PRP+ A S+PGML MFQ EWD +ML    ++QQLH  R+ELSHALYQHDAACRVIARL 
Sbjct  61   RPRPLTATSLPGMLAMFQNEWDDVMLETHVIKQQLHATRKELSHALYQHDAACRVIARLV  120

Query  457  KERDEARELLAQADRQL  507
             ERDEA+ L+A+  R L
Sbjct  121  NERDEAQRLVAELQRSL  137



>gb|EAR89590.2| Pre-mRNA-processing factor, putative [Tetrahymena thermophila 
SB210]
Length=508

 Score =   177 bits (449),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 84/145 (58%), Positives = 105/145 (72%), Gaps = 1/145 (1%)
 Frame = +1

Query  106  CSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVKPR  285
            C+I+GE   EPVVS KSG +FEKR+IE+HI   G+CP+TG+ L+ DD++P++     KPR
Sbjct  6    CAITGEQLHEPVVSKKSGHVFEKRVIEKHIQSTGQCPITGQALSNDDLIPVQLNVQTKPR  65

Query  286  PVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKKER  465
             V + SIPG+L  FQ EWD+LML  + L+Q L T RQELSHALYQHDAACRVIARL KER
Sbjct  66   SVTSNSIPGILKTFQNEWDALMLETYNLKQHLETVRQELSHALYQHDAACRVIARLIKER  125

Query  466  DEARELLAQADRQLPSAAA-MESAD  537
            DEAR  +AQ   +L      +E AD
Sbjct  126  DEARFEVAQLQEKLRQGKMELEEAD  150



>ref|XP_001701820.1| spliceosome component, nuclear pre-mRNA splicing factor [Chlamydomonas 
reinhardtii]
 gb|EDP06795.1| spliceosome component, nuclear pre-mRNA splicing factor [Chlamydomonas 
reinhardtii]
Length=503

 Score =   177 bits (449),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 86/135 (64%), Positives = 100/135 (74%), Gaps = 0/135 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M CSISG VPE+ VVSTKSG LFEK LIE+++ + GKCPVTGEPL+ +D++P+K  K VK
Sbjct  1    MFCSISGTVPEQGVVSTKSGHLFEKSLIEKYVRETGKCPVTGEPLSTEDLLPLKVNKTVK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PR   A SIPG+L +F  EWD+ ML       QLH  RQELSHALYQHDAA RVIARL K
Sbjct  61   PRTAPATSIPGLLSLFHDEWDANMLELHNTRTQLHQTRQELSHALYQHDAATRVIARLLK  120

Query  460  ERDEARELLAQADRQ  504
            ERDEAR  LA   +Q
Sbjct  121  ERDEARAALADMKQQ  135



>gb|EXX73176.1| E3 ubiquitin-protein ligase PRP19 [Rhizophagus irregularis DAOM 
197198w]
Length=506

 Score =   177 bits (448),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 90/152 (59%), Positives = 105/152 (69%), Gaps = 6/152 (4%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTG-KIV  276
            M C+ISGE P+EPVVS KSG ++EKRLI ++I+DYGK P+TGE    DD++ IK   K V
Sbjct  1    MFCAISGEPPQEPVVSKKSGQVYEKRLILKYIADYGKDPITGEDTKEDDLLEIKASPKTV  60

Query  277  KPRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLK  456
            KPRP    SIP +L +FQ EWDSLML  F L+QQ    RQELS ALYQHDAACRVIARL 
Sbjct  61   KPRPATLTSIPSLLSVFQNEWDSLMLETFTLKQQYQQVRQELSQALYQHDAACRVIARLM  120

Query  457  KERDEARELLAQADRQL-----PSAAAMESAD  537
            KERD ARE LA     +     P A A ES +
Sbjct  121  KERDAAREALASVQAHIAIKPPPEAVASESQN  152



>ref|XP_002340278.1| cell cycle control protein (Cwf8), putative [Talaromyces stipitatus 
ATCC 10500]
 gb|EED22891.1| cell cycle control protein (Cwf8), putative [Talaromyces stipitatus 
ATCC 10500]
Length=475

 Score =   174 bits (441),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 83/131 (63%), Positives = 101/131 (77%), Gaps = 0/131 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M C+ISGE P+ PVVSTKSG +FEKRLIE +I++ GK PVTGE L+ DD+V +KT ++V+
Sbjct  1    MLCAISGEAPQVPVVSTKSGNVFEKRLIEAYIAENGKDPVTGEDLSTDDLVELKTARVVR  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP    SIP +LG+FQ EWD+L L  + L Q L   RQELS ALYQHDAA RVIARL K
Sbjct  61   PRPPTLTSIPSLLGVFQEEWDALALETYTLRQALVQTRQELSTALYQHDAAVRVIARLTK  120

Query  460  ERDEARELLAQ  492
            ERDEARE L++
Sbjct  121  ERDEARETLSK  131



>ref|XP_001456947.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK89550.1| unnamed protein product [Paramecium tetraurelia]
Length=486

 Score =   174 bits (440),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 78/144 (54%), Positives = 102/144 (71%), Gaps = 0/144 (0%)
 Frame = +1

Query  106  CSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVKPR  285
            C++SGE+ E PV+S  SG ++EKRLIE+HI   G CP+TG PL ++D++ +K  KI KPR
Sbjct  7    CALSGELIETPVISKVSGHIYEKRLIEKHIESTGTCPITGRPLNLEDLIEVKVAKIQKPR  66

Query  286  PVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKKER  465
            PV A SIP +L + Q EWD+L+L  F L+Q L   R EL+HALYQHDAACRVIA+L KER
Sbjct  67   PVTATSIPSLLSLLQNEWDALLLEQFQLKQHLEQVRHELTHALYQHDAACRVIAKLIKER  126

Query  466  DEARELLAQADRQLPSAAAMESAD  537
            D AR  LAQ   +L     +E+ +
Sbjct  127  DLARIELAQLQNKLNHKVEVETNN  150



>ref|XP_009011512.1| hypothetical protein HELRODRAFT_186274 [Helobdella robusta]
 gb|ESO10400.1| hypothetical protein HELRODRAFT_186274 [Helobdella robusta]
Length=516

 Score =   174 bits (441),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 81/131 (62%), Positives = 102/131 (78%), Gaps = 0/131 (0%)
 Frame = +1

Query  97   TMNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIV  276
            ++NC+IS EVPE PV+S  SG +FE+RLIE+++++ G  PV GE L++D ++ IK   +V
Sbjct  2    SLNCAISNEVPEHPVISPISGCVFERRLIEKYVNETGLDPVNGEKLSIDQLISIKAPPLV  61

Query  277  KPRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLK  456
            KPRP  A SIP +L MFQ EWD++ML NF L+QQL TARQELSH+LYQHDAACRVIARL 
Sbjct  62   KPRPPTATSIPAILKMFQDEWDAVMLHNFTLKQQLQTARQELSHSLYQHDAACRVIARLT  121

Query  457  KERDEARELLA  489
            KE   ARE LA
Sbjct  122  KEVTAAREALA  132



>gb|ELR09720.1| hypothetical protein GMDG_04206 [Pseudogymnoascus destructans 
20631-21]
Length=473

 Score =   173 bits (439),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 84/148 (57%), Positives = 101/148 (68%), Gaps = 0/148 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M C+ISGE P++PVVSTKSG +F + LIE HIS +G  P+T EPLT+DD++PIKT +I  
Sbjct  1    MLCAISGEAPQDPVVSTKSGNVFSRALIESHISTHGTDPITSEPLTVDDLIPIKTSRIAP  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP    SIP +L  FQ EWD+L L +F L QQL   RQELS ALY HDAA RV+ARL +
Sbjct  61   PRPPTHTSIPALLSTFQSEWDALALDSFTLRQQLAQTRQELSTALYHHDAAVRVVARLTR  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNA  543
            ERDEARE L+        A      DNA
Sbjct  121  ERDEAREALSNVGIAPSGAGDAMQIDNA  148



>gb|EPZ30796.1| U box domain-containing protein, partial [Rozella allomycis CSF55]
Length=143

 Score =   164 bits (415),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 104/130 (80%), Gaps = 0/130 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M C+ISGEVP+EPVVS+ +G ++E+RLIE+HI + GKCP++GEP+TM++++ +KT  ++K
Sbjct  1    MFCAISGEVPQEPVVSSLTGHVYERRLIEKHIQETGKCPMSGEPMTMENLIAVKTNPLIK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP QA S+P +L M Q+EWD+LML +  ++  L   R+EL+ ALYQ+DAA RVIARL K
Sbjct  61   PRPPQATSVPSILTMLQLEWDALMLESHQMKTVLERTREELAAALYQNDAAKRVIARLIK  120

Query  460  ERDEARELLA  489
            ERD+A+  +A
Sbjct  121  ERDDAKNAVA  130



>ref|XP_002340279.1| cell cycle control protein (Cwf8), putative [Talaromyces stipitatus 
ATCC 10500]
 gb|EED22892.1| cell cycle control protein (Cwf8), putative [Talaromyces stipitatus 
ATCC 10500]
Length=495

 Score =   174 bits (440),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 83/131 (63%), Positives = 101/131 (77%), Gaps = 0/131 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M C+ISGE P+ PVVSTKSG +FEKRLIE +I++ GK PVTGE L+ DD+V +KT ++V+
Sbjct  1    MLCAISGEAPQVPVVSTKSGNVFEKRLIEAYIAENGKDPVTGEDLSTDDLVELKTARVVR  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP    SIP +LG+FQ EWD+L L  + L Q L   RQELS ALYQHDAA RVIARL K
Sbjct  61   PRPPTLTSIPSLLGVFQEEWDALALETYTLRQALVQTRQELSTALYQHDAAVRVIARLTK  120

Query  460  ERDEARELLAQ  492
            ERDEARE L++
Sbjct  121  ERDEARETLSK  131



>ref|XP_001455246.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK87849.1| unnamed protein product [Paramecium tetraurelia]
Length=486

 Score =   173 bits (439),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 79/146 (54%), Positives = 105/146 (72%), Gaps = 1/146 (1%)
 Frame = +1

Query  106  CSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVKPR  285
            C++SGE+ E PV+S  SG ++EKRLIE+HI   G CP+TG PL ++D++ +K  ++ KPR
Sbjct  7    CALSGELIETPVISKVSGHIYEKRLIEKHIESTGTCPITGRPLNIEDLIEVKVSRVQKPR  66

Query  286  PVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKKER  465
            PV A SIP +L + Q EWD+L+L  F L+Q L   R EL+HALYQHDAACRVIA+L KER
Sbjct  67   PVTATSIPSLLSLLQNEWDALLLEQFQLKQHLEQVRHELTHALYQHDAACRVIAKLIKER  126

Query  466  DEARELLAQADRQLPSAAAMESADNA  543
            D+AR  LAQ   +L     +E A+NA
Sbjct  127  DQARIELAQLQHKLNHKIEVE-ANNA  151



>gb|KFZ15491.1| hypothetical protein V501_02685 [Pseudogymnoascus pannorum VKM 
F-4519 (FW-2642)]
Length=473

 Score =   172 bits (437),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 83/148 (56%), Positives = 101/148 (68%), Gaps = 0/148 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M C+ISGE P++PVVSTKSG +F + LIE HIS +G  P+T EPLT+DD++PIKT +I  
Sbjct  1    MLCAISGEAPQDPVVSTKSGNVFSRALIESHISTHGTDPITSEPLTVDDLIPIKTSRIAP  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP    SIP +L  FQ EWD+L L +F L QQL   RQEL+ ALY HDAA RV+ARL +
Sbjct  61   PRPPTHTSIPALLSTFQSEWDALALDSFTLRQQLAQTRQELATALYHHDAAVRVVARLTR  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNA  543
            ERDEARE L+        A      DNA
Sbjct  121  ERDEAREALSNVGIAPSGAGEAMQIDNA  148



>gb|ETW32415.1| hypothetical protein PFFCH_00153 [Plasmodium falciparum FCH/4]
Length=533

 Score =   174 bits (440),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 76/134 (57%), Positives = 104/134 (78%), Gaps = 1/134 (1%)
 Frame = +1

Query  106  CSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVKPR  285
            C+ISG+ PEEPV+S K+G +FEKRLIE+HI +YG CPVTGE LT++D+ PIK  KIVKPR
Sbjct  5    CTISGQTPEEPVIS-KTGYIFEKRLIEKHIINYGICPVTGEVLTLEDLYPIKNEKIVKPR  63

Query  286  PVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKKER  465
            P+ A+SIPG+L +FQ EWDS++   F+L   ++  R ELSH+LYQ+DAA RVIA+L KE+
Sbjct  64   PITASSIPGLLSIFQTEWDSIISEMFSLRTHVNDIRNELSHSLYQYDAATRVIAKLLKEK  123

Query  466  DEARELLAQADRQL  507
            +  +E +    +Q+
Sbjct  124  NGYKEEIENLKKQI  137



>gb|AFW68634.1| hypothetical protein ZEAMMB73_254634 [Zea mays]
Length=431

 Score =   172 bits (435),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 99/113 (88%), Gaps = 2/113 (2%)
 Frame = +1

Query  238  MDDIVPIKTGKIVKPRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALY  417
            MDDIVP+KT  IVKPRP+QAASIPG+LG+FQ EWD+LMLSNFALEQQLHTARQELSHALY
Sbjct  1    MDDIVPVKTNTIVKPRPLQAASIPGLLGIFQNEWDALMLSNFALEQQLHTARQELSHALY  60

Query  418  QHDAACRVIARLKKERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAAE  576
            QHDAACRVIARLKKERD+AR LLAQA+RQ+P++ A  +   A  +SNGKR  E
Sbjct  61   QHDAACRVIARLKKERDDARALLAQAERQIPASVAGAAP--AAVVSNGKRVIE  111



>gb|KFY76130.1| hypothetical protein V499_04060 [Pseudogymnoascus pannorum VKM 
F-103]
Length=473

 Score =   172 bits (437),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 83/148 (56%), Positives = 101/148 (68%), Gaps = 0/148 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M C+ISGE P++PVVSTKSG +F + LIE HIS +G  P+T EPLT+DD++PIKT +I  
Sbjct  1    MLCAISGEAPQDPVVSTKSGNVFSRALIESHISTHGTDPITSEPLTVDDLIPIKTSRIAP  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP    SIP +L  FQ EWD+L L +F L QQL   RQEL+ ALY HDAA RV+ARL +
Sbjct  61   PRPPTHTSIPALLSTFQSEWDALALDSFTLRQQLAQTRQELATALYHHDAAVRVVARLTR  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNA  543
            ERDEARE L+        A      DNA
Sbjct  121  ERDEAREALSNVGIAPSGAGEAMQIDNA  148



>ref|XP_001009835.1| hypothetical protein TTHERM_00161050 [Tetrahymena thermophila]
Length=609

 Score =   174 bits (442),  Expect = 2e-47, Method: Composition-based stats.
 Identities = 84/145 (58%), Positives = 105/145 (72%), Gaps = 1/145 (1%)
 Frame = +1

Query  106  CSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVKPR  285
            C+I+GE   EPVVS KSG +FEKR+IE+HI   G+CP+TG+ L+ DD++P++     KPR
Sbjct  107  CAITGEQLHEPVVSKKSGHVFEKRVIEKHIQSTGQCPITGQALSNDDLIPVQLNVQTKPR  166

Query  286  PVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKKER  465
             V + SIPG+L  FQ EWD+LML  + L+Q L T RQELSHALYQHDAACRVIARL KER
Sbjct  167  SVTSNSIPGILKTFQNEWDALMLETYNLKQHLETVRQELSHALYQHDAACRVIARLIKER  226

Query  466  DEARELLAQADRQLPSAA-AMESAD  537
            DEAR  +AQ   +L      +E AD
Sbjct  227  DEARFEVAQLQEKLRQGKMELEEAD  251



>gb|KGO75749.1| Zinc finger, RING/FYVE/PHD-type [Penicillium italicum]
Length=474

 Score =   172 bits (437),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 80/131 (61%), Positives = 101/131 (77%), Gaps = 0/131 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M C+ISGE P+ PVVSTKSG +FEKRLIE +I+++GK PV GE LT DD++ +K+ ++V+
Sbjct  1    MLCAISGEAPQVPVVSTKSGSVFEKRLIEVYIAEHGKDPVNGEELTTDDLIDLKSQRVVR  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP    SIP +LG+FQ EWD+L L  F L+Q L   R+ELS ALYQHDAA RVIARL +
Sbjct  61   PRPPTLTSIPSLLGVFQEEWDALALETFTLQQNLAQTRRELSSALYQHDAAVRVIARLTQ  120

Query  460  ERDEARELLAQ  492
            ERDEARE L+ 
Sbjct  121  ERDEAREALSN  131



>emb|CDO62513.1| pre-mRNA-processing factor 19, putative [Plasmodium reichenowi]
Length=533

 Score =   173 bits (439),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 104/134 (78%), Gaps = 1/134 (1%)
 Frame = +1

Query  106  CSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVKPR  285
            C+ISG+ PEEPV+S K+G +FEKRLIE+HI +YG CPV+GE LT++D+ PIK  KIVKPR
Sbjct  5    CTISGQTPEEPVIS-KTGYIFEKRLIEKHIINYGICPVSGEVLTLEDLYPIKNEKIVKPR  63

Query  286  PVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKKER  465
            P+ A+SIPG+L +FQ EWDS++   F+L   ++  R ELSH+LYQ+DAA RVIA+L KE+
Sbjct  64   PITASSIPGLLSIFQTEWDSIISEMFSLRTHVNDIRNELSHSLYQYDAATRVIAKLLKEK  123

Query  466  DEARELLAQADRQL  507
            +  +E +    +Q+
Sbjct  124  NSYKEEIENLKKQI  137



>ref|XP_002567398.1| Pc21g03340 [Penicillium rubens Wisconsin 54-1255]
 emb|CAP95231.1| Pc21g03340 [Penicillium rubens Wisconsin 54-1255]
Length=474

 Score =   172 bits (436),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 80/131 (61%), Positives = 101/131 (77%), Gaps = 0/131 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M C+ISGE P+ PVVSTKSG +FEKRL+E +I+++GK PV GE LT DD++ +K+ ++V+
Sbjct  1    MLCAISGEAPQVPVVSTKSGGVFEKRLVEAYIAEHGKDPVNGEELTTDDLIELKSQRVVR  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP    SIP +LG+FQ EWD+L L  F L+Q L   R+ELS ALYQHDAA RVIARL K
Sbjct  61   PRPPTLTSIPSLLGVFQEEWDALALEAFTLQQTLAQTRRELSSALYQHDAAVRVIARLTK  120

Query  460  ERDEARELLAQ  492
            ERDEARE L+ 
Sbjct  121  ERDEAREALSN  131



>ref|XP_001437995.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK70598.1| unnamed protein product [Paramecium tetraurelia]
Length=489

 Score =   172 bits (436),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 78/155 (50%), Positives = 108/155 (70%), Gaps = 0/155 (0%)
 Frame = +1

Query  106  CSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVKPR  285
            C++SGE+ E PV+S  SG ++EKRLIE+HI   G CP+TG PL ++D++ +K  ++ KPR
Sbjct  7    CALSGELIETPVISKVSGHIYEKRLIEKHIESTGTCPITGRPLNIEDLIEVKVSRVQKPR  66

Query  286  PVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKKER  465
            PV A SIP +L + Q EWD+L+L  F L+Q L   R EL+HALYQHDAACRVIA+L KER
Sbjct  67   PVTATSIPSLLSLLQNEWDALLLEQFQLKQHLEQVRHELTHALYQHDAACRVIAKLIKER  126

Query  466  DEARELLAQADRQLPSAAAMESADNATTLSNGKRA  570
            D+AR  L+Q   +L     +E+ +    LS+ + A
Sbjct  127  DQARIELSQLQHKLNHKIEVEANNAPEKLSSNQIA  161



>ref|XP_002848472.1| cell cycle control protein cwf8 [Arthroderma otae CBS 113480]
 gb|EEQ31159.1| cell cycle control protein cwf8 [Arthroderma otae CBS 113480]
Length=476

 Score =   172 bits (435),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 81/131 (62%), Positives = 101/131 (77%), Gaps = 0/131 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M C+ISGE P+ PVVS KSG +FEKRLIE +IS++GK PVTGE  T+DD++ +K+ +I +
Sbjct  1    MLCAISGEAPQVPVVSRKSGNVFEKRLIEEYISEHGKEPVTGEEHTVDDLIELKSARIAR  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP    SIP +LG+FQ EWD+L L  F L Q L   RQELS ALYQHDAA RVIARL+K
Sbjct  61   PRPPTLTSIPSLLGVFQEEWDALALETFTLRQTLAQTRQELSTALYQHDAAVRVIARLRK  120

Query  460  ERDEARELLAQ  492
            ERDEAR+ L++
Sbjct  121  ERDEARDALSK  131



>gb|EEH09948.1| cell cycle control protein [Histoplasma capsulatum G186AR]
Length=476

 Score =   172 bits (435),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 82/131 (63%), Positives = 102/131 (78%), Gaps = 0/131 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M C+ISGE P+ PVVS KSG +FEKRLIE +IS+ GK PV+GE LT++D+V +KT +IV+
Sbjct  1    MLCAISGEAPQVPVVSRKSGNVFEKRLIEAYISENGKDPVSGEDLTVEDLVELKTARIVR  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP    SIP +LG+FQ EWD+L L  + L+Q L   RQELS ALYQHDAA RVIARL K
Sbjct  61   PRPPTLTSIPSLLGVFQEEWDALALETYTLKQTLAQTRQELSTALYQHDAAVRVIARLTK  120

Query  460  ERDEARELLAQ  492
            ERDEAR+ L++
Sbjct  121  ERDEARDALSK  131



>gb|EGC44417.1| ubiquitin-protein ligase E4 [Histoplasma capsulatum H88]
Length=476

 Score =   172 bits (435),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 82/131 (63%), Positives = 102/131 (78%), Gaps = 0/131 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M C+ISGE P+ PVVS KSG +FEKRLIE +IS+ GK PV+GE LT++D+V +KT +IV+
Sbjct  1    MLCAISGEAPQVPVVSRKSGNVFEKRLIEAYISENGKDPVSGEDLTVEDLVELKTARIVR  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP    SIP +LG+FQ EWD+L L  + L+Q L   RQELS ALYQHDAA RVIARL K
Sbjct  61   PRPPTLTSIPSLLGVFQEEWDALALETYTLKQTLAQTRQELSTALYQHDAAVRVIARLTK  120

Query  460  ERDEARELLAQ  492
            ERDEAR+ L++
Sbjct  121  ERDEARDALSK  131



>emb|CEG80296.1| Putative Pre-mRNA-processing factor 19 [Rhizopus microsporus]
Length=404

 Score =   170 bits (431),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 82/137 (60%), Positives = 103/137 (75%), Gaps = 1/137 (1%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTG-KIV  276
            M C+ISGE PE+PVVS KSG +FEKRLIE++IS++G+ PV  E +T +D++ +KT  + V
Sbjct  1    MFCAISGEAPEQPVVSIKSGHVFEKRLIEKYISEHGRDPVNNEEMTEEDLIDVKTTPETV  60

Query  277  KPRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLK  456
            KPRP + AS+P +L   Q EWDS+ML +F L+QQ    RQELSHALYQ+DAA RVIARLK
Sbjct  61   KPRPPKLASVPSLLSALQNEWDSVMLESFTLKQQYQQVRQELSHALYQNDAATRVIARLK  120

Query  457  KERDEARELLAQADRQL  507
            KERD ARE LA     L
Sbjct  121  KERDAAREALANVQAHL  137



>gb|KFX51269.1| Pre-mRNA-splicing factor cwf8 [Talaromyces marneffei PM1]
Length=470

 Score =   171 bits (434),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 81/131 (62%), Positives = 102/131 (78%), Gaps = 0/131 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M C+ISGE P+ PVVSTKSG +FEKRLIE +I++ GK PVTGE L+++D+V +KT ++V+
Sbjct  1    MLCAISGEAPQVPVVSTKSGNVFEKRLIEAYIAENGKDPVTGEDLSVEDLVELKTARVVR  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP    SIP +LG+FQ EWD+L L  + L Q L   RQELS ALYQHDAA RVIARL K
Sbjct  61   PRPPTLTSIPSLLGVFQEEWDALALETYTLRQALVQTRQELSTALYQHDAAVRVIARLTK  120

Query  460  ERDEARELLAQ  492
            ERDEAR+ L++
Sbjct  121  ERDEARDTLSK  131



>ref|XP_001351160.1| PRP19-like protein, putative [Plasmodium falciparum 3D7]
 emb|CAB11109.1| PRP19-like protein, putative [Plasmodium falciparum 3D7]
 gb|ETW20699.1| hypothetical protein PFFVO_00458 [Plasmodium falciparum Vietnam 
Oak-Knoll (FVO)]
 gb|ETW38781.1| hypothetical protein PFTANZ_00525 [Plasmodium falciparum Tanzania 
(2000708)]
 gb|ETW45166.1| hypothetical protein PFNF135_00494 [Plasmodium falciparum NF135/5.C10]
 gb|ETW51510.1| hypothetical protein PFMALIP_00486 [Plasmodium falciparum MaliPS096_E11]
 gb|ETW52241.1| hypothetical protein PFUGPA_05854 [Plasmodium falciparum Palo 
Alto/Uganda]
 gb|ETW63713.1| hypothetical protein PFMC_00459 [Plasmodium falciparum CAMP/Malaysia]
 gb|EUT92253.1| hypothetical protein PFAG_00392 [Plasmodium falciparum Santa 
Lucia]
 gb|EWC78755.1| hypothetical protein C923_00524 [Plasmodium falciparum UGT5.1]
 gb|EWC90785.1| hypothetical protein PFNF54_00430 [Plasmodium falciparum NF54]
Length=532

 Score =   172 bits (436),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 104/134 (78%), Gaps = 1/134 (1%)
 Frame = +1

Query  106  CSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVKPR  285
            C+ISG+ PEEPV+S K+G +FEKRLIE+HI +YG CPV+GE LT++D+ PIK  KIVKPR
Sbjct  5    CTISGQTPEEPVIS-KTGYIFEKRLIEKHIINYGICPVSGEVLTLEDLYPIKNEKIVKPR  63

Query  286  PVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKKER  465
            P+ A+SIPG+L +FQ EWDS++   F+L   ++  R ELSH+LYQ+DAA RVIA+L KE+
Sbjct  64   PITASSIPGLLSIFQTEWDSIISEMFSLRTHVNDIRNELSHSLYQYDAATRVIAKLLKEK  123

Query  466  DEARELLAQADRQL  507
            +  +E +    +Q+
Sbjct  124  NGYKEEIENLKKQI  137



>gb|EUR80965.1| hypothetical protein PFBG_00330 [Plasmodium falciparum 7G8]
Length=533

 Score =   172 bits (436),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 104/134 (78%), Gaps = 1/134 (1%)
 Frame = +1

Query  106  CSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVKPR  285
            C+ISG+ PEEPV+S K+G +FEKRLIE+HI +YG CPV+GE LT++D+ PIK  KIVKPR
Sbjct  5    CTISGQTPEEPVIS-KTGYIFEKRLIEKHIINYGICPVSGEVLTLEDLYPIKNEKIVKPR  63

Query  286  PVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKKER  465
            P+ A+SIPG+L +FQ EWDS++   F+L   ++  R ELSH+LYQ+DAA RVIA+L KE+
Sbjct  64   PITASSIPGLLSIFQTEWDSIISEMFSLRTHVNDIRNELSHSLYQYDAATRVIAKLLKEK  123

Query  466  DEARELLAQADRQL  507
            +  +E +    +Q+
Sbjct  124  NGYKEEIENLKKQI  137



>emb|CBK23997.2| unnamed protein product [Blastocystis hominis]
Length=484

 Score =   171 bits (433),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 99/133 (74%), Gaps = 0/133 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M C+ISGEVP EPVVS K+G ++EK LI ++I   GKCP+TGE L + D++ +KT  +VK
Sbjct  1    MFCAISGEVPHEPVVSKKTGYIYEKSLITKYIEAEGKCPITGEELDLSDLIDVKTQPLVK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            P+P  A SIPG+L   Q EWDS+ML +F L++ L   RQELS ALYQH+AACRVIARL K
Sbjct  61   PKPTPATSIPGLLVSLQNEWDSMMLESFTLKKHLQAVRQELSQALYQHEAACRVIARLIK  120

Query  460  ERDEARELLAQAD  498
            ERDEAR  LA  +
Sbjct  121  ERDEARAALASVE  133



>emb|CEI90047.1| Putative Pre-mRNA-processing factor 19 [Rhizopus microsporus]
Length=502

 Score =   171 bits (434),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 82/137 (60%), Positives = 104/137 (76%), Gaps = 1/137 (1%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTG-KIV  276
            M C+ISGE PE+PVVS KSG +FEKRLIE++IS++G+ PV  E +T++D++ +KT  + V
Sbjct  1    MFCAISGEAPEQPVVSIKSGHIFEKRLIEKYISEHGRDPVNNEEMTVEDLIDVKTTPETV  60

Query  277  KPRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLK  456
            KPRP + AS+P +L   Q EWDS+ML +F L+QQ    RQELSHALYQ+DAA RVIARLK
Sbjct  61   KPRPPKLASVPSLLSALQNEWDSVMLESFTLKQQYQQVRQELSHALYQNDAATRVIARLK  120

Query  457  KERDEARELLAQADRQL  507
            KERD ARE LA     L
Sbjct  121  KERDAAREALANVQAHL  137



>gb|KFM80282.1| Pre-mRNA-processing factor 19, partial [Stegodyphus mimosarum]
Length=146

 Score =   162 bits (410),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 81/142 (57%), Positives = 101/142 (71%), Gaps = 0/142 (0%)
 Frame = +1

Query  97   TMNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIV  276
            +++C++S EVPE+PVVS  SG +FEKRLI ++I + G  P+ G+ L+ + ++ IKT   V
Sbjct  2    SLSCALSNEVPEQPVVSPASGSIFEKRLIVKYIQENGTDPINGKELSEESLIEIKTPSAV  61

Query  277  KPRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLK  456
            KPRP  A SIP +L   Q EWD++ML +F L QQL TARQELSHALYQHDAACRVIARL 
Sbjct  62   KPRPPSATSIPAILKTLQDEWDAVMLHSFTLRQQLQTARQELSHALYQHDAACRVIARLT  121

Query  457  KERDEARELLAQADRQLPSAAA  522
            KE   ARE LA    Q   AAA
Sbjct  122  KEVTAAREALATLKPQAGIAAA  143



>gb|KGO60216.1| Zinc finger, RING/FYVE/PHD-type [Penicillium expansum]
 gb|KGO68742.1| Zinc finger, RING/FYVE/PHD-type [Penicillium expansum]
Length=474

 Score =   171 bits (432),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 79/131 (60%), Positives = 101/131 (77%), Gaps = 0/131 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M C+ISGE P+ PVVSTKSG +FEKRLIE +I+++GK PV GE LT +D++ +K+ ++V+
Sbjct  1    MLCAISGEAPQVPVVSTKSGSVFEKRLIEAYIAEHGKDPVNGEELTTEDLIDLKSQRVVR  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP    SIP +LG+FQ EWD+L L  F L+Q L   R+ELS ALYQHDAA RVIARL +
Sbjct  61   PRPPTLTSIPSLLGVFQEEWDALALETFTLQQNLAQTRRELSSALYQHDAAVRVIARLTQ  120

Query  460  ERDEARELLAQ  492
            ERDEARE L+ 
Sbjct  121  ERDEAREALSN  131



>ref|XP_010762278.1| hypothetical protein PADG_06901 [Paracoccidioides brasiliensis 
Pb18]
 gb|EEH15760.1| hypothetical protein PABG_05847 [Paracoccidioides brasiliensis 
Pb03]
 gb|EEH50822.1| hypothetical protein PADG_06901 [Paracoccidioides brasiliensis 
Pb18]
Length=476

 Score =   171 bits (432),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 80/131 (61%), Positives = 102/131 (78%), Gaps = 0/131 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M C+ISGE P+ PVVS KSG +FEKRLIE ++S+ GK PVTGE LT++D+V +K+ ++V+
Sbjct  1    MLCAISGEAPQVPVVSRKSGNVFEKRLIEAYVSENGKDPVTGEDLTVEDLVELKSARVVR  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP    SIP +LG+FQ EWD+L L  + L+Q L   RQELS ALYQHDAA RVIARL K
Sbjct  61   PRPPTLTSIPSLLGVFQEEWDALALETYTLQQTLAQTRQELSTALYQHDAAVRVIARLTK  120

Query  460  ERDEARELLAQ  492
            ERDEAR+ L++
Sbjct  121  ERDEARDALSK  131



>gb|KGO41547.1| Zinc finger, RING/FYVE/PHD-type [Penicillium expansum]
Length=474

 Score =   171 bits (432),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 79/131 (60%), Positives = 101/131 (77%), Gaps = 0/131 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M C+ISGE P+ PVVSTKSG +FEKRLIE +I+++GK PV GE LT +D++ +K+ ++V+
Sbjct  1    MLCAISGEAPQVPVVSTKSGSVFEKRLIEAYIAEHGKDPVNGEELTTEDLIDLKSQRVVR  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP    SIP +LG+FQ EWD+L L  F L+Q L   R+ELS ALYQHDAA RVIARL +
Sbjct  61   PRPPTLTSIPSLLGVFQEEWDALALETFTLQQNLAQTRRELSSALYQHDAAVRVIARLTQ  120

Query  460  ERDEARELLAQ  492
            ERDEARE L+ 
Sbjct  121  ERDEAREALSN  131



>dbj|GAM34593.1| hypothetical protein TCE0_015f02271 [Talaromyces cellulolyticus]
Length=475

 Score =   171 bits (432),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 81/131 (62%), Positives = 101/131 (77%), Gaps = 0/131 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M C+ISGE P+ PVVSTKSG +FEKRLIE +I++ GK PVTGE L+ +D+V +KT ++V+
Sbjct  1    MLCAISGEAPQVPVVSTKSGNVFEKRLIEAYIAENGKDPVTGEDLSAEDLVELKTARVVR  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP    SIP +LG+FQ EWD+L L  + L Q L   RQELS ALYQHDAA RVIARL K
Sbjct  61   PRPPTLTSIPSLLGVFQEEWDALALETYTLRQALVQTRQELSTALYQHDAAVRVIARLTK  120

Query  460  ERDEARELLAQ  492
            ERDEAR+ L++
Sbjct  121  ERDEARDTLSK  131



>ref|XP_002795874.1| cell cycle control protein cwf8 [Paracoccidioides sp. 'lutzii' 
Pb01]
 gb|EEH40525.1| cell cycle control protein cwf8 [Paracoccidioides sp. 'lutzii' 
Pb01]
Length=476

 Score =   171 bits (432),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 81/131 (62%), Positives = 101/131 (77%), Gaps = 0/131 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M C+ISGE P+ PVVS KSG +FEKRLIE ++S+ GK PVTGE LT++D+V +K+ ++V+
Sbjct  1    MLCAISGEAPQVPVVSRKSGNVFEKRLIEAYVSENGKDPVTGEDLTVEDLVELKSARVVR  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP    SIP +LG+FQ EWDSL L  + L Q L   RQELS ALYQHDAA RVIARL K
Sbjct  61   PRPPTLTSIPSLLGVFQEEWDSLALETYTLRQTLAQTRQELSTALYQHDAAIRVIARLTK  120

Query  460  ERDEARELLAQ  492
            ERDEAR+ L++
Sbjct  121  ERDEARDALSK  131



>gb|KFH68916.1| hypothetical protein MVEG_05720 [Mortierella verticillata NRRL 
6337]
Length=494

 Score =   171 bits (432),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 83/147 (56%), Positives = 103/147 (70%), Gaps = 1/147 (1%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTG-KIV  276
            M C+ISGE PE PVVS KSG ++E+RLI ++I D GK PVTGE L+ +D++ IK+    V
Sbjct  1    MFCAISGEAPEHPVVSKKSGQVYERRLIVKYIEDNGKDPVTGEDLSEEDLLDIKSSPSTV  60

Query  277  KPRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLK  456
            KPRP    SIP +L + Q EWDS+ML  F ++QQ    RQELSHALYQHDAACRVIARL 
Sbjct  61   KPRPPTMTSIPSILSVLQNEWDSIMLETFTMKQQYQQVRQELSHALYQHDAACRVIARLM  120

Query  457  KERDEARELLAQADRQLPSAAAMESAD  537
            KERD ARE LA     + + A +E  +
Sbjct  121  KERDAAREALANVQAHIGTKAPVEDVN  147



>ref|XP_002948553.1| hypothetical protein VOLCADRAFT_80185 [Volvox carteri f. nagariensis]
 gb|EFJ50428.1| hypothetical protein VOLCADRAFT_80185 [Volvox carteri f. nagariensis]
Length=510

 Score =   171 bits (433),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 99/135 (73%), Gaps = 0/135 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M CS+SG VPE+ VVS KSG LFEK LIE+++ + GKCPVTGE L+++D++P+K  K VK
Sbjct  1    MFCSVSGTVPEQGVVSVKSGHLFEKSLIEKYVRETGKCPVTGEALSLEDLLPLKVNKTVK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PR   A SIPG+L +F  EWD+ ML       QLH  RQELSHALYQHDAA RVIARL K
Sbjct  61   PRTAPATSIPGLLSLFHDEWDANMLELHNTRTQLHQTRQELSHALYQHDAATRVIARLLK  120

Query  460  ERDEARELLAQADRQ  504
            ERDEAR  L +  +Q
Sbjct  121  ERDEARTALTEMKQQ  135



>gb|EKV05742.1| Cell cycle control protein (Cwf8), putative [Penicillium digitatum 
Pd1]
 gb|EKV18702.1| Cell cycle control protein (Cwf8), putative [Penicillium digitatum 
PHI26]
Length=474

 Score =   170 bits (431),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/131 (60%), Positives = 101/131 (77%), Gaps = 0/131 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M C+ISGE P+ PVVSTKSG +FEKRLIE +I+++GK PV GE LT D+++ +K+ ++V+
Sbjct  1    MLCAISGEAPQVPVVSTKSGSVFEKRLIEAYITEHGKDPVNGEELTTDNLIDLKSQRVVR  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP    SIP +LG+FQ EWD+L L  F L+Q L   R+ELS ALYQHDAA RVIARL +
Sbjct  61   PRPPTLTSIPSLLGVFQEEWDALALETFTLQQNLAQTRRELSLALYQHDAAVRVIARLTQ  120

Query  460  ERDEARELLAQ  492
            ERDEARE L+ 
Sbjct  121  ERDEAREALSN  131



>gb|EZF27930.1| hypothetical protein H100_00174 [Trichophyton rubrum MR850]
 gb|EZF46936.1| hypothetical protein H102_00173 [Trichophyton rubrum CBS 100081]
 gb|EZF57561.1| hypothetical protein H103_00175 [Trichophyton rubrum CBS 288.86]
 gb|EZF68214.1| hypothetical protein H104_00174 [Trichophyton rubrum CBS 289.86]
 gb|EZF78920.1| hypothetical protein H105_00165 [Trichophyton soudanense CBS 
452.61]
 gb|EZF89499.1| hypothetical protein H110_00174 [Trichophyton rubrum MR1448]
 gb|EZG00314.1| hypothetical protein H113_00175 [Trichophyton rubrum MR1459]
 gb|EZG11214.1| hypothetical protein H106_00067 [Trichophyton rubrum CBS 735.88]
 gb|EZG21935.1| hypothetical protein H107_00177 [Trichophyton rubrum CBS 202.88]
 gb|KDB38695.1| hypothetical protein H112_00174 [Trichophyton rubrum D6]
 gb|KFL63065.1| hypothetical protein TERG_08493 [Trichophyton rubrum CBS 118892]
Length=382

 Score =   168 bits (426),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/131 (60%), Positives = 101/131 (77%), Gaps = 0/131 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M C+ISGE P+ PVVS KSG +FEKRL+E +IS++GK P+TGE  T++D+V +K+ +I +
Sbjct  44   MLCAISGEAPQVPVVSRKSGNVFEKRLVEEYISEHGKEPITGEEHTVEDLVELKSARIAR  103

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP    SIP +LG+FQ EWD+L L  F L Q L   RQELS ALYQHDAA RVIARL+K
Sbjct  104  PRPPTLTSIPSLLGVFQEEWDALALETFTLRQTLAQTRQELSTALYQHDAAVRVIARLRK  163

Query  460  ERDEARELLAQ  492
            ERDEAR+ L++
Sbjct  164  ERDEARDALSK  174



>gb|KFZ10979.1| hypothetical protein V502_07803 [Pseudogymnoascus pannorum VKM 
F-4520 (FW-2644)]
Length=473

 Score =   170 bits (431),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 87/170 (51%), Positives = 107/170 (63%), Gaps = 14/170 (8%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M C+ISGE P++PVVSTKSG +F + LIE +IS +G  P+T EPLT+DD++PIKT +I  
Sbjct  1    MLCAISGEAPQDPVVSTKSGNVFSRALIESYISTHGTDPITSEPLTVDDLIPIKTSRIAP  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP    SIP +L  FQ EWD+L L +F L QQL   RQEL+ ALY HDAA RV+ARL +
Sbjct  61   PRPPTHTSIPALLSTFQSEWDALALDSFTLRQQLAHTRQELATALYHHDAAVRVVARLTR  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATT--------------LSNGKR  567
            ERDEARE L+        A      DNA                LSNG+R
Sbjct  121  ERDEAREALSNVGIAPSGAGEAMQIDNAGLPSEIVERVEEVQGRLSNGRR  170



>gb|KFY35697.1| hypothetical protein V494_05699 [Pseudogymnoascus pannorum VKM 
F-4513 (FW-928)]
Length=473

 Score =   170 bits (431),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/131 (60%), Positives = 96/131 (73%), Gaps = 0/131 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M C+ISGE P++PVVSTKSG +F + LIE HIS  G  P+T EPLT+DD++PIKT +I  
Sbjct  1    MLCAISGEAPQDPVVSTKSGNVFSRALIESHISTQGTDPITSEPLTVDDLIPIKTSRIAP  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP    SIP +L  FQ EWD+L L +F L QQL   RQEL+ ALY HDAA RV+ARL +
Sbjct  61   PRPPTHTSIPALLSTFQSEWDALALDSFTLRQQLAQTRQELATALYHHDAAVRVVARLTR  120

Query  460  ERDEARELLAQ  492
            ERDEARE L+ 
Sbjct  121  ERDEAREALSN  131



>gb|ESA02174.1| hypothetical protein GLOINDRAFT_6770 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX73177.1| E3 ubiquitin-protein ligase PRP19 [Rhizophagus irregularis DAOM 
197198w]
Length=508

 Score =   171 bits (432),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 87/148 (59%), Positives = 102/148 (69%), Gaps = 6/148 (4%)
 Frame = +1

Query  112  ISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTG-KIVKPRP  288
            +SGE P+EPVVS KSG ++EKRLI ++I+DYGK P+TGE    DD++ IK   K VKPRP
Sbjct  7    VSGEPPQEPVVSKKSGQVYEKRLILKYIADYGKDPITGEDTKEDDLLEIKASPKTVKPRP  66

Query  289  VQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKKERD  468
                SIP +L +FQ EWDSLML  F L+QQ    RQELS ALYQHDAACRVIARL KERD
Sbjct  67   ATLTSIPSLLSVFQNEWDSLMLETFTLKQQYQQVRQELSQALYQHDAACRVIARLMKERD  126

Query  469  EARELLAQADRQL-----PSAAAMESAD  537
             ARE LA     +     P A A ES +
Sbjct  127  AAREALASVQAHIAIKPPPEAVASESQN  154



>dbj|GAM20395.1| hypothetical protein SAMD00019534_035700 [Acytostelium subglobosum 
LB1]
Length=500

 Score =   170 bits (431),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 88/158 (56%), Positives = 109/158 (69%), Gaps = 11/158 (7%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKT-----  264
            M CSISGEVPE+PVVS K+G ++E+RLIE+ I   GK P TGEPLT+ D+V IK+     
Sbjct  1    MICSISGEVPEQPVVSVKTGNVYERRLIEKFIDANGKEPTTGEPLTVADLVTIKSPGSRA  60

Query  265  -----GKIVKPRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDA  429
                 G  ++PR   A SIP ML MFQ EWD+LML  F L+QQ  T RQEL+H+LYQ+DA
Sbjct  61   AGGVGGGPLRPRTSTATSIPSMLQMFQNEWDALMLETFTLKQQFETVRQELAHSLYQYDA  120

Query  430  ACRVIARLKKERDEARELLAQADRQLPSAAAMESADNA  543
            +CRVIARL KERD+AR  LA   R   SA   +S+D +
Sbjct  121  SCRVIARLIKERDQARSALANV-RLRSSAENNQSSDTS  157



>emb|CDM31028.1| Zinc finger, RING/FYVE/PHD-type [Penicillium roqueforti FM164]
Length=474

 Score =   170 bits (430),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/131 (60%), Positives = 100/131 (76%), Gaps = 0/131 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M C+ISGE P+ PVVSTKSG +FEKRLIE +I+++GK PV GE LT DD++ +K+ ++V+
Sbjct  1    MLCAISGEAPQVPVVSTKSGSVFEKRLIEAYIAEHGKDPVNGEELTTDDLIDLKSQRVVR  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP    SIP +L +FQ EWD+L L  F L+Q L   R+ELS ALYQHDAA RVIARL +
Sbjct  61   PRPPTLTSIPSLLSVFQEEWDALALETFTLQQNLAQTRRELSSALYQHDAAVRVIARLTQ  120

Query  460  ERDEARELLAQ  492
            ERDEARE L+ 
Sbjct  121  ERDEAREALSN  131



>gb|KFY22183.1| hypothetical protein V493_06788 [Pseudogymnoascus pannorum VKM 
F-4281 (FW-2241)]
Length=473

 Score =   169 bits (429),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 101/148 (68%), Gaps = 0/148 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M C+ISGE P++PVVSTKSG +F + LIE +IS +G  P+T EPLT+DD++PIKT +I  
Sbjct  1    MLCAISGEAPQDPVVSTKSGNVFSRALIESYISTHGTDPITSEPLTVDDLIPIKTSRIAP  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP    SIP +L  FQ EWD+L L +F L QQL   RQEL+ ALY HDAA RV+ARL +
Sbjct  61   PRPPTHTSIPALLSTFQSEWDALALDSFTLRQQLAHTRQELATALYHHDAAVRVVARLTR  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNA  543
            ERDEARE L+        A      DNA
Sbjct  121  ERDEAREALSNVGIAPSGAGEAMQIDNA  148



>gb|EER38786.1| ubiquitin-protein ligase E4 [Histoplasma capsulatum H143]
Length=476

 Score =   169 bits (429),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 81/131 (62%), Positives = 101/131 (77%), Gaps = 0/131 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M C+ISGE P+ PVVS KSG +FEKRLIE +IS+ GK PV+GE LT++D+V +K  +IV+
Sbjct  1    MLCAISGEAPQVPVVSRKSGNVFEKRLIEAYISENGKDPVSGEDLTVEDLVELKIARIVR  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP    SIP +LG+FQ EWD+L L  + L+Q L   RQELS ALYQHDAA RVIARL K
Sbjct  61   PRPPTLTSIPSLLGVFQEEWDALALETYTLKQTLAQTRQELSTALYQHDAAVRVIARLTK  120

Query  460  ERDEARELLAQ  492
            ERDEAR+ L++
Sbjct  121  ERDEARDALSK  131



>emb|CEG68152.1| Putative Pre-mRNA-processing factor 19 [Rhizopus microsporus]
Length=502

 Score =   170 bits (430),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 82/137 (60%), Positives = 103/137 (75%), Gaps = 1/137 (1%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTG-KIV  276
            M C+ISGE PE+PVVS KSG +FEKRLIE++IS++G+ PV  E +T +D++ +KT  + V
Sbjct  1    MFCAISGEAPEQPVVSIKSGHIFEKRLIEKYISEHGRDPVNNEEMTEEDLIDVKTTPETV  60

Query  277  KPRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLK  456
            KPRP + AS+P +L   Q EWDS+ML +F L+QQ    RQELSHALYQ+DAA RVIARLK
Sbjct  61   KPRPPKLASVPSLLSALQNEWDSVMLESFTLKQQYQQVRQELSHALYQNDAATRVIARLK  120

Query  457  KERDEARELLAQADRQL  507
            KERD ARE LA     L
Sbjct  121  KERDAAREALANVQAHL  137



>ref|XP_008625985.1| pre-mRNA-processing factor 19 [Plasmodium vinckei vinckei]
 gb|KEG01087.1| pre-mRNA-processing factor 19 [Plasmodium vinckei vinckei]
Length=499

 Score =   170 bits (430),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 99/134 (74%), Gaps = 1/134 (1%)
 Frame = +1

Query  106  CSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVKPR  285
            C+ISG+ PEEPVVS K+G +FEKRLIE+HI +YG CPV+GE LT+DD+ PIK  K VKPR
Sbjct  5    CTISGQTPEEPVVS-KTGYIFEKRLIEKHIKNYGICPVSGEVLTLDDLYPIKIEKFVKPR  63

Query  286  PVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKKER  465
            P+ A SIPG+L +FQ EWDS++   F L   ++  R +LSH LYQ+DAA RVIA+L KE+
Sbjct  64   PITATSIPGLLSIFQTEWDSMISEMFTLRTHVNDVRNQLSHCLYQYDAATRVIAKLLKEK  123

Query  466  DEARELLAQADRQL  507
            +  +E +     Q+
Sbjct  124  NNYQEEINNLRNQI  137



>ref|XP_003698766.1| PREDICTED: pre-mRNA-processing factor 19 [Apis florea]
Length=504

 Score =   170 bits (430),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 81/130 (62%), Positives = 100/130 (77%), Gaps = 0/130 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            ++C+IS EVPE PVVS  SG +FEKRLIE+++++ G  P+TG+ LT D ++ IKT  IVK
Sbjct  3    LSCAISNEVPEHPVVSPVSGSIFEKRLIEKYLAENGVDPITGKELTADQLIDIKTTAIVK  62

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            P+P  A SIP +L + Q EWD++ML +F L QQL TARQELSHALYQHDAACRVIARL K
Sbjct  63   PKPPSATSIPAILKILQDEWDAVMLHSFTLRQQLQTARQELSHALYQHDAACRVIARLTK  122

Query  460  ERDEARELLA  489
            E   ARE LA
Sbjct  123  EVTAAREALA  132



>ref|XP_392284.2| PREDICTED: pre-mRNA-processing factor 19 [Apis mellifera]
 ref|XP_006609753.1| PREDICTED: pre-mRNA-processing factor 19-like [Apis dorsata]
Length=504

 Score =   169 bits (429),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 81/130 (62%), Positives = 100/130 (77%), Gaps = 0/130 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            ++C+IS EVPE PVVS  SG +FEKRLIE+++++ G  P+TG+ LT D ++ IKT  IVK
Sbjct  3    LSCAISNEVPEHPVVSPVSGSIFEKRLIEKYLAENGVDPITGKELTADQLIDIKTTAIVK  62

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            P+P  A SIP +L + Q EWD++ML +F L QQL TARQELSHALYQHDAACRVIARL K
Sbjct  63   PKPPSATSIPAILKILQDEWDAVMLHSFTLRQQLQTARQELSHALYQHDAACRVIARLTK  122

Query  460  ERDEARELLA  489
            E   ARE LA
Sbjct  123  EVTAAREALA  132



>gb|EUD70798.1| pre-mRNA-processing factor 19 [Plasmodium vinckei petteri]
Length=499

 Score =   169 bits (429),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 99/134 (74%), Gaps = 1/134 (1%)
 Frame = +1

Query  106  CSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVKPR  285
            C+ISG+ PEEPVVS K+G +FEKRLIE+HI +YG CPV+GE LT+DD+ PIK  K VKPR
Sbjct  5    CTISGQTPEEPVVS-KTGYIFEKRLIEKHIKNYGICPVSGEVLTLDDLYPIKIEKFVKPR  63

Query  286  PVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKKER  465
            P+ A SIPG+L +FQ EWDS++   F L   ++  R +LSH LYQ+DAA RVIA+L KE+
Sbjct  64   PITATSIPGLLSIFQTEWDSMISEMFTLRTHVNDVRNQLSHCLYQYDAATRVIAKLLKEK  123

Query  466  DEARELLAQADRQL  507
            +  +E +     Q+
Sbjct  124  NNYQEEINNLRNQI  137



>ref|XP_007839473.1| hypothetical protein PFICI_12701 [Pestalotiopsis fici W106-1]
 gb|ETS75757.1| hypothetical protein PFICI_12701 [Pestalotiopsis fici W106-1]
Length=477

 Score =   169 bits (428),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 77/131 (59%), Positives = 101/131 (77%), Gaps = 0/131 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M C++SGE P+EPVVS  SG +FEKRLIE++I + GK PVTG+ LT+DD++PIKT ++V+
Sbjct  1    MLCALSGEAPQEPVVSKLSGSVFEKRLIEKYIEENGKDPVTGQDLTLDDLLPIKTARVVR  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP    SIP +L  FQ EWD+L L  F + +QL   R+EL+ ALYQHDAA RVIARL +
Sbjct  61   PRPPTLTSIPALLSTFQNEWDALALETFNIREQLTRTREELATALYQHDAAVRVIARLTQ  120

Query  460  ERDEARELLAQ  492
            ERDEAR+ L++
Sbjct  121  ERDEARDALSK  131



>ref|XP_743082.1| hypothetical protein [Plasmodium chabaudi chabaudi]
 emb|CAH79092.1| conserved protein, putative [Plasmodium chabaudi chabaudi]
 emb|CDR11241.1| pre-mRNA-processing factor 19, putative [Plasmodium chabaudi 
chabaudi]
Length=499

 Score =   169 bits (429),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 99/134 (74%), Gaps = 1/134 (1%)
 Frame = +1

Query  106  CSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVKPR  285
            C+ISG+ PEEPVVS K+G +FEKRLIE+HI +YG CPV+GE LT+DD+ PIK  K VKPR
Sbjct  5    CTISGQTPEEPVVS-KTGYIFEKRLIEKHIKNYGICPVSGEVLTLDDLYPIKIEKFVKPR  63

Query  286  PVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKKER  465
            P+ A SIPG+L +FQ EWDS++   F L   ++  R +LSH LYQ+DAA RVIA+L KE+
Sbjct  64   PITATSIPGLLSIFQTEWDSMISEMFTLRTHVNDVRNQLSHCLYQYDAATRVIAKLLKEK  123

Query  466  DEARELLAQADRQL  507
            +  +E +     Q+
Sbjct  124  NNYQEEINNLRNQI  137



>ref|XP_003394205.1| PREDICTED: pre-mRNA-processing factor 19-like [Bombus terrestris]
 ref|XP_003489512.1| PREDICTED: pre-mRNA-processing factor 19-like [Bombus impatiens]
Length=504

 Score =   169 bits (429),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 80/130 (62%), Positives = 101/130 (78%), Gaps = 0/130 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            ++C+IS EVPE PVVS  SG +FEKRLIE+++++ G  P+TG+ LT+D ++ IKT  IVK
Sbjct  3    LSCAISNEVPEHPVVSPVSGSIFEKRLIEKYLAENGVDPITGKELTVDQLIDIKTTAIVK  62

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            P+P  A SIP +L + Q EWD++ML +F L QQL TARQELSH+LYQHDAACRVIARL K
Sbjct  63   PKPPSATSIPAILKILQDEWDAVMLHSFTLRQQLQTARQELSHSLYQHDAACRVIARLTK  122

Query  460  ERDEARELLA  489
            E   ARE LA
Sbjct  123  EVTAAREALA  132



>gb|KIW64512.1| hypothetical protein PV04_09440 [Capronia semiimmersa]
Length=477

 Score =   169 bits (428),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 82/141 (58%), Positives = 102/141 (72%), Gaps = 0/141 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M C+ISGE P+ PV S KSG ++EKRLIE +IS+ G  P TGE L++DD++ +K+  +V 
Sbjct  1    MLCAISGEAPQVPVASRKSGNVYEKRLIEAYISENGTEPTTGETLSVDDLIDLKSPNVVY  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP Q  SIP ML  FQ EWD+L L  + L+Q LH ARQELS ALY++DAA RVIARL K
Sbjct  61   PRPPQMTSIPAMLSFFQNEWDALALQTYTLQQNLHQARQELSTALYENDAAVRVIARLTK  120

Query  460  ERDEARELLAQADRQLPSAAA  522
            ERDEAR  LAQ D    ++AA
Sbjct  121  ERDEARSALAQVDVGRAASAA  141



>ref|XP_005843657.1| hypothetical protein CHLNCDRAFT_140025 [Chlorella variabilis]
 gb|EFN51555.1| hypothetical protein CHLNCDRAFT_140025 [Chlorella variabilis]
Length=504

 Score =   169 bits (429),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 89/156 (57%), Positives = 104/156 (67%), Gaps = 11/156 (7%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M CSISG VPE PVVS KSG L+EKRLI + I + G+ PVT E L  DD++ + + + VK
Sbjct  1    MLCSISGTVPEVPVVSKKSGHLYEKRLILKVIKETGRDPVTSEALGEDDLLELTSSQAVK  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP  A SIPG+L +FQ EWDS ML    L Q L+T RQELSHALYQHDAACRVIARL +
Sbjct  61   PRPTPATSIPGLLSLFQNEWDSTMLEVHQLRQSLNTVRQELSHALYQHDAACRVIARLMR  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNATTLSNGKR  567
            ERD  R+ L +A R  P  AA           NGKR
Sbjct  121  ERDAYRQQLEEAQRAAPEGAA-----------NGKR  145



>ref|XP_007873530.1| hypothetical protein PNEG_01576 [Pneumocystis murina B123]
 gb|EMR10320.1| hypothetical protein PNEG_01576 [Pneumocystis murina B123]
Length=478

 Score =   169 bits (428),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 83/131 (63%), Positives = 101/131 (77%), Gaps = 0/131 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M C++SGE  +  VVS KSG ++EKRLIE +I +  K PVTGEPLT+DD+V +KT K ++
Sbjct  1    MFCALSGESIDIGVVSKKSGNVYEKRLIEAYIQENEKDPVTGEPLTLDDLVELKTSKTIR  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
             RP QA SIP +L +FQ EWDSL L  + L+QQL+ ARQELS ALYQHDAACRVIARL K
Sbjct  61   GRPPQATSIPSLLAIFQNEWDSLALETYNLKQQLNQARQELSTALYQHDAACRVIARLLK  120

Query  460  ERDEARELLAQ  492
            ERDEARE L +
Sbjct  121  ERDEAREALKK  131



>dbj|GAD93209.1| cell cycle control protein [Byssochlamys spectabilis No. 5]
Length=476

 Score =   169 bits (427),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 90/173 (52%), Positives = 109/173 (63%), Gaps = 17/173 (10%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M C+ISGE P+ PV S KSG +FEKRLIE  I+++GK PVTGE L+ DD+V +KT ++V+
Sbjct  1    MLCAISGEAPQVPVASRKSGNVFEKRLIEAFIAEHGKDPVTGEELSTDDLVELKTQRVVR  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP    SIP +LG+FQ EWD+L L  + L Q L   RQELS ALYQHDAA RVIARL K
Sbjct  61   PRPPTLTSIPSLLGVFQEEWDALALETYTLRQTLAQTRQELSTALYQHDAAVRVIARLTK  120

Query  460  ERDEARELLA----------------QADRQ-LPSAAAMESADNATTLSNGKR  567
            ERDEAR+ L+                Q D   LP A          TLS G+R
Sbjct  121  ERDEARDALSKVSVGATRAPSGGDAMQVDSTGLPEAVVARIESTQATLSKGRR  173



>ref|XP_008473784.1| PREDICTED: pre-mRNA-processing factor 19-like [Diaphorina citri]
Length=194

 Score =   161 bits (408),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 94/130 (72%), Gaps = 0/130 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            +N  +S EVPE PVVS  SG +FEKRLIE++I + G  P+  E LT++ ++ IK   + K
Sbjct  42   INSLVSNEVPEHPVVSPISGSVFEKRLIEKYIKENGTDPINAERLTLEQLIDIKVSPVTK  101

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            P+P QA SIP +L M Q EWD++ML +F   QQL TARQELSHALYQHDAACRVIARL K
Sbjct  102  PKPPQATSIPAILKMLQDEWDAIMLHSFTQRQQLQTARQELSHALYQHDAACRVIARLTK  161

Query  460  ERDEARELLA  489
            E   ARE LA
Sbjct  162  EVTAAREALA  171



>gb|EGD96657.1| cell cycle control protein [Trichophyton tonsurans CBS 112818]
Length=476

 Score =   169 bits (427),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 79/131 (60%), Positives = 101/131 (77%), Gaps = 0/131 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M C+ISGE P+ PVVS KSG +FEKRL+E +IS++GK P+TGE  T++D+V +K+ +I +
Sbjct  1    MLCAISGEAPQVPVVSRKSGNVFEKRLVEEYISEHGKEPITGEEHTVEDLVELKSARIAR  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP    SIP +LG+FQ EWD+L L  F L Q L   RQELS ALYQHDAA RVIARL+K
Sbjct  61   PRPPTLTSIPSLLGVFQGEWDALALETFTLRQTLAQTRQELSTALYQHDAAVRVIARLRK  120

Query  460  ERDEARELLAQ  492
            ERDEAR+ L++
Sbjct  121  ERDEARDALSK  131



>ref|XP_001542335.1| conserved hypothetical protein [Histoplasma capsulatum NAm1]
 gb|EDN05903.1| conserved hypothetical protein [Histoplasma capsulatum NAm1]
Length=476

 Score =   169 bits (427),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 81/131 (62%), Positives = 101/131 (77%), Gaps = 0/131 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M C+ISGE P+ PVVS KSG +FEKRLIE +IS+ GK PV+GE LT++D+V +KT +IV+
Sbjct  1    MLCAISGEAPQVPVVSRKSGNVFEKRLIEAYISENGKDPVSGEDLTVEDLVELKTARIVR  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP    SIP +LG+FQ EWD+L L  + L+Q L   RQELS ALYQ DAA RVIARL K
Sbjct  61   PRPPTLTSIPSLLGVFQEEWDALALETYTLKQTLAQTRQELSTALYQQDAAVRVIARLTK  120

Query  460  ERDEARELLAQ  492
            ERDEAR+ L++
Sbjct  121  ERDEARDALSK  131



>gb|EPS32364.1| hypothetical protein PDE_07324 [Penicillium oxalicum 114-2]
Length=474

 Score =   169 bits (427),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 84/153 (55%), Positives = 111/153 (73%), Gaps = 5/153 (3%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M C+ISGE P+ PVVS+KSG +FEKRLIE +I+++GK PV GE L+ DD++ +KT ++V+
Sbjct  1    MLCAISGEAPQVPVVSSKSGSVFEKRLIEAYITEHGKDPVNGEDLSTDDLIDVKTQRVVR  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP    SIP +L +FQ EWD+L L  + L+Q L   R+ELS ALYQHDAA RVIARL +
Sbjct  61   PRPPTLTSIPSLLSVFQEEWDALALETYTLQQTLAQTRRELSAALYQHDAAVRVIARLTR  120

Query  460  ERDEARELLAQ----ADRQLPSAAAMESADNAT  546
            ERDEAR+ L+Q    A +   S  AM+  D+AT
Sbjct  121  ERDEARDALSQVTVGASKASASGEAMQ-VDSAT  152



>ref|XP_001552539.1| hypothetical protein BC1G_08404 [Botrytis cinerea B05.10]
 emb|CCD43834.1| similar to cell cycle control protein cwf8 [Botrytis cinerea 
T4]
 gb|EMR85485.1| putative cell cycle control protein [Botrytis cinerea BcDW1]
Length=476

 Score =   169 bits (427),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 81/131 (62%), Positives = 98/131 (75%), Gaps = 0/131 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M CSISGE P+ PV S+KSG +FEKRLIE +IS+  K PVTGE L + D++ +K+ KIV 
Sbjct  1    MLCSISGEAPQHPVASSKSGNVFEKRLIESYISENHKDPVTGEDLEIADLIDLKSAKIVT  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP    SIP +L  FQ EWD+L L +F + QQLH  RQELS ALYQHDAA RVIARL K
Sbjct  61   PRPPTLTSIPSLLSTFQNEWDALALESFTIRQQLHQTRQELSTALYQHDAAVRVIARLTK  120

Query  460  ERDEARELLAQ  492
            ERDEAR+ L++
Sbjct  121  ERDEARDALSK  131



>ref|XP_007285232.1| cell cycle control protein [Colletotrichum gloeosporioides Nara 
gc5]
 gb|ELA25710.1| cell cycle control protein [Colletotrichum gloeosporioides Nara 
gc5]
Length=477

 Score =   169 bits (427),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 79/131 (60%), Positives = 97/131 (74%), Gaps = 0/131 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M C+ISGE P+EPV S KSG +FEKRLIE++I + G  PVTGE LT DD++P+    IV+
Sbjct  1    MLCAISGEAPQEPVASKKSGTVFEKRLIEKYIEENGTEPVTGEALTADDLLPLTQSHIVR  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP    SIP +L  FQ EWD+L L  F L++QL   R+EL+ ALYQHDAA RVIARL K
Sbjct  61   PRPPTLTSIPALLATFQNEWDALALETFNLKEQLARTREELATALYQHDAAVRVIARLTK  120

Query  460  ERDEARELLAQ  492
            ERDEARE L++
Sbjct  121  ERDEAREALSK  131



>gb|EFA82568.1| WD40 repeat-containing protein [Polysphondylium pallidum PN500]
Length=488

 Score =   169 bits (427),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 83/151 (55%), Positives = 105/151 (70%), Gaps = 7/151 (5%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKI--  273
            M CSISG+VP+EPVVS K+G ++EKRLIE++I   G+ P TGEPL++ DIV I    +  
Sbjct  1    MICSISGDVPQEPVVSIKTGNVYEKRLIEKYIDTNGREPTTGEPLSITDIVVISKQSMSG  60

Query  274  -----VKPRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACR  438
                  KPR   A SIP ML MFQ EWD+LML  F L+QQ    RQEL+H+LYQ+DA+CR
Sbjct  61   GGVGGAKPRTSNATSIPSMLQMFQNEWDALMLETFTLKQQFEQVRQELAHSLYQYDASCR  120

Query  439  VIARLKKERDEARELLAQADRQLPSAAAMES  531
            VIARL KERD+AR  LA A  ++ S  + +S
Sbjct  121  VIARLIKERDQARNALANAKIKVDSNNSQDS  151



>gb|EQB48268.1| hypothetical protein CGLO_12519 [Colletotrichum gloeosporioides 
Cg-14]
Length=477

 Score =   168 bits (426),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 79/131 (60%), Positives = 97/131 (74%), Gaps = 0/131 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M C+ISGE P+EPV S KSG +FEKRLIE++I + G  PVTGE LT DD++P+    IV+
Sbjct  1    MLCAISGEAPQEPVASKKSGTVFEKRLIEKYIEENGTEPVTGEALTADDLLPLAQSHIVR  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP    SIP +L  FQ EWD+L L  F L++QL   R+EL+ ALYQHDAA RVIARL K
Sbjct  61   PRPPTLTSIPALLATFQNEWDALALETFNLKEQLARTREELATALYQHDAAVRVIARLTK  120

Query  460  ERDEARELLAQ  492
            ERDEARE L++
Sbjct  121  ERDEAREALSK  131



>gb|EQL37776.1| pre-mRNA-processing factor 19 [Blastomyces dermatitidis ATCC 
26199]
Length=450

 Score =   168 bits (425),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 79/131 (60%), Positives = 102/131 (78%), Gaps = 0/131 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M C+ISGE P+ PVVS KSG +FEKRLIE +IS+ GK PVTGE L+++D++ +K+ ++V+
Sbjct  1    MLCAISGEAPQVPVVSRKSGNVFEKRLIEAYISENGKDPVTGEDLSVEDLLELKSARVVR  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP    SIP +LG+FQ EWD+L L  + L+Q L   RQELS ALYQHDAA RVIARL K
Sbjct  61   PRPPTLTSIPSLLGVFQEEWDALALETYTLKQTLAQTRQELSTALYQHDAAVRVIARLTK  120

Query  460  ERDEARELLAQ  492
            ERDEAR+ L++
Sbjct  121  ERDEARDALSK  131



>gb|EEQ89951.1| cell cycle control protein [Blastomyces dermatitidis ER-3]
Length=476

 Score =   168 bits (426),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 79/131 (60%), Positives = 102/131 (78%), Gaps = 0/131 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M C+ISGE P+ PVVS KSG +FEKRLIE +IS+ GK PVTGE L+++D++ +K+ ++V+
Sbjct  1    MLCAISGEAPQVPVVSRKSGNVFEKRLIEAYISENGKDPVTGEDLSVEDLLELKSARVVR  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP    SIP +LG+FQ EWD+L L  + L+Q L   RQELS ALYQHDAA RVIARL K
Sbjct  61   PRPPTLTSIPSLLGVFQEEWDALALETYTLKQTLAQTRQELSTALYQHDAAVRVIARLTK  120

Query  460  ERDEARELLAQ  492
            ERDEAR+ L++
Sbjct  121  ERDEARDALSK  131



>ref|XP_002621271.1| cell cycle control protein [Blastomyces dermatitidis SLH14081]
 gb|EEQ74088.1| cell cycle control protein [Blastomyces dermatitidis SLH14081]
Length=476

 Score =   168 bits (426),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 79/131 (60%), Positives = 102/131 (78%), Gaps = 0/131 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M C+ISGE P+ PVVS KSG +FEKRLIE +IS+ GK PVTGE L+++D++ +K+ ++V+
Sbjct  1    MLCAISGEAPQVPVVSRKSGNVFEKRLIEAYISENGKDPVTGEDLSVEDLLELKSARVVR  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP    SIP +LG+FQ EWD+L L  + L+Q L   RQELS ALYQHDAA RVIARL K
Sbjct  61   PRPPTLTSIPSLLGVFQEEWDALALETYTLKQTLAQTRQELSTALYQHDAAVRVIARLTK  120

Query  460  ERDEARELLAQ  492
            ERDEAR+ L++
Sbjct  121  ERDEARDALSK  131



>gb|EGE80994.1| cell cycle control protein [Blastomyces dermatitidis ATCC 18188]
Length=476

 Score =   168 bits (426),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 79/131 (60%), Positives = 102/131 (78%), Gaps = 0/131 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M C+ISGE P+ PVVS KSG +FEKRLIE +IS+ GK PVTGE L+++D++ +K+ ++V+
Sbjct  1    MLCAISGEAPQVPVVSRKSGNVFEKRLIEAYISENGKDPVTGEDLSVEDLLELKSARVVR  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP    SIP +LG+FQ EWD+L L  + L+Q L   RQELS ALYQHDAA RVIARL K
Sbjct  61   PRPPTLTSIPSLLGVFQEEWDALALETYTLKQTLAQTRQELSTALYQHDAAVRVIARLTK  120

Query  460  ERDEARELLAQ  492
            ERDEAR+ L++
Sbjct  121  ERDEARDALSK  131



>ref|XP_001239734.1| hypothetical protein CIMG_09355 [Coccidioides immitis RS]
 gb|EAS28151.3| cell cycle control protein [Coccidioides immitis RS]
Length=476

 Score =   168 bits (426),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 78/131 (60%), Positives = 102/131 (78%), Gaps = 0/131 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M C+ISGE P+ PVVS KSG +FEKRLIE +I+++GK PVTGE LT+DD++ +K+ ++V+
Sbjct  1    MLCAISGEAPQVPVVSRKSGNVFEKRLIEAYIAEHGKEPVTGEELTIDDLIELKSARVVR  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP    SIP +LG+FQ EWD+L L  + L Q L   RQELS ALYQHDAA RVIARL++
Sbjct  61   PRPPTLTSIPSLLGVFQEEWDALALETYTLRQTLAQTRQELSTALYQHDAAVRVIARLRQ  120

Query  460  ERDEARELLAQ  492
            ERD AR+ L++
Sbjct  121  ERDAARDALSK  131



>ref|XP_787949.3| PREDICTED: pre-mRNA-processing factor 19 [Strongylocentrotus 
purpuratus]
Length=509

 Score =   169 bits (427),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 83/128 (65%), Positives = 95/128 (74%), Gaps = 0/128 (0%)
 Frame = +1

Query  106  CSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVKPR  285
            CSIS E+PE PVVS  SG +FEKRLIE+ IS+ G  PV GEPL+ D ++ IK   +VKPR
Sbjct  5    CSISNELPEVPVVSPASGRVFEKRLIEKFISENGSDPVNGEPLSEDQLIEIKVNPLVKPR  64

Query  286  PVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKKER  465
            P  A SIP +L + Q EWD+ ML +F L QQL TARQELSHALYQHDAACRVIARL KE 
Sbjct  65   PPTATSIPAILKLLQDEWDACMLHSFTLRQQLQTARQELSHALYQHDAACRVIARLTKEV  124

Query  466  DEARELLA  489
              ARE LA
Sbjct  125  TAAREALA  132



>ref|XP_003231017.1| cell cycle control protein [Trichophyton rubrum CBS 118892]
 gb|EGD92276.1| hypothetical protein TERG_08493 [Trichophyton rubrum CBS 118892]
 gb|EZF27929.1| hypothetical protein H100_00174 [Trichophyton rubrum MR850]
 gb|EZF46935.1| hypothetical protein H102_00173 [Trichophyton rubrum CBS 100081]
 gb|EZF57560.1| hypothetical protein H103_00175 [Trichophyton rubrum CBS 288.86]
 gb|EZF68213.1| hypothetical protein H104_00174 [Trichophyton rubrum CBS 289.86]
 gb|EZF78919.1| hypothetical protein H105_00165 [Trichophyton soudanense CBS 
452.61]
 gb|EZF89498.1| hypothetical protein H110_00174 [Trichophyton rubrum MR1448]
 gb|EZG00313.1| hypothetical protein H113_00175 [Trichophyton rubrum MR1459]
 gb|EZG11213.1| hypothetical protein H106_00067 [Trichophyton rubrum CBS 735.88]
 gb|EZG21934.1| hypothetical protein H107_00177 [Trichophyton rubrum CBS 202.88]
 gb|KDB38694.1| hypothetical protein H112_00174 [Trichophyton rubrum D6]
Length=519

 Score =   169 bits (427),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 79/131 (60%), Positives = 101/131 (77%), Gaps = 0/131 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M C+ISGE P+ PVVS KSG +FEKRL+E +IS++GK P+TGE  T++D+V +K+ +I +
Sbjct  44   MLCAISGEAPQVPVVSRKSGNVFEKRLVEEYISEHGKEPITGEEHTVEDLVELKSARIAR  103

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP    SIP +LG+FQ EWD+L L  F L Q L   RQELS ALYQHDAA RVIARL+K
Sbjct  104  PRPPTLTSIPSLLGVFQEEWDALALETFTLRQTLAQTRQELSTALYQHDAAVRVIARLRK  163

Query  460  ERDEARELLAQ  492
            ERDEAR+ L++
Sbjct  164  ERDEARDALSK  174



>ref|XP_003067278.1| WD domain, G-beta repeat containing protein [Coccidioides posadasii 
C735 delta SOWgp]
 gb|EER25133.1| WD domain, G-beta repeat containing protein [Coccidioides posadasii 
C735 delta SOWgp]
 gb|EFW19521.1| cell cycle control protein [Coccidioides posadasii str. Silveira]
Length=476

 Score =   168 bits (425),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 78/131 (60%), Positives = 102/131 (78%), Gaps = 0/131 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M C+ISGE P+ PVVS KSG +FEKRLIE +I+++GK PVTGE LT+DD++ +K+ ++V+
Sbjct  1    MLCAISGEAPQVPVVSRKSGNVFEKRLIEAYIAEHGKEPVTGEELTIDDLIELKSARVVR  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP    SIP +LG+FQ EWD+L L  + L Q L   RQELS ALYQHDAA RVIARL++
Sbjct  61   PRPPTLTSIPSLLGVFQEEWDALALETYTLRQTLAQTRQELSTALYQHDAAVRVIARLRQ  120

Query  460  ERDEARELLAQ  492
            ERD AR+ L++
Sbjct  121  ERDAARDALSK  131



>gb|EZF32247.1| hypothetical protein H101_04159 [Trichophyton interdigitale H6]
 gb|KDB28153.1| hypothetical protein H109_00098 [Trichophyton interdigitale MR816]
Length=523

 Score =   169 bits (427),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 79/131 (60%), Positives = 101/131 (77%), Gaps = 0/131 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M C+ISGE P+ PVVS KSG +FEKRL+E +IS++GK P+TGE  T++D+V +K+ +I +
Sbjct  48   MLCAISGEAPQVPVVSRKSGNVFEKRLVEEYISEHGKEPITGEEHTVEDLVELKSARIAR  107

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP    SIP +LG+FQ EWD+L L  F L Q L   RQELS ALYQHDAA RVIARL+K
Sbjct  108  PRPPTLTSIPSLLGVFQEEWDALALETFTLRQTLAQTRQELSTALYQHDAAVRVIARLRK  167

Query  460  ERDEARELLAQ  492
            ERDEAR+ L++
Sbjct  168  ERDEARDALSK  178



>emb|CCF46222.1| hypothetical protein CH063_03812 [Colletotrichum higginsianum]
Length=477

 Score =   168 bits (425),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 79/131 (60%), Positives = 97/131 (74%), Gaps = 0/131 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M C+ISGE P+EPV S KSG +FEKRLIE++I + G  PVTGE LT DD++P+    IV+
Sbjct  1    MLCAISGEAPQEPVASKKSGTIFEKRLIEKYIEENGTEPVTGEALTNDDLLPLTQSHIVR  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP    SIP +L  FQ EWD+L L  F L++QL   R+EL+ ALYQHDAA RVIARL K
Sbjct  61   PRPPTLTSIPALLATFQNEWDALALETFNLKEQLARTREELATALYQHDAAVRVIARLAK  120

Query  460  ERDEARELLAQ  492
            ERDEARE L++
Sbjct  121  ERDEAREALSK  131



>gb|ESZ95262.1| putative Pre-mRNA-processing factor 19 like protein [Sclerotinia 
borealis F-4157]
Length=476

 Score =   168 bits (425),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 81/131 (62%), Positives = 97/131 (74%), Gaps = 0/131 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M CSISGE P  PV S+KSG +FEKRLIE +IS+  K PVTGE L + D++ +K+ KIV 
Sbjct  1    MLCSISGEAPHHPVASSKSGNVFEKRLIESYISENHKDPVTGEDLEIADLIDLKSAKIVT  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP    SIP +L  FQ EWD+L L +F + QQLH  RQELS ALYQHDAA RVIARL K
Sbjct  61   PRPPTLTSIPSLLSTFQNEWDALALESFTIRQQLHQTRQELSTALYQHDAAVRVIARLTK  120

Query  460  ERDEARELLAQ  492
            ERDEAR+ L++
Sbjct  121  ERDEARDALSK  131



>ref|XP_003701647.1| PREDICTED: pre-mRNA-processing factor 19 [Megachile rotundata]
Length=504

 Score =   168 bits (425),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 101/130 (78%), Gaps = 0/130 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            ++C+IS EVPE PVVS  SG +FE+RLIE+++++ G  P++G+ LT+D ++ +KT  IVK
Sbjct  3    LSCAISNEVPEHPVVSPVSGSIFERRLIEKYVAENGVDPISGKELTVDQLIDVKTTAIVK  62

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            P+P  A SIP +L + Q EWD++ML +F L QQL TARQELSHALYQHDAACRVIARL K
Sbjct  63   PKPPSATSIPAILKILQDEWDAVMLHSFTLRQQLQTARQELSHALYQHDAACRVIARLTK  122

Query  460  ERDEARELLA  489
            E   ARE LA
Sbjct  123  EVTAAREALA  132



>ref|XP_970005.1| PREDICTED: pre-mRNA-processing factor 19 [Tribolium castaneum]
 gb|EFA10419.1| hypothetical protein TcasGA2_TC012659 [Tribolium castaneum]
Length=500

 Score =   167 bits (424),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 79/130 (61%), Positives = 99/130 (76%), Gaps = 0/130 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            + C++S EVPE PVVS  SG +FEKR+IE++I ++GK P++G+ LT+D ++ IKT  IVK
Sbjct  3    LFCALSNEVPEHPVVSPTSGAIFEKRIIEKYIQEHGKDPISGDELTVDKLIEIKTPPIVK  62

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            P+P  A SIP  L + Q EWD++ML +F   QQL TARQELSHALYQHDAACRVIARL K
Sbjct  63   PKPPSATSIPATLKLLQDEWDAVMLYSFTQRQQLQTARQELSHALYQHDAACRVIARLNK  122

Query  460  ERDEARELLA  489
            E   ARE LA
Sbjct  123  EVTAAREALA  132



>ref|XP_007597798.1| hypothetical protein CFIO01_11021 [Colletotrichum fioriniae PJ7]
 gb|EXF78557.1| hypothetical protein CFIO01_11021 [Colletotrichum fioriniae PJ7]
Length=477

 Score =   167 bits (423),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 77/131 (59%), Positives = 98/131 (75%), Gaps = 0/131 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M C+ISGE P+EPV S KSG +FEKRLIE++I + G  PVTGE LT++D++P+    +V+
Sbjct  1    MLCAISGEAPQEPVASKKSGTVFEKRLIEKYIEENGTEPVTGEALTIEDLLPLTQSHVVR  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP    SIP +L  FQ EWD+L L  F L++QL   R+EL+ ALYQHDAA RVIARL K
Sbjct  61   PRPPTLTSIPALLATFQNEWDALALETFNLKEQLARTREELATALYQHDAAVRVIARLSK  120

Query  460  ERDEARELLAQ  492
            ERDEARE L++
Sbjct  121  ERDEAREALSK  131



>ref|XP_730217.1| hypothetical protein [Plasmodium yoelii yoelii 17XNL]
 gb|EAA21782.1| hypothetical protein [Plasmodium yoelii yoelii]
 gb|ETB59136.1| hypothetical protein YYC_03401 [Plasmodium yoelii 17X]
 emb|CDU16471.1| pre-mRNA-processing factor 19, putative [Plasmodium yoelii]
 emb|CDZ10995.1| pre-mRNA-processing factor 19, putative [Plasmodium yoelii]
Length=499

 Score =   167 bits (424),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 100/134 (75%), Gaps = 1/134 (1%)
 Frame = +1

Query  106  CSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVKPR  285
            C+ISG+ PEEPVVS K+G +FEKRLIE+HI +YG CP++GE LT++D+ PIK  K VKPR
Sbjct  5    CTISGQTPEEPVVS-KTGYIFEKRLIEKHIKNYGICPISGEILTLEDLYPIKNEKYVKPR  63

Query  286  PVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKKER  465
            P+ A SIPG+L +FQ EWDS++   F L   ++  R +LSH+LYQ+DAA RVIA+L KE+
Sbjct  64   PITATSIPGLLSIFQTEWDSMISEMFNLRTHVNDVRNQLSHSLYQYDAATRVIAKLLKEK  123

Query  466  DEARELLAQADRQL  507
            +  +E +     Q+
Sbjct  124  NNYQEEINNLRNQI  137



>gb|KFG80204.1| cell cycle control protein [Metarhizium anisopliae]
 gb|KID62231.1| cell cycle control protein, partial [Metarhizium anisopliae ARSEF 
549]
Length=476

 Score =   167 bits (422),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 101/131 (77%), Gaps = 0/131 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M C ISGE P+EPVVS KSG+++EKRLIE++I+D+G  P TGE LT DD++ I++ ++V+
Sbjct  1    MLCGISGEAPQEPVVSKKSGVVYEKRLIEQYINDHGTEPSTGEALTADDLLSIQSSRVVR  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP    SIP +L  FQ EWD+L L  + L++QL   R+EL+ ALYQHDAA RVIARL K
Sbjct  61   PRPPTLTSIPALLATFQNEWDNLALETYNLKEQLARTREELATALYQHDAAVRVIARLSK  120

Query  460  ERDEARELLAQ  492
            ERDEAR+ L++
Sbjct  121  ERDEARDSLSK  131



>dbj|GAA90727.1| cell cycle control protein [Aspergillus kawachii IFO 4308]
Length=476

 Score =   167 bits (422),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 81/141 (57%), Positives = 102/141 (72%), Gaps = 0/141 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M C+ISGE P+ PVVS KSG +FEKRLIE +I++ GK PV GE L+ DD++ +K+ ++V+
Sbjct  1    MLCAISGEAPQVPVVSPKSGSVFEKRLIEAYIAENGKDPVNGEELSTDDLIDVKSQRVVR  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP    SIP +L +FQ EWD+L L  + L Q L   RQELS ALYQHDAA RVIARL K
Sbjct  61   PRPPTLTSIPSLLSVFQEEWDALALETYTLRQTLAQTRQELSSALYQHDAAVRVIARLTK  120

Query  460  ERDEARELLAQADRQLPSAAA  522
            ERDEAR+ L++      SAAA
Sbjct  121  ERDEARDALSKVTVGARSAAA  141



>gb|KID78304.1| cell cycle control protein, partial [Metarhizium brunneum ARSEF 
3297]
Length=476

 Score =   167 bits (422),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 101/131 (77%), Gaps = 0/131 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M C ISGE P+EPVVS KSG+++EKRLIE++I+D+G  P TGE LT DD++ I++ ++V+
Sbjct  1    MLCGISGEAPQEPVVSKKSGVVYEKRLIEQYINDHGTEPSTGEALTADDLLSIQSSRVVR  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP    SIP +L  FQ EWD+L L  + L++QL   R+EL+ ALYQHDAA RVIARL K
Sbjct  61   PRPPTLTSIPALLATFQNEWDNLALETYNLKEQLARTREELATALYQHDAAVRVIARLSK  120

Query  460  ERDEARELLAQ  492
            ERDEAR+ L++
Sbjct  121  ERDEARDSLSK  131



>gb|KID92673.1| cell cycle control protein [Metarhizium guizhouense ARSEF 977]
Length=476

 Score =   167 bits (422),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 101/131 (77%), Gaps = 0/131 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M C ISGE P+EPVVS KSG+++EKRLIE++I+D+G  P TGE LT DD++ I++ ++V+
Sbjct  1    MLCGISGEAPQEPVVSKKSGVVYEKRLIEQYINDHGTEPSTGEALTADDLLSIQSSRVVR  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP    SIP +L  FQ EWD+L L  + L++QL   R+EL+ ALYQHDAA RVIARL K
Sbjct  61   PRPPTLTSIPALLATFQNEWDNLALETYNLKEQLARTREELATALYQHDAAVRVIARLSK  120

Query  460  ERDEARELLAQ  492
            ERDEAR+ L++
Sbjct  121  ERDEARDSLSK  131



>ref|XP_007818610.1| cell cycle control protein [Metarhizium robertsii ARSEF 23]
 gb|EFZ02839.1| cell cycle control protein [Metarhizium robertsii ARSEF 23]
 gb|EXV06086.1| Prp19/Pso4-like domain protein [Metarhizium robertsii]
Length=476

 Score =   167 bits (422),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 101/131 (77%), Gaps = 0/131 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M C ISGE P+EPVVS KSG+++EKRLIE++I+D+G  P TGE LT DD++ I++ ++V+
Sbjct  1    MLCGISGEAPQEPVVSKKSGVVYEKRLIEQYINDHGTEPSTGEALTADDLLSIQSSRVVR  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP    SIP +L  FQ EWD+L L  + L++QL   R+EL+ ALYQHDAA RVIARL K
Sbjct  61   PRPPTLTSIPALLATFQNEWDNLALETYNLKEQLARTREELATALYQHDAAVRVIARLSK  120

Query  460  ERDEARELLAQ  492
            ERDEAR+ L++
Sbjct  121  ERDEARDSLSK  131



>ref|XP_001401121.1| cell cycle control protein (Cwf8) [Aspergillus niger CBS 513.88]
 emb|CAK42059.1| unnamed protein product [Aspergillus niger]
Length=476

 Score =   167 bits (422),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 81/141 (57%), Positives = 102/141 (72%), Gaps = 0/141 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M C+ISGE P+ PVVS KSG +FEKRLIE +I++ GK PV GE L+ DD++ +K+ ++V+
Sbjct  1    MLCAISGEAPQVPVVSPKSGSVFEKRLIEAYIAENGKDPVNGEELSTDDLIDVKSQRVVR  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP    SIP +L +FQ EWD+L L  + L Q L   RQELS ALYQHDAA RVIARL K
Sbjct  61   PRPPTLTSIPSLLSVFQEEWDALALETYTLRQTLAQTRQELSSALYQHDAAVRVIARLTK  120

Query  460  ERDEARELLAQADRQLPSAAA  522
            ERDEAR+ L++      SAAA
Sbjct  121  ERDEARDALSKVTVGARSAAA  141



>gb|KIE01641.1| cell cycle control protein, partial [Metarhizium majus ARSEF 
297]
Length=476

 Score =   167 bits (422),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 101/131 (77%), Gaps = 0/131 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M C ISGE P+EPVVS KSG+++EKRLIE++I+D+G  P TGE LT DD++ I++ ++V+
Sbjct  1    MLCGISGEAPQEPVVSKKSGVVYEKRLIEQYINDHGTEPSTGEALTADDLLSIQSSRVVR  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP    SIP +L  FQ EWD+L L  + L++QL   R+EL+ ALYQHDAA RVIARL K
Sbjct  61   PRPPTLTSIPALLATFQNEWDNLALETYNLKEQLARTREELATALYQHDAAVRVIARLSK  120

Query  460  ERDEARELLAQ  492
            ERDEAR+ L++
Sbjct  121  ERDEARDSLSK  131



>emb|CDS05955.1| hypothetical protein LRAMOSA08483 [Absidia idahoensis var. thermophila]
Length=506

 Score =   167 bits (423),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 86/137 (63%), Positives = 104/137 (76%), Gaps = 1/137 (1%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTG-KIV  276
            M C+ISGE PEEPVVS KSG LFEKRLIE++I+D+GK P+TGE LT DD+V +K   + V
Sbjct  1    MFCAISGEAPEEPVVSVKSGHLFEKRLIEKYIADHGKDPITGEELTNDDLVSVKANPETV  60

Query  277  KPRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLK  456
            +PRP + +S+P +L   Q EWDS+ML +F L+QQ    RQELSHALYQ+DAA RVIARLK
Sbjct  61   RPRPPKLSSVPSLLSSLQNEWDSVMLESFTLKQQYQQVRQELSHALYQNDAATRVIARLK  120

Query  457  KERDEARELLAQADRQL  507
            KERD ARE LA     L
Sbjct  121  KERDSAREALANVQAHL  137



>gb|EFQ36117.1| hypothetical protein GLRG_11261 [Colletotrichum graminicola M1.001]
Length=474

 Score =   166 bits (421),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 77/131 (59%), Positives = 98/131 (75%), Gaps = 0/131 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M C+ISGE P+EPV S KSG++FEKRLIE++I + G  P TGE LT DD++P+   +IV+
Sbjct  1    MLCAISGEAPQEPVASKKSGIIFEKRLIEKYIEENGTEPGTGEALTNDDLLPLTQSRIVR  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP    SIP +L  FQ EWD+L L  F L++QL   R+EL+ ALYQHDAA RVIARL K
Sbjct  61   PRPPTLTSIPALLATFQNEWDALALETFNLKEQLSRTREELATALYQHDAAVRVIARLSK  120

Query  460  ERDEARELLAQ  492
            ERDEAR+ L++
Sbjct  121  ERDEARDALSK  131



>ref|XP_680256.1| hypothetical protein [Plasmodium berghei strain ANKA]
 emb|CAI04399.1| conserved protein, putative [Plasmodium berghei]
 emb|CDS44969.1| pre-mRNA-processing factor 19, putative [Plasmodium berghei ANKA]
Length=499

 Score =   167 bits (422),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 100/134 (75%), Gaps = 1/134 (1%)
 Frame = +1

Query  106  CSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVKPR  285
            C+ISG+ P+EPVVS K+G +FEKRLIE+HI +YG CPV+GE LT++D+ PIK  K VKPR
Sbjct  5    CTISGQTPDEPVVS-KTGYIFEKRLIEKHIKNYGICPVSGEILTLEDLYPIKIEKFVKPR  63

Query  286  PVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKKER  465
            P+ A SIPG+L +FQ EWDS++   F+L   ++  R +LSH LYQ+DAA RVIA+L KE+
Sbjct  64   PITATSIPGLLSIFQTEWDSMISEMFSLRTHVNDVRNQLSHCLYQYDAATRVIAKLLKEK  123

Query  466  DEARELLAQADRQL  507
            +  +E +     Q+
Sbjct  124  NNCQEEINNLRNQI  137



>ref|XP_003170434.1| cell cycle control protein cwf8 [Microsporum gypseum CBS 118893]
 gb|EFR04671.1| cell cycle control protein cwf8 [Microsporum gypseum CBS 118893]
Length=476

 Score =   166 bits (421),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 79/131 (60%), Positives = 99/131 (76%), Gaps = 0/131 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M C+ISGE P+ PVVS KSG +FEKRL+E +IS+ GK P+TGE  T++D+V +K+  I +
Sbjct  1    MLCAISGEAPQVPVVSRKSGNVFEKRLVEEYISENGKEPITGEEHTLEDLVELKSAHIAR  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP    SIP +LG+FQ EWD+L L  F L Q L   RQELS ALYQHDAA RVIARL+K
Sbjct  61   PRPPTLTSIPSLLGVFQEEWDALALETFTLRQTLAQTRQELSTALYQHDAAVRVIARLRK  120

Query  460  ERDEARELLAQ  492
            ERDEAR+ L++
Sbjct  121  ERDEARDALSK  131



>ref|XP_003716887.1| cell cycle control protein [Magnaporthe oryzae 70-15]
 gb|EHA50568.1| spliceosome component [Magnaporthe oryzae 70-15]
 gb|ELQ42218.1| spliceosome component [Magnaporthe oryzae Y34]
 gb|ELQ60355.1| spliceosome component [Magnaporthe oryzae P131]
Length=494

 Score =   167 bits (422),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 77/131 (59%), Positives = 101/131 (77%), Gaps = 0/131 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M CSISGE P+EPVVSTKSG ++EKRLIE++I ++GK P +   L  +D++PI+T ++V+
Sbjct  1    MLCSISGEAPQEPVVSTKSGNVYEKRLIEKYIDEHGKEPGSDTDLDKEDLLPIQTSRVVR  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP    SIP +L  FQ EWDSL L  + L+QQL   R+EL++ALYQHDAA RVIARL K
Sbjct  61   PRPAALTSIPALLSTFQNEWDSLALETYNLQQQLQRTREELANALYQHDAAIRVIARLTK  120

Query  460  ERDEARELLAQ  492
            ER+EAR+ LA+
Sbjct  121  ERNEARDALAK  131



>ref|XP_001595475.1| hypothetical protein SS1G_03564 [Sclerotinia sclerotiorum 1980]
 gb|EDO01090.1| hypothetical protein SS1G_03564 [Sclerotinia sclerotiorum 1980 
UF-70]
Length=475

 Score =   166 bits (421),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 80/131 (61%), Positives = 98/131 (75%), Gaps = 0/131 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M CSISGE P +PV S+KSG +FEKRLIE +I++  K PVTGE L + D++ +K+ KIV 
Sbjct  1    MLCSISGEAPLQPVASSKSGNIFEKRLIESYIAENHKDPVTGEDLEIADLIDLKSAKIVT  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP    SIP +L  FQ EWD+L L +F + QQLH  RQELS ALYQHDAA RVIARL K
Sbjct  61   PRPPTLTSIPSLLSTFQNEWDALALESFTIRQQLHQTRQELSTALYQHDAAVRVIARLTK  120

Query  460  ERDEARELLAQ  492
            ERDEAR+ L++
Sbjct  121  ERDEARDALSK  131



>ref|XP_664510.1| hypothetical protein AN6906.2 [Aspergillus nidulans FGSC A4]
 gb|EAA58305.1| hypothetical protein AN6906.2 [Aspergillus nidulans FGSC A4]
 tpe|CBF71702.1| TPA: cell cycle control protein (Cwf8), putative (AFU_orthologue; 
AFUA_5G13510) [Aspergillus nidulans FGSC A4]
Length=475

 Score =   166 bits (420),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 77/131 (59%), Positives = 99/131 (76%), Gaps = 0/131 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M C+ISGE P+EPVVS KSG +FEKRL+E +I++ GK PV GE L+ +D++ +KT ++V+
Sbjct  1    MLCAISGEAPQEPVVSPKSGSVFEKRLVEAYIAENGKDPVNGEELSTEDLIEVKTQRVVR  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP    SIP +L +FQ EWD+L L  + L Q L   RQELS ALYQHDAA RVIARL K
Sbjct  61   PRPPTLTSIPSLLSVFQEEWDALALETYTLRQTLAQTRQELSAALYQHDAAVRVIARLTK  120

Query  460  ERDEARELLAQ  492
            ERDEAR+ L++
Sbjct  121  ERDEARDALSK  131



>gb|KFY85883.1| hypothetical protein V500_08057 [Pseudogymnoascus pannorum VKM 
F-4518 (FW-2643)]
Length=763

 Score =   168 bits (426),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 101/148 (68%), Gaps = 0/148 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M C+ISGE P++PVVSTKSG +F + LIE +IS +G  P+T EPLT+DD++PIKT +I  
Sbjct  1    MLCAISGEAPQDPVVSTKSGNVFSRALIESYISTHGTDPITSEPLTVDDLIPIKTSRIAP  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP    SIP +L  FQ EWD+L L +F L QQL   RQEL+ ALY HDAA RV+ARL +
Sbjct  61   PRPPTHTSIPALLSTFQSEWDALALDSFTLRQQLAHTRQELATALYHHDAAVRVVARLTR  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNA  543
            ERDEARE L+        A      DNA
Sbjct  121  ERDEAREALSNVGIAPSGAGEAMQIDNA  148



>ref|XP_011127669.1| hypothetical protein AOL_s00215g165 [Arthrobotrys oligospora 
ATCC 24927]
 gb|EGX43429.1| hypothetical protein AOL_s00215g165 [Arthrobotrys oligospora 
ATCC 24927]
Length=479

 Score =   165 bits (418),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 77/131 (59%), Positives = 99/131 (76%), Gaps = 0/131 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M C+ISGE P+ P +S+KSG +FEKRLIE++I ++GK PVTGE L ++D+V +KT + V+
Sbjct  1    MLCAISGETPQTPAISSKSGHVFEKRLIEQYIQEHGKDPVTGEELKLEDLVDLKTSRTVR  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP    SIP +L +FQ EWD+L L  + L QQL   RQELS ALYQHDAA RVI RL K
Sbjct  61   PRPPTITSIPSLLSVFQNEWDALALETYTLRQQLAQTRQELSTALYQHDAAVRVIGRLIK  120

Query  460  ERDEARELLAQ  492
            ERDEAR+ L++
Sbjct  121  ERDEARDALSK  131



>gb|KDO43335.1| hypothetical protein CISIN_1g009763mg [Citrus sinensis]
Length=490

 Score =   166 bits (419),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 90/107 (84%), Gaps = 1/107 (1%)
 Frame = +1

Query  256  IKTGKIVKPRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAAC  435
             ++ +IVKPRP+ AASIPGMLGMFQ EWD LMLSNFALEQQLHTARQELSHALYQHDAAC
Sbjct  17   FQSKQIVKPRPLTAASIPGMLGMFQNEWDGLMLSNFALEQQLHTARQELSHALYQHDAAC  76

Query  436  RVIARLKKERDEARELLAQADRQLPSAAAMESADNATTLSNGKRAAE  576
            RVIARLKKERDEAR LLAQ++RQ+  A +     NA  LSNGKRA E
Sbjct  77   RVIARLKKERDEARSLLAQSERQIMPAESTAVTSNA-ALSNGKRAPE  122



>ref|XP_002734121.1| PREDICTED: pre-mRNA-processing factor 19 [Saccoglossus kowalevskii]
Length=511

 Score =   166 bits (419),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 82/128 (64%), Positives = 94/128 (73%), Gaps = 0/128 (0%)
 Frame = +1

Query  106  CSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVKPR  285
            CSIS EVPE PV+S  SG +FEKRLIE++ISD G  P+ GE L+ D ++ IK   +VKPR
Sbjct  5    CSISHEVPEHPVLSPTSGHIFEKRLIEKYISDNGTDPINGEDLSEDQLIDIKVSPVVKPR  64

Query  286  PVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKKER  465
            P  A SIP +L   Q EWD+ ML +F L QQL TARQELSHALYQHDAACRVIARL KE 
Sbjct  65   PPTATSIPAILKALQDEWDACMLHSFTLRQQLQTARQELSHALYQHDAACRVIARLTKEV  124

Query  466  DEARELLA  489
              ARE LA
Sbjct  125  MAAREALA  132



>emb|CDH60390.1| pre-mrna-processing factor 19 [Lichtheimia corymbifera JMRC:FSU:9682]
Length=506

 Score =   166 bits (419),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 85/137 (62%), Positives = 104/137 (76%), Gaps = 1/137 (1%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTG-KIV  276
            M C+ISGE PEEPVVS KSG LFEKRLIE++I+D+GK P+TG+ LT DD+V +K   + V
Sbjct  1    MFCAISGEAPEEPVVSVKSGHLFEKRLIEKYIADHGKDPITGDELTNDDLVSVKANPETV  60

Query  277  KPRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLK  456
            +PRP + +S+P +L   Q EWDS+ML +F L+QQ    RQELSHALYQ+DAA RVIARLK
Sbjct  61   RPRPPKLSSVPSLLSSLQNEWDSVMLESFTLKQQYQQVRQELSHALYQNDAATRVIARLK  120

Query  457  KERDEARELLAQADRQL  507
            KERD ARE LA     L
Sbjct  121  KERDSAREALANVQAHL  137



>ref|XP_002340280.1| cell cycle control protein (Cwf8), putative [Talaromyces stipitatus 
ATCC 10500]
 gb|EED22893.1| cell cycle control protein (Cwf8), putative [Talaromyces stipitatus 
ATCC 10500]
Length=492

 Score =   165 bits (418),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 83/148 (56%), Positives = 102/148 (69%), Gaps = 17/148 (11%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGL-----------------LFEKRLIERHISDYGKCPVTGE  228
            M C+ISGE P+ PVVSTKSG+                 +FEKRLIE +I++ GK PVTGE
Sbjct  1    MLCAISGEAPQVPVVSTKSGMSILRTIRLLSMLTCLGNVFEKRLIEAYIAENGKDPVTGE  60

Query  229  PLTMDDIVPIKTGKIVKPRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSH  408
             L+ DD+V +KT ++V+PRP    SIP +LG+FQ EWD+L L  + L Q L   RQELS 
Sbjct  61   DLSTDDLVELKTARVVRPRPPTLTSIPSLLGVFQEEWDALALETYTLRQALVQTRQELST  120

Query  409  ALYQHDAACRVIARLKKERDEARELLAQ  492
            ALYQHDAA RVIARL KERDEARE L++
Sbjct  121  ALYQHDAAVRVIARLTKERDEARETLSK  148



>emb|CCG82061.1| putative Cell cycle control protein [Taphrina deformans PYCC 
5710]
Length=683

 Score =   167 bits (422),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 78/133 (59%), Positives = 100/133 (75%), Gaps = 0/133 (0%)
 Frame = +1

Query  109  SISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVKPRP  288
            S SGE PE PV+S  SG +FEKRL++ +I+++GK PV GE L+ DDIV IKT +++KPRP
Sbjct  281  SFSGEAPEVPVLSRVSGSVFEKRLLDTYIAEHGKDPVNGEELSTDDIVEIKTSRVIKPRP  340

Query  289  VQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKKERD  468
              A SIP +L +FQ EWD+L L  + ++QQLH  RQELS ALYQHDAACRVIAR+ +ERD
Sbjct  341  PTATSIPSLLSIFQNEWDALALETYQVKQQLHQTRQELSTALYQHDAACRVIARITQERD  400

Query  469  EARELLAQADRQL  507
            EAR  L+   + L
Sbjct  401  EARSALSNLSQNL  413



>ref|XP_002145102.1| cell cycle control protein (Cwf8), putative [Talaromyces marneffei 
ATCC 18224]
 gb|EEA28587.1| cell cycle control protein (Cwf8), putative [Talaromyces marneffei 
ATCC 18224]
Length=878

 Score =   168 bits (426),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 81/131 (62%), Positives = 102/131 (78%), Gaps = 0/131 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M C+ISGE P+ PVVSTKSG +FEKRLIE +I++ GK PVTGE L+++D+V +KT ++V+
Sbjct  1    MLCAISGEAPQVPVVSTKSGNVFEKRLIEAYIAENGKDPVTGEDLSVEDLVELKTARVVR  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP    SIP +LG+FQ EWD+L L  + L Q L   RQELS ALYQHDAA RVIARL K
Sbjct  61   PRPPTLTSIPSLLGVFQEEWDALALETYTLRQALVQTRQELSTALYQHDAAVRVIARLTK  120

Query  460  ERDEARELLAQ  492
            ERDEAR+ L++
Sbjct  121  ERDEARDTLSK  131



>gb|ENN74961.1| hypothetical protein YQE_08537, partial [Dendroctonus ponderosae]
 gb|ERL92066.1| hypothetical protein D910_09388 [Dendroctonus ponderosae]
Length=501

 Score =   165 bits (418),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 98/130 (75%), Gaps = 0/130 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            + C+IS EVPE PVVS  SG +FE+R+IE++I + G  P++G+ L +D+++ IKT  IVK
Sbjct  3    LFCAISNEVPEHPVVSPSSGAVFERRIIEKYIQENGVDPISGKELAVDELIEIKTPPIVK  62

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            P+P  A SIP  L + Q EWD++ML +F   QQLHTARQELSHALYQHDAACRVIARL K
Sbjct  63   PKPPSATSIPATLKLLQDEWDAVMLYSFTQRQQLHTARQELSHALYQHDAACRVIARLNK  122

Query  460  ERDEARELLA  489
            E   ARE LA
Sbjct  123  EVTAAREALA  132



>ref|XP_007807925.1| cell cycle control protein [Metarhizium acridum CQMa 102]
 gb|EFY92314.1| cell cycle control protein [Metarhizium acridum CQMa 102]
Length=498

 Score =   165 bits (417),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 100/131 (76%), Gaps = 0/131 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M C ISGE P+EPVVS KSG+++EKRLIE++I+D G  P TGE LT DD++ I++ ++V+
Sbjct  1    MLCGISGEAPQEPVVSKKSGVVYEKRLIEQYINDNGTEPSTGEALTADDLLSIQSSRVVR  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP    SIP +L  FQ EWD+L L  + L++QL   R+EL+ ALYQHDAA RVIARL K
Sbjct  61   PRPPTLTSIPALLATFQNEWDNLALETYNLKEQLARTREELATALYQHDAAVRVIARLSK  120

Query  460  ERDEARELLAQ  492
            ERDEAR+ L++
Sbjct  121  ERDEARDSLSK  131



>ref|XP_005102524.1| PREDICTED: LOW QUALITY PROTEIN: pre-mRNA-processing factor 19-like 
[Aplysia californica]
Length=516

 Score =   165 bits (418),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 80/130 (62%), Positives = 97/130 (75%), Gaps = 0/130 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            + C+IS EVPE+PV+S  SG +FEKRLIE++I + G  PV+ E L  D ++P+KT  +VK
Sbjct  3    LCCAISNEVPEQPVISPVSGHVFEKRLIEKYIQENGVDPVSNEKLAADMLIPVKTSTVVK  62

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP  A SIP +L   Q EWD++ML +F L QQL TARQELSHALYQHDAACRVIARL K
Sbjct  63   PRPPSATSIPAILKSLQDEWDAVMLHSFTLRQQLQTARQELSHALYQHDAACRVIARLIK  122

Query  460  ERDEARELLA  489
            E   ARE LA
Sbjct  123  EVTAAREALA  132



>ref|XP_005835857.1| hypothetical protein GUITHDRAFT_93577 [Guillardia theta CCMP2712]
 gb|EKX48877.1| hypothetical protein GUITHDRAFT_93577 [Guillardia theta CCMP2712]
Length=500

 Score =   165 bits (417),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 84/159 (53%), Positives = 107/159 (67%), Gaps = 7/159 (4%)
 Frame = +1

Query  112  ISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVKPRPV  291
            +SGE P E  +S KSGL+FE+ LIE +I D+G CP+TGEPL+M+DI+ +K    VK RPV
Sbjct  1    MSGEAPREARMSIKSGLVFERSLIENYIQDHGTCPITGEPLSMEDIMEVKGNCYVKGRPV  60

Query  292  QAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKKERDE  471
            ++ SIPGML +FQ EW+  +     L + L   RQELSH LYQHDAACRVI+RL KERDE
Sbjct  61   KSTSIPGMLSIFQEEWEQTVRECVVLRKLLEQTRQELSHTLYQHDAACRVISRLMKERDE  120

Query  472  ARELLAQADRQ----LPSAAAMESADNATTLSNGKRAAE  576
            ARE L +A  +    LPSA A   A N    ++G  + E
Sbjct  121  AREALVKASAKGEFSLPSAGA---ASNGVKPTSGNDSME  156



>gb|EXK40135.1| pre-mRNA-processing factor 19 [Fusarium oxysporum f. sp. melonis 
26406]
Length=477

 Score =   164 bits (416),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 101/131 (77%), Gaps = 0/131 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M C ISGE P+EPVVS KSG+++EKRLI+++I+++G  P +GE LT DD++PI + +IV+
Sbjct  1    MLCGISGEAPQEPVVSKKSGVVYEKRLIDQYINEHGTEPDSGEALTTDDLLPIHSSRIVR  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP    SIP +L  FQ EWD+L L  + L++QL   R+EL+ ALYQHDAA RVIARL +
Sbjct  61   PRPPTLTSIPALLATFQNEWDALALETYNLKEQLARTREELATALYQHDAAVRVIARLTR  120

Query  460  ERDEARELLAQ  492
            ERDEAR+ L++
Sbjct  121  ERDEARDALSK  131



>gb|EXA45673.1| pre-mRNA-processing factor 19 [Fusarium oxysporum f. sp. pisi 
HDV247]
 gb|EXK87008.1| pre-mRNA-processing factor 19 [Fusarium oxysporum f. sp. raphani 
54005]
Length=477

 Score =   164 bits (415),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 101/131 (77%), Gaps = 0/131 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M C ISGE P+EPVVS KSG+++EKRLI+++I+++G  P +GE LT DD++PI + +IV+
Sbjct  1    MLCGISGEAPQEPVVSKKSGVVYEKRLIDQYINEHGTEPDSGEALTADDLLPIHSSRIVR  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP    SIP +L  FQ EWD+L L  + L++QL   R+EL+ ALYQHDAA RVIARL +
Sbjct  61   PRPPTLTSIPALLATFQNEWDALALETYNLKEQLARTREELATALYQHDAAVRVIARLTR  120

Query  460  ERDEARELLAQ  492
            ERDEAR+ L++
Sbjct  121  ERDEARDALSK  131



>gb|EWZ38067.1| pre-mRNA-processing factor 19 [Fusarium oxysporum Fo47]
Length=477

 Score =   164 bits (415),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 101/131 (77%), Gaps = 0/131 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M C ISGE P+EPVVS KSG+++EKRLI+++I+++G  P +GE LT DD++PI + +IV+
Sbjct  1    MLCGISGEAPQEPVVSKKSGVVYEKRLIDQYINEHGTEPDSGEALTADDLLPIHSSRIVR  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP    SIP +L  FQ EWD+L L  + L++QL   R+EL+ ALYQHDAA RVIARL +
Sbjct  61   PRPPTLTSIPALLATFQNEWDALALETYNLKEQLARTREELATALYQHDAAVRVIARLTR  120

Query  460  ERDEARELLAQ  492
            ERDEAR+ L++
Sbjct  121  ERDEARDALSK  131



>gb|EGU87554.1| hypothetical protein FOXB_01936 [Fusarium oxysporum Fo5176]
 gb|EMT70895.1| Cell cycle control protein cwf8 [Fusarium oxysporum f. sp. cubense 
race 4]
 gb|ENH66242.1| Cell cycle control protein cwf8 [Fusarium oxysporum f. sp. cubense 
race 1]
 gb|EXL72775.1| pre-mRNA-processing factor 19 [Fusarium oxysporum f. sp. conglutinans 
race 2 54008]
 gb|EXL97022.1| pre-mRNA-processing factor 19 [Fusarium oxysporum f. sp. cubense 
tropical race 4 54006]
 gb|EXM22532.1| pre-mRNA-processing factor 19 [Fusarium oxysporum f. sp. vasinfectum 
25433]
Length=477

 Score =   164 bits (415),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 101/131 (77%), Gaps = 0/131 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M C ISGE P+EPVVS KSG+++EKRLI+++I+++G  P +GE LT DD++PI + +IV+
Sbjct  1    MLCGISGEAPQEPVVSKKSGVVYEKRLIDQYINEHGTEPDSGEALTADDLLPIHSSRIVR  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP    SIP +L  FQ EWD+L L  + L++QL   R+EL+ ALYQHDAA RVIARL +
Sbjct  61   PRPPTLTSIPALLATFQNEWDALALETYNLKEQLARTREELATALYQHDAAVRVIARLTR  120

Query  460  ERDEARELLAQ  492
            ERDEAR+ L++
Sbjct  121  ERDEARDALSK  131



>emb|CCT69373.1| related to non-snRNP spliceosome component (pre-mRNA splicing 
protein PRP19) [Fusarium fujikuroi IMI 58289]
Length=477

 Score =   164 bits (415),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 101/131 (77%), Gaps = 0/131 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M C ISGE P+EPVVS KSG+++EKRLI+++I+++G  P +GE LT DD++PI + +IV+
Sbjct  1    MLCGISGEAPQEPVVSKKSGVVYEKRLIDQYINEHGTEPDSGEALTADDLLPIHSSRIVR  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP    SIP +L  FQ EWD+L L  + L++QL   R+EL+ ALYQHDAA RVIARL +
Sbjct  61   PRPPTLTSIPALLATFQNEWDALALETYNLKEQLARTREELATALYQHDAAVRVIARLTR  120

Query  460  ERDEARELLAQ  492
            ERDEAR+ L++
Sbjct  121  ERDEARDALSK  131



>ref|XP_004222194.1| WD domain G-beta repeat domain containing protein [Plasmodium 
cynomolgi strain B]
 dbj|GAB66247.1| WD domain G-beta repeat domain containing protein [Plasmodium 
cynomolgi strain B]
Length=456

 Score =   164 bits (414),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 73/136 (54%), Positives = 101/136 (74%), Gaps = 1/136 (1%)
 Frame = +1

Query  106  CSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVKPR  285
            C+ISG+ PEEPVVS K+G +FEKRLIE+HI +YG CPV+GE LT+ D+ P+K  K+VKPR
Sbjct  5    CTISGQTPEEPVVS-KTGYIFEKRLIEKHILNYGICPVSGEVLTLQDLYPLKNEKVVKPR  63

Query  286  PVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKKER  465
            P+ A+SIPG+L + Q EWDSL+   F L   ++  R +L+H+LYQ+DAA RVIA+L KE+
Sbjct  64   PITASSIPGLLSIMQTEWDSLISEMFTLRTHVNDIRNQLTHSLYQYDAATRVIAKLLKEK  123

Query  466  DEARELLAQADRQLPS  513
            +   E + +   Q+ S
Sbjct  124  NSYTEEIKKLKNQILS  139



>ref|XP_008712665.1| hypothetical protein HMPREF1541_09770 [Cyphellophora europaea 
CBS 101466]
 gb|ETN44895.1| hypothetical protein HMPREF1541_09770 [Cyphellophora europaea 
CBS 101466]
Length=473

 Score =   164 bits (415),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 80/148 (54%), Positives = 104/148 (70%), Gaps = 0/148 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M C+ISGE P+ PVVS+KSG ++EKRLIE +I++ G  P TGE LT+DD++ +KT + V+
Sbjct  1    MLCAISGEAPQVPVVSSKSGNVYEKRLIETYITENGTEPSTGESLTVDDLIDLKTPQSVR  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP    SIP +L +FQ EWD+L L  + L Q L   RQELS+ALYQ+DAA RVIARL K
Sbjct  61   PRPPTLTSIPSLLSVFQEEWDALALETYTLRQNLTQTRQELSNALYQNDAAIRVIARLTK  120

Query  460  ERDEARELLAQADRQLPSAAAMESADNA  543
            ERDEARE L + +   P+       D+A
Sbjct  121  ERDEAREALGKVNVAAPTNGDAMHVDSA  148



>gb|EWY91404.1| pre-mRNA-processing factor 19 [Fusarium oxysporum FOSC 3-a]
Length=477

 Score =   164 bits (415),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 101/131 (77%), Gaps = 0/131 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M C ISGE P+EPVVS KSG+++EKRLI+++I+++G  P +GE LT DD++PI + +IV+
Sbjct  1    MLCGISGEAPQEPVVSKKSGVVYEKRLIDQYINEHGTEPDSGEALTADDLLPIHSSRIVR  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP    SIP +L  FQ EWD+L L  + L++QL   R+EL+ ALYQHDAA RVIARL +
Sbjct  61   PRPPTLTSIPALLATFQNEWDALALETYNLKEQLARTREELATALYQHDAAVRVIARLTR  120

Query  460  ERDEARELLAQ  492
            ERDEAR+ L++
Sbjct  121  ERDEARDALSK  131



>gb|EFN66997.1| Pre-mRNA-processing factor 19 [Camponotus floridanus]
Length=504

 Score =   164 bits (415),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 99/130 (76%), Gaps = 0/130 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            ++C+IS EVPE PVVS  SG +FE+RL+E+++++ G  P+ G+ LT++ ++ IKT  IVK
Sbjct  3    LSCAISNEVPEHPVVSPVSGSIFERRLVEKYVAENGVDPINGKELTIEQLIDIKTTPIVK  62

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            P+P  A SIP +L   Q EWD++ML +F L QQL TARQELSHALYQHDAACRVIARL K
Sbjct  63   PKPPSATSIPAILKNLQDEWDAVMLHSFTLRQQLQTARQELSHALYQHDAACRVIARLTK  122

Query  460  ERDEARELLA  489
            E   ARE LA
Sbjct  123  EVTAAREALA  132



>gb|KHO01235.1| cell cycle control protein [Metarhizium album ARSEF 1941]
Length=476

 Score =   164 bits (414),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 98/131 (75%), Gaps = 0/131 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M C ISGE P+EPVVS KSG+++EKRLIE++I D G  P TGE LT DD++ I++ +IV+
Sbjct  1    MLCGISGEAPQEPVVSKKSGVVYEKRLIEQYIKDNGTEPGTGETLTADDLLSIQSSRIVR  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP    SIP +L  FQ EWD+  L  + +++QL   R+EL+ ALYQHDAA RVIARL K
Sbjct  61   PRPPTLTSIPALLATFQNEWDNFALETYNMKEQLARTREELATALYQHDAAVRVIARLSK  120

Query  460  ERDEARELLAQ  492
            ERDEARE L++
Sbjct  121  ERDEAREALSK  131



>emb|CEJ91799.1| Putative Cell cycle control protein cwf8 [Torrubiella hemipterigena]
Length=476

 Score =   164 bits (414),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 100/131 (76%), Gaps = 0/131 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M C ISGE P+EPV S KSG+++EKRLIE++I+++G  P TG+ LT DD++PI + +IV+
Sbjct  1    MLCGISGETPQEPVASKKSGIVYEKRLIEQYINEHGTEPNTGDALTSDDLLPITSSRIVR  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP    SIP +L  FQ EWD+L L  + L++QL   R+EL+ ALYQHDAA RVIARL +
Sbjct  61   PRPPALTSIPALLSTFQQEWDNLALETYNLKEQLARTREELATALYQHDAAVRVIARLTR  120

Query  460  ERDEARELLAQ  492
            ERDEAR+ L++
Sbjct  121  ERDEARDSLSK  131



>gb|KGQ10077.1| Pre-mRNA-processing factor 19 [Beauveria bassiana D1-5]
Length=482

 Score =   164 bits (414),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 75/131 (57%), Positives = 99/131 (76%), Gaps = 0/131 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M C ISGE P+EPV S KSG+++EKRLIE++I+++G  P TGE LT +D++PI + +IV+
Sbjct  1    MLCGISGEAPQEPVASKKSGVVYEKRLIEQYINEHGTEPSTGEALTAEDLLPINSSRIVR  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP    SIP +L  FQ EWDSL L  + L +QL   R+EL+ ALYQHDAA RVIARL K
Sbjct  61   PRPPTLTSIPALLATFQNEWDSLALETYNLREQLARTREELATALYQHDAAVRVIARLTK  120

Query  460  ERDEARELLAQ  492
            ER+EAR+ L++
Sbjct  121  ERNEARDALSK  131



>gb|ENH86632.1| cell cycle control protein [Colletotrichum orbiculare MAFF 240422]
Length=477

 Score =   164 bits (414),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 97/131 (74%), Gaps = 0/131 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M C+ISGE P++PV S KSG +F+KRLIE++I + G  P+TGE LT DD++P+    +V+
Sbjct  1    MLCAISGEAPQQPVASKKSGTVFDKRLIEKYIEENGTEPITGEALTTDDLLPLTQSHVVR  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP    SIP +L  FQ EWD+L L  F L++QL   R+EL+ ALYQHDAA RVIARL +
Sbjct  61   PRPPTLTSIPALLATFQNEWDALALETFNLKEQLARTREELATALYQHDAAVRVIARLTR  120

Query  460  ERDEARELLAQ  492
            ERDEARE L++
Sbjct  121  ERDEAREALSK  131



>ref|XP_008730521.1| hypothetical protein G647_07987 [Cladophialophora carrionii CBS 
160.54]
 gb|ETI21640.1| hypothetical protein G647_07987 [Cladophialophora carrionii CBS 
160.54]
Length=477

 Score =   164 bits (414),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 78/133 (59%), Positives = 98/133 (74%), Gaps = 0/133 (0%)
 Frame = +1

Query  100  MNCSISGEVPEEPVVSTKSGLLFEKRLIERHISDYGKCPVTGEPLTMDDIVPIKTGKIVK  279
            M C+ISGE P+ PV S KSG ++EKRLIE +IS+ G  P TGE L+++D++ +K+  +V 
Sbjct  1    MLCAISGEAPQVPVASRKSGNIYEKRLIEAYISENGTEPTTGETLSVEDLIDLKSPHVVY  60

Query  280  PRPVQAASIPGMLGMFQIEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK  459
            PRP Q  SIP ML  FQ EWD+L L  + L+Q LH ARQELS ALY++DAA RVIA+L K
Sbjct  61   PRPPQMTSIPAMLSFFQNEWDALALQTYTLQQNLHQARQELSTALYENDAAVRVIAQLTK  120

Query  460  ERDEARELLAQAD  498
            ERDEAR  LAQ D
Sbjct  121  ERDEARAALAQID  133



Lambda      K        H        a         alpha
   0.315    0.130    0.367    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 696633491985