BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002B16

Length=547
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|EPS65822.1|  hypothetical protein M569_08957                         162   1e-46   Genlisea aurea
ref|XP_010250479.1|  PREDICTED: 40S ribosomal protein S27-2             159   4e-46   Nelumbo nucifera [Indian lotus]
ref|XP_010279570.1|  PREDICTED: 40S ribosomal protein S27-2-like        158   9e-46   Nelumbo nucifera [Indian lotus]
ref|XP_002273119.1|  PREDICTED: 40S ribosomal protein S27-2             156   2e-45   Vitis vinifera
ref|XP_009383858.1|  PREDICTED: 40S ribosomal protein S27-2-like        156   2e-45   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008780838.1|  PREDICTED: 40S ribosomal protein S27-2             155   3e-45   Phoenix dactylifera
gb|ABA40465.1|  ribosomal protein S27-like protein                      155   3e-45   Solanum tuberosum [potatoes]
ref|XP_004228542.1|  PREDICTED: 40S ribosomal protein S27-2             155   3e-45   Solanum lycopersicum
ref|XP_009410582.1|  PREDICTED: 40S ribosomal protein S27-2-like        155   5e-45   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB22717.1|  hypothetical protein B456_004G062400                    155   1e-44   Gossypium raimondii
ref|XP_009384308.1|  PREDICTED: 40S ribosomal protein S27-2             154   1e-44   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009393881.1|  PREDICTED: 40S ribosomal protein S27-2-like        154   1e-44   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006348533.1|  PREDICTED: 40S ribosomal protein S27-2-like ...    154   1e-44   Solanum tuberosum [potatoes]
ref|XP_009595222.1|  PREDICTED: 40S ribosomal protein S27-2             154   1e-44   Nicotiana tomentosiformis
emb|CBI21255.3|  unnamed protein product                                156   1e-44   Vitis vinifera
gb|EYU46714.1|  hypothetical protein MIMGU_mgv1a016569mg                154   2e-44   Erythranthe guttata [common monkey flower]
gb|EYU26951.1|  hypothetical protein MIMGU_mgv1a017251mg                154   2e-44   Erythranthe guttata [common monkey flower]
ref|XP_006348532.1|  PREDICTED: 40S ribosomal protein S27-2-like        153   2e-44   Solanum tuberosum [potatoes]
emb|CBI29279.3|  unnamed protein product                                153   2e-44   Vitis vinifera
ref|XP_006292074.1|  hypothetical protein CARUB_v10018269mg             154   2e-44   
ref|XP_002512685.1|  40S ribosomal protein S27, putative                153   2e-44   Ricinus communis
ref|XP_010942333.1|  PREDICTED: 40S ribosomal protein S27-2-like        153   3e-44   Elaeis guineensis
ref|XP_002277329.1|  PREDICTED: 40S ribosomal protein S27-2-like        153   3e-44   Vitis vinifera
ref|XP_007161552.1|  hypothetical protein PHAVU_001G079100g             152   5e-44   Phaseolus vulgaris [French bean]
ref|XP_004140655.1|  PREDICTED: 40S ribosomal protein S27-2-like        155   5e-44   
ref|XP_010530726.1|  PREDICTED: 40S ribosomal protein S27-2             152   5e-44   Tarenaya hassleriana [spider flower]
ref|XP_003593745.1|  Ribosomal protein S27                              152   5e-44   Medicago truncatula
ref|XP_008459925.1|  PREDICTED: 40S ribosomal protein S27-2             152   5e-44   Cucumis melo [Oriental melon]
ref|NP_001236263.1|  uncharacterized protein LOC100499804               152   8e-44   Glycine max [soybeans]
ref|XP_011073957.1|  PREDICTED: 40S ribosomal protein S27-2             152   8e-44   Sesamum indicum [beniseed]
ref|XP_007223843.1|  hypothetical protein PRUPE_ppa014109mg             152   9e-44   Prunus persica
ref|XP_004497146.1|  PREDICTED: 40S ribosomal protein S27-2-like        151   1e-43   Cicer arietinum [garbanzo]
ref|XP_006295333.1|  hypothetical protein CARUB_v10024423mg             151   1e-43   Capsella rubella
ref|XP_009598692.1|  PREDICTED: 40S ribosomal protein S27-2-like        151   1e-43   Nicotiana tomentosiformis
ref|XP_006852307.1|  hypothetical protein AMTR_s00049p00194290          151   1e-43   Amborella trichopoda
ref|NP_191670.1|  40S ribosomal protein S27-2                           151   2e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008369601.1|  PREDICTED: 40S ribosomal protein S27-2             150   2e-43   Malus domestica [apple tree]
gb|KGN46405.1|  hypothetical protein Csa_6G091290                       152   3e-43   Cucumis sativus [cucumbers]
ref|XP_003548832.1|  PREDICTED: 40S ribosomal protein S27-2             150   3e-43   
ref|XP_004494250.1|  PREDICTED: 40S ribosomal protein S27-2-like        150   3e-43   Cicer arietinum [garbanzo]
ref|XP_010506530.1|  PREDICTED: 40S ribosomal protein S27-2-like        150   3e-43   Camelina sativa [gold-of-pleasure]
ref|XP_010695943.1|  PREDICTED: 40S ribosomal protein S27-2             150   3e-43   
emb|CDY53891.1|  BnaA03g56930D                                          150   3e-43   Brassica napus [oilseed rape]
ref|XP_010508123.1|  PREDICTED: 40S ribosomal protein S27-2-like        150   4e-43   Camelina sativa [gold-of-pleasure]
ref|XP_010523717.1|  PREDICTED: 40S ribosomal protein S27-2-like        150   4e-43   Tarenaya hassleriana [spider flower]
ref|XP_002876593.1|  ARS27A                                             150   5e-43   
gb|EPS62677.1|  hypothetical protein M569_12113                         150   5e-43   Genlisea aurea
ref|XP_004310130.1|  PREDICTED: 40S ribosomal protein S27-2             149   6e-43   Fragaria vesca subsp. vesca
ref|XP_010523008.1|  PREDICTED: 40S ribosomal protein S27-2-like        149   6e-43   Tarenaya hassleriana [spider flower]
ref|XP_007032056.1|  Ribosomal protein S27                              149   6e-43   Theobroma cacao [chocolate]
gb|ABK21973.1|  unknown                                                 149   7e-43   Picea sitchensis
ref|XP_010442209.1|  PREDICTED: 40S ribosomal protein S27-2-like        149   7e-43   Camelina sativa [gold-of-pleasure]
gb|EYU40953.1|  hypothetical protein MIMGU_mgv1a017257mg                149   7e-43   Erythranthe guttata [common monkey flower]
ref|XP_006446889.1|  hypothetical protein CICLE_v10017335mg             149   8e-43   Citrus clementina [clementine]
ref|XP_006279439.1|  hypothetical protein CARUB_v10007905mg             149   9e-43   
emb|CDY54522.1|  BnaC07g49260D                                          150   9e-43   Brassica napus [oilseed rape]
ref|XP_004297596.1|  PREDICTED: 40S ribosomal protein S27-2-like        149   9e-43   Fragaria vesca subsp. vesca
ref|XP_010102910.1|  40S ribosomal protein S27-2                        153   9e-43   
ref|XP_008390175.1|  PREDICTED: 40S ribosomal protein S27-2-like        149   9e-43   Malus domestica [apple tree]
ref|XP_009773562.1|  PREDICTED: 40S ribosomal protein S27-2-like        149   9e-43   Nicotiana sylvestris
ref|XP_010482041.1|  PREDICTED: 40S ribosomal protein S27-2-like        150   1e-42   Camelina sativa [gold-of-pleasure]
ref|XP_007030948.1|  Ribosomal protein S27                              149   1e-42   Theobroma cacao [chocolate]
emb|CDP18996.1|  unnamed protein product                                149   1e-42   Coffea canephora [robusta coffee]
gb|ABK20991.1|  unknown                                                 148   2e-42   Picea sitchensis
emb|CAB71041.1|  ribosomal protein S27                                  148   2e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002297884.1|  ribosomal protein S27                              148   2e-42   Populus trichocarpa [western balsam poplar]
emb|CDY35762.1|  BnaC02g38320D                                          149   3e-42   Brassica napus [oilseed rape]
ref|XP_002304634.2|  hypothetical protein POPTR_0003s15960g             149   3e-42   
ref|XP_007049127.1|  Ribosomal protein S27                              147   3e-42   Theobroma cacao [chocolate]
emb|CDY45678.1|  BnaCnng13430D                                          149   4e-42   Brassica napus [oilseed rape]
gb|KJB08657.1|  hypothetical protein B456_001G096100                    148   4e-42   Gossypium raimondii
gb|KFK37361.1|  hypothetical protein AALP_AA4G246600                    147   5e-42   Arabis alpina [alpine rockcress]
gb|ABK94313.1|  unknown                                                 147   5e-42   Populus trichocarpa [western balsam poplar]
emb|CDY45920.1|  BnaAnng08010D                                          149   5e-42   Brassica napus [oilseed rape]
gb|AGU28439.1|  ribosomal protein S27                                   147   6e-42   Sinapis alba [bai jie]
gb|ACH63219.1|  ribosomal protein S27-like protein                      147   6e-42   Rheum australe [Himalayan rhubarb]
emb|CDY27365.1|  BnaC04g50400D                                          147   6e-42   Brassica napus [oilseed rape]
ref|XP_009129700.1|  PREDICTED: 40S ribosomal protein S27-2             147   6e-42   Brassica rapa
ref|XP_006279437.1|  hypothetical protein CARUB_v10007902mg             147   8e-42   
ref|XP_009133746.1|  PREDICTED: 40S ribosomal protein S27-2-like        146   9e-42   Brassica rapa
ref|XP_006418083.1|  hypothetical protein EUTSA_v10009228mg             146   9e-42   Eutrema salsugineum [saltwater cress]
ref|XP_007226686.1|  hypothetical protein PRUPE_ppa020777mg             146   1e-41   
gb|EYU40950.1|  hypothetical protein MIMGU_mgv1a021290mg                146   2e-41   Erythranthe guttata [common monkey flower]
emb|CDY37058.1|  BnaA04g26360D                                          145   2e-41   Brassica napus [oilseed rape]
gb|KHN28606.1|  40S ribosomal protein S27-2                             145   2e-41   Glycine soja [wild soybean]
gb|ABK96570.1|  unknown                                                 145   2e-41   Populus trichocarpa x Populus deltoides
ref|XP_006395228.1|  hypothetical protein EUTSA_v10005209mg             145   2e-41   Eutrema salsugineum [saltwater cress]
ref|XP_002880192.1|  predicted protein                                  145   3e-41   
ref|XP_002865574.1|  ribosomal protein S27                              145   3e-41   Arabidopsis lyrata subsp. lyrata
emb|CDY67291.1|  BnaCnng54330D                                          146   3e-41   Brassica napus [oilseed rape]
ref|XP_003083456.1|  40s ribosomal protein S27 (ISS)                    145   3e-41   
gb|EAY85847.1|  hypothetical protein OsI_07209                          145   4e-41   Oryza sativa Indica Group [Indian rice]
emb|CDY52337.1|  BnaA09g38860D                                          145   4e-41   Brassica napus [oilseed rape]
emb|CDY19967.1|  BnaA09g02840D                                          145   4e-41   Brassica napus [oilseed rape]
ref|XP_001755320.1|  predicted protein                                  145   4e-41   
gb|KIZ01143.1|  40S ribosomal protein S27-2                             145   5e-41   Monoraphidium neglectum
gb|KHG04899.1|  40S ribosomal S27-2 -like protein                       145   5e-41   Gossypium arboreum [tree cotton]
emb|CEG00244.1|  Ribosomal protein S27e, zinc-binding domain            145   5e-41   Ostreococcus tauri
ref|XP_003060837.1|  predicted protein                                  144   6e-41   Micromonas pusilla CCMP1545
ref|XP_009405158.1|  PREDICTED: 40S ribosomal protein S27-3-like        144   6e-41   
ref|XP_010090115.1|  Protein Brevis radix-like 4                        155   6e-41   
ref|XP_003574974.1|  PREDICTED: 40S ribosomal protein S27-like          144   6e-41   Brachypodium distachyon [annual false brome]
ref|NP_001046847.1|  Os02g0478700                                       144   8e-41   
ref|XP_001767364.1|  predicted protein                                  144   8e-41   
gb|KJB82614.1|  hypothetical protein B456_013G205000                    144   8e-41   Gossypium raimondii
emb|CDY18908.1|  BnaC04g04420D                                          145   9e-41   Brassica napus [oilseed rape]
ref|XP_003579638.1|  PREDICTED: 40S ribosomal protein S27               144   1e-40   Brachypodium distachyon [annual false brome]
gb|AAM66954.1|  ribosomal protein S27                                   144   1e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006652184.1|  PREDICTED: 40S ribosomal protein S27-like          143   2e-40   Oryza brachyantha
ref|XP_002502728.1|  predicted protein                                  143   2e-40   Micromonas commoda
ref|XP_001774611.1|  predicted protein                                  142   4e-40   
ref|XP_001696854.1|  ribosomal protein S27 isoform A, component o...    142   4e-40   Chlamydomonas reinhardtii
ref|NP_001105614.1|  ribosomal protein S27                              142   5e-40   Zea mays [maize]
ref|NP_001052512.1|  Os04g0346100                                       142   5e-40   
gb|EMS47313.1|  40S ribosomal protein S27                               142   6e-40   Triticum urartu
ref|XP_006648639.1|  PREDICTED: 40S ribosomal protein S27-like          142   7e-40   
ref|NP_182095.1|  40S ribosomal protein S27-1                           142   7e-40   Arabidopsis thaliana [mouse-ear cress]
gb|EMS47163.1|  40S ribosomal protein S27                               144   1e-39   Triticum urartu
ref|XP_004952504.1|  PREDICTED: 40S ribosomal protein S27-like          141   1e-39   Setaria italica
ref|NP_199604.1|  40S ribosomal protein S27-3                           141   1e-39   Arabidopsis thaliana [mouse-ear cress]
emb|CAH66540.1|  H0209H04.7                                             140   3e-39   Oryza sativa [red rice]
ref|XP_002953520.1|  component of 80S ribosome and 40S small subunit    140   3e-39   Volvox carteri f. nagariensis
emb|CDX86334.1|  BnaA06g30510D                                          152   3e-39   
ref|XP_005651549.1|  hypothetical protein COCSUDRAFT_27353              140   4e-39   Coccomyxa subellipsoidea C-169
ref|XP_006652234.1|  PREDICTED: 40S ribosomal protein S27-like          140   4e-39   Oryza brachyantha
ref|XP_008348423.1|  PREDICTED: 40S ribosomal protein S27-2             139   8e-39   
ref|XP_001421547.1|  Ribosomal protein S27, component of cytosoli...    139   9e-39   Ostreococcus lucimarinus CCE9901
ref|XP_008388226.1|  PREDICTED: 40S ribosomal protein S27-2-like        139   9e-39   
ref|XP_002960333.1|  hypothetical protein SELMODRAFT_163947             138   2e-38   Selaginella moellendorffii
gb|AAV50037.1|  ribosomal protein S27                                   138   2e-38   Saccharum hybrid cultivar Pindar
ref|NP_001149602.1|  40S ribosomal protein S27                          137   3e-38   
ref|XP_007512212.1|  40S ribosomal protein S27                          139   3e-38   Bathycoccus prasinos
ref|XP_005651550.1|  ribosomal protein S27 isoform B component of...    137   4e-38   Coccomyxa subellipsoidea C-169
ref|XP_008372447.1|  PREDICTED: 40S ribosomal protein S27-2-like        137   5e-38   
emb|CDP18146.1|  unnamed protein product                                135   1e-37   Coffea canephora [robusta coffee]
ref|XP_006397752.1|  hypothetical protein EUTSA_v10001700mg             135   2e-37   Eutrema salsugineum [saltwater cress]
ref|XP_005847363.1|  40S ribosomal protein S27                          134   6e-37   Chlorella variabilis
sp|P47903.1|RS27_CHLRE  RecName: Full=40S ribosomal protein S27         134   6e-37   Chlamydomonas reinhardtii
ref|XP_002878361.1|  predicted protein                                  132   5e-36   Arabidopsis lyrata subsp. lyrata
ref|XP_010473739.1|  PREDICTED: 40S ribosomal protein S27-1-like        131   2e-35   
ref|XP_008390588.1|  PREDICTED: 40S ribosomal protein S27-3-like        130   4e-35   
ref|XP_011396013.1|  40S ribosomal protein S27-2                        135   5e-35   Auxenochlorella protothecoides
gb|KIY98071.1|  40S ribosomal protein S27-1                             129   8e-35   Monoraphidium neglectum
ref|XP_009804103.1|  PREDICTED: 40S ribosomal protein S27-2 isofo...    128   1e-34   Nicotiana sylvestris
ref|XP_007411417.1|  hypothetical protein MELLADRAFT_87975              126   7e-34   Melampsora larici-populina 98AG31
ref|XP_010482042.1|  PREDICTED: 40S ribosomal protein S27-2-like        126   9e-34   Camelina sativa [gold-of-pleasure]
gb|KIJ68657.1|  hypothetical protein HYDPIDRAFT_173325                  125   1e-33   Hydnomerulius pinastri MD-312
ref|XP_005758635.1|  hypothetical protein EMIHUDRAFT_425447             125   1e-33   Emiliania huxleyi CCMP1516
ref|XP_003332938.1|  40S ribosomal protein S27                          125   3e-33   Puccinia graminis f. sp. tritici CRL 75-36-700-3
gb|EMS20867.1|  40S ribosomal protein s27                               124   5e-33   Rhodotorula toruloides NP11
ref|XP_010439108.1|  PREDICTED: 40S ribosomal protein S27-2-like        124   7e-33   Camelina sativa [gold-of-pleasure]
gb|KIY51346.1|  hypothetical protein FISHEDRAFT_64347                   124   7e-33   Fistulina hepatica ATCC 64428
gb|EJU00994.1|  40S ribosomal protein S27                               123   9e-33   Dacryopinax primogenitus
ref|XP_004241662.1|  PREDICTED: 40S ribosomal protein S27-1-like ...    124   1e-32   Solanum lycopersicum
ref|XP_004241663.2|  PREDICTED: 40S ribosomal protein S27-3-like ...    124   1e-32   Solanum lycopersicum
ref|XP_007336756.1|  ribosomal protein S27                              123   1e-32   
emb|CBJ26210.1|  Ribosomal protein S27                                  123   1e-32   Ectocarpus siliculosus
gb|KDQ12784.1|  hypothetical protein BOTBODRAFT_189045                  124   1e-32   Botryobasidium botryosum FD-172 SS1
gb|KIM84521.1|  hypothetical protein PILCRDRAFT_96691                   123   1e-32   Piloderma croceum F 1598
gb|KIK71317.1|  hypothetical protein GYMLUDRAFT_66525                   123   2e-32   Gymnopus luxurians FD-317 M1
ref|NP_001118871.1|  zinc-binding ribosomal protein family protein      122   2e-32   Arabidopsis thaliana [mouse-ear cress]
gb|KJB18512.1|  hypothetical protein B456_003G057100                    122   2e-32   Gossypium raimondii
ref|XP_008619499.1|  40S ribosomal protein                              122   3e-32   Saprolegnia diclina VS20
ref|XP_006366283.1|  PREDICTED: 40S ribosomal protein S27-2-like        122   4e-32   Solanum tuberosum [potatoes]
ref|XP_010418599.1|  PREDICTED: 40S ribosomal protein S27-1-like        122   4e-32   Camelina sativa [gold-of-pleasure]
ref|XP_008870490.1|  40S ribosomal protein S27-like protein             121   5e-32   Aphanomyces invadans
ref|XP_007378532.1|  40S ribosomal protein S27                          121   5e-32   Punctularia strigosozonata HHB-11173 SS5
gb|KIJ45559.1|  hypothetical protein M422DRAFT_29684                    121   6e-32   Sphaerobolus stellatus SS14
gb|KII93407.1|  hypothetical protein PLICRDRAFT_35612                   121   6e-32   Plicaturopsis crispa FD-325 SS-3
ref|XP_001874254.1|  40S ribosomal protein S27                          121   6e-32   Laccaria bicolor S238N-H82
gb|EPB84084.1|  40S ribosomal protein S27                               121   6e-32   Mucor circinelloides f. circinelloides 1006PhL
ref|XP_001828417.1|  40S ribosomal protein S27                          121   6e-32   Coprinopsis cinerea okayama7#130
gb|KIL71015.1|  hypothetical protein M378DRAFT_183546                   121   6e-32   Amanita muscaria Koide BX008
ref|XP_005539223.1|  40S ribosomal protein S27                          121   7e-32   Cyanidioschyzon merolae strain 10D
ref|XP_002452082.1|  hypothetical protein SORBIDRAFT_04g018990          121   7e-32   
emb|CEP11719.1|  hypothetical protein                                   129   7e-32   Parasitella parasitica
ref|XP_007312861.1|  hypothetical protein SERLADRAFT_376403             121   7e-32   Serpula lacrymans var. lacrymans S7.9
gb|KIY67579.1|  40S ribosomal protein S27                               121   8e-32   Cylindrobasidium torrendii FP15055 ss-10
dbj|GAN04920.1|  glycerol-3-phosphate 1-acyltransferase                 129   1e-31   Mucor ambiguus
gb|EUC67120.1|  40S ribosomal protein S27                               120   1e-31   Rhizoctonia solani AG-3 Rhs1AP
emb|CEG74698.1|  Putative 40S ribosomal protein S27                     120   1e-31   Rhizopus microsporus
emb|CEP15743.1|  hypothetical protein                                   129   1e-31   Parasitella parasitica
gb|KIK49593.1|  hypothetical protein CY34DRAFT_797038                   120   1e-31   Suillus luteus UH-Slu-Lm8-n1
dbj|GAN04500.1|  acyltransferase                                        129   1e-31   Mucor ambiguus
gb|EPB83252.1|  hypothetical protein HMPREF1544_09996                   129   1e-31   Mucor circinelloides f. circinelloides 1006PhL
gb|KIJ21531.1|  hypothetical protein PAXINDRAFT_165006                  120   1e-31   Paxillus involutus ATCC 200175
gb|KIO26317.1|  hypothetical protein M407DRAFT_243776                   120   1e-31   Tulasnella calospora MUT 4182
ref|XP_009842102.1|  40S ribosomal protein S27-like protein             120   1e-31   Aphanomyces astaci
ref|XP_006446890.1|  hypothetical protein CICLE_v10017799mg             120   1e-31   
emb|CCA68832.1|  probable 40S ribosomal protein S27                     120   1e-31   Serendipita indica DSM 11827
gb|KDQ54756.1|  hypothetical protein JAAARDRAFT_347609                  120   2e-31   Jaapia argillacea MUCL 33604
emb|CEG63847.1|  Putative 40S ribosomal protein S27                     120   2e-31   Rhizopus microsporus
gb|KIK98514.1|  hypothetical protein PAXRUDRAFT_823809                  120   2e-31   Paxillus rubicundulus Ve08.2h10
gb|KIK26487.1|  hypothetical protein PISMIDRAFT_28413                   120   2e-31   Pisolithus microcarpus 441
ref|XP_009269072.1|  40S ribosomal protein S27                          120   2e-31   Wallemia ichthyophaga EXF-994
emb|CEG76972.1|  Putative 40S ribosomal protein S27                     120   2e-31   Rhizopus microsporus
emb|CCO26109.1|  40S ribosomal protein S27                              120   2e-31   Rhizoctonia solani AG-1 IB
ref|XP_006454760.1|  40S ribosomal protein S27                          119   3e-31   Agaricus bisporus var. bisporus H97
ref|XP_009541432.1|  hypothetical protein HETIRDRAFT_378607             119   3e-31   Heterobasidion irregulare TC 32-1
ref|XP_002176067.1|  40S ribosomal protein S27                          119   3e-31   Schizosaccharomyces japonicus yFS275
gb|KIK05557.1|  hypothetical protein K443DRAFT_675114                   119   3e-31   Laccaria amethystina LaAM-08-1
ref|XP_007842411.1|  40s ribosomal protein s27                          119   4e-31   
gb|KIM19626.1|  hypothetical protein M408DRAFT_18707                    119   4e-31   Serendipita vermifera MAFF 305830
ref|XP_009804519.1|  PREDICTED: 40S ribosomal protein S27-3-like        119   4e-31   Nicotiana sylvestris
ref|XP_005711226.1|  unnamed protein product                            119   4e-31   Chondrus crispus [carageen]
gb|EXX70688.1|  ribosomal 40S subunit protein S27B                      119   4e-31   Rhizophagus irregularis DAOM 197198w
gb|EIE92409.1|  40S ribosomal protein S27                               119   4e-31   Rhizopus delemar RA 99-880
ref|XP_002173548.1|  40S ribosomal protein S27                          119   5e-31   Schizosaccharomyces japonicus yFS275
ref|XP_007230626.1|  PREDICTED: 40S ribosomal protein S27-like          119   5e-31   Astyanax mexicanus [blind cave fish]
ref|XP_003384020.1|  PREDICTED: 40S ribosomal protein S27               119   6e-31   Amphimedon queenslandica
ref|XP_003038484.1|  40S ribosomal protein S27                          119   6e-31   Schizophyllum commune H4-8
emb|CDH50073.1|  40s ribosomal protein s27                              120   7e-31   Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_011388013.1|  ribosomal 40S subunit protein S27                  118   7e-31   Ustilago maydis 521
ref|XP_007246542.1|  PREDICTED: 40S ribosomal protein S27-like          118   7e-31   Astyanax mexicanus [blind cave fish]
ref|XP_007763247.1|  ribosomal protein S27                              119   7e-31   Coniophora puteana RWD-64-598 SS2
ref|XP_009038097.1|  hypothetical protein AURANDRAFT_27981              118   8e-31   Aureococcus anophagefferens
ref|XP_009619646.1|  PREDICTED: 40S ribosomal protein S27-3-like        119   8e-31   
gb|KDR72772.1|  hypothetical protein GALMADRAFT_73283                   118   8e-31   Galerina marginata CBS 339.88
emb|CCI43109.1|  unnamed protein product                                118   9e-31   Albugo candida
ref|XP_007298188.1|  40S ribosomal protein S27                          118   9e-31   Stereum hirsutum FP-91666 SS1
ref|XP_007390302.1|  hypothetical protein PHACADRAFT_247057             118   9e-31   Phanerochaete carnosa HHB-10118-sp
ref|NP_001187087.1|  40S ribosomal protein S27-1                        118   1e-30   Ictalurus punctatus
gb|KIK41858.1|  hypothetical protein CY34DRAFT_805556                   118   1e-30   Suillus luteus UH-Slu-Lm8-n1
gb|EJK74356.1|  hypothetical protein THAOC_03970                        119   1e-30   Thalassiosira oceanica
gb|KJA26001.1|  hypothetical protein HYPSUDRAFT_36856                   118   1e-30   Hypholoma sublateritium FD-334 SS-4
gb|KIP05171.1|  hypothetical protein PHLGIDRAFT_92491                   118   1e-30   Phlebiopsis gigantea 11061_1 CR5-6
ref|XP_007265907.1|  40S ribosomal protein S27                          118   1e-30   Fomitiporia mediterranea MF3/22
ref|XP_007324980.1|  hypothetical protein AGABI1DRAFT_32795             117   1e-30   Agaricus bisporus var. burnettii JB137-S8
ref|XP_010892700.1|  PREDICTED: 40S ribosomal protein S27               118   1e-30   
gb|KDN53570.1|  putative 40S ribosomal protein S27                      117   1e-30   Tilletiaria anomala UBC 951
ref|XP_002293775.1|  RS27, ribosomal protein 27 40S small ribosom...    117   2e-30   Thalassiosira pseudonana CCMP1335
gb|KIM48382.1|  hypothetical protein M413DRAFT_230288                   117   2e-30   Hebeloma cylindrosporum h7
emb|CDQ93017.1|  unnamed protein product                                119   2e-30   Oncorhynchus mykiss
ref|XP_002473543.1|  40S ribosomal protein S27                          117   2e-30   
gb|ACH71004.1|  ribosomal protein S27-2                                 117   2e-30   Salmo salar
ref|XP_006959507.1|  40S ribosomal protein S27                          117   2e-30   Wallemia mellicola CBS 633.66
ref|XP_006629108.1|  PREDICTED: 40S ribosomal protein S27-like          120   2e-30   
gb|KDR84803.1|  hypothetical protein GALMADRAFT_290729                  117   2e-30   Galerina marginata CBS 339.88
ref|XP_004334523.1|  ribosomal protein s27, putative                    117   2e-30   Acanthamoeba castellanii str. Neff
ref|XP_784036.1|  PREDICTED: 40S ribosomal protein S27-like isofo...    117   2e-30   Strongylocentrotus purpuratus [purple urchin]
emb|CCM01651.1|  predicted protein                                      119   3e-30   Fibroporia radiculosa
ref|NP_001129418.1|  ribosomal protein S27-1                            117   3e-30   Acyrthosiphon pisum
ref|XP_005627537.1|  PREDICTED: 40S ribosomal protein S27-like          117   3e-30   Canis lupus familiaris [dogs]
emb|CCF53551.1|  probable 40S ribosomal protein S27                     117   3e-30   Ustilago hordei
gb|KDR18843.1|  40S ribosomal protein S27                               117   3e-30   Zootermopsis nevadensis
gb|ABM55459.1|  ribosomal protein S27                                   117   3e-30   Xenopsylla cheopis
ref|XP_004541310.1|  PREDICTED: 40S ribosomal protein S27-like is...    117   3e-30   
ref|XP_007526209.1|  PREDICTED: 40S ribosomal protein S27-like          117   4e-30   Erinaceus europaeus [common hedgehog]
emb|CCX29534.1|  Similar to 40S ribosomal protein S27; acc. no. Q...    116   4e-30   Pyronema omphalodes CBS 100304
ref|XP_007861244.1|  40S ribosomal protein S27                          116   4e-30   Gloeophyllum trabeum ATCC 11539
gb|ACO07998.1|  40S ribosomal protein S27                               116   4e-30   Oncorhynchus mykiss
gb|KDE02345.1|  40S ribosomal protein S27                               117   4e-30   Microbotryum lychnidis-dioicae p1A1 Lamole
dbj|BAN20548.1|  ribosomal protein S27                                  116   4e-30   Riptortus pedestris
ref|XP_007872748.1|  hypothetical protein PNEG_00839                    116   4e-30   Pneumocystis murina B123
ref|NP_595214.1|  40S ribosomal protein S27                             116   4e-30   Schizosaccharomyces pombe
gb|ACH71007.1|  ribosomal protein S27-4                                 116   4e-30   Salmo salar
ref|XP_002839823.1|  40S ribosomal protein S27                          117   5e-30   Tuber melanosporum Mel28
ref|XP_010766198.1|  PREDICTED: 40S ribosomal protein S27               116   5e-30   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_005676594.1|  PREDICTED: 40S ribosomal protein S27-like          116   5e-30   Capra hircus [domestic goat]
ref|XP_003452490.1|  PREDICTED: 40S ribosomal protein S27-like          116   5e-30   Oreochromis niloticus
gb|ACO11127.1|  40S ribosomal protein S27                               116   6e-30   Caligus rogercresseyi
gb|AAD02390.2|  ribosomal protein S27                                   116   6e-30   Schizosaccharomyces pombe
emb|CDO70277.1|  hypothetical protein BN946_scf184942.g77               116   6e-30   Trametes cinnabarina
gb|ACI67409.1|  40S ribosomal protein S27                               116   6e-30   Salmo salar
gb|EPX71568.1|  40S ribosomal protein S27                               116   6e-30   Schizosaccharomyces octosporus yFS286
ref|XP_007879406.1|  hypothetical protein PFL1_03696                    116   6e-30   Anthracocystis flocculosa PF-1
ref|NP_957059.1|  ribosomal protein S27                                 116   7e-30   Danio rerio [leopard danio]
gb|ABJ98653.1|  40S ribosomal protein S27                               116   7e-30   Scophthalmus maximus
gb|AAX48903.1|  S27                                                     116   7e-30   Suberites domuncula
gb|ACO07571.1|  40S ribosomal protein S27                               116   7e-30   Oncorhynchus mykiss
ref|XP_008473447.1|  PREDICTED: 40S ribosomal protein S27               116   7e-30   Diaphorina citri
ref|XP_003450940.1|  PREDICTED: 40S ribosomal protein S27-like          116   8e-30   Oreochromis niloticus
ref|XP_004176966.1|  PREDICTED: 40S ribosomal protein S27-like          116   8e-30   Taeniopygia guttata
gb|AAK92195.1|AF400223_1  ribosomal protein S27                         115   8e-30   Spodoptera frugiperda
ref|NP_001153000.1|  40S ribosomal protein S27-like                     115   8e-30   Danio rerio [leopard danio]
gb|AFM87535.1|  40S ribosomal protein S27                               115   8e-30   Callorhinchus milii [Australian ghost shark]
gb|EFX72565.1|  hypothetical protein DAPPUDRAFT_308217                  115   8e-30   Daphnia pulex
emb|CDH49327.1|  40s ribosomal protein s27                              115   9e-30   Lichtheimia corymbifera JMRC:FSU:9682
gb|AGN29666.1|  40S ribosomal protein S27                               115   9e-30   Acartia pacifica
ref|XP_002897791.1|  40S ribosomal protein S27-like protein             115   9e-30   
gb|ACD65152.1|  putative 40S ribosomal protein RPS27                    115   9e-30   
gb|EPS99117.1|  hypothetical protein FOMPIDRAFT_1164358                 115   9e-30   
ref|XP_009058472.1|  hypothetical protein LOTGIDRAFT_191640             115   9e-30   
ref|NP_001264389.1|  40S ribosomal protein S27-like                     115   9e-30   
gb|ABW90431.1|  putative ribosomal protein S27                          115   9e-30   
dbj|GAA98006.1|  hypothetical protein E5Q_04686                         115   1e-29   
ref|XP_010784972.1|  PREDICTED: 40S ribosomal protein S27-like          115   1e-29   
gb|ACV21012.1|  small subunit ribosomal protein 27                      115   1e-29   
ref|NP_001165123.1|  ribosomal protein S27                              115   1e-29   
ref|NP_001037277.1|  ribosomal protein S27                              115   1e-29   
emb|CCQ18637.1|  40S ribosomal protein S27                              116   1e-29   
ref|XP_004077955.1|  PREDICTED: 40S ribosomal protein S27-like          115   1e-29   
ref|XP_004347411.1|  40S ribosomal protein S27                          115   1e-29   
ref|XP_010897381.1|  PREDICTED: 40S ribosomal protein S27               115   1e-29   
gb|ELR07139.1|  40S ribosomal protein S27                               115   1e-29   
ref|XP_007360034.1|  40S ribosomal protein S27                          115   1e-29   
ref|NP_001166151.1|  40S ribosomal protein S27-like                     115   1e-29   
gb|ABW90386.1|  putative ribosomal protein S27                          115   1e-29   
gb|ACI68736.1|  40S ribosomal protein S27                               115   1e-29   
ref|XP_009992813.1|  PREDICTED: 40S ribosomal protein S27-like          115   1e-29   
ref|XP_005810342.1|  PREDICTED: 40S ribosomal protein S27-like          116   1e-29   
ref|XP_008902958.1|  40S ribosomal protein S27-like                     115   1e-29   
ref|XP_009857963.1|  PREDICTED: zinc finger protein isoform X2          124   1e-29   
ref|XP_005699108.1|  PREDICTED: 40S ribosomal protein S27-like          115   2e-29   
ref|NP_001232652.1|  ribosomal protein S27-like                         115   2e-29   
emb|CDQ72724.1|  unnamed protein product                                115   2e-29   
ref|XP_010741824.1|  PREDICTED: 40S ribosomal protein S27 isoform X2    115   2e-29   
gb|AER42702.1|  40S ribosomal protein S27                               115   2e-29   
gb|ACO07477.1|  40S ribosomal protein S27                               115   2e-29   
gb|KFU87199.1|  40S ribosomal protein S27-like                          115   2e-29   
dbj|BAM17777.1|  ribosomal protein S27                                  115   2e-29   
ref|XP_004553184.1|  PREDICTED: 40S ribosomal protein S27-like is...    115   2e-29   
ref|XP_003499471.1|  PREDICTED: 40S ribosomal protein S27               115   2e-29   
ref|XP_008942544.1|  PREDICTED: 40S ribosomal protein S27-like          115   2e-29   
gb|KFV61067.1|  40S ribosomal protein S27-like                          115   2e-29   
ref|XP_005372227.1|  PREDICTED: 40S ribosomal protein S27-like          115   2e-29   
gb|KFQ16968.1|  40S ribosomal protein S27-like                          114   2e-29   
gb|EPE07515.1|  40s ribosomal protein s27                               115   2e-29   
gb|ABS57436.1|  ribosomal protein S27                                   114   2e-29   
gb|EMC77435.1|  40S ribosomal protein S27-like protein                  114   2e-29   
ref|XP_008933109.1|  PREDICTED: 40S ribosomal protein S27-like          114   2e-29   
gb|KDQ30522.1|  hypothetical protein PLEOSDRAFT_1070156                 114   3e-29   
emb|CAG11854.1|  unnamed protein product                                114   3e-29   
emb|CAB58439.1|  40S ribosomal protein S27                              114   3e-29   
gb|EMR88546.1|  putative 40s ribosomal protein s27 protein              115   3e-29   
ref|XP_001556267.1|  40S ribosomal protein S27                          114   3e-29   
gb|EPZ35573.1|  40S ribosomal protein S27                               114   3e-29   
gb|ADO27851.1|  40S ribosomal protein s27                               114   3e-29   
gb|ABW23154.1|  ribosomal protein rps27                                 114   3e-29   
gb|KDD76606.1|  hypothetical protein H632_c164p2                        115   3e-29   
gb|ACO09139.1|  40S ribosomal protein S27                               114   3e-29   
ref|XP_005110289.1|  PREDICTED: 40S ribosomal protein S27-like is...    114   3e-29   
gb|KIL92468.1|  40s ribosomal protein s27                               114   3e-29   
gb|ACO07977.1|  40S ribosomal protein S27                               114   3e-29   
ref|XP_011420447.1|  PREDICTED: 40S ribosomal protein S27-like          114   3e-29   
emb|CAD91436.1|  ribosomal protein S27-1                                114   3e-29   
ref|XP_001694878.1|  ribosomal protein S27 isoform B, component o...    114   3e-29   
ref|XP_005703531.1|  40S ribosomal protein S27e                         114   3e-29   
ref|XP_003172995.1|  40S ribosomal protein S27                          114   3e-29   
gb|ABI52737.1|  40S ribosomal protein S27                               114   3e-29   
ref|XP_007450885.1|  PREDICTED: 40S ribosomal protein S27-like          114   3e-29   
dbj|GAC96340.1|  40S ribosomal protein S27                              120   4e-29   
ref|XP_007905932.1|  PREDICTED: 40S ribosomal protein S27-like          114   4e-29   
ref|XP_003050947.1|  40S ribosomal protein S27                          114   4e-29   
ref|XP_002765427.1|  40S ribosomal protein S27-4, putative              114   4e-29   
gb|ABX44799.1|  putative 40S ribosomal protein RPS27                    114   4e-29   
ref|XP_662381.1|  RS27_XENLA 40S ribosomal protein S27                  114   4e-29   
gb|AGH70209.1|  40S ribosomal protein S27                               114   4e-29   
gb|ABR27855.1|  40S ribosomal protein S27                               114   4e-29   
ref|XP_009503188.1|  PREDICTED: 40S ribosomal protein S27-like          114   4e-29   
ref|XP_005987787.1|  PREDICTED: 40S ribosomal protein S27-like          114   5e-29   
ref|NP_001035668.1|  40S ribosomal protein S27-like                     114   5e-29   
ref|XP_003418390.1|  PREDICTED: 40S ribosomal protein S27-like          114   5e-29   
gb|KFO05889.1|  40S ribosomal protein S27-like                          114   5e-29   
gb|KJB45261.1|  hypothetical protein B456_007G298000                    113   5e-29   
ref|XP_007533173.1|  PREDICTED: 40S ribosomal protein S27               114   5e-29   
ref|XP_009012599.1|  hypothetical protein HELRODRAFT_156474             114   5e-29   
gb|ETL44382.1|  40S ribosomal protein S27-like                          115   5e-29   
gb|ACO09371.1|  40S ribosomal protein S27                               114   5e-29   
gb|AAH03667.1|  Ribosomal protein S27-like                              114   6e-29   
ref|NP_057004.1|  40S ribosomal protein S27-like                        114   6e-29   
ref|XP_009328374.1|  PREDICTED: 40S ribosomal protein S27-like          114   6e-29   
gb|KFM73335.1|  40S ribosomal protein S27                               114   6e-29   
gb|ABR23466.1|  40s ribosomal protein S27                               114   6e-29   
ref|XP_002398160.1|  hypothetical protein MPER_01292                    114   6e-29   
ref|XP_005145810.1|  PREDICTED: 40S ribosomal protein S27-like          115   6e-29   
ref|XP_005425967.1|  PREDICTED: 40S ribosomal protein S27-like          114   6e-29   
ref|XP_003190521.1|  40S ribosomal protein S27                          113   6e-29   
gb|EKC21036.1|  40S ribosomal protein S27-like protein                  114   6e-29   
ref|XP_003440483.1|  PREDICTED: 40S ribosomal protein S27-like          113   6e-29   
gb|AAM27204.1|AF502249_1  40s ribosomal protein S27                     113   7e-29   
ref|XP_008278915.1|  PREDICTED: 40S ribosomal protein S27-like          113   7e-29   
gb|KFM03968.1|  40S ribosomal protein S27-like                          113   7e-29   
gb|AAN05598.1|  ribosomal protein S27-1                                 113   7e-29   
ref|XP_005501174.1|  PREDICTED: 40S ribosomal protein S27-like          114   7e-29   
gb|EHK45878.1|  hypothetical protein TRIATDRAFT_264382                  113   7e-29   
ref|XP_010831820.1|  PREDICTED: 40S ribosomal protein S27-like is...    113   8e-29   
emb|CDM31909.1|  40S ribosomal protein S27                              113   8e-29   
ref|XP_005824202.1|  small subunit ribosomal protein S27e, cytopl...    113   8e-29   
gb|KFQ08084.1|  40S ribosomal protein S27-like                          113   8e-29   
ref|XP_008321387.1|  PREDICTED: 40S ribosomal protein S27-like          113   8e-29   
ref|XP_010864201.1|  PREDICTED: 40S ribosomal protein S27-like          113   8e-29   
ref|XP_009467957.1|  PREDICTED: 40S ribosomal protein S27-like          113   8e-29   
ref|NP_651359.1|  ribosomal protein S27, isoform A                      113   8e-29   
ref|XP_001394925.1|  40S ribosomal protein S27                          113   8e-29   
gb|ACQ58346.1|  40S ribosomal protein S27-like protein                  113   9e-29   
ref|XP_009070724.1|  PREDICTED: 40S ribosomal protein S27-like          113   9e-29   
ref|XP_010639513.1|  PREDICTED: 40S ribosomal protein S27-like          114   9e-29   
ref|XP_010831828.1|  PREDICTED: 40S ribosomal protein S27-like is...    113   9e-29   
ref|XP_006967262.1|  ribosomal protein S27                              113   9e-29   
ref|XP_853191.3|  PREDICTED: ribosomal protein S27-like                 114   9e-29   
ref|XP_001097084.1|  PREDICTED: 40S ribosomal protein S27-like          113   9e-29   
gb|KGQ07100.1|  40S ribosomal protein S27                               113   9e-29   
ref|XP_002176320.1|  predicted protein                                  113   9e-29   
ref|XP_010831812.1|  PREDICTED: 40S ribosomal protein S27-like is...    113   9e-29   
ref|XP_003966302.1|  PREDICTED: 40S ribosomal protein S27-like          113   9e-29   
gb|AAM94274.1|  ribosomal protein S27E                                  113   9e-29   
gb|EDL84249.1|  rCG56651, isoform CRA_a                                 113   9e-29   
ref|XP_005188216.1|  PREDICTED: 40S ribosomal protein S27               113   9e-29   
gb|EHL01289.1|  putative 40S ribosomal protein S27                      113   9e-29   
ref|XP_005366048.1|  PREDICTED: 40S ribosomal protein S27-like          113   1e-28   
ref|XP_007526168.1|  PREDICTED: 40S ribosomal protein S27-like          113   1e-28   
ref|XP_001352335.2|  GA10310                                            113   1e-28   
gb|ELR57208.1|  hypothetical protein M91_14372                          113   1e-28   
ref|XP_001518279.2|  PREDICTED: 40S ribosomal protein S27-like          113   1e-28   
emb|CCU77415.1|  40S ribosomal protein S27                              113   1e-28   
ref|XP_003743039.1|  PREDICTED: 40S ribosomal protein S27-like          113   1e-28   
ref|XP_002141309.1|  40S ribosomal protein S27                          113   1e-28   
ref|XP_007068955.1|  PREDICTED: 40S ribosomal protein S27-like          113   1e-28   
gb|KIH57963.1|  Ribosomal protein S27                                   113   1e-28   
ref|XP_001217341.1|  40S ribosomal protein S27                          113   1e-28   
ref|XP_007534019.1|  PREDICTED: 40S ribosomal protein S27-like          113   1e-28   
gb|EPQ64747.1|  Protein component of the small (40S) ribosomal su...    112   1e-28   
ref|XP_628330.1|  ribosomal protein S27                                 113   1e-28   
ref|XP_668596.1|  40S ribosomal protein S27                             112   1e-28   
ref|XP_004469682.1|  PREDICTED: 40S ribosomal protein S27-like          114   1e-28   
gb|AIL48454.1|  small subunit ribosomal protein 27                      112   1e-28   
dbj|BAA28754.1|  ribosomal protein S27 homolog                          112   1e-28   
ref|XP_754942.1|  40S ribosomal protein S27                             112   1e-28   
ref|XP_006680758.1|  hypothetical protein BATDEDRAFT_30472              112   1e-28   
gb|AFJ92678.1|  small ribosomal protein 27                              112   1e-28   
gb|AAY66945.1|  40S ribosomal protein S27                               112   1e-28   
ref|XP_006670446.1|  40S ribosomal protein S27                          112   1e-28   
ref|XP_005861157.1|  PREDICTED: 40S ribosomal protein S27-like          112   1e-28   
ref|XP_005490382.1|  PREDICTED: 40S ribosomal protein S27-like          113   1e-28   
gb|ACV21023.1|  small subunit ribosomal protein 27                      112   1e-28   
ref|XP_005434178.1|  PREDICTED: 40S ribosomal protein S27-like          114   1e-28   
ref|XP_003969395.1|  PREDICTED: leucine-rich repeat-containing pr...    117   1e-28   
ref|XP_007479603.1|  PREDICTED: 40S ribosomal protein S27-like          112   1e-28   
gb|EEH23503.1|  40S ribosomal protein S27                               112   2e-28   
ref|XP_007067881.1|  PREDICTED: 40S ribosomal protein S27               112   2e-28   
gb|ACO10286.1|  40S ribosomal protein S27                               112   2e-28   
gb|EDP53070.1|  40S ribosomal protein S27, putative                     113   2e-28   
ref|XP_003659916.1|  hypothetical protein MYCTH_2313891                 112   2e-28   
ref|XP_001246701.1|  40S ribosomal protein S27                          112   2e-28   
gb|AEG78362.1|  40S ribosomal protein S27-like protein                  112   2e-28   
ref|XP_006126790.1|  PREDICTED: 40S ribosomal protein S27-like          112   2e-28   
ref|XP_006029727.1|  PREDICTED: 40S ribosomal protein S27-like is...    112   2e-28   
gb|AAN86980.1|  ribosomal protein S27                                   112   2e-28   
ref|XP_004667260.1|  PREDICTED: 40S ribosomal protein S27               112   2e-28   
ref|XP_008275017.1|  PREDICTED: 40S ribosomal protein S27-like          112   2e-28   
ref|XP_002152480.1|  40S ribosomal protein S27                          112   2e-28   
gb|ABQ82150.1|  ribosomal protein S27-like                              112   2e-28   
gb|EPQ04525.1|  40S ribosomal protein S27                               113   2e-28   
gb|ABZ04272.1|  ribosomal protein rps27                                 112   2e-28   
ref|XP_002486096.1|  40S ribosomal protein S27                          112   2e-28   
ref|XP_002623285.1|  40S ribosomal protein S27                          112   2e-28   
dbj|BAF45916.1|  ribosomal protein S27-2                                112   2e-28   
gb|EDL26136.1|  mCG1230, isoform CRA_b                                  112   2e-28   
gb|AIL48450.1|  small subunit ribosomal protein 27                      112   2e-28   
gb|ACV21025.1|  small subunit ribosomal protein 27                      112   2e-28   
gb|ABR87562.1|  small subunit ribosomal protein 27                      112   2e-28   
gb|ABR87580.1|  small subunit ribosomal protein 27                      112   2e-28   
ref|XP_004613989.1|  PREDICTED: 40S ribosomal protein S27-like          112   2e-28   
ref|XP_007130183.1|  PREDICTED: 40S ribosomal protein S27-like is...    112   2e-28   
gb|EAW91426.1|  hCG2027326                                              112   2e-28   
ref|XP_007292816.1|  40S ribosomal protein S27                          112   2e-28   
ref|XP_001544181.1|  40S ribosomal protein S27                          112   2e-28   
emb|CEF86029.1|  unnamed protein product                                113   2e-28   
ref|XP_003007631.1|  40S ribosomal protein S27                          112   2e-28   
ref|XP_002843043.1|  40S ribosomal protein S27                          112   2e-28   
ref|XP_009272285.1|  PREDICTED: 40S ribosomal protein S27-like          113   2e-28   
ref|XP_009914408.1|  PREDICTED: 40S ribosomal protein S27-like          112   2e-28   
ref|XP_010831802.1|  PREDICTED: 40S ribosomal protein S27-like is...    114   2e-28   
ref|XP_001263787.1|  40S ribosomal protein S27                          113   2e-28   
ref|XP_010846130.1|  PREDICTED: 40S ribosomal protein S27-like          112   2e-28   
ref|XP_007817233.2|  Ribosomal protein S27e                             112   3e-28   
gb|ELK24888.1|  40S ribosomal protein S27-like protein                  112   3e-28   
gb|KHO01281.1|  Ribosomal protein S27e                                  112   3e-28   
gb|KFV84751.1|  40S ribosomal protein S27-like                          112   3e-28   
ref|XP_006029726.1|  PREDICTED: 40S ribosomal protein S27-like is...    112   3e-28   
ref|XP_008596506.1|  40S ribosomal protein S27                          113   3e-28   
gb|EYB22000.1|  hypothetical protein FG05_06407                         112   3e-28   
emb|CCE27294.1|  probable 40S ribosomal protein S27-2                   112   3e-28   
ref|XP_010176993.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...    112   3e-28   
ref|XP_007829628.1|  40S ribosomal protein S27                          112   3e-28   
gb|EER38744.1|  40S ribosomal protein S27                               112   3e-28   
ref|XP_010727758.1|  PREDICTED: 40S ribosomal protein S27-like          112   3e-28   
ref|XP_010761319.1|  40S ribosomal protein S27                          113   3e-28   
ref|XP_005075658.1|  PREDICTED: 40S ribosomal protein S27-like          112   3e-28   
gb|EQB47349.1|  hypothetical protein CGLO_13525                         112   3e-28   
gb|EPS26892.1|  hypothetical protein PDE_01832                          111   3e-28   
ref|XP_006087316.1|  PREDICTED: 40S ribosomal protein S27-like          112   3e-28   
ref|XP_010807585.1|  PREDICTED: 40S ribosomal protein S27-like is...    114   3e-28   
gb|KGL73058.1|  40S ribosomal protein S27-like                          111   3e-28   
ref|XP_005028047.1|  PREDICTED: 40S ribosomal protein S27-like          112   3e-28   
emb|CAF98322.1|  unnamed protein product                                111   3e-28   
ref|XP_005559791.1|  PREDICTED: uncharacterized LOC101866206 isof...    112   3e-28   
gb|ABP52062.1|  ribosomal protein S27e                                  111   3e-28   
dbj|GAD92245.1|  40S ribosomal protein S27                              111   3e-28   
ref|XP_010980432.1|  PREDICTED: 40S ribosomal protein S27-like          111   3e-28   
ref|XP_003352468.1|  40S ribosomal protein S27                          111   3e-28   
gb|KFO96703.1|  40S ribosomal protein S27-like                          111   3e-28   
ref|XP_005899524.1|  PREDICTED: 40S ribosomal protein S27-like          112   4e-28   
ref|XP_004056354.1|  PREDICTED: 40S ribosomal protein S27-like          112   4e-28   
ref|XP_009238116.1|  PREDICTED: 40S ribosomal protein S27-like          111   4e-28   
ref|XP_002540998.1|  40S ribosomal protein S27                          111   4e-28   
emb|CDJ96011.1|  Ribosomal protein S27e domain containing protein       111   4e-28   
ref|XP_008704299.1|  PREDICTED: 40S ribosomal protein S27-like          112   4e-28   
ref|XP_011122435.1|  hypothetical protein AOL_s00079g258                111   4e-28   



>gb|EPS65822.1| hypothetical protein M569_08957 [Genlisea aurea]
Length=181

 Score =   162 bits (410),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 86/88 (98%), Positives = 88/88 (100%), Gaps = 0/88 (0%)
 Frame = +3

Query  111  NTMVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVC  290
            +TMVLPNDIDLLNPPAELEK+KHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVC
Sbjct  94   STMVLPNDIDLLNPPAELEKRKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVC  153

Query  291  GNCQTVLCQPTGGRARLTEGCSFRRKGD  374
            GNCQTVLCQPTGGRARLTEGCSFRRKGD
Sbjct  154  GNCQTVLCQPTGGRARLTEGCSFRRKGD  181



>ref|XP_010250479.1| PREDICTED: 40S ribosomal protein S27-2 [Nelumbo nucifera]
Length=119

 Score =   159 bits (401),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 97/116 (84%), Gaps = 5/116 (4%)
 Frame = +3

Query  42   TFNEPILGSLHTAAF*GFRSSTFN-----TMVLPNDIDLLNPPAelekkkhklkRLVQSP  206
            + + PIL +    AF G    + +      MVLPNDIDLLNPPAELEK++HKLKRLVQSP
Sbjct  4    SVSSPILLAATARAFGGLSRVSGSSRVSAKMVLPNDIDLLNPPAELEKRRHKLKRLVQSP  63

Query  207  NSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQTVLCQPTGGRARLTEGCSFRRKGD  374
            NSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQTVLCQPTGGRARLTEGCSFRRKGD
Sbjct  64   NSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQTVLCQPTGGRARLTEGCSFRRKGD  119



>ref|XP_010279570.1| PREDICTED: 40S ribosomal protein S27-2-like [Nelumbo nucifera]
Length=135

 Score =   158 bits (400),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 84/86 (98%), Positives = 86/86 (100%), Gaps = 0/86 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVLPNDIDLLNPPAELEK++HKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN
Sbjct  50   MVLPNDIDLLNPPAELEKRRHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  109

Query  297  CQTVLCQPTGGRARLTEGCSFRRKGD  374
            CQTVLCQPTGGRARLTEGCSFRRKGD
Sbjct  110  CQTVLCQPTGGRARLTEGCSFRRKGD  135



>ref|XP_002273119.1| PREDICTED: 40S ribosomal protein S27-2 [Vitis vinifera]
 emb|CAN78160.1| hypothetical protein VITISV_040920 [Vitis vinifera]
Length=86

 Score =   156 bits (394),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 84/86 (98%), Positives = 86/86 (100%), Gaps = 0/86 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVLPNDIDLLNPPAE+EK+KHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN
Sbjct  1    MVLPNDIDLLNPPAEIEKRKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  60

Query  297  CQTVLCQPTGGRARLTEGCSFRRKGD  374
            CQTVLCQPTGGRARLTEGCSFRRKGD
Sbjct  61   CQTVLCQPTGGRARLTEGCSFRRKGD  86



>ref|XP_009383858.1| PREDICTED: 40S ribosomal protein S27-2-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_010926238.1| PREDICTED: 40S ribosomal protein S27-2-like [Elaeis guineensis]
Length=86

 Score =   156 bits (394),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 85/86 (99%), Positives = 86/86 (100%), Gaps = 0/86 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVLPNDIDLLNPPAELEKK+HKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN
Sbjct  1    MVLPNDIDLLNPPAELEKKRHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  60

Query  297  CQTVLCQPTGGRARLTEGCSFRRKGD  374
            CQTVLCQPTGGRARLTEGCSFRRKGD
Sbjct  61   CQTVLCQPTGGRARLTEGCSFRRKGD  86



>ref|XP_008780838.1| PREDICTED: 40S ribosomal protein S27-2 [Phoenix dactylifera]
 ref|XP_008797103.1| PREDICTED: 40S ribosomal protein S27-2 [Phoenix dactylifera]
 ref|XP_008808848.1| PREDICTED: 40S ribosomal protein S27-2 [Phoenix dactylifera]
 ref|XP_008810622.1| PREDICTED: 40S ribosomal protein S27-2 [Phoenix dactylifera]
 ref|XP_009404730.1| PREDICTED: 40S ribosomal protein S27-2-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_010916940.1| PREDICTED: 40S ribosomal protein S27-2 [Elaeis guineensis]
 ref|XP_010908925.1| PREDICTED: 40S ribosomal protein S27-2 [Elaeis guineensis]
Length=86

 Score =   155 bits (393),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 84/86 (98%), Positives = 86/86 (100%), Gaps = 0/86 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVLPNDIDLLNPPAELEK++HKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN
Sbjct  1    MVLPNDIDLLNPPAELEKRRHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  60

Query  297  CQTVLCQPTGGRARLTEGCSFRRKGD  374
            CQTVLCQPTGGRARLTEGCSFRRKGD
Sbjct  61   CQTVLCQPTGGRARLTEGCSFRRKGD  86



>gb|ABA40465.1| ribosomal protein S27-like protein [Solanum tuberosum]
 gb|AFX66976.1| ribosomal protein S27 [Solanum tuberosum]
Length=86

 Score =   155 bits (392),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 83/86 (97%), Positives = 85/86 (99%), Gaps = 0/86 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVLPND+DLLNPPAE EK+KHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN
Sbjct  1    MVLPNDVDLLNPPAEQEKRKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  60

Query  297  CQTVLCQPTGGRARLTEGCSFRRKGD  374
            CQTVLCQPTGGRARLTEGCSFRRKGD
Sbjct  61   CQTVLCQPTGGRARLTEGCSFRRKGD  86



>ref|XP_004228542.1| PREDICTED: 40S ribosomal protein S27-2 [Solanum lycopersicum]
 ref|XP_004228543.1| PREDICTED: 40S ribosomal protein S27-2 [Solanum lycopersicum]
Length=86

 Score =   155 bits (392),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 83/86 (97%), Positives = 85/86 (99%), Gaps = 0/86 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVLPND+DLLNPPAE EK+KHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN
Sbjct  1    MVLPNDVDLLNPPAEHEKRKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  60

Query  297  CQTVLCQPTGGRARLTEGCSFRRKGD  374
            CQTVLCQPTGGRARLTEGCSFRRKGD
Sbjct  61   CQTVLCQPTGGRARLTEGCSFRRKGD  86



>ref|XP_009410582.1| PREDICTED: 40S ribosomal protein S27-2-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009384350.1| PREDICTED: 40S ribosomal protein S27-2-like [Musa acuminata subsp. 
malaccensis]
Length=86

 Score =   155 bits (391),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 83/86 (97%), Positives = 86/86 (100%), Gaps = 0/86 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVLPND+DLLNPPAELEK++HKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN
Sbjct  1    MVLPNDVDLLNPPAELEKRRHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  60

Query  297  CQTVLCQPTGGRARLTEGCSFRRKGD  374
            CQTVLCQPTGGRARLTEGCSFRRKGD
Sbjct  61   CQTVLCQPTGGRARLTEGCSFRRKGD  86



>gb|KJB22717.1| hypothetical protein B456_004G062400 [Gossypium raimondii]
 gb|KJB22718.1| hypothetical protein B456_004G062400 [Gossypium raimondii]
Length=122

 Score =   155 bits (392),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 86/93 (92%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = +3

Query  96   RSSTFNTMVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQ  275
            + S+  TMVL NDIDLLNPPAELEKKKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQ
Sbjct  30   KPSSTATMVLQNDIDLLNPPAELEKKKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQ  89

Query  276  TVVVCGNCQTVLCQPTGGRARLTEGCSFRRKGD  374
            TVVVCGNCQTVLCQPTGGRARLTEGCSFR+KGD
Sbjct  90   TVVVCGNCQTVLCQPTGGRARLTEGCSFRKKGD  122



>ref|XP_009384308.1| PREDICTED: 40S ribosomal protein S27-2 [Musa acuminata subsp. 
malaccensis]
Length=86

 Score =   154 bits (389),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 83/86 (97%), Positives = 86/86 (100%), Gaps = 0/86 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVLPNDIDLLNPPAELEK+KHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN
Sbjct  1    MVLPNDIDLLNPPAELEKRKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  60

Query  297  CQTVLCQPTGGRARLTEGCSFRRKGD  374
            CQTVLCQPTGG+A+LTEGCSFRRKGD
Sbjct  61   CQTVLCQPTGGKAKLTEGCSFRRKGD  86



>ref|XP_009393881.1| PREDICTED: 40S ribosomal protein S27-2-like [Musa acuminata subsp. 
malaccensis]
Length=86

 Score =   154 bits (388),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 82/86 (95%), Positives = 86/86 (100%), Gaps = 0/86 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVLPND+DLLNPPAELEK++HKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN
Sbjct  1    MVLPNDVDLLNPPAELEKRRHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  60

Query  297  CQTVLCQPTGGRARLTEGCSFRRKGD  374
            CQTVLCQPTGGRA+LTEGCSFRRKGD
Sbjct  61   CQTVLCQPTGGRAKLTEGCSFRRKGD  86



>ref|XP_006348533.1| PREDICTED: 40S ribosomal protein S27-2-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006348534.1| PREDICTED: 40S ribosomal protein S27-2-like isoform X2 [Solanum 
tuberosum]
 gb|ABB87121.1| ribosomal protein S27-like protein-like [Solanum tuberosum]
Length=86

 Score =   154 bits (388),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 82/86 (95%), Positives = 85/86 (99%), Gaps = 0/86 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVLPND+DLLNPPAE EK+KHKLKRLVQSP+SFFMDVKCQGCFNITTVFSHSQTVVVCGN
Sbjct  1    MVLPNDVDLLNPPAEQEKRKHKLKRLVQSPDSFFMDVKCQGCFNITTVFSHSQTVVVCGN  60

Query  297  CQTVLCQPTGGRARLTEGCSFRRKGD  374
            CQTVLCQPTGGRARLTEGCSFRRKGD
Sbjct  61   CQTVLCQPTGGRARLTEGCSFRRKGD  86



>ref|XP_009595222.1| PREDICTED: 40S ribosomal protein S27-2 [Nicotiana tomentosiformis]
 ref|XP_009804102.1| PREDICTED: 40S ribosomal protein S27-2 isoform X1 [Nicotiana 
sylvestris]
Length=86

 Score =   154 bits (388),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 83/86 (97%), Positives = 85/86 (99%), Gaps = 0/86 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            M LPND+DLLNPPAELEK+KHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN
Sbjct  1    MTLPNDVDLLNPPAELEKRKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  60

Query  297  CQTVLCQPTGGRARLTEGCSFRRKGD  374
            CQTVLCQPTGGRARLTEGCSFRRKGD
Sbjct  61   CQTVLCQPTGGRARLTEGCSFRRKGD  86



>emb|CBI21255.3| unnamed protein product [Vitis vinifera]
Length=160

 Score =   156 bits (394),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 83/86 (97%), Positives = 85/86 (99%), Gaps = 0/86 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVLPNDIDLLNPPAELEK+KHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN
Sbjct  75   MVLPNDIDLLNPPAELEKRKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  134

Query  297  CQTVLCQPTGGRARLTEGCSFRRKGD  374
            CQ VLCQPTGGRARLTEGCSFR+KGD
Sbjct  135  CQLVLCQPTGGRARLTEGCSFRKKGD  160



>gb|EYU46714.1| hypothetical protein MIMGU_mgv1a016569mg [Erythranthe guttata]
Length=116

 Score =   154 bits (390),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 84/88 (95%), Positives = 86/88 (98%), Gaps = 0/88 (0%)
 Frame = +3

Query  111  NTMVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVC  290
            +TMVL ND DLLNPPAELEK+KHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVC
Sbjct  29   STMVLSNDYDLLNPPAELEKRKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVC  88

Query  291  GNCQTVLCQPTGGRARLTEGCSFRRKGD  374
            GNCQTVLCQPTGGRARLTEGCSFRRKGD
Sbjct  89   GNCQTVLCQPTGGRARLTEGCSFRRKGD  116



>gb|EYU26951.1| hypothetical protein MIMGU_mgv1a017251mg [Erythranthe guttata]
Length=86

 Score =   154 bits (388),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 84/86 (98%), Positives = 85/86 (99%), Gaps = 0/86 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL NDIDLLNPPAELEK+KHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN
Sbjct  1    MVLSNDIDLLNPPAELEKRKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  60

Query  297  CQTVLCQPTGGRARLTEGCSFRRKGD  374
            CQTVLCQPTGGRARLTEGCSFRRKGD
Sbjct  61   CQTVLCQPTGGRARLTEGCSFRRKGD  86



>ref|XP_006348532.1| PREDICTED: 40S ribosomal protein S27-2-like [Solanum tuberosum]
Length=86

 Score =   153 bits (387),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 82/86 (95%), Positives = 84/86 (98%), Gaps = 0/86 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVLPND+DLLNPP E EK+KHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN
Sbjct  1    MVLPNDVDLLNPPVEQEKRKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  60

Query  297  CQTVLCQPTGGRARLTEGCSFRRKGD  374
            CQTVLCQPTGGRARLTEGCSFRRKGD
Sbjct  61   CQTVLCQPTGGRARLTEGCSFRRKGD  86



>emb|CBI29279.3| unnamed protein product [Vitis vinifera]
Length=87

 Score =   153 bits (387),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 83/86 (97%), Positives = 85/86 (99%), Gaps = 0/86 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
             VLPNDIDLLNPPAE+EK+KHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN
Sbjct  2    FVLPNDIDLLNPPAEIEKRKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  61

Query  297  CQTVLCQPTGGRARLTEGCSFRRKGD  374
            CQTVLCQPTGGRARLTEGCSFRRKGD
Sbjct  62   CQTVLCQPTGGRARLTEGCSFRRKGD  87



>ref|XP_006292074.1| hypothetical protein CARUB_v10018269mg, partial [Capsella rubella]
 gb|EOA24972.1| hypothetical protein CARUB_v10018269mg, partial [Capsella rubella]
Length=115

 Score =   154 bits (390),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 82/91 (90%), Positives = 86/91 (95%), Gaps = 0/91 (0%)
 Frame = +3

Query  102  STFNTMVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTV  281
             +   MVL NDIDLLNPPAELEK+KHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTV
Sbjct  25   ESLTKMVLQNDIDLLNPPAELEKRKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTV  84

Query  282  VVCGNCQTVLCQPTGGRARLTEGCSFRRKGD  374
            VVCGNCQT+LCQPTGG+ARLTEGCSFRRKGD
Sbjct  85   VVCGNCQTILCQPTGGKARLTEGCSFRRKGD  115



>ref|XP_002512685.1| 40S ribosomal protein S27, putative [Ricinus communis]
 ref|XP_002519401.1| 40S ribosomal protein S27, putative [Ricinus communis]
 ref|XP_004143769.1| PREDICTED: 40S ribosomal protein S27-2-like [Cucumis sativus]
 ref|XP_004169542.1| PREDICTED: 40S ribosomal protein S27-2-like [Cucumis sativus]
 ref|XP_008465377.1| PREDICTED: 40S ribosomal protein S27-2-like [Cucumis melo]
 ref|XP_010057712.1| PREDICTED: 40S ribosomal protein S27-2 [Eucalyptus grandis]
 ref|XP_010028919.1| PREDICTED: 40S ribosomal protein S27-2 [Eucalyptus grandis]
 gb|EEF43018.1| 40S ribosomal protein S27, putative [Ricinus communis]
 gb|EEF50137.1| 40S ribosomal protein S27, putative [Ricinus communis]
 gb|KCW74930.1| hypothetical protein EUGRSUZ_E03676 [Eucalyptus grandis]
 gb|KDP23246.1| hypothetical protein JCGZ_23079 [Jatropha curcas]
 gb|KGN51141.1| hypothetical protein Csa_5G466870 [Cucumis sativus]
Length=86

 Score =   153 bits (387),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 84/86 (98%), Positives = 85/86 (99%), Gaps = 0/86 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL NDIDLLNPPAELEK+KHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN
Sbjct  1    MVLQNDIDLLNPPAELEKRKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  60

Query  297  CQTVLCQPTGGRARLTEGCSFRRKGD  374
            CQTVLCQPTGGRARLTEGCSFRRKGD
Sbjct  61   CQTVLCQPTGGRARLTEGCSFRRKGD  86



>ref|XP_010942333.1| PREDICTED: 40S ribosomal protein S27-2-like [Elaeis guineensis]
Length=86

 Score =   153 bits (386),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 83/86 (97%), Positives = 85/86 (99%), Gaps = 0/86 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVLPNDIDLLNPP ELEK++HKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN
Sbjct  1    MVLPNDIDLLNPPPELEKRRHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  60

Query  297  CQTVLCQPTGGRARLTEGCSFRRKGD  374
            CQTVLCQPTGGRARLTEGCSFRRKGD
Sbjct  61   CQTVLCQPTGGRARLTEGCSFRRKGD  86



>ref|XP_002277329.1| PREDICTED: 40S ribosomal protein S27-2-like [Vitis vinifera]
Length=86

 Score =   153 bits (386),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 83/86 (97%), Positives = 85/86 (99%), Gaps = 0/86 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVLPNDIDLLNPPAELEK+KHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN
Sbjct  1    MVLPNDIDLLNPPAELEKRKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  60

Query  297  CQTVLCQPTGGRARLTEGCSFRRKGD  374
            CQ VLCQPTGGRARLTEGCSFR+KGD
Sbjct  61   CQLVLCQPTGGRARLTEGCSFRKKGD  86



>ref|XP_007161552.1| hypothetical protein PHAVU_001G079100g [Phaseolus vulgaris]
 gb|ESW33546.1| hypothetical protein PHAVU_001G079100g [Phaseolus vulgaris]
Length=86

 Score =   152 bits (385),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 82/86 (95%), Positives = 85/86 (99%), Gaps = 0/86 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL NDIDLLNPPAE+EK+KHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN
Sbjct  1    MVLQNDIDLLNPPAEIEKRKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  60

Query  297  CQTVLCQPTGGRARLTEGCSFRRKGD  374
            CQTVLCQPTGGRARLTEGCSFR+KGD
Sbjct  61   CQTVLCQPTGGRARLTEGCSFRKKGD  86



>ref|XP_004140655.1| PREDICTED: 40S ribosomal protein S27-2-like [Cucumis sativus]
 ref|XP_004157631.1| PREDICTED: 40S ribosomal protein S27-2-like [Cucumis sativus]
Length=161

 Score =   155 bits (391),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 94/121 (78%), Positives = 100/121 (83%), Gaps = 11/121 (9%)
 Frame = +3

Query  33   SSPTFNEPILGSLHTAAF*GFR-------SSTFNTMVLPNDIDLLNPPAelekkkhklkR  191
            SSP+F+    G L  + F  FR        S+FN  VL NDIDLLNPPAELEK+KHKLKR
Sbjct  45   SSPSFDHH--GKLQISLF-SFRIWIQLISVSSFN-QVLQNDIDLLNPPAELEKRKHKLKR  100

Query  192  LVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQTVLCQPTGGRARLTEGCSFRRKG  371
            LVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQTVLCQPTGGRA+LTEGCSFRRKG
Sbjct  101  LVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQTVLCQPTGGRAKLTEGCSFRRKG  160

Query  372  D  374
            D
Sbjct  161  D  161



>ref|XP_010530726.1| PREDICTED: 40S ribosomal protein S27-2 [Tarenaya hassleriana]
 ref|XP_010543929.1| PREDICTED: 40S ribosomal protein S27-2 [Tarenaya hassleriana]
 ref|XP_010520993.1| PREDICTED: 40S ribosomal protein S27-2 [Tarenaya hassleriana]
Length=86

 Score =   152 bits (384),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 83/86 (97%), Positives = 85/86 (99%), Gaps = 0/86 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL NDIDLLNPPAELEK+KHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN
Sbjct  1    MVLQNDIDLLNPPAELEKRKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  60

Query  297  CQTVLCQPTGGRARLTEGCSFRRKGD  374
            CQTVLCQPTGG+ARLTEGCSFRRKGD
Sbjct  61   CQTVLCQPTGGKARLTEGCSFRRKGD  86



>ref|XP_003593745.1| Ribosomal protein S27 [Medicago truncatula]
 ref|XP_004485881.1| PREDICTED: 40S ribosomal protein S27-2-like [Cicer arietinum]
 ref|XP_004507524.1| PREDICTED: 40S ribosomal protein S27-2-like [Cicer arietinum]
 ref|XP_007151707.1| hypothetical protein PHAVU_004G069100g [Phaseolus vulgaris]
 gb|ACJ84132.1| unknown [Medicago truncatula]
 gb|AES63996.1| 40S ribosomal protein S27-1 [Medicago truncatula]
 gb|AFK35616.1| unknown [Lotus japonicus]
 gb|AFK49262.1| unknown [Medicago truncatula]
 gb|ESW23701.1| hypothetical protein PHAVU_004G069100g [Phaseolus vulgaris]
 gb|KHN00634.1| 40S ribosomal protein S27-2 [Glycine soja]
 gb|KHN00635.1| 40S ribosomal protein S27-2 [Glycine soja]
 gb|KHN13396.1| 40S ribosomal protein S27-2 [Glycine soja]
Length=86

 Score =   152 bits (384),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 83/86 (97%), Positives = 85/86 (99%), Gaps = 0/86 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL NDIDLLNPPAELEK+KHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN
Sbjct  1    MVLQNDIDLLNPPAELEKRKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  60

Query  297  CQTVLCQPTGGRARLTEGCSFRRKGD  374
            CQTVLCQPTGGRARLTEGCSFR+KGD
Sbjct  61   CQTVLCQPTGGRARLTEGCSFRKKGD  86



>ref|XP_008459925.1| PREDICTED: 40S ribosomal protein S27-2 [Cucumis melo]
 gb|ADN33695.1| 40S ribosomal protein s27 [Cucumis melo subsp. melo]
Length=86

 Score =   152 bits (384),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 83/86 (97%), Positives = 85/86 (99%), Gaps = 0/86 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL NDIDLLNPPAELEK+KHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN
Sbjct  1    MVLQNDIDLLNPPAELEKRKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  60

Query  297  CQTVLCQPTGGRARLTEGCSFRRKGD  374
            CQTVLCQPTGGRA+LTEGCSFRRKGD
Sbjct  61   CQTVLCQPTGGRAKLTEGCSFRRKGD  86



>ref|NP_001236263.1| uncharacterized protein LOC100499804 [Glycine max]
 gb|ACU13729.1| unknown [Glycine max]
Length=90

 Score =   152 bits (384),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 83/86 (97%), Positives = 85/86 (99%), Gaps = 0/86 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL NDIDLLNPPAELEK+KHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN
Sbjct  1    MVLQNDIDLLNPPAELEKRKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  60

Query  297  CQTVLCQPTGGRARLTEGCSFRRKGD  374
            CQTVLCQPTGGRARLTEGCSFR+KGD
Sbjct  61   CQTVLCQPTGGRARLTEGCSFRKKGD  86



>ref|XP_011073957.1| PREDICTED: 40S ribosomal protein S27-2 [Sesamum indicum]
 ref|XP_011088960.1| PREDICTED: 40S ribosomal protein S27-2 [Sesamum indicum]
Length=86

 Score =   152 bits (383),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 83/86 (97%), Positives = 84/86 (98%), Gaps = 0/86 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL ND DLLNPPAELEK+KHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN
Sbjct  1    MVLSNDYDLLNPPAELEKRKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  60

Query  297  CQTVLCQPTGGRARLTEGCSFRRKGD  374
            CQTVLCQPTGGRARLTEGCSFRRKGD
Sbjct  61   CQTVLCQPTGGRARLTEGCSFRRKGD  86



>ref|XP_007223843.1| hypothetical protein PRUPE_ppa014109mg [Prunus persica]
 ref|XP_008222271.1| PREDICTED: 40S ribosomal protein S27-2 [Prunus mume]
 ref|XP_008222364.1| PREDICTED: 40S ribosomal protein S27-2 [Prunus mume]
 gb|EMJ25042.1| hypothetical protein PRUPE_ppa014109mg [Prunus persica]
Length=86

 Score =   152 bits (383),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 83/86 (97%), Positives = 85/86 (99%), Gaps = 0/86 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL NDIDLL+PPAELEK+KHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN
Sbjct  1    MVLQNDIDLLHPPAELEKRKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  60

Query  297  CQTVLCQPTGGRARLTEGCSFRRKGD  374
            CQTVLCQPTGGRARLTEGCSFRRKGD
Sbjct  61   CQTVLCQPTGGRARLTEGCSFRRKGD  86



>ref|XP_004497146.1| PREDICTED: 40S ribosomal protein S27-2-like [Cicer arietinum]
 gb|ACJ86187.1| unknown [Medicago truncatula]
 gb|AFK33395.1| unknown [Medicago truncatula]
 gb|AFK42753.1| unknown [Medicago truncatula]
 gb|KEH37032.1| 40S ribosomal protein S27-1 [Medicago truncatula]
 gb|KEH44299.1| 40S ribosomal protein S27-1 [Medicago truncatula]
Length=86

 Score =   151 bits (382),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 82/86 (95%), Positives = 85/86 (99%), Gaps = 0/86 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL NDIDLLNPPAELEK+KHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN
Sbjct  1    MVLQNDIDLLNPPAELEKRKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  60

Query  297  CQTVLCQPTGGRARLTEGCSFRRKGD  374
            CQTVLCQPTGG+ARLTEGCSFR+KGD
Sbjct  61   CQTVLCQPTGGKARLTEGCSFRKKGD  86



>ref|XP_006295333.1| hypothetical protein CARUB_v10024423mg [Capsella rubella]
 gb|EOA28231.1| hypothetical protein CARUB_v10024423mg [Capsella rubella]
Length=86

 Score =   151 bits (382),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 82/86 (95%), Positives = 85/86 (99%), Gaps = 0/86 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL NDIDLLNPPAELEK+KHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN
Sbjct  1    MVLQNDIDLLNPPAELEKRKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  60

Query  297  CQTVLCQPTGGRARLTEGCSFRRKGD  374
            CQTVLCQPTGG+A+LTEGCSFRRKGD
Sbjct  61   CQTVLCQPTGGKAKLTEGCSFRRKGD  86



>ref|XP_009598692.1| PREDICTED: 40S ribosomal protein S27-2-like [Nicotiana tomentosiformis]
Length=86

 Score =   151 bits (382),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 81/86 (94%), Positives = 84/86 (98%), Gaps = 0/86 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL ND DLLNPPA++EK+KHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN
Sbjct  1    MVLSNDYDLLNPPADVEKRKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  60

Query  297  CQTVLCQPTGGRARLTEGCSFRRKGD  374
            CQTVLCQPTGGRARLTEGCSFRRKGD
Sbjct  61   CQTVLCQPTGGRARLTEGCSFRRKGD  86



>ref|XP_006852307.1| hypothetical protein AMTR_s00049p00194290 [Amborella trichopoda]
 gb|ERN13774.1| hypothetical protein AMTR_s00049p00194290 [Amborella trichopoda]
Length=86

 Score =   151 bits (381),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 82/86 (95%), Positives = 85/86 (99%), Gaps = 0/86 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL NDIDLL+PPAELEK+KHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN
Sbjct  1    MVLSNDIDLLHPPAELEKRKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  60

Query  297  CQTVLCQPTGGRARLTEGCSFRRKGD  374
            CQTVLCQPTGGRARLTEGCSFR+KGD
Sbjct  61   CQTVLCQPTGGRARLTEGCSFRKKGD  86



>ref|NP_191670.1| 40S ribosomal protein S27-2 [Arabidopsis thaliana]
 ref|XP_010469120.1| PREDICTED: 40S ribosomal protein S27-2 isoform X1 [Camelina sativa]
 ref|XP_010469121.1| PREDICTED: 40S ribosomal protein S27-2 isoform X2 [Camelina sativa]
 sp|Q9M2F1.2|RS272_ARATH RecName: Full=40S ribosomal protein S27-2 [Arabidopsis thaliana]
 gb|AAL06506.1|AF412053_1 AT3g61110/T27I15_200 [Arabidopsis thaliana]
 gb|AAD10029.1| ribosomal protein S27 [Arabidopsis thaliana]
 gb|AAD10030.1| ribosomal protein S27 [Arabidopsis thaliana]
 emb|CAB94147.1| ribosomal protein S27 [Arabidopsis thaliana]
 gb|AAL90920.1| AT3g61110/T27I15_200 [Arabidopsis thaliana]
 gb|AEE80154.1| 40S ribosomal protein S27-2 [Arabidopsis thaliana]
Length=86

 Score =   151 bits (381),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 81/86 (94%), Positives = 85/86 (99%), Gaps = 0/86 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL NDIDLLNPPAELEK+KHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN
Sbjct  1    MVLQNDIDLLNPPAELEKRKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  60

Query  297  CQTVLCQPTGGRARLTEGCSFRRKGD  374
            CQT+LCQPTGG+A+LTEGCSFRRKGD
Sbjct  61   CQTILCQPTGGKAKLTEGCSFRRKGD  86



>ref|XP_008369601.1| PREDICTED: 40S ribosomal protein S27-2 [Malus domestica]
 ref|XP_008390225.1| PREDICTED: 40S ribosomal protein S27-2 [Malus domestica]
 ref|XP_009353498.1| PREDICTED: 40S ribosomal protein S27-2 [Pyrus x bretschneideri]
 ref|XP_009359856.1| PREDICTED: 40S ribosomal protein S27-2 [Pyrus x bretschneideri]
 ref|XP_009339525.1| PREDICTED: 40S ribosomal protein S27-2 [Pyrus x bretschneideri]
Length=86

 Score =   150 bits (380),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 82/86 (95%), Positives = 85/86 (99%), Gaps = 0/86 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL NDIDLL+PPAELEK+KHKLKRLVQ+PNSFFMDVKCQGCFNITTVFSHSQTVVVCGN
Sbjct  1    MVLQNDIDLLHPPAELEKRKHKLKRLVQTPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  60

Query  297  CQTVLCQPTGGRARLTEGCSFRRKGD  374
            CQTVLCQPTGGRARLTEGCSFRRKGD
Sbjct  61   CQTVLCQPTGGRARLTEGCSFRRKGD  86



>gb|KGN46405.1| hypothetical protein Csa_6G091290 [Cucumis sativus]
Length=145

 Score =   152 bits (385),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 83/86 (97%), Positives = 85/86 (99%), Gaps = 0/86 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL NDIDLLNPPAELEK+KHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN
Sbjct  60   MVLQNDIDLLNPPAELEKRKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  119

Query  297  CQTVLCQPTGGRARLTEGCSFRRKGD  374
            CQTVLCQPTGGRA+LTEGCSFRRKGD
Sbjct  120  CQTVLCQPTGGRAKLTEGCSFRRKGD  145



>ref|XP_003548832.1| PREDICTED: 40S ribosomal protein S27-2 [Glycine max]
 gb|ACU14439.1| unknown [Glycine max]
 gb|KHN46833.1| 40S ribosomal protein S27-2 [Glycine soja]
Length=86

 Score =   150 bits (380),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 82/86 (95%), Positives = 84/86 (98%), Gaps = 0/86 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL NDIDLLNPP ELEK+KHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN
Sbjct  1    MVLQNDIDLLNPPVELEKRKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  60

Query  297  CQTVLCQPTGGRARLTEGCSFRRKGD  374
            CQTVLCQPTGGRARLTEGCSFR+KGD
Sbjct  61   CQTVLCQPTGGRARLTEGCSFRKKGD  86



>ref|XP_004494250.1| PREDICTED: 40S ribosomal protein S27-2-like [Cicer arietinum]
Length=86

 Score =   150 bits (380),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 82/86 (95%), Positives = 84/86 (98%), Gaps = 0/86 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL NDIDLLNPPAELEK+KHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN
Sbjct  1    MVLQNDIDLLNPPAELEKRKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  60

Query  297  CQTVLCQPTGGRARLTEGCSFRRKGD  374
            CQTVLCQP GGRARLTEGCSFR+KGD
Sbjct  61   CQTVLCQPNGGRARLTEGCSFRKKGD  86



>ref|XP_010506530.1| PREDICTED: 40S ribosomal protein S27-2-like [Camelina sativa]
Length=86

 Score =   150 bits (380),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 81/86 (94%), Positives = 85/86 (99%), Gaps = 0/86 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL NDIDLLNPPAELEK+KHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN
Sbjct  1    MVLQNDIDLLNPPAELEKRKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  60

Query  297  CQTVLCQPTGGRARLTEGCSFRRKGD  374
            CQTVLCQPTGG+A+LTEGCSFR+KGD
Sbjct  61   CQTVLCQPTGGKAKLTEGCSFRKKGD  86



>ref|XP_010695943.1| PREDICTED: 40S ribosomal protein S27-2 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010695944.1| PREDICTED: 40S ribosomal protein S27-2 [Beta vulgaris subsp. 
vulgaris]
Length=86

 Score =   150 bits (379),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 85/86 (99%), Positives = 85/86 (99%), Gaps = 0/86 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL NDIDLLNPPAELEKKKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN
Sbjct  1    MVLQNDIDLLNPPAELEKKKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  60

Query  297  CQTVLCQPTGGRARLTEGCSFRRKGD  374
            CQTVLCQPTGGRARLTEGCSFRRKGD
Sbjct  61   CQTVLCQPTGGRARLTEGCSFRRKGD  86



>emb|CDY53891.1| BnaA03g56930D [Brassica napus]
Length=93

 Score =   150 bits (380),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 82/90 (91%), Positives = 86/90 (96%), Gaps = 0/90 (0%)
 Frame = +3

Query  99   SSTFNTMVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQT  278
            S  FN +VL NDIDLLNPPAELEK+KHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQT
Sbjct  4    SLLFNHVVLQNDIDLLNPPAELEKRKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQT  63

Query  279  VVVCGNCQTVLCQPTGGRARLTEGCSFRRK  368
            VVVCGNCQTVLCQPTGG+ARLTEGCSFR+K
Sbjct  64   VVVCGNCQTVLCQPTGGKARLTEGCSFRKK  93



>ref|XP_010508123.1| PREDICTED: 40S ribosomal protein S27-2-like [Camelina sativa]
 ref|XP_010512439.1| PREDICTED: 40S ribosomal protein S27-2-like [Camelina sativa]
 ref|XP_010413493.1| PREDICTED: 40S ribosomal protein S27-2-like [Camelina sativa]
Length=86

 Score =   150 bits (379),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 80/86 (93%), Positives = 85/86 (99%), Gaps = 0/86 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL NDIDLLNPPAELEK+KHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN
Sbjct  1    MVLQNDIDLLNPPAELEKRKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  60

Query  297  CQTVLCQPTGGRARLTEGCSFRRKGD  374
            CQT+LCQPTGG+A+LTEGCSFR+KGD
Sbjct  61   CQTILCQPTGGKAKLTEGCSFRKKGD  86



>ref|XP_010523717.1| PREDICTED: 40S ribosomal protein S27-2-like [Tarenaya hassleriana]
Length=86

 Score =   150 bits (378),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 82/86 (95%), Positives = 84/86 (98%), Gaps = 0/86 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL NDID LNPPAELEK+KHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN
Sbjct  1    MVLQNDIDQLNPPAELEKRKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  60

Query  297  CQTVLCQPTGGRARLTEGCSFRRKGD  374
            CQTVLCQPTGG+ARLTEGCSFRRKGD
Sbjct  61   CQTVLCQPTGGKARLTEGCSFRRKGD  86



>ref|XP_002876593.1| ARS27A [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52852.1| ARS27A [Arabidopsis lyrata subsp. lyrata]
Length=86

 Score =   150 bits (378),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 80/86 (93%), Positives = 85/86 (99%), Gaps = 0/86 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL NDIDLLNPPAELEK+KHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVV+CGN
Sbjct  1    MVLQNDIDLLNPPAELEKRKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVMCGN  60

Query  297  CQTVLCQPTGGRARLTEGCSFRRKGD  374
            CQT+LCQPTGG+A+LTEGCSFRRKGD
Sbjct  61   CQTILCQPTGGKAKLTEGCSFRRKGD  86



>gb|EPS62677.1| hypothetical protein M569_12113, partial [Genlisea aurea]
Length=85

 Score =   150 bits (378),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 82/85 (96%), Positives = 84/85 (99%), Gaps = 0/85 (0%)
 Frame = +3

Query  120  VLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNC  299
            VLPNDIDLLNPPA+LEK+KHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNC
Sbjct  1    VLPNDIDLLNPPADLEKRKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNC  60

Query  300  QTVLCQPTGGRARLTEGCSFRRKGD  374
            QTVLCQPTGGRARLTEGCSFRRK D
Sbjct  61   QTVLCQPTGGRARLTEGCSFRRKVD  85



>ref|XP_004310130.1| PREDICTED: 40S ribosomal protein S27-2 [Fragaria vesca subsp. 
vesca]
Length=86

 Score =   149 bits (377),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 81/86 (94%), Positives = 85/86 (99%), Gaps = 0/86 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL NDIDLL+PPAELEK+KHKLKRLVQ+PNSFFMDVKCQGCFNITTVFSHSQTVVVCGN
Sbjct  1    MVLQNDIDLLHPPAELEKRKHKLKRLVQTPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  60

Query  297  CQTVLCQPTGGRARLTEGCSFRRKGD  374
            CQTVLCQPTGGRARLTEGCSFR+KGD
Sbjct  61   CQTVLCQPTGGRARLTEGCSFRKKGD  86



>ref|XP_010523008.1| PREDICTED: 40S ribosomal protein S27-2-like [Tarenaya hassleriana]
Length=86

 Score =   149 bits (377),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 84/86 (98%), Positives = 85/86 (99%), Gaps = 0/86 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL NDIDLLNPPAELEKKKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN
Sbjct  1    MVLQNDIDLLNPPAELEKKKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  60

Query  297  CQTVLCQPTGGRARLTEGCSFRRKGD  374
            CQTVLCQPTGG+ARLTEGCSFRRKGD
Sbjct  61   CQTVLCQPTGGKARLTEGCSFRRKGD  86



>ref|XP_007032056.1| Ribosomal protein S27 [Theobroma cacao]
 gb|EOY02982.1| Ribosomal protein S27 [Theobroma cacao]
 gb|KHG10770.1| 40S ribosomal S27-2 -like protein [Gossypium arboreum]
 gb|KHG17427.1| 40S ribosomal S27-2 -like protein [Gossypium arboreum]
 gb|KHG21580.1| 40S ribosomal S27-2 -like protein [Gossypium arboreum]
 gb|KHG28060.1| 40S ribosomal S27-2 -like protein [Gossypium arboreum]
 gb|KHG29636.1| 40S ribosomal S27-2 -like protein [Gossypium arboreum]
 gb|KJB08656.1| hypothetical protein B456_001G096100 [Gossypium raimondii]
 gb|KJB10377.1| hypothetical protein B456_001G197900 [Gossypium raimondii]
 gb|KJB22719.1| hypothetical protein B456_004G062400 [Gossypium raimondii]
 gb|KJB26427.1| hypothetical protein B456_004G240700 [Gossypium raimondii]
Length=86

 Score =   149 bits (377),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 84/86 (98%), Positives = 85/86 (99%), Gaps = 0/86 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL NDIDLLNPPAELEKKKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN
Sbjct  1    MVLQNDIDLLNPPAELEKKKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  60

Query  297  CQTVLCQPTGGRARLTEGCSFRRKGD  374
            CQTVLCQPTGGRARLTEGCSFR+KGD
Sbjct  61   CQTVLCQPTGGRARLTEGCSFRKKGD  86



>gb|ABK21973.1| unknown [Picea sitchensis]
 gb|ABK27002.1| unknown [Picea sitchensis]
 gb|ABR17568.1| unknown [Picea sitchensis]
 gb|ADE76476.1| unknown [Picea sitchensis]
Length=86

 Score =   149 bits (377),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 81/86 (94%), Positives = 85/86 (99%), Gaps = 0/86 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL NDIDLL+PPAELEK+KHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCG+
Sbjct  1    MVLSNDIDLLHPPAELEKRKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGS  60

Query  297  CQTVLCQPTGGRARLTEGCSFRRKGD  374
            CQTVLCQPTGGRARLTEGCSFR+KGD
Sbjct  61   CQTVLCQPTGGRARLTEGCSFRKKGD  86



>ref|XP_010442209.1| PREDICTED: 40S ribosomal protein S27-2-like [Camelina sativa]
Length=86

 Score =   149 bits (377),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 81/86 (94%), Positives = 84/86 (98%), Gaps = 0/86 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL NDIDLLNPPAELEK+KHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN
Sbjct  1    MVLQNDIDLLNPPAELEKRKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  60

Query  297  CQTVLCQPTGGRARLTEGCSFRRKGD  374
            CQTVLCQPTGG+ARL EGCSFR+KGD
Sbjct  61   CQTVLCQPTGGKARLQEGCSFRKKGD  86



>gb|EYU40953.1| hypothetical protein MIMGU_mgv1a017257mg [Erythranthe guttata]
Length=86

 Score =   149 bits (377),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 81/86 (94%), Positives = 83/86 (97%), Gaps = 0/86 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            M + ND DLLNPPAELEK+KHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN
Sbjct  1    MAVSNDYDLLNPPAELEKRKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  60

Query  297  CQTVLCQPTGGRARLTEGCSFRRKGD  374
            CQTVLCQPTGGRARLTEGCSFRRKGD
Sbjct  61   CQTVLCQPTGGRARLTEGCSFRRKGD  86



>ref|XP_006446889.1| hypothetical protein CICLE_v10017335mg [Citrus clementina]
 ref|XP_006446892.1| hypothetical protein CICLE_v10017332mg [Citrus clementina]
 ref|XP_006468930.1| PREDICTED: 40S ribosomal protein S27-2-like [Citrus sinensis]
 ref|XP_006468931.1| PREDICTED: 40S ribosomal protein S27-2-like [Citrus sinensis]
 gb|ESR60129.1| hypothetical protein CICLE_v10017335mg [Citrus clementina]
 gb|ESR60132.1| hypothetical protein CICLE_v10017332mg [Citrus clementina]
Length=86

 Score =   149 bits (377),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 84/86 (98%), Positives = 85/86 (99%), Gaps = 0/86 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL NDIDLLNPPAELEKKKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN
Sbjct  1    MVLQNDIDLLNPPAELEKKKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  60

Query  297  CQTVLCQPTGGRARLTEGCSFRRKGD  374
            CQ+VLCQPTGGRARLTEGCSFRRKGD
Sbjct  61   CQSVLCQPTGGRARLTEGCSFRRKGD  86



>ref|XP_006279439.1| hypothetical protein CARUB_v10007905mg, partial [Capsella rubella]
 gb|EOA12337.1| hypothetical protein CARUB_v10007905mg, partial [Capsella rubella]
Length=85

 Score =   149 bits (376),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 81/85 (95%), Positives = 84/85 (99%), Gaps = 0/85 (0%)
 Frame = +3

Query  120  VLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNC  299
            VL NDIDLLNPPAELEK+KHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNC
Sbjct  1    VLQNDIDLLNPPAELEKRKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNC  60

Query  300  QTVLCQPTGGRARLTEGCSFRRKGD  374
            QT+LCQPTGG+ARLTEGCSFRRKGD
Sbjct  61   QTILCQPTGGKARLTEGCSFRRKGD  85



>emb|CDY54522.1| BnaC07g49260D [Brassica napus]
Length=132

 Score =   150 bits (380),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 84/100 (84%), Positives = 88/100 (88%), Gaps = 3/100 (3%)
 Frame = +3

Query  69   LHTAAF*GFRSSTFNTMVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFN  248
             H A F  F  +    MVL NDIDLLNPPAELEK+KHKLKRLVQSPNSFFMDVKCQGCFN
Sbjct  36   FHQAVFAAFPQAA---MVLQNDIDLLNPPAELEKRKHKLKRLVQSPNSFFMDVKCQGCFN  92

Query  249  ITTVFSHSQTVVVCGNCQTVLCQPTGGRARLTEGCSFRRK  368
            ITTVFSHSQTVVVCGNCQTVLCQPTGG+ARLTEGCSFR+K
Sbjct  93   ITTVFSHSQTVVVCGNCQTVLCQPTGGKARLTEGCSFRKK  132



>ref|XP_004297596.1| PREDICTED: 40S ribosomal protein S27-2-like [Fragaria vesca subsp. 
vesca]
Length=86

 Score =   149 bits (376),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 80/86 (93%), Positives = 85/86 (99%), Gaps = 0/86 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL NDIDLL+PPA+LEK+KHKLKRLVQ+PNSFFMDVKCQGCFNITTVFSHSQTVVVCGN
Sbjct  1    MVLQNDIDLLHPPADLEKRKHKLKRLVQTPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  60

Query  297  CQTVLCQPTGGRARLTEGCSFRRKGD  374
            CQTVLCQPTGGRARLTEGCSFR+KGD
Sbjct  61   CQTVLCQPTGGRARLTEGCSFRKKGD  86



>ref|XP_010102910.1| 40S ribosomal protein S27-2 [Morus notabilis]
 gb|EXB94378.1| 40S ribosomal protein S27-2 [Morus notabilis]
Length=205

 Score =   153 bits (386),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 85/88 (97%), Positives = 85/88 (97%), Gaps = 0/88 (0%)
 Frame = +3

Query  111  NTMVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVC  290
            N  VL NDIDLLNPPAELEKKKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVC
Sbjct  118  NENVLQNDIDLLNPPAELEKKKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVC  177

Query  291  GNCQTVLCQPTGGRARLTEGCSFRRKGD  374
            GNCQTVLCQPTGGRARLTEGCSFRRKGD
Sbjct  178  GNCQTVLCQPTGGRARLTEGCSFRRKGD  205



>ref|XP_008390175.1| PREDICTED: 40S ribosomal protein S27-2-like [Malus domestica]
 ref|XP_008390688.1| PREDICTED: 40S ribosomal protein S27-2-like [Malus domestica]
 ref|XP_009378829.1| PREDICTED: 40S ribosomal protein S27-2-like [Pyrus x bretschneideri]
Length=86

 Score =   149 bits (376),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 81/86 (94%), Positives = 85/86 (99%), Gaps = 0/86 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL NDIDLL+PPAELEK+KHKLKRLVQ+PNSFFMDVKCQGCF+ITTVFSHSQTVVVCGN
Sbjct  1    MVLQNDIDLLHPPAELEKRKHKLKRLVQTPNSFFMDVKCQGCFSITTVFSHSQTVVVCGN  60

Query  297  CQTVLCQPTGGRARLTEGCSFRRKGD  374
            CQTVLCQPTGGRARLTEGCSFRRKGD
Sbjct  61   CQTVLCQPTGGRARLTEGCSFRRKGD  86



>ref|XP_009773562.1| PREDICTED: 40S ribosomal protein S27-2-like [Nicotiana sylvestris]
Length=86

 Score =   149 bits (376),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 80/86 (93%), Positives = 83/86 (97%), Gaps = 0/86 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL ND D LNPPA++EK+KHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN
Sbjct  1    MVLSNDYDSLNPPADVEKRKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  60

Query  297  CQTVLCQPTGGRARLTEGCSFRRKGD  374
            CQTVLCQPTGGRARLTEGCSFRRKGD
Sbjct  61   CQTVLCQPTGGRARLTEGCSFRRKGD  86



>ref|XP_010482041.1| PREDICTED: 40S ribosomal protein S27-2-like [Camelina sativa]
Length=137

 Score =   150 bits (380),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 81/86 (94%), Positives = 84/86 (98%), Gaps = 0/86 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL NDIDLLNPPAELEK+KHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN
Sbjct  52   MVLQNDIDLLNPPAELEKRKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  111

Query  297  CQTVLCQPTGGRARLTEGCSFRRKGD  374
            CQTVLCQPTGG+ARL EGCSFR+KGD
Sbjct  112  CQTVLCQPTGGKARLQEGCSFRKKGD  137



>ref|XP_007030948.1| Ribosomal protein S27 [Theobroma cacao]
 gb|EOY11450.1| Ribosomal protein S27 [Theobroma cacao]
Length=86

 Score =   149 bits (376),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 83/86 (97%), Positives = 85/86 (99%), Gaps = 0/86 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL ND+DLLNPPAELEKKKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN
Sbjct  1    MVLQNDVDLLNPPAELEKKKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  60

Query  297  CQTVLCQPTGGRARLTEGCSFRRKGD  374
            CQTVLCQPTGGRARLTEGCSFR+KGD
Sbjct  61   CQTVLCQPTGGRARLTEGCSFRKKGD  86



>emb|CDP18996.1| unnamed protein product [Coffea canephora]
Length=111

 Score =   149 bits (377),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 83/90 (92%), Positives = 87/90 (97%), Gaps = 1/90 (1%)
 Frame = +3

Query  108  FNTM-VLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVV  284
            FN + VLPND+DLLNPPA+LEK+KHKLKRLV SPNSFFMDVKCQGCFNITTVFSHSQTVV
Sbjct  22   FNHLKVLPNDVDLLNPPADLEKRKHKLKRLVPSPNSFFMDVKCQGCFNITTVFSHSQTVV  81

Query  285  VCGNCQTVLCQPTGGRARLTEGCSFRRKGD  374
            VCGNCQTVLCQPTGGRARLTEGCSFRRKGD
Sbjct  82   VCGNCQTVLCQPTGGRARLTEGCSFRRKGD  111



>gb|ABK20991.1| unknown [Picea sitchensis]
 gb|ABK21223.1| unknown [Picea sitchensis]
 gb|ABR17755.1| unknown [Picea sitchensis]
Length=86

 Score =   148 bits (374),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 80/86 (93%), Positives = 85/86 (99%), Gaps = 0/86 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL NDIDLL+PPAELEK+KHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCG+
Sbjct  1    MVLSNDIDLLHPPAELEKRKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGS  60

Query  297  CQTVLCQPTGGRARLTEGCSFRRKGD  374
            CQTVLCQPTGG+ARLTEGCSFR+KGD
Sbjct  61   CQTVLCQPTGGKARLTEGCSFRKKGD  86



>emb|CAB71041.1| ribosomal protein S27 [Arabidopsis thaliana]
Length=85

 Score =   148 bits (374),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 80/85 (94%), Positives = 84/85 (99%), Gaps = 0/85 (0%)
 Frame = +3

Query  120  VLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNC  299
            VL NDIDLLNPPAELEK+KHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNC
Sbjct  1    VLQNDIDLLNPPAELEKRKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNC  60

Query  300  QTVLCQPTGGRARLTEGCSFRRKGD  374
            QT+LCQPTGG+A+LTEGCSFRRKGD
Sbjct  61   QTILCQPTGGKAKLTEGCSFRRKGD  85



>ref|XP_002297884.1| ribosomal protein S27 [Populus trichocarpa]
 ref|XP_006381907.1| hypothetical protein POPTR_0006s20730g [Populus trichocarpa]
 ref|XP_006381908.1| hypothetical protein POPTR_0006s20730g [Populus trichocarpa]
 ref|XP_011020912.1| PREDICTED: 40S ribosomal protein S27-2 [Populus euphratica]
 ref|XP_011036211.1| PREDICTED: 40S ribosomal protein S27-2 [Populus euphratica]
 ref|XP_011004842.1| PREDICTED: 40S ribosomal protein S27-2 [Populus euphratica]
 ref|XP_011013242.1| PREDICTED: 40S ribosomal protein S27-2 [Populus euphratica]
 gb|ABK92659.1| unknown [Populus trichocarpa]
 gb|ABK93328.1| unknown [Populus trichocarpa]
 gb|ABK93442.1| unknown [Populus trichocarpa]
 gb|ABK93598.1| unknown [Populus trichocarpa]
 gb|ABK93927.1| unknown [Populus trichocarpa]
 gb|ABK94171.1| unknown [Populus trichocarpa]
 gb|EEE82689.1| ribosomal protein S27 [Populus trichocarpa]
 gb|ERP59704.1| hypothetical protein POPTR_0006s20730g [Populus trichocarpa]
 gb|ERP59705.1| hypothetical protein POPTR_0006s20730g [Populus trichocarpa]
Length=86

 Score =   148 bits (374),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 80/86 (93%), Positives = 84/86 (98%), Gaps = 0/86 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL NDIDLLNPPAELEK+KHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN
Sbjct  1    MVLQNDIDLLNPPAELEKRKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  60

Query  297  CQTVLCQPTGGRARLTEGCSFRRKGD  374
            CQTVLCQPTGGRA+LTEGCSFR+K +
Sbjct  61   CQTVLCQPTGGRAKLTEGCSFRKKSE  86



>emb|CDY35762.1| BnaC02g38320D [Brassica napus]
Length=135

 Score =   149 bits (377),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 81/85 (95%), Positives = 84/85 (99%), Gaps = 0/85 (0%)
 Frame = +3

Query  114  TMVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCG  293
            TMVL NDIDLLNPPAELEK+KHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCG
Sbjct  51   TMVLQNDIDLLNPPAELEKRKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCG  110

Query  294  NCQTVLCQPTGGRARLTEGCSFRRK  368
            NCQTVLCQPTGG+ARLTEGCSFR+K
Sbjct  111  NCQTVLCQPTGGKARLTEGCSFRKK  135



>ref|XP_002304634.2| hypothetical protein POPTR_0003s15960g, partial [Populus trichocarpa]
 gb|EEE79613.2| hypothetical protein POPTR_0003s15960g, partial [Populus trichocarpa]
Length=125

 Score =   149 bits (376),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 80/86 (93%), Positives = 84/86 (98%), Gaps = 0/86 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL NDIDLLNPPAELEK+KHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN
Sbjct  40   MVLQNDIDLLNPPAELEKRKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  99

Query  297  CQTVLCQPTGGRARLTEGCSFRRKGD  374
            CQTVLCQPTGGRA+LTEGCSFR+K +
Sbjct  100  CQTVLCQPTGGRAKLTEGCSFRKKSE  125



>ref|XP_007049127.1| Ribosomal protein S27 [Theobroma cacao]
 gb|EOX93284.1| Ribosomal protein S27 [Theobroma cacao]
 gb|KJB82615.1| hypothetical protein B456_013G205000 [Gossypium raimondii]
Length=86

 Score =   147 bits (372),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 83/86 (97%), Positives = 84/86 (98%), Gaps = 0/86 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL NDIDLLNPP ELEKKKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN
Sbjct  1    MVLQNDIDLLNPPVELEKKKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  60

Query  297  CQTVLCQPTGGRARLTEGCSFRRKGD  374
            CQTVLCQPTGGRARLTEGCSFR+KGD
Sbjct  61   CQTVLCQPTGGRARLTEGCSFRKKGD  86



>emb|CDY45678.1| BnaCnng13430D [Brassica napus]
Length=125

 Score =   149 bits (375),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 80/84 (95%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL NDIDLLNPPAELEK+KHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN
Sbjct  42   MVLQNDIDLLNPPAELEKRKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  101

Query  297  CQTVLCQPTGGRARLTEGCSFRRK  368
            CQTVLCQPTGG+ARLTEGCSFR+K
Sbjct  102  CQTVLCQPTGGKARLTEGCSFRKK  125



>gb|KJB08657.1| hypothetical protein B456_001G096100 [Gossypium raimondii]
Length=118

 Score =   148 bits (374),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 83/85 (98%), Positives = 84/85 (99%), Gaps = 0/85 (0%)
 Frame = +3

Query  120  VLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNC  299
            VL NDIDLLNPPAELEKKKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNC
Sbjct  34   VLQNDIDLLNPPAELEKKKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNC  93

Query  300  QTVLCQPTGGRARLTEGCSFRRKGD  374
            QTVLCQPTGGRARLTEGCSFR+KGD
Sbjct  94   QTVLCQPTGGRARLTEGCSFRKKGD  118



>gb|KFK37361.1| hypothetical protein AALP_AA4G246600 [Arabis alpina]
Length=86

 Score =   147 bits (371),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 81/86 (94%), Positives = 83/86 (97%), Gaps = 0/86 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL NDIDLLNPP ELEK+KHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN
Sbjct  1    MVLQNDIDLLNPPVELEKRKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  60

Query  297  CQTVLCQPTGGRARLTEGCSFRRKGD  374
            CQTVLCQPTGG+ARLTEGCSFRRK D
Sbjct  61   CQTVLCQPTGGKARLTEGCSFRRKLD  86



>gb|ABK94313.1| unknown [Populus trichocarpa]
Length=86

 Score =   147 bits (371),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 79/86 (92%), Positives = 84/86 (98%), Gaps = 0/86 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL NDIDLLNPPAELEK+KHKLKRLVQ+PNSFFMDVKCQGCFNITTVFSHSQTVVVCGN
Sbjct  1    MVLQNDIDLLNPPAELEKRKHKLKRLVQTPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  60

Query  297  CQTVLCQPTGGRARLTEGCSFRRKGD  374
            CQTVLCQPTGGRA+LTEGCSFR+K +
Sbjct  61   CQTVLCQPTGGRAKLTEGCSFRKKSE  86



>emb|CDY45920.1| BnaAnng08010D [Brassica napus]
Length=136

 Score =   149 bits (375),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 81/85 (95%), Positives = 84/85 (99%), Gaps = 0/85 (0%)
 Frame = +3

Query  114  TMVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCG  293
            TMVL NDIDLLNPPAELEK+KHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCG
Sbjct  52   TMVLQNDIDLLNPPAELEKRKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCG  111

Query  294  NCQTVLCQPTGGRARLTEGCSFRRK  368
            NCQTVLCQPTGG+ARLTEGCSFR+K
Sbjct  112  NCQTVLCQPTGGKARLTEGCSFRKK  136



>gb|AGU28439.1| ribosomal protein S27 [Sinapis alba]
Length=85

 Score =   147 bits (371),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 80/84 (95%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL NDIDLLNPPAELEK+KHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN
Sbjct  1    MVLQNDIDLLNPPAELEKRKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  60

Query  297  CQTVLCQPTGGRARLTEGCSFRRK  368
            CQTVLCQPTGG+ARLTEGCSFR+K
Sbjct  61   CQTVLCQPTGGKARLTEGCSFRKK  84



>gb|ACH63219.1| ribosomal protein S27-like protein [Rheum australe]
Length=86

 Score =   147 bits (371),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 83/86 (97%), Positives = 83/86 (97%), Gaps = 0/86 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL NDIDLLNPP ELEKKKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN
Sbjct  1    MVLQNDIDLLNPPVELEKKKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  60

Query  297  CQTVLCQPTGGRARLTEGCSFRRKGD  374
            CQ VLCQPTGGRARLTEGCSFRRKGD
Sbjct  61   CQAVLCQPTGGRARLTEGCSFRRKGD  86



>emb|CDY27365.1| BnaC04g50400D [Brassica napus]
Length=91

 Score =   147 bits (371),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 80/84 (95%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL NDIDLLNPPAELEK+KHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN
Sbjct  8    MVLQNDIDLLNPPAELEKRKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  67

Query  297  CQTVLCQPTGGRARLTEGCSFRRK  368
            CQTVLCQPTGG+ARLTEGCSFR+K
Sbjct  68   CQTVLCQPTGGKARLTEGCSFRKK  91



>ref|XP_009129700.1| PREDICTED: 40S ribosomal protein S27-2 [Brassica rapa]
 ref|XP_009142358.1| PREDICTED: 40S ribosomal protein S27-2 [Brassica rapa]
 ref|XP_009151598.1| PREDICTED: 40S ribosomal protein S27-2 [Brassica rapa]
 ref|XP_009104290.1| PREDICTED: 40S ribosomal protein S27-2 [Brassica rapa]
 ref|XP_009111820.1| PREDICTED: 40S ribosomal protein S27-2 [Brassica rapa]
 ref|XP_009116770.1| PREDICTED: 40S ribosomal protein S27-2 [Brassica rapa]
 gb|ABL97986.1| ribosomal protein S27 [Brassica rapa]
 gb|KFK35310.1| hypothetical protein AALP_AA5G267800 [Arabis alpina]
Length=84

 Score =   147 bits (370),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 80/84 (95%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL NDIDLLNPPAELEK+KHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN
Sbjct  1    MVLQNDIDLLNPPAELEKRKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  60

Query  297  CQTVLCQPTGGRARLTEGCSFRRK  368
            CQTVLCQPTGG+ARLTEGCSFR+K
Sbjct  61   CQTVLCQPTGGKARLTEGCSFRKK  84



>ref|XP_006279437.1| hypothetical protein CARUB_v10007902mg [Capsella rubella]
 gb|EOA12335.1| hypothetical protein CARUB_v10007902mg [Capsella rubella]
Length=83

 Score =   147 bits (370),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 79/82 (96%), Positives = 82/82 (100%), Gaps = 0/82 (0%)
 Frame = +3

Query  129  NDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQTV  308
            NDIDLLNPPAELEK+KHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQT+
Sbjct  2    NDIDLLNPPAELEKRKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQTI  61

Query  309  LCQPTGGRARLTEGCSFRRKGD  374
            LCQPTGG+ARLTEGCSFRRKGD
Sbjct  62   LCQPTGGKARLTEGCSFRRKGD  83



>ref|XP_009133746.1| PREDICTED: 40S ribosomal protein S27-2-like [Brassica rapa]
Length=84

 Score =   146 bits (369),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 79/84 (94%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL NDIDLLNPPAELEK+KHKLKRL+QSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN
Sbjct  1    MVLQNDIDLLNPPAELEKRKHKLKRLIQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  60

Query  297  CQTVLCQPTGGRARLTEGCSFRRK  368
            CQTVLCQPTGG+ARLTEGCSFR+K
Sbjct  61   CQTVLCQPTGGKARLTEGCSFRKK  84



>ref|XP_006418083.1| hypothetical protein EUTSA_v10009228mg [Eutrema salsugineum]
 ref|XP_006402520.1| hypothetical protein EUTSA_v10006345mg [Eutrema salsugineum]
 dbj|BAJ34536.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ36436.1| hypothetical protein EUTSA_v10009228mg [Eutrema salsugineum]
 gb|ESQ43973.1| hypothetical protein EUTSA_v10006345mg [Eutrema salsugineum]
Length=84

 Score =   146 bits (369),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 79/84 (94%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL NDIDLLNPPAELEK+KHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN
Sbjct  1    MVLQNDIDLLNPPAELEKRKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  60

Query  297  CQTVLCQPTGGRARLTEGCSFRRK  368
            CQT+LCQPTGG+ARLTEGCSFR+K
Sbjct  61   CQTILCQPTGGKARLTEGCSFRKK  84



>ref|XP_007226686.1| hypothetical protein PRUPE_ppa020777mg, partial [Prunus persica]
 gb|EMJ27885.1| hypothetical protein PRUPE_ppa020777mg, partial [Prunus persica]
Length=85

 Score =   146 bits (369),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 81/85 (95%), Positives = 83/85 (98%), Gaps = 0/85 (0%)
 Frame = +3

Query  120  VLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNC  299
            VL NDIDLL+PPAELEK+KHKLKRLVQ PNSFFMDVKCQGCFNITTVFSHSQTVVVCGNC
Sbjct  1    VLQNDIDLLHPPAELEKRKHKLKRLVQCPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNC  60

Query  300  QTVLCQPTGGRARLTEGCSFRRKGD  374
            QTVLCQPTGGRARLTEGCSFRRKGD
Sbjct  61   QTVLCQPTGGRARLTEGCSFRRKGD  85



>gb|EYU40950.1| hypothetical protein MIMGU_mgv1a021290mg, partial [Erythranthe 
guttata]
Length=85

 Score =   146 bits (368),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 80/82 (98%), Positives = 81/82 (99%), Gaps = 0/82 (0%)
 Frame = +3

Query  129  NDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQTV  308
            ND DLLNPPAELEK+KHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQTV
Sbjct  4    NDYDLLNPPAELEKRKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQTV  63

Query  309  LCQPTGGRARLTEGCSFRRKGD  374
            LCQPTGGRARLTEGCSFRRKGD
Sbjct  64   LCQPTGGRARLTEGCSFRRKGD  85



>emb|CDY37058.1| BnaA04g26360D [Brassica napus]
Length=86

 Score =   145 bits (367),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 79/85 (93%), Positives = 83/85 (98%), Gaps = 0/85 (0%)
 Frame = +3

Query  114  TMVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCG  293
            + VL NDIDLLNPPAELEK+KHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCG
Sbjct  2    SQVLQNDIDLLNPPAELEKRKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCG  61

Query  294  NCQTVLCQPTGGRARLTEGCSFRRK  368
            NCQTVLCQPTGG+ARLTEGCSFR+K
Sbjct  62   NCQTVLCQPTGGKARLTEGCSFRKK  86



>gb|KHN28606.1| 40S ribosomal protein S27-2 [Glycine soja]
Length=85

 Score =   145 bits (367),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 82/86 (95%), Positives = 84/86 (98%), Gaps = 1/86 (1%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL NDIDLLNPPAELEK+KHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN
Sbjct  1    MVLQNDIDLLNPPAELEKRKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  60

Query  297  CQTVLCQPTGGRARLTEGCSFRRKGD  374
            CQTVLCQPT GRARLTEGCSFR+KGD
Sbjct  61   CQTVLCQPT-GRARLTEGCSFRKKGD  85



>gb|ABK96570.1| unknown [Populus trichocarpa x Populus deltoides]
Length=86

 Score =   145 bits (367),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 79/86 (92%), Positives = 83/86 (97%), Gaps = 0/86 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL NDIDLLNPPAELEK+KHKLKRLVQSPNSFFMDVKCQGCFNITTV SHSQTVVVCGN
Sbjct  1    MVLQNDIDLLNPPAELEKRKHKLKRLVQSPNSFFMDVKCQGCFNITTVSSHSQTVVVCGN  60

Query  297  CQTVLCQPTGGRARLTEGCSFRRKGD  374
            CQTVLCQPTGGRA+LTEGCSFR+K +
Sbjct  61   CQTVLCQPTGGRAKLTEGCSFRKKSE  86



>ref|XP_006395228.1| hypothetical protein EUTSA_v10005209mg [Eutrema salsugineum]
 gb|ESQ32514.1| hypothetical protein EUTSA_v10005209mg [Eutrema salsugineum]
Length=84

 Score =   145 bits (366),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 79/84 (94%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL NDIDLL+PPAELEK+KHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN
Sbjct  1    MVLQNDIDLLSPPAELEKRKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  60

Query  297  CQTVLCQPTGGRARLTEGCSFRRK  368
            CQTVLCQPTGG+ARLTEGCSFR+K
Sbjct  61   CQTVLCQPTGGKARLTEGCSFRKK  84



>ref|XP_002880192.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56451.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=86

 Score =   145 bits (366),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 79/86 (92%), Positives = 83/86 (97%), Gaps = 0/86 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL NDIDLLNPPAELEK+KHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN
Sbjct  1    MVLQNDIDLLNPPAELEKRKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  60

Query  297  CQTVLCQPTGGRARLTEGCSFRRKGD  374
            CQT+LC PTGG+A LTEGCSFR+KGD
Sbjct  61   CQTLLCTPTGGKAMLTEGCSFRKKGD  86



>ref|XP_002865574.1| ribosomal protein S27 [Arabidopsis lyrata subsp. lyrata]
 ref|XP_010439077.1| PREDICTED: 40S ribosomal protein S27-3 [Camelina sativa]
 gb|EFH41833.1| ribosomal protein S27 [Arabidopsis lyrata subsp. lyrata]
Length=84

 Score =   145 bits (366),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 79/84 (94%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL NDIDLLNPPAELEK+KHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN
Sbjct  1    MVLQNDIDLLNPPAELEKRKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  60

Query  297  CQTVLCQPTGGRARLTEGCSFRRK  368
            CQTVLCQPTGG+ARL EGCSFR+K
Sbjct  61   CQTVLCQPTGGKARLQEGCSFRKK  84



>emb|CDY67291.1| BnaCnng54330D [Brassica napus]
Length=120

 Score =   146 bits (369),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 81/89 (91%), Positives = 84/89 (94%), Gaps = 0/89 (0%)
 Frame = +3

Query  102  STFNTMVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTV  281
            S    MVL NDIDLLNPPAELEK+KHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTV
Sbjct  32   SNKTIMVLQNDIDLLNPPAELEKRKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTV  91

Query  282  VVCGNCQTVLCQPTGGRARLTEGCSFRRK  368
            VVCGNCQTVLCQPTGG+ARLTEGCSFR+K
Sbjct  92   VVCGNCQTVLCQPTGGKARLTEGCSFRKK  120



>ref|XP_003083456.1| 40s ribosomal protein S27 (ISS) [Ostreococcus tauri]
Length=100

 Score =   145 bits (367),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 76/87 (87%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = +3

Query  114  TMVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCG  293
            T VL  DIDLLNPPA LE  KHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVV+CG
Sbjct  14   TQVLAQDIDLLNPPAALEAGKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVLCG  73

Query  294  NCQTVLCQPTGGRARLTEGCSFRRKGD  374
            +C  VLCQPTGG+ARLTEGCSFRRKGD
Sbjct  74   SCSAVLCQPTGGKARLTEGCSFRRKGD  100



>gb|EAY85847.1| hypothetical protein OsI_07209 [Oryza sativa Indica Group]
Length=86

 Score =   145 bits (365),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 80/86 (93%), Positives = 81/86 (94%), Gaps = 0/86 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL NDIDLLNPPAELEK KHK KRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVC  
Sbjct  1    MVLSNDIDLLNPPAELEKHKHKKKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCPG  60

Query  297  CQTVLCQPTGGRARLTEGCSFRRKGD  374
            CQTVLCQPTGG+ARLTEGCSFRRKGD
Sbjct  61   CQTVLCQPTGGKARLTEGCSFRRKGD  86



>emb|CDY52337.1| BnaA09g38860D [Brassica napus]
 emb|CDX71764.1| BnaC08g31100D [Brassica napus]
 emb|CDX67852.1| BnaA07g18920D [Brassica napus]
Length=86

 Score =   145 bits (365),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 79/83 (95%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  120  VLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNC  299
            VL NDIDLLNPPAELEK+KHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNC
Sbjct  4    VLQNDIDLLNPPAELEKRKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNC  63

Query  300  QTVLCQPTGGRARLTEGCSFRRK  368
            QTVLCQPTGG+ARLTEGCSFR+K
Sbjct  64   QTVLCQPTGGKARLTEGCSFRKK  86



>emb|CDY19967.1| BnaA09g02840D [Brassica napus]
Length=88

 Score =   145 bits (365),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 79/85 (93%), Positives = 83/85 (98%), Gaps = 0/85 (0%)
 Frame = +3

Query  114  TMVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCG  293
            + VL NDIDLLNPPAELEK+KHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCG
Sbjct  4    SQVLQNDIDLLNPPAELEKRKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCG  63

Query  294  NCQTVLCQPTGGRARLTEGCSFRRK  368
            NCQTVLCQPTGG+ARLTEGCSFR+K
Sbjct  64   NCQTVLCQPTGGKARLTEGCSFRKK  88



>ref|XP_001755320.1| predicted protein [Physcomitrella patens]
 ref|XP_001763758.1| predicted protein [Physcomitrella patens]
 ref|XP_001773625.1| predicted protein [Physcomitrella patens]
 gb|EDQ61513.1| predicted protein [Physcomitrella patens]
 gb|EDQ71400.1| predicted protein [Physcomitrella patens]
 gb|EDQ79800.1| predicted protein [Physcomitrella patens]
Length=86

 Score =   145 bits (365),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 78/86 (91%), Positives = 84/86 (98%), Gaps = 0/86 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL NDIDLL+PPAELEK+KHKLKRLVQSPNSFFMDVKCQGCF+ITTVFSHSQTVV+CG+
Sbjct  1    MVLSNDIDLLHPPAELEKRKHKLKRLVQSPNSFFMDVKCQGCFSITTVFSHSQTVVLCGS  60

Query  297  CQTVLCQPTGGRARLTEGCSFRRKGD  374
            C TVLCQPTGGRARLTEGCSFR+KGD
Sbjct  61   CSTVLCQPTGGRARLTEGCSFRKKGD  86



>gb|KIZ01143.1| 40S ribosomal protein S27-2 [Monoraphidium neglectum]
Length=86

 Score =   145 bits (365),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 79/86 (92%), Positives = 83/86 (97%), Gaps = 0/86 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL +DIDLLNPPAELEK+KHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVV+CG+
Sbjct  1    MVLHSDIDLLNPPAELEKQKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVLCGS  60

Query  297  CQTVLCQPTGGRARLTEGCSFRRKGD  374
            C TVLC PTGGRARLTEGCSFRRKGD
Sbjct  61   CSTVLCTPTGGRARLTEGCSFRRKGD  86



>gb|KHG04899.1| 40S ribosomal S27-2 -like protein [Gossypium arboreum]
 gb|KJB45262.1| hypothetical protein B456_007G298000 [Gossypium raimondii]
Length=86

 Score =   145 bits (365),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 81/86 (94%), Positives = 84/86 (98%), Gaps = 0/86 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            M L NDIDLLNPPAELEKKKHKLKRLVQ+PNSFFMDVKCQGCFNITTVFSHSQTVVVCGN
Sbjct  1    MGLQNDIDLLNPPAELEKKKHKLKRLVQTPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  60

Query  297  CQTVLCQPTGGRARLTEGCSFRRKGD  374
            CQTVLCQPTGG+ARLTEGCSFR+KGD
Sbjct  61   CQTVLCQPTGGKARLTEGCSFRKKGD  86



>emb|CEG00244.1| Ribosomal protein S27e, zinc-binding domain [Ostreococcus tauri]
Length=86

 Score =   145 bits (365),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 76/86 (88%), Positives = 79/86 (92%), Gaps = 0/86 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL  DIDLLNPPA LE  KHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVV+CG+
Sbjct  1    MVLAQDIDLLNPPAALEAGKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVLCGS  60

Query  297  CQTVLCQPTGGRARLTEGCSFRRKGD  374
            C  VLCQPTGG+ARLTEGCSFRRKGD
Sbjct  61   CSAVLCQPTGGKARLTEGCSFRRKGD  86



>ref|XP_003060837.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH54487.1| predicted protein [Micromonas pusilla CCMP1545]
Length=86

 Score =   144 bits (364),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 76/86 (88%), Positives = 80/86 (93%), Gaps = 0/86 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL  DIDLL+PPA LE +KHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVV+CG+
Sbjct  1    MVLAQDIDLLHPPAALEARKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVLCGS  60

Query  297  CQTVLCQPTGGRARLTEGCSFRRKGD  374
            C  VLCQPTGGRARLTEGCSFRRKGD
Sbjct  61   CSAVLCQPTGGRARLTEGCSFRRKGD  86



>ref|XP_009405158.1| PREDICTED: 40S ribosomal protein S27-3-like [Musa acuminata subsp. 
malaccensis]
Length=92

 Score =   144 bits (364),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 77/85 (91%), Positives = 81/85 (95%), Gaps = 0/85 (0%)
 Frame = +3

Query  120  VLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNC  299
            VLP DIDLL+PP ELEK++HK KRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVV+CGNC
Sbjct  8    VLPGDIDLLDPPPELEKRRHKKKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVICGNC  67

Query  300  QTVLCQPTGGRARLTEGCSFRRKGD  374
            QTVLCQPTGGRARLTEGCSFRRK D
Sbjct  68   QTVLCQPTGGRARLTEGCSFRRKTD  92



>ref|XP_010090115.1| Protein Brevis radix-like 4 [Morus notabilis]
 gb|EXB38912.1| Protein Brevis radix-like 4 [Morus notabilis]
Length=522

 Score =   155 bits (391),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 84/85 (99%), Positives = 84/85 (99%), Gaps = 0/85 (0%)
 Frame = +3

Query  120  VLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNC  299
            VL NDIDLLNPPAELEKKKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNC
Sbjct  438  VLQNDIDLLNPPAELEKKKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNC  497

Query  300  QTVLCQPTGGRARLTEGCSFRRKGD  374
            QTVLCQPTGGRARLTEGCSFRRKGD
Sbjct  498  QTVLCQPTGGRARLTEGCSFRRKGD  522



>ref|XP_003574974.1| PREDICTED: 40S ribosomal protein S27-like [Brachypodium distachyon]
Length=86

 Score =   144 bits (364),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 79/86 (92%), Positives = 81/86 (94%), Gaps = 0/86 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL NDIDLLNPP ELEK+KHK KRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVC  
Sbjct  1    MVLQNDIDLLNPPPELEKRKHKKKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCPG  60

Query  297  CQTVLCQPTGGRARLTEGCSFRRKGD  374
            CQTVLCQPTGG+ARLTEGCSFRRKGD
Sbjct  61   CQTVLCQPTGGKARLTEGCSFRRKGD  86



>ref|NP_001046847.1| Os02g0478700 [Oryza sativa Japonica Group]
 pdb|3J60|BB Chain b, Localization Of The Small Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
 dbj|BAD22060.1| 40S ribosomal protein S27 [Oryza sativa Japonica Group]
 dbj|BAF08761.1| Os02g0478700 [Oryza sativa Japonica Group]
 gb|EEE56990.1| hypothetical protein OsJ_06730 [Oryza sativa Japonica Group]
Length=86

 Score =   144 bits (363),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 80/86 (93%), Positives = 81/86 (94%), Gaps = 0/86 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL NDIDLLNPPAELEK KHK KRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVC  
Sbjct  1    MVLSNDIDLLNPPAELEKLKHKKKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCPG  60

Query  297  CQTVLCQPTGGRARLTEGCSFRRKGD  374
            CQTVLCQPTGG+ARLTEGCSFRRKGD
Sbjct  61   CQTVLCQPTGGKARLTEGCSFRRKGD  86



>ref|XP_001767364.1| predicted protein [Physcomitrella patens]
 gb|EDQ67855.1| predicted protein [Physcomitrella patens]
Length=86

 Score =   144 bits (363),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 77/86 (90%), Positives = 83/86 (97%), Gaps = 0/86 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL NDIDLL+PPAELEK KHKLKRLVQSPNSFFMDVKCQGCF+ITTVFSHSQTVV+CG+
Sbjct  1    MVLSNDIDLLHPPAELEKTKHKLKRLVQSPNSFFMDVKCQGCFSITTVFSHSQTVVLCGS  60

Query  297  CQTVLCQPTGGRARLTEGCSFRRKGD  374
            C TVLCQPTGGRARLTEGCSFR+KG+
Sbjct  61   CSTVLCQPTGGRARLTEGCSFRKKGE  86



>gb|KJB82614.1| hypothetical protein B456_013G205000 [Gossypium raimondii]
Length=89

 Score =   144 bits (363),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 81/86 (94%), Positives = 82/86 (95%), Gaps = 0/86 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL NDIDLLNPP ELEKKKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN
Sbjct  1    MVLQNDIDLLNPPVELEKKKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  60

Query  297  CQTVLCQPTGGRARLTEGCSFRRKGD  374
            CQTVLCQPTGGRARLTEGCSFR+K  
Sbjct  61   CQTVLCQPTGGRARLTEGCSFRKKAS  86



>emb|CDY18908.1| BnaC04g04420D [Brassica napus]
Length=116

 Score =   145 bits (365),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 77/85 (91%), Positives = 82/85 (96%), Gaps = 0/85 (0%)
 Frame = +3

Query  114  TMVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCG  293
            ++VL NDI LLNPPAELEK+KHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVV CG
Sbjct  32   SLVLQNDIHLLNPPAELEKRKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVACG  91

Query  294  NCQTVLCQPTGGRARLTEGCSFRRK  368
            NCQTVLCQPTGG+ARLTEGCSFR+K
Sbjct  92   NCQTVLCQPTGGKARLTEGCSFRKK  116



>ref|XP_003579638.1| PREDICTED: 40S ribosomal protein S27 [Brachypodium distachyon]
 sp|Q96564.2|RS27_HORVU RecName: Full=40S ribosomal protein S27; AltName: Full=Manganese 
efficiency-related protein 1 [Hordeum vulgare]
 emb|CAA59732.2| putative zinc finger protein [Hordeum vulgare subsp. vulgare]
 emb|CAC42134.1| putative ribosomal protein S27 [Hordeum vulgare subsp. vulgare]
 emb|CAC42162.1| putative ribosomal protein S27 [Hordeum vulgare subsp. vulgare]
 emb|CAC42163.1| putative ribosomal protein S27 [Hordeum vulgare subsp. vulgare]
 dbj|BAK06053.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|EMT10015.1| 40S ribosomal protein S27 [Aegilops tauschii]
Length=86

 Score =   144 bits (362),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 80/86 (93%), Positives = 81/86 (94%), Gaps = 0/86 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL NDIDLLNPPAELEK KHK KRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVC  
Sbjct  1    MVLQNDIDLLNPPAELEKLKHKKKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCPG  60

Query  297  CQTVLCQPTGGRARLTEGCSFRRKGD  374
            CQTVLCQPTGG+ARLTEGCSFRRKGD
Sbjct  61   CQTVLCQPTGGKARLTEGCSFRRKGD  86



>gb|AAM66954.1| ribosomal protein S27 [Arabidopsis thaliana]
Length=84

 Score =   144 bits (362),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL NDIDLL+PPAELEK+KHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN
Sbjct  1    MVLQNDIDLLHPPAELEKRKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  60

Query  297  CQTVLCQPTGGRARLTEGCSFRRK  368
            CQTVLCQPTGG+ARL EGCSFR+K
Sbjct  61   CQTVLCQPTGGKARLQEGCSFRKK  84



>ref|XP_006652184.1| PREDICTED: 40S ribosomal protein S27-like [Oryza brachyantha]
Length=86

 Score =   143 bits (361),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 78/86 (91%), Positives = 81/86 (94%), Gaps = 0/86 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL NDIDLLNPPAELEK+KHK KRLVQSPNSFFMDVKCQGCF+ITTVFSHSQTVVVC  
Sbjct  1    MVLQNDIDLLNPPAELEKRKHKKKRLVQSPNSFFMDVKCQGCFSITTVFSHSQTVVVCPG  60

Query  297  CQTVLCQPTGGRARLTEGCSFRRKGD  374
            CQTVLCQPTGG+ARLTEGCSFRRK D
Sbjct  61   CQTVLCQPTGGKARLTEGCSFRRKSD  86



>ref|XP_002502728.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO63986.1| predicted protein [Micromonas sp. RCC299]
Length=86

 Score =   143 bits (361),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/86 (86%), Positives = 80/86 (93%), Gaps = 0/86 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL  DIDLL+PPA LE ++HKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVV+CG+
Sbjct  1    MVLAQDIDLLHPPAALEARRHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVLCGS  60

Query  297  CQTVLCQPTGGRARLTEGCSFRRKGD  374
            C  VLCQPTGG+ARLTEGCSFRRKGD
Sbjct  61   CSAVLCQPTGGKARLTEGCSFRRKGD  86



>ref|XP_001774611.1| predicted protein [Physcomitrella patens]
 gb|EDQ60545.1| predicted protein [Physcomitrella patens]
Length=86

 Score =   142 bits (359),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 77/86 (90%), Positives = 82/86 (95%), Gaps = 0/86 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL NDIDLL PPAELEK+KHKLKRLVQSPNSFFMDVKCQGCF+ITTVFSHSQTVV+C +
Sbjct  1    MVLSNDIDLLQPPAELEKRKHKLKRLVQSPNSFFMDVKCQGCFSITTVFSHSQTVVLCSS  60

Query  297  CQTVLCQPTGGRARLTEGCSFRRKGD  374
            C TVLCQPTGGRARLTEGCSFR+KGD
Sbjct  61   CSTVLCQPTGGRARLTEGCSFRKKGD  86



>ref|XP_001696854.1| ribosomal protein S27 isoform A, component of 80S ribosome and 
40S small subunit [Chlamydomonas reinhardtii]
 gb|EDP00546.1| ribosomal protein S27 isoform A [Chlamydomonas reinhardtii]
Length=86

 Score =   142 bits (358),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 76/86 (88%), Positives = 80/86 (93%), Gaps = 0/86 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL +DIDLLNPPAELEK KHK KRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVV+CG+
Sbjct  1    MVLSSDIDLLNPPAELEKTKHKRKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVMCGS  60

Query  297  CQTVLCQPTGGRARLTEGCSFRRKGD  374
            C +VLC PTGGRARLTEGCSFRRK D
Sbjct  61   CSSVLCTPTGGRARLTEGCSFRRKSD  86



>ref|NP_001105614.1| ribosomal protein S27 [Zea mays]
 ref|XP_002463883.1| hypothetical protein SORBIDRAFT_01g008260 [Sorghum bicolor]
 ref|XP_002466468.1| hypothetical protein SORBIDRAFT_01g008270 [Sorghum bicolor]
 ref|XP_002452083.1| hypothetical protein SORBIDRAFT_04g019000 [Sorghum bicolor]
 ref|XP_004975295.1| PREDICTED: 40S ribosomal protein S27-like [Setaria italica]
 ref|XP_004975470.1| PREDICTED: 40S ribosomal protein S27-like [Setaria italica]
 ref|XP_008644513.1| PREDICTED: 40S ribosomal protein S27 [Zea mays]
 ref|XP_008645684.1| PREDICTED: 40S ribosomal protein S27 [Zea mays]
 gb|AAC97381.1| 40S ribosomal protein S27 homolog [Zea mays]
 gb|AAV50048.1| S27 ribosomal protein [Saccharum hybrid cultivar Pindar]
 gb|ACF80524.1| unknown [Zea mays]
 gb|ACG24578.1| 40S ribosomal protein S27 [Zea mays]
 gb|ACG29546.1| 40S ribosomal protein S27 [Zea mays]
 gb|ACG30349.1| 40S ribosomal protein S27 [Zea mays]
 gb|ACG30829.1| 40S ribosomal protein S27 [Zea mays]
 gb|ACG30900.1| 40S ribosomal protein S27 [Zea mays]
 gb|ACG31023.1| 40S ribosomal protein S27 [Zea mays]
 gb|ACG32741.1| 40S ribosomal protein S27 [Zea mays]
 gb|ACG36481.1| 40S ribosomal protein S27 [Zea mays]
 gb|EER90881.1| hypothetical protein SORBIDRAFT_01g008260 [Sorghum bicolor]
 gb|EER93466.1| hypothetical protein SORBIDRAFT_01g008270 [Sorghum bicolor]
 gb|EES05059.1| hypothetical protein SORBIDRAFT_04g019000 [Sorghum bicolor]
 gb|AFW65692.1| ribosomal protein S27 [Zea mays]
 gb|AFW67638.1| ribosomal protein S27 [Zea mays]
 gb|AFW71451.1| ribosomal protein S27 [Zea mays]
Length=86

 Score =   142 bits (358),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 79/86 (92%), Positives = 81/86 (94%), Gaps = 0/86 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL NDIDLLNPPAELEK KHK KRLVQSPNSFFMDVKCQGCF+ITTVFSHSQTVVVC  
Sbjct  1    MVLQNDIDLLNPPAELEKLKHKKKRLVQSPNSFFMDVKCQGCFSITTVFSHSQTVVVCPG  60

Query  297  CQTVLCQPTGGRARLTEGCSFRRKGD  374
            CQTVLCQPTGG+ARLTEGCSFRRKGD
Sbjct  61   CQTVLCQPTGGKARLTEGCSFRRKGD  86



>ref|NP_001052512.1| Os04g0346100 [Oryza sativa Japonica Group]
 emb|CAD40354.1| OSJNBa0020I02.1 [Oryza sativa Japonica Group]
 dbj|BAF14426.1| Os04g0346100 [Oryza sativa Japonica Group]
 emb|CAH66507.1| OSIGBa0111I14.2 [Oryza sativa Indica Group]
 gb|EAY93641.1| hypothetical protein OsI_15427 [Oryza sativa Indica Group]
 gb|EAZ30304.1| hypothetical protein OsJ_14350 [Oryza sativa Japonica Group]
 dbj|BAG90709.1| unnamed protein product [Oryza sativa Japonica Group]
Length=86

 Score =   142 bits (358),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 79/86 (92%), Positives = 80/86 (93%), Gaps = 0/86 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL NDIDLLNPPAELEK KHK KRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVC  
Sbjct  1    MVLSNDIDLLNPPAELEKLKHKKKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCPG  60

Query  297  CQTVLCQPTGGRARLTEGCSFRRKGD  374
            CQTVLCQPTGG+ARLTEGCSFRRK D
Sbjct  61   CQTVLCQPTGGKARLTEGCSFRRKSD  86



>gb|EMS47313.1| 40S ribosomal protein S27 [Triticum urartu]
 gb|EMT29048.1| hypothetical protein F775_43942 [Aegilops tauschii]
Length=86

 Score =   142 bits (357),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 79/86 (92%), Positives = 80/86 (93%), Gaps = 0/86 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL NDIDLL PPAELEK KHK KRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVC  
Sbjct  1    MVLQNDIDLLTPPAELEKLKHKKKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCPG  60

Query  297  CQTVLCQPTGGRARLTEGCSFRRKGD  374
            CQTVLCQPTGG+ARLTEGCSFRRKGD
Sbjct  61   CQTVLCQPTGGKARLTEGCSFRRKGD  86



>ref|XP_006648639.1| PREDICTED: 40S ribosomal protein S27-like [Oryza brachyantha]
Length=108

 Score =   142 bits (359),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 85/118 (72%), Positives = 91/118 (77%), Gaps = 14/118 (12%)
 Frame = +3

Query  21   NCLLSSPTFNEPILGSLHTAAF*GFRSSTFNTMVLPNDIDLLNPPAelekkkhklkRLVQ  200
            +C++ +P F + I      AAF           VL NDIDLLNPPAELEK KHK KRLVQ
Sbjct  5    HCIIDTPLFVQSI-----GAAF---------VSVLQNDIDLLNPPAELEKLKHKKKRLVQ  50

Query  201  SPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQTVLCQPTGGRARLTEGCSFRRKGD  374
            SPNSFFMDVKCQGCFNITTVFSHSQTVVVC  CQTVLCQPTGG+ARLTEGCSFRRK D
Sbjct  51   SPNSFFMDVKCQGCFNITTVFSHSQTVVVCPGCQTVLCQPTGGKARLTEGCSFRRKSD  108



>ref|NP_182095.1| 40S ribosomal protein S27-1 [Arabidopsis thaliana]
 sp|O64650.1|RS271_ARATH RecName: Full=40S ribosomal protein S27-1 [Arabidopsis thaliana]
 gb|AAC28554.1| putative ribosomal protein S27 [Arabidopsis thaliana]
 gb|AAL62368.1| putative ribosomal protein S27 [Arabidopsis thaliana]
 gb|AAM14895.1| putative ribosomal protein S27 [Arabidopsis thaliana]
 gb|AAM63040.1| putative ribosomal protein S27 [Arabidopsis thaliana]
 gb|AAN15408.1| putative ribosomal protein S27 [Arabidopsis thaliana]
 dbj|BAF00090.1| 40S ribosomal protein S27 [Arabidopsis thaliana]
 gb|AEC10590.1| 40S ribosomal protein S27-1 [Arabidopsis thaliana]
Length=84

 Score =   142 bits (357),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 76/84 (90%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL NDIDLLNPPAELEK+KHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVV+CGN
Sbjct  1    MVLQNDIDLLNPPAELEKRKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVMCGN  60

Query  297  CQTVLCQPTGGRARLTEGCSFRRK  368
            CQT+LC PTGG+A+LTEGCSFR+K
Sbjct  61   CQTLLCTPTGGKAKLTEGCSFRKK  84



>gb|EMS47163.1| 40S ribosomal protein S27 [Triticum urartu]
Length=162

 Score =   144 bits (362),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 79/85 (93%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = +3

Query  120  VLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNC  299
            VL NDIDLLNPPAELEK KHK KRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVC  C
Sbjct  78   VLQNDIDLLNPPAELEKLKHKKKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCPGC  137

Query  300  QTVLCQPTGGRARLTEGCSFRRKGD  374
            QTVLCQPTGG+ARLTEGCSFRRKGD
Sbjct  138  QTVLCQPTGGKARLTEGCSFRRKGD  162



>ref|XP_004952504.1| PREDICTED: 40S ribosomal protein S27-like [Setaria italica]
Length=86

 Score =   141 bits (355),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 78/86 (91%), Positives = 81/86 (94%), Gaps = 0/86 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL NDIDLLNPPAELEK KHK KRLVQSPNSFFMDVKCQGCF+ITTVFSHSQTVVVC  
Sbjct  1    MVLQNDIDLLNPPAELEKLKHKKKRLVQSPNSFFMDVKCQGCFSITTVFSHSQTVVVCPG  60

Query  297  CQTVLCQPTGGRARLTEGCSFRRKGD  374
            CQTVLCQPTGG+ARLTEGCSFR+KGD
Sbjct  61   CQTVLCQPTGGKARLTEGCSFRKKGD  86



>ref|NP_199604.1| 40S ribosomal protein S27-3 [Arabidopsis thaliana]
 sp|Q8L953.2|RS273_ARATH RecName: Full=40S ribosomal protein S27-3 [Arabidopsis thaliana]
 dbj|BAB09045.1| ribosomal protein S27 [Arabidopsis thaliana]
 gb|AAK76706.1| putative ribosomal protein S27 [Arabidopsis thaliana]
 gb|AAL85150.1| putative ribosomal protein S27 [Arabidopsis thaliana]
 gb|AED95596.1| 40S ribosomal protein S27-3 [Arabidopsis thaliana]
Length=84

 Score =   141 bits (355),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 77/84 (92%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL NDIDLL+PP ELEK+KHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN
Sbjct  1    MVLQNDIDLLHPPPELEKRKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  60

Query  297  CQTVLCQPTGGRARLTEGCSFRRK  368
            CQTVLCQPTGG+ARL EGCSFR+K
Sbjct  61   CQTVLCQPTGGKARLQEGCSFRKK  84



>emb|CAH66540.1| H0209H04.7 [Oryza sativa Indica Group]
 gb|EEE60924.1| hypothetical protein OsJ_14646 [Oryza sativa Japonica Group]
Length=86

 Score =   140 bits (353),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 78/86 (91%), Positives = 80/86 (93%), Gaps = 0/86 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL NDIDLLNPPAELEK KHK KRLVQSPNSFFMDVKCQGCF+ITTVFSHSQTVVVC  
Sbjct  1    MVLSNDIDLLNPPAELEKLKHKKKRLVQSPNSFFMDVKCQGCFSITTVFSHSQTVVVCPG  60

Query  297  CQTVLCQPTGGRARLTEGCSFRRKGD  374
            CQTVLCQPTGG+ARLTEGCSFRRK D
Sbjct  61   CQTVLCQPTGGKARLTEGCSFRRKND  86



>ref|XP_002953520.1| component of 80S ribosome and 40S small subunit [Volvox carteri 
f. nagariensis]
 gb|EFJ45493.1| component of 80S ribosome and 40S small subunit [Volvox carteri 
f. nagariensis]
Length=86

 Score =   140 bits (352),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 74/86 (86%), Positives = 81/86 (94%), Gaps = 0/86 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL +DIDLLNPPA+LEK+KHK KRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVV+CG+
Sbjct  1    MVLHSDIDLLNPPADLEKQKHKRKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVMCGS  60

Query  297  CQTVLCQPTGGRARLTEGCSFRRKGD  374
            C +VLC PTGGRARLTEGCSFR+K D
Sbjct  61   CSSVLCTPTGGRARLTEGCSFRKKSD  86



>emb|CDX86334.1| BnaA06g30510D [Brassica napus]
Length=886

 Score =   152 bits (385),  Expect = 3e-39, Method: Composition-based stats.
 Identities = 79/83 (95%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  120  VLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNC  299
            VL NDIDLLNPPAELEK+KHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNC
Sbjct  804  VLQNDIDLLNPPAELEKRKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNC  863

Query  300  QTVLCQPTGGRARLTEGCSFRRK  368
            QTVLCQPTGG+ARLTEGCSFR+K
Sbjct  864  QTVLCQPTGGKARLTEGCSFRKK  886



>ref|XP_005651549.1| hypothetical protein COCSUDRAFT_27353 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE27005.1| hypothetical protein COCSUDRAFT_27353 [Coccomyxa subellipsoidea 
C-169]
Length=86

 Score =   140 bits (352),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 75/86 (87%), Positives = 79/86 (92%), Gaps = 0/86 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL  DIDLL+PPAELEK+KHK KRLVQSPNSFFMDVKCQGCF ITTVFSHSQTVVVC +
Sbjct  1    MVLSTDIDLLHPPAELEKQKHKTKRLVQSPNSFFMDVKCQGCFQITTVFSHSQTVVVCSS  60

Query  297  CQTVLCQPTGGRARLTEGCSFRRKGD  374
            C TVLC PTGG+ARLTEGCSFRRKGD
Sbjct  61   CSTVLCTPTGGKARLTEGCSFRRKGD  86



>ref|XP_006652234.1| PREDICTED: 40S ribosomal protein S27-like [Oryza brachyantha]
Length=86

 Score =   140 bits (352),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 78/86 (91%), Positives = 80/86 (93%), Gaps = 0/86 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL NDIDLLNPPAELEK KHK KRLVQSPNSFFMDVKCQGCF+ITTVFSHSQTVVVC  
Sbjct  1    MVLQNDIDLLNPPAELEKLKHKKKRLVQSPNSFFMDVKCQGCFSITTVFSHSQTVVVCPG  60

Query  297  CQTVLCQPTGGRARLTEGCSFRRKGD  374
            CQTVLCQPTGG+ARLTEGCSFRRK D
Sbjct  61   CQTVLCQPTGGKARLTEGCSFRRKND  86



>ref|XP_008348423.1| PREDICTED: 40S ribosomal protein S27-2 [Malus domestica]
Length=88

 Score =   139 bits (350),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 78/88 (89%), Positives = 82/88 (93%), Gaps = 2/88 (2%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL NDIDLL+P AELEK+KHK+KRLVQ+PNSFFMDVKCQGCFNITTVFSHSQTVVVCGN
Sbjct  1    MVLQNDIDLLHPSAELEKRKHKIKRLVQTPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  60

Query  297  CQTVLCQPTGGRARL--TEGCSFRRKGD  374
            CQTVLCQPTGGRARL  TEG SFRR GD
Sbjct  61   CQTVLCQPTGGRARLTETEGSSFRRNGD  88



>ref|XP_001421547.1| Ribosomal protein S27, component of cytosolic 80S ribosome and 
40S small subunit [Ostreococcus lucimarinus CCE9901]
 gb|ABO99840.1| Ribosomal protein S27, component of cytosolic 80S ribosome and 
40S small subunit [Ostreococcus lucimarinus CCE9901]
Length=104

 Score =   139 bits (351),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 71/85 (84%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = +3

Query  120  VLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNC  299
            VL  DIDLLNPPA LE  KHKLKRLVQSPNSFFMDVKCQGCFNITT+FSHSQ+VV+CG+C
Sbjct  20   VLAQDIDLLNPPAALEAGKHKLKRLVQSPNSFFMDVKCQGCFNITTIFSHSQSVVLCGSC  79

Query  300  QTVLCQPTGGRARLTEGCSFRRKGD  374
              VLCQPTGG+ARLTEGC +RRKGD
Sbjct  80   SAVLCQPTGGKARLTEGCEWRRKGD  104



>ref|XP_008388226.1| PREDICTED: 40S ribosomal protein S27-2-like [Malus domestica]
Length=88

 Score =   139 bits (350),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 78/88 (89%), Positives = 82/88 (93%), Gaps = 2/88 (2%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL NDIDLL+P AELEK+KHK+KRLVQ+PNSFFMDVKCQGCFNITTVFSHSQTVVVCGN
Sbjct  1    MVLQNDIDLLHPSAELEKRKHKIKRLVQTPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  60

Query  297  CQTVLCQPTGGRARL--TEGCSFRRKGD  374
            CQTVLCQPTGGRARL  TEG SFRR GD
Sbjct  61   CQTVLCQPTGGRARLTXTEGSSFRRNGD  88



>ref|XP_002960333.1| hypothetical protein SELMODRAFT_163947 [Selaginella moellendorffii]
 ref|XP_002967379.1| hypothetical protein SELMODRAFT_144596 [Selaginella moellendorffii]
 gb|EFJ31978.1| hypothetical protein SELMODRAFT_144596 [Selaginella moellendorffii]
 gb|EFJ37872.1| hypothetical protein SELMODRAFT_163947 [Selaginella moellendorffii]
Length=86

 Score =   138 bits (348),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 75/86 (87%), Positives = 80/86 (93%), Gaps = 0/86 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL NDIDLL+PPAELEK+KHKLKRLV +PNSFFMDVKCQGCFNITTVFSHSQTVV C N
Sbjct  1    MVLSNDIDLLHPPAELEKRKHKLKRLVPTPNSFFMDVKCQGCFNITTVFSHSQTVVFCSN  60

Query  297  CQTVLCQPTGGRARLTEGCSFRRKGD  374
            CQ VLCQPTGG+ARLTEGCSFR+K D
Sbjct  61   CQNVLCQPTGGKARLTEGCSFRKKSD  86



>gb|AAV50037.1| ribosomal protein S27 [Saccharum hybrid cultivar Pindar]
Length=84

 Score =   138 bits (347),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 77/84 (92%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = +3

Query  123  LPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQ  302
            L NDIDLLNPPAELEK KHK KRLVQSPNSFFMDVKCQGCF+ITTVFSHSQTVVVC  CQ
Sbjct  1    LQNDIDLLNPPAELEKLKHKKKRLVQSPNSFFMDVKCQGCFSITTVFSHSQTVVVCPGCQ  60

Query  303  TVLCQPTGGRARLTEGCSFRRKGD  374
            TVLCQPTGG+ARLTEGCSFRRKGD
Sbjct  61   TVLCQPTGGKARLTEGCSFRRKGD  84



>ref|NP_001149602.1| 40S ribosomal protein S27 [Zea mays]
 gb|ACG36017.1| 40S ribosomal protein S27 [Zea mays]
Length=86

 Score =   137 bits (346),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 77/86 (90%), Positives = 79/86 (92%), Gaps = 0/86 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL NDIDLLNPPAELEK KHK KRLVQSP SFFMDVK QGCF+ITTVFSHSQTVVVC  
Sbjct  1    MVLQNDIDLLNPPAELEKLKHKKKRLVQSPXSFFMDVKXQGCFSITTVFSHSQTVVVCXG  60

Query  297  CQTVLCQPTGGRARLTEGCSFRRKGD  374
            CQTVLCQPTGG+ARLTEGCSFRRKGD
Sbjct  61   CQTVLCQPTGGKARLTEGCSFRRKGD  86



>ref|XP_007512212.1| 40S ribosomal protein S27 [Bathycoccus prasinos]
 emb|CCO66300.1| 40S ribosomal protein S27 [Bathycoccus prasinos]
Length=135

 Score =   139 bits (350),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = +3

Query  96   RSSTFNTMVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQ  275
            R   F + +L  DIDLLNPPA LE  KHKLKRLVQ PNSFFMDVKCQGCF+ITTVFSHSQ
Sbjct  43   RGKNFFSSLLAQDIDLLNPPAALEASKHKLKRLVQGPNSFFMDVKCQGCFSITTVFSHSQ  102

Query  276  TVVVCGNCQTVLCQPTGGRARLTEGCSFRRKGD  374
            TVV+CG+C  VLCQPTGG+ARLTEGCSFR+K D
Sbjct  103  TVVLCGSCSAVLCQPTGGKARLTEGCSFRKKTD  135



>ref|XP_005651550.1| ribosomal protein S27 isoform B component of 80S ribosome and 
40S small subunit [Coccomyxa subellipsoidea C-169]
 gb|EIE27006.1| ribosomal protein S27 isoform B component of 80S ribosome and 
40S small subunit [Coccomyxa subellipsoidea C-169]
Length=86

 Score =   137 bits (345),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 73/86 (85%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL  DIDLL+PPAELEK+KHK KRLVQSPNSFFMDVKCQGCF ITTVFSHSQ+VVVC +
Sbjct  1    MVLSTDIDLLHPPAELEKQKHKTKRLVQSPNSFFMDVKCQGCFQITTVFSHSQSVVVCSS  60

Query  297  CQTVLCQPTGGRARLTEGCSFRRKGD  374
            C  VLC PTGG+ARLTEGCSFRRKGD
Sbjct  61   CSAVLCTPTGGKARLTEGCSFRRKGD  86



>ref|XP_008372447.1| PREDICTED: 40S ribosomal protein S27-2-like [Malus domestica]
Length=88

 Score =   137 bits (345),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 77/88 (88%), Positives = 81/88 (92%), Gaps = 2/88 (2%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL NDIDLL+P AELEK+KHK+KRLVQ+PNSFFMDVKCQGCFNITT FSHSQTVVVCGN
Sbjct  1    MVLQNDIDLLHPSAELEKRKHKIKRLVQTPNSFFMDVKCQGCFNITTXFSHSQTVVVCGN  60

Query  297  CQTVLCQPTGGRARL--TEGCSFRRKGD  374
            CQTVLCQPTGGRARL  TEG SFRR GD
Sbjct  61   CQTVLCQPTGGRARLTXTEGSSFRRNGD  88



>emb|CDP18146.1| unnamed protein product [Coffea canephora]
Length=82

 Score =   135 bits (341),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 74/78 (95%), Positives = 77/78 (99%), Gaps = 0/78 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVLPND+DLLNPPA+LEK+KHKLKRLV SPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN
Sbjct  1    MVLPNDVDLLNPPADLEKRKHKLKRLVPSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  60

Query  297  CQTVLCQPTGGRARLTEG  350
            CQTVLCQPTGGRARLTEG
Sbjct  61   CQTVLCQPTGGRARLTEG  78



>ref|XP_006397752.1| hypothetical protein EUTSA_v10001700mg [Eutrema salsugineum]
 gb|ESQ39205.1| hypothetical protein EUTSA_v10001700mg [Eutrema salsugineum]
Length=87

 Score =   135 bits (341),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/84 (86%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL NDIDLLNPPAELEK+KHKLKRLVQSPNS++MDVK QGCFNITTVFSHSQT+V+CG 
Sbjct  1    MVLQNDIDLLNPPAELEKRKHKLKRLVQSPNSYYMDVKHQGCFNITTVFSHSQTIVLCGK  60

Query  297  CQTVLCQPTGGRARLTEGCSFRRK  368
            CQTVLCQPTGG+A LTEGC+FR+K
Sbjct  61   CQTVLCQPTGGKALLTEGCAFRKK  84



>ref|XP_005847363.1| 40S ribosomal protein S27 [Chlorella variabilis]
 gb|EFN55261.1| 40S ribosomal protein S27 [Chlorella variabilis]
Length=86

 Score =   134 bits (337),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 75/86 (87%), Positives = 79/86 (92%), Gaps = 0/86 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL  DIDLLNPPAELEK+KHKLKRLV SPNS+FMDVKCQGCF ITTVFSHSQTVVVC +
Sbjct  1    MVLACDIDLLNPPAELEKRKHKLKRLVASPNSYFMDVKCQGCFTITTVFSHSQTVVVCPS  60

Query  297  CQTVLCQPTGGRARLTEGCSFRRKGD  374
            C TVLC PTGG+ARLTEGCSFRRKGD
Sbjct  61   CNTVLCVPTGGKARLTEGCSFRRKGD  86



>sp|P47903.1|RS27_CHLRE RecName: Full=40S ribosomal protein S27 [Chlamydomonas reinhardtii]
 emb|CAA58669.1| ribosomal protein S27 [Chlamydomonas reinhardtii]
 prf||2205351B ribosomal protein S27
Length=86

 Score =   134 bits (337),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 73/86 (85%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL +DIDLLNPPAELEK KHK KRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVV+CG+
Sbjct  1    MVLSSDIDLLNPPAELEKTKHKRKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVMCGS  60

Query  297  CQTVLCQPTGGRARLTEGCSFRRKGD  374
            C +VLC PTG   RLTEGCSFRRK D
Sbjct  61   CSSVLCTPTGWPRRLTEGCSFRRKSD  86



>ref|XP_002878361.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54620.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=86

 Score =   132 bits (331),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 71/83 (86%), Positives = 77/83 (93%), Gaps = 0/83 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL NDIDLLNPPAELEK+KHKLKRLVQSPNS+FM V+C GCFNITT+FSHSQTVVV G 
Sbjct  1    MVLQNDIDLLNPPAELEKRKHKLKRLVQSPNSYFMYVRCYGCFNITTIFSHSQTVVVWGK  60

Query  297  CQTVLCQPTGGRARLTEGCSFRR  365
            CQ VLCQPTGG+ARLTEGCSFR+
Sbjct  61   CQNVLCQPTGGKARLTEGCSFRK  83



>ref|XP_010473739.1| PREDICTED: 40S ribosomal protein S27-1-like [Camelina sativa]
Length=114

 Score =   131 bits (329),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 69/86 (80%), Positives = 79/86 (92%), Gaps = 0/86 (0%)
 Frame = +3

Query  108  FNTMVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVV  287
            F   VL NDIDLLNPPAELEK+KHKLKRLVQSPNS+FM V+C+GCFN+TTVFSHSQTVVV
Sbjct  26   FVITVLQNDIDLLNPPAELEKRKHKLKRLVQSPNSYFMYVRCEGCFNVTTVFSHSQTVVV  85

Query  288  CGNCQTVLCQPTGGRARLTEGCSFRR  365
            CG CQ VLCQPTGG+A+L+EGC+FR+
Sbjct  86   CGKCQNVLCQPTGGKAKLSEGCAFRK  111



>ref|XP_008390588.1| PREDICTED: 40S ribosomal protein S27-3-like, partial [Malus domestica]
Length=89

 Score =   130 bits (326),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 70/77 (91%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL NDIDLL+P AELEK+KHK+KRLVQ+PNSFFMDVKCQGCFNITT+FSHSQTVVVCGN
Sbjct  1    MVLQNDIDLLHPSAELEKRKHKIKRLVQTPNSFFMDVKCQGCFNITTMFSHSQTVVVCGN  60

Query  297  CQTVLCQPTGGRARLTE  347
            CQTVLCQPTGGRARLTE
Sbjct  61   CQTVLCQPTGGRARLTE  77



>ref|XP_011396013.1| 40S ribosomal protein S27-2 [Auxenochlorella protothecoides]
 gb|KFM23143.1| 40S ribosomal protein S27-2 [Auxenochlorella protothecoides]
Length=313

 Score =   135 bits (341),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 78/116 (67%), Positives = 88/116 (76%), Gaps = 1/116 (1%)
 Frame = +3

Query  27   LLSSPTFNEPILGSLHTAAF*GFRSSTFNTMVLPNDIDLLNPPAelekkkhklkRLVQSP  206
            L  +P  +E +  +   A +   R   ++  VL  DIDLLNPP ELEK+KHKL RLV SP
Sbjct  198  LQGNPLTSEQLAATEGYADYEQRRQRKYDK-VLACDIDLLNPPKELEKRKHKLHRLVASP  256

Query  207  NSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQTVLCQPTGGRARLTEGCSFRRKGD  374
            NS+FMDVKCQGCFNITTVFSHSQTVVVC NC TVLC PTGG+ARLTEGCSFRRK D
Sbjct  257  NSYFMDVKCQGCFNITTVFSHSQTVVVCTNCNTVLCVPTGGKARLTEGCSFRRKAD  312



>gb|KIY98071.1| 40S ribosomal protein S27-1 [Monoraphidium neglectum]
Length=85

 Score =   129 bits (323),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 71/78 (91%), Positives = 75/78 (96%), Gaps = 0/78 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL +DIDLLNPPAELEK+KHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVV+CG+
Sbjct  1    MVLHSDIDLLNPPAELEKQKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVLCGS  60

Query  297  CQTVLCQPTGGRARLTEG  350
            C TVLC PTGGRARLTEG
Sbjct  61   CSTVLCTPTGGRARLTEG  78



>ref|XP_009804103.1| PREDICTED: 40S ribosomal protein S27-2 isoform X2 [Nicotiana 
sylvestris]
Length=77

 Score =   128 bits (321),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 74/86 (86%), Positives = 76/86 (88%), Gaps = 9/86 (10%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            M LPND+DLLNPPAELEK+KHKLKRL         DVKCQGCFNITTVFSHSQTVVVCGN
Sbjct  1    MTLPNDVDLLNPPAELEKRKHKLKRL---------DVKCQGCFNITTVFSHSQTVVVCGN  51

Query  297  CQTVLCQPTGGRARLTEGCSFRRKGD  374
            CQTVLCQPTGGRARLTEGCSFRRKGD
Sbjct  52   CQTVLCQPTGGRARLTEGCSFRRKGD  77



>ref|XP_007411417.1| hypothetical protein MELLADRAFT_87975 [Melampsora larici-populina 
98AG31]
 gb|EGG05495.1| hypothetical protein MELLADRAFT_87975 [Melampsora larici-populina 
98AG31]
Length=83

 Score =   126 bits (316),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 67/78 (86%), Positives = 74/78 (95%), Gaps = 0/78 (0%)
 Frame = +3

Query  135  IDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQTVLC  314
            IDLLNP AE E++KHKLKRLVQSPNS+FMDVKC GCFNITTVFSH+QTVV+CG+C TVLC
Sbjct  5    IDLLNPSAEQERRKHKLKRLVQSPNSYFMDVKCPGCFNITTVFSHAQTVVLCGSCATVLC  64

Query  315  QPTGGRARLTEGCSFRRK  368
            QPTGG+ARLTEGCSFRRK
Sbjct  65   QPTGGKARLTEGCSFRRK  82



>ref|XP_010482042.1| PREDICTED: 40S ribosomal protein S27-2-like [Camelina sativa]
Length=85

 Score =   126 bits (316),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 68/79 (86%), Positives = 74/79 (94%), Gaps = 0/79 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL NDIDLLNPPAE+EK+KHKLKRLVQSPNSFFMDVKC GCFNITT+FSHSQTVVVC  
Sbjct  1    MVLQNDIDLLNPPAEIEKRKHKLKRLVQSPNSFFMDVKCPGCFNITTMFSHSQTVVVCAK  60

Query  297  CQTVLCQPTGGRARLTEGC  353
            C TVLCQPTGG+A+LT+GC
Sbjct  61   CNTVLCQPTGGKAKLTQGC  79



>gb|KIJ68657.1| hypothetical protein HYDPIDRAFT_173325 [Hydnomerulius pinastri 
MD-312]
Length=83

 Score =   125 bits (315),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +3

Query  123  LPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQ  302
            +P  IDLLNP AE E+++HKLKRLVQSPNSFFMDVKC GCF ITTVFSH+Q+VV+CG+C 
Sbjct  1    MPLAIDLLNPSAEHEQRQHKLKRLVQSPNSFFMDVKCPGCFAITTVFSHAQSVVICGSCA  60

Query  303  TVLCQPTGGRARLTEGCSFRRK  368
            +VLCQPTGGRARLTEGCSFRRK
Sbjct  61   SVLCQPTGGRARLTEGCSFRRK  82



>ref|XP_005758635.1| hypothetical protein EMIHUDRAFT_425447 [Emiliania huxleyi CCMP1516]
 ref|XP_005787750.1| hypothetical protein EMIHUDRAFT_420900 [Emiliania huxleyi CCMP1516]
 gb|EOD06206.1| hypothetical protein EMIHUDRAFT_425447 [Emiliania huxleyi CCMP1516]
 gb|EOD35321.1| hypothetical protein EMIHUDRAFT_420900 [Emiliania huxleyi CCMP1516]
Length=83

 Score =   125 bits (314),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = +3

Query  129  NDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQTV  308
             D+DLL PPAELEK++HKLKRLVQSPNSFFMDVKC GCF+ITTVFSH+QTVV+CG C TV
Sbjct  2    GDVDLLFPPAELEKRRHKLKRLVQSPNSFFMDVKCPGCFSITTVFSHAQTVVICGGCSTV  61

Query  309  LCQPTGGRARLTEGCSFRRK  368
            LCQPTGG+ARLTEGCSFR+K
Sbjct  62   LCQPTGGKARLTEGCSFRKK  81



>ref|XP_003332938.1| 40S ribosomal protein S27 [Puccinia graminis f. sp. tritici CRL 
75-36-700-3]
 ref|XP_003337094.1| 40S ribosomal protein S27 [Puccinia graminis f. sp. tritici CRL 
75-36-700-3]
 gb|EFP88519.1| small subunit ribosomal protein S27e [Puccinia graminis f. sp. 
tritici CRL 75-36-700-3]
 gb|EFP92675.1| small subunit ribosomal protein S27e [Puccinia graminis f. sp. 
tritici CRL 75-36-700-3]
Length=112

 Score =   125 bits (314),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 66/78 (85%), Positives = 74/78 (95%), Gaps = 0/78 (0%)
 Frame = +3

Query  135  IDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQTVLC  314
            +DLLNP AE E++KHKLKRLVQSPNS+FMDVKC GCFNITTVFSH+QTVV+CG+C TVLC
Sbjct  34   VDLLNPSAEQERRKHKLKRLVQSPNSYFMDVKCPGCFNITTVFSHAQTVVLCGSCATVLC  93

Query  315  QPTGGRARLTEGCSFRRK  368
            QPTGG+ARLTEGCSFRRK
Sbjct  94   QPTGGKARLTEGCSFRRK  111



>gb|EMS20867.1| 40S ribosomal protein s27 [Rhodosporidium toruloides NP11]
 emb|CDR40431.1| RHTO0S05e03422g1_1 [Rhodosporidium toruloides]
Length=83

 Score =   124 bits (311),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 62/78 (79%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +3

Query  135  IDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQTVLC  314
            +DLLNP AE   + HKLKRLVQSPNS+FMDVKC GCFNITTVFSH+QTVV+CG+C T+LC
Sbjct  5    VDLLNPSAEKTAQTHKLKRLVQSPNSYFMDVKCPGCFNITTVFSHAQTVVLCGSCSTILC  64

Query  315  QPTGGRARLTEGCSFRRK  368
             PTGG+ARLTEGCSFRRK
Sbjct  65   TPTGGKARLTEGCSFRRK  82



>ref|XP_010439108.1| PREDICTED: 40S ribosomal protein S27-2-like [Camelina sativa]
Length=85

 Score =   124 bits (310),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 67/79 (85%), Positives = 73/79 (92%), Gaps = 0/79 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL NDID+LNPPAELEK+KHKLKRLVQSPNSFFMDVKC GCFNITT+FSHSQTVVVC  
Sbjct  1    MVLQNDIDMLNPPAELEKRKHKLKRLVQSPNSFFMDVKCPGCFNITTMFSHSQTVVVCAK  60

Query  297  CQTVLCQPTGGRARLTEGC  353
            C TVLCQP GG+A+LT+GC
Sbjct  61   CNTVLCQPAGGKAKLTQGC  79



>gb|KIY51346.1| hypothetical protein FISHEDRAFT_64347 [Fistulina hepatica ATCC 
64428]
Length=83

 Score =   124 bits (310),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 66/78 (85%), Positives = 74/78 (95%), Gaps = 0/78 (0%)
 Frame = +3

Query  135  IDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQTVLC  314
            +DLLNP AELEK++HKLKRLVQSPNS+FMDVKC GCF ITTVFSH+QTVV+CG CQ+VLC
Sbjct  5    VDLLNPSAELEKRQHKLKRLVQSPNSYFMDVKCPGCFAITTVFSHAQTVVLCGACQSVLC  64

Query  315  QPTGGRARLTEGCSFRRK  368
            QPTGG+ARLTEGCSFRRK
Sbjct  65   QPTGGKARLTEGCSFRRK  82



>gb|EJU00994.1| 40S ribosomal protein S27 [Dacryopinax sp. DJM-731 SS1]
Length=83

 Score =   123 bits (309),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 63/79 (80%), Positives = 70/79 (89%), Gaps = 0/79 (0%)
 Frame = +3

Query  135  IDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQTVLC  314
            +DLLNP    E ++HKLKRLVQSPNSFFMDVKC GCF ITTVFSH+QTVVVC +CQTVLC
Sbjct  5    VDLLNPTPTAEARRHKLKRLVQSPNSFFMDVKCTGCFAITTVFSHAQTVVVCASCQTVLC  64

Query  315  QPTGGRARLTEGCSFRRKG  371
            QPTGG+ARLTEGCSFR+K 
Sbjct  65   QPTGGKARLTEGCSFRKKA  83



>ref|XP_004241662.1| PREDICTED: 40S ribosomal protein S27-1-like isoform X2 [Solanum 
lycopersicum]
Length=95

 Score =   124 bits (310),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = +3

Query  123  LPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQ  302
            + ND DLL+PPAELEK+KHKLKRLVQSPNS F+DVKCQGCF ITT+FSHSQTVV C NCQ
Sbjct  6    ISNDTDLLHPPAELEKQKHKLKRLVQSPNSTFLDVKCQGCFQITTIFSHSQTVVTCPNCQ  65

Query  303  TVLCQPTGGRARLTEGCSFRRK  368
             VLCQPTGGRA+LTEGCSFR K
Sbjct  66   QVLCQPTGGRAKLTEGCSFRVK  87



>ref|XP_004241663.2| PREDICTED: 40S ribosomal protein S27-3-like isoform X1 [Solanum 
lycopersicum]
Length=132

 Score =   124 bits (312),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = +3

Query  123  LPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQ  302
            + ND DLL+PPAELEK+KHKLKRLVQSPNS F+DVKCQGCF ITT+FSHSQTVV C NCQ
Sbjct  43   ISNDTDLLHPPAELEKQKHKLKRLVQSPNSTFLDVKCQGCFQITTIFSHSQTVVTCPNCQ  102

Query  303  TVLCQPTGGRARLTEGCSFRRK  368
             VLCQPTGGRA+LTEGCSFR K
Sbjct  103  QVLCQPTGGRAKLTEGCSFRVK  124



>ref|XP_007336756.1| ribosomal protein S27 [Auricularia delicata TFB-10046 SS5]
 gb|EJD55455.1| ribosomal protein S27 [Auricularia delicata TFB-10046 SS5]
Length=83

 Score =   123 bits (308),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/79 (80%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +3

Query  135  IDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQTVLC  314
            +DLLNP A  EKK HKLKRLVQSPNSFFMDVKC GCF ITTVFSH+QTVV+C +C  VLC
Sbjct  5    VDLLNPSAAHEKKSHKLKRLVQSPNSFFMDVKCSGCFTITTVFSHAQTVVICASCTQVLC  64

Query  315  QPTGGRARLTEGCSFRRKG  371
            QPTGG+ARLTEGCS+RRK 
Sbjct  65   QPTGGKARLTEGCSYRRKA  83



>emb|CBJ26210.1| Ribosomal protein S27 [Ectocarpus siliculosus]
Length=82

 Score =   123 bits (308),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/79 (81%), Positives = 72/79 (91%), Gaps = 0/79 (0%)
 Frame = +3

Query  138  DLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQTVLCQ  317
            DLL+P +  EK+ HKLKRLVQSPNSFFMDVKC GCFNITTVFSH+QTVVVCG+C T+LCQ
Sbjct  4    DLLHPTSSHEKRVHKLKRLVQSPNSFFMDVKCPGCFNITTVFSHAQTVVVCGSCSTILCQ  63

Query  318  PTGGRARLTEGCSFRRKGD  374
            PTGG+ARLTEGCSFR+K D
Sbjct  64   PTGGKARLTEGCSFRKKVD  82



>gb|KDQ12784.1| hypothetical protein BOTBODRAFT_189045 [Botryobasidium botryosum 
FD-172 SS1]
Length=104

 Score =   124 bits (310),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = +3

Query  99   SSTFNTMVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQT  278
            + + + + L   IDLLNP AE E+K+HKLKRLVQSPNS+FMDVKC GCF ITTVFSH+QT
Sbjct  14   ARSLDDLELTLAIDLLNPSAEHERKQHKLKRLVQSPNSYFMDVKCPGCFAITTVFSHAQT  73

Query  279  VVVCGNCQTVLCQPTGGRARLTEGCSFRRK  368
            VV+CG+C TVLCQPTGG+ARLTEG SFRRK
Sbjct  74   VVICGSCSTVLCQPTGGKARLTEGSSFRRK  103



>gb|KIM84521.1| hypothetical protein PILCRDRAFT_96691 [Piloderma croceum F 1598]
Length=83

 Score =   123 bits (308),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/78 (83%), Positives = 73/78 (94%), Gaps = 0/78 (0%)
 Frame = +3

Query  135  IDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQTVLC  314
            +DLLNP AE E+K+HKLKRLVQSPNSFFMDVKC GCF ITTVFSH+QTVV+CG+C +VLC
Sbjct  5    VDLLNPSAEHERKQHKLKRLVQSPNSFFMDVKCPGCFAITTVFSHAQTVVLCGSCASVLC  64

Query  315  QPTGGRARLTEGCSFRRK  368
            QPTGG+ARLTEGCSFRRK
Sbjct  65   QPTGGKARLTEGCSFRRK  82



>gb|KIK71317.1| hypothetical protein GYMLUDRAFT_66525 [Gymnopus luxurians FD-317 
M1]
Length=83

 Score =   123 bits (308),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 65/78 (83%), Positives = 74/78 (95%), Gaps = 0/78 (0%)
 Frame = +3

Query  135  IDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQTVLC  314
            +DLLNP AELEKK+HKLKRLVQSPNS+FMDVKC GCF ITTVFSH+QTVV+CG+C ++LC
Sbjct  5    VDLLNPSAELEKKQHKLKRLVQSPNSYFMDVKCPGCFAITTVFSHAQTVVICGSCASILC  64

Query  315  QPTGGRARLTEGCSFRRK  368
            QPTGG+ARLTEGCSFRRK
Sbjct  65   QPTGGKARLTEGCSFRRK  82



>ref|NP_001118871.1| zinc-binding ribosomal protein family protein [Arabidopsis thaliana]
 gb|AEE80155.1| zinc-binding ribosomal protein family protein [Arabidopsis thaliana]
Length=86

 Score =   122 bits (307),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 68/86 (79%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL NDIDLLNPPAELEK+KHKLKRLV SPNS+FM V+C  C NITT+FSHSQTVVVCG 
Sbjct  1    MVLQNDIDLLNPPAELEKRKHKLKRLVPSPNSYFMLVRCSDCINITTIFSHSQTVVVCGK  60

Query  297  CQTVLCQPTGGRARLTEGCSFRRKGD  374
            CQ VLCQPTGG+A+LT GCSFR+  D
Sbjct  61   CQNVLCQPTGGKAKLTVGCSFRKLTD  86



>gb|KJB18512.1| hypothetical protein B456_003G057100 [Gossypium raimondii]
Length=82

 Score =   122 bits (307),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 69/82 (84%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            M L NDIDLLNP  ELEKK HKLK LV + NSFF+DVKCQGCFNITT+FSHSQTVVVCGN
Sbjct  1    MGLQNDIDLLNPLTELEKKMHKLKLLVLTVNSFFIDVKCQGCFNITTMFSHSQTVVVCGN  60

Query  297  CQTVLCQPTGGRARLTEGCSFR  362
            CQTVLCQP GG+ARLTEGCSFR
Sbjct  61   CQTVLCQPIGGKARLTEGCSFR  82



>ref|XP_008619499.1| 40S ribosomal protein [Saprolegnia diclina VS20]
 gb|EQC27105.1| 40S ribosomal protein [Saprolegnia diclina VS20]
 gb|KDO22869.1| 40S ribosomal protein [Saprolegnia parasitica CBS 223.65]
Length=82

 Score =   122 bits (305),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 63/79 (80%), Positives = 71/79 (90%), Gaps = 0/79 (0%)
 Frame = +3

Query  138  DLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQTVLCQ  317
            DLL+P A  E+ KHKLKRLVQSPNSFFMDVKC GCFNITTVFSH+QTVV+CG+C  +LCQ
Sbjct  4    DLLHPSASEERSKHKLKRLVQSPNSFFMDVKCPGCFNITTVFSHAQTVVLCGSCSVMLCQ  63

Query  318  PTGGRARLTEGCSFRRKGD  374
            PTGG+ARLTEGCSFR+K D
Sbjct  64   PTGGKARLTEGCSFRKKTD  82



>ref|XP_006366283.1| PREDICTED: 40S ribosomal protein S27-2-like [Solanum tuberosum]
Length=95

 Score =   122 bits (306),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = +3

Query  123  LPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQ  302
            + ND DLL+PPAELEK+ HKLKRLVQSPNS F+DVKCQGCF ITT+FSHSQTVV C NCQ
Sbjct  6    ISNDTDLLHPPAELEKQNHKLKRLVQSPNSTFLDVKCQGCFQITTIFSHSQTVVTCPNCQ  65

Query  303  TVLCQPTGGRARLTEGCSFRRK  368
             VLCQP+GGRA+LTEGCSFR K
Sbjct  66   QVLCQPSGGRAKLTEGCSFRVK  87



>ref|XP_010418599.1| PREDICTED: 40S ribosomal protein S27-1-like [Camelina sativa]
Length=88

 Score =   122 bits (305),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +3

Query  120  VLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNC  299
            VL NDIDLLNPPA+LEK+KHKLKRLVQSPNSFFM V+C+ CFN+TTVFSHSQTVVVCG  
Sbjct  4    VLQNDIDLLNPPAQLEKRKHKLKRLVQSPNSFFMYVRCECCFNVTTVFSHSQTVVVCGKS  63

Query  300  QTVLCQPTGGRARLTEGCSFRR  365
            Q VLCQPTGG+ +L+EGC+FR+
Sbjct  64   QNVLCQPTGGKTKLSEGCAFRK  85



>ref|XP_008870490.1| 40S ribosomal protein S27-like protein [Aphanomyces invadans]
 gb|ETW00355.1| 40S ribosomal protein S27-like protein [Aphanomyces invadans]
Length=82

 Score =   121 bits (304),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 63/79 (80%), Positives = 71/79 (90%), Gaps = 0/79 (0%)
 Frame = +3

Query  138  DLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQTVLCQ  317
            DLL+P A  E+ KHKLKRLVQSPNSFFMDVKC GCFNITTVFSH+QTVV+CG+C  +LCQ
Sbjct  4    DLLHPSATEERSKHKLKRLVQSPNSFFMDVKCPGCFNITTVFSHAQTVVLCGSCSVMLCQ  63

Query  318  PTGGRARLTEGCSFRRKGD  374
            PTGG+ARLTEGCSFR+K D
Sbjct  64   PTGGKARLTEGCSFRKKTD  82



>ref|XP_007378532.1| 40S ribosomal protein S27 [Punctularia strigosozonata HHB-11173 
SS5]
 gb|EIN13615.1| 40S ribosomal protein S27 [Punctularia strigosozonata HHB-11173 
SS5]
Length=83

 Score =   121 bits (304),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 64/78 (82%), Positives = 72/78 (92%), Gaps = 0/78 (0%)
 Frame = +3

Query  135  IDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQTVLC  314
            +DLLNP  E EK+KHKLKRLVQSPNS+FMDVKC GCF ITTVFSH+QTVV+CG+C +VLC
Sbjct  5    VDLLNPSIEAEKRKHKLKRLVQSPNSYFMDVKCPGCFAITTVFSHAQTVVICGSCASVLC  64

Query  315  QPTGGRARLTEGCSFRRK  368
            QPTGG+ARLTEGCSFRRK
Sbjct  65   QPTGGKARLTEGCSFRRK  82



>gb|KIJ45559.1| hypothetical protein M422DRAFT_29684 [Sphaerobolus stellatus 
SS14]
Length=83

 Score =   121 bits (304),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 64/78 (82%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = +3

Query  135  IDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQTVLC  314
            +DLLNP AE EK+ HKLKRLVQSPNS+FMDVKC GCF ITTVFSH+QTVV+CG+C TVLC
Sbjct  5    VDLLNPSAETEKRSHKLKRLVQSPNSYFMDVKCPGCFAITTVFSHAQTVVLCGSCATVLC  64

Query  315  QPTGGRARLTEGCSFRRK  368
            QPTGG+ARLTEG SFRRK
Sbjct  65   QPTGGKARLTEGSSFRRK  82



>gb|KII93407.1| hypothetical protein PLICRDRAFT_35612 [Plicaturopsis crispa FD-325 
SS-3]
Length=83

 Score =   121 bits (304),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 65/78 (83%), Positives = 72/78 (92%), Gaps = 0/78 (0%)
 Frame = +3

Query  135  IDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQTVLC  314
            +DLLNP  E EKK+HKLKRLVQSPNS+FMDVKC GCF ITTVFSH+QTVV+CG+C +VLC
Sbjct  5    VDLLNPSLEHEKKQHKLKRLVQSPNSYFMDVKCPGCFAITTVFSHAQTVVLCGSCASVLC  64

Query  315  QPTGGRARLTEGCSFRRK  368
            QPTGGRARLTEGCSFRRK
Sbjct  65   QPTGGRARLTEGCSFRRK  82



>ref|XP_001874254.1| 40S ribosomal protein S27 [Laccaria bicolor S238N-H82]
 gb|EDR16046.1| 40S ribosomal protein S27 [Laccaria bicolor S238N-H82]
Length=83

 Score =   121 bits (304),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 63/78 (81%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = +3

Query  135  IDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQTVLC  314
            +DLLNP AE E K+HKLKRLVQSPNS+FMDVKC GCF ITTVFSH+QTVV+C +C +VLC
Sbjct  5    VDLLNPSAEYELKQHKLKRLVQSPNSYFMDVKCPGCFAITTVFSHAQTVVICASCTSVLC  64

Query  315  QPTGGRARLTEGCSFRRK  368
            QPTGG+ARLTEGCSFRRK
Sbjct  65   QPTGGKARLTEGCSFRRK  82



>gb|EPB84084.1| 40S ribosomal protein S27 [Mucor circinelloides f. circinelloides 
1006PhL]
 dbj|GAN07540.1| 40S ribosomal protein S27 [Mucor ambiguus]
 emb|CEP13930.1| hypothetical protein [Parasitella parasitica]
Length=84

 Score =   121 bits (304),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +3

Query  135  IDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQTVLC  314
            IDLLNP  E EK+ HKLKRLVQSPNS+FMDVKC GC NI+TVFSH+QTVV+C +C TVLC
Sbjct  5    IDLLNPSVEHEKRSHKLKRLVQSPNSYFMDVKCPGCLNISTVFSHAQTVVLCSSCGTVLC  64

Query  315  QPTGGRARLTEGCSFRRKGD  374
            QPTGGRARLTEGCSFRRK +
Sbjct  65   QPTGGRARLTEGCSFRRKAN  84



>ref|XP_001828417.1| 40S ribosomal protein S27 [Coprinopsis cinerea okayama7#130]
 gb|EAU93409.1| ribosomal protein S27 [Coprinopsis cinerea okayama7#130]
Length=83

 Score =   121 bits (303),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 63/78 (81%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = +3

Query  135  IDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQTVLC  314
            +DLLNP AE E K+HKLKRLVQSPNS+FMDVKC GCF ITTVFSH+QTVV+C +C +VLC
Sbjct  5    VDLLNPSAEHEAKQHKLKRLVQSPNSYFMDVKCPGCFAITTVFSHAQTVVICSSCTSVLC  64

Query  315  QPTGGRARLTEGCSFRRK  368
            QPTGG+ARLTEGCSFRRK
Sbjct  65   QPTGGKARLTEGCSFRRK  82



>gb|KIL71015.1| hypothetical protein M378DRAFT_183546 [Amanita muscaria Koide 
BX008]
Length=83

 Score =   121 bits (303),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 63/82 (77%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = +3

Query  123  LPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQ  302
            +P  +DLLNP AE EK++HKLKRLVQSPNS+FMDVKC GCF I+TVFSH+QTVV+CG C 
Sbjct  1    MPLAVDLLNPSAEAEKRRHKLKRLVQSPNSYFMDVKCSGCFAISTVFSHAQTVVLCGACS  60

Query  303  TVLCQPTGGRARLTEGCSFRRK  368
            +VLCQPTGG+ARLTEG SFRRK
Sbjct  61   SVLCQPTGGKARLTEGSSFRRK  82



>ref|XP_005539223.1| 40S ribosomal protein S27 [Cyanidioschyzon merolae strain 10D]
 dbj|BAM83187.1| 40S ribosomal protein S27 [Cyanidioschyzon merolae strain 10D]
Length=85

 Score =   121 bits (303),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = +3

Query  132  DIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQTVL  311
            + DLL+PP E E +KHKLKRLVQSPNS+FMDVKCQGC  ITT+FSH+QTVVVCG+C TVL
Sbjct  5    ESDLLHPPKESEARKHKLKRLVQSPNSYFMDVKCQGCLAITTIFSHAQTVVVCGSCATVL  64

Query  312  CQPTGGRARLTEGCSFRRKGD  374
            CQPTGG+ RL++GCSFRRK D
Sbjct  65   CQPTGGKVRLSQGCSFRRKVD  85



>ref|XP_002452082.1| hypothetical protein SORBIDRAFT_04g018990 [Sorghum bicolor]
 gb|EES05058.1| hypothetical protein SORBIDRAFT_04g018990 [Sorghum bicolor]
Length=87

 Score =   121 bits (303),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 70/85 (82%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL NDIDLLNPPAELEK KHK KRLVQSPNSFFMDVKCQGC +ITTVFSHSQTVVVC  
Sbjct  1    MVLQNDIDLLNPPAELEKLKHKKKRLVQSPNSFFMDVKCQGCLSITTVFSHSQTVVVCPG  60

Query  297  CQTVLCQPTGGRARLTEGCSFRRKG  371
            CQTVLCQPTGG+ARL  GC  +  G
Sbjct  61   CQTVLCQPTGGKARLPGGCIKQYSG  85



>emb|CEP11719.1| hypothetical protein [Parasitella parasitica]
Length=555

 Score =   129 bits (325),  Expect = 7e-32, Method: Composition-based stats.
 Identities = 64/80 (80%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +3

Query  135  IDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQTVLC  314
            IDLLNP  E EK+ HKLKRLVQSPNS+FMDVKC GC NI+TVFSH+QTVV+C +C TVLC
Sbjct  476  IDLLNPSVEHEKRSHKLKRLVQSPNSYFMDVKCPGCLNISTVFSHAQTVVLCSSCGTVLC  535

Query  315  QPTGGRARLTEGCSFRRKGD  374
            QPTGGRARLTEGCSFRRK +
Sbjct  536  QPTGGRARLTEGCSFRRKAN  555



>ref|XP_007312861.1| hypothetical protein SERLADRAFT_376403 [Serpula lacrymans var. 
lacrymans S7.9]
 gb|EGO05235.1| hypothetical protein SERLA73DRAFT_118795 [Serpula lacrymans var. 
lacrymans S7.3]
 gb|EGO30977.1| hypothetical protein SERLADRAFT_376403 [Serpula lacrymans var. 
lacrymans S7.9]
Length=83

 Score =   121 bits (303),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 64/78 (82%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = +3

Query  135  IDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQTVLC  314
            +DLLNP AE EK++HKLKRLVQSPNS+FMDVKC GCF ITTVFSH+QTVV+C  C +VLC
Sbjct  5    VDLLNPSAEHEKRQHKLKRLVQSPNSYFMDVKCPGCFAITTVFSHAQTVVLCAACASVLC  64

Query  315  QPTGGRARLTEGCSFRRK  368
            QPTGGRARLTEGCSFRRK
Sbjct  65   QPTGGRARLTEGCSFRRK  82



>gb|KIY67579.1| 40S ribosomal protein S27 [Cylindrobasidium torrendii FP15055 
ss-10]
Length=83

 Score =   121 bits (303),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 63/78 (81%), Positives = 72/78 (92%), Gaps = 0/78 (0%)
 Frame = +3

Query  135  IDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQTVLC  314
            +DLLNP  E EK+KHKLKRLVQSPNS+FMDVKC GCF ITTVFSH+QTVV+CG+C ++LC
Sbjct  5    VDLLNPSLEAEKQKHKLKRLVQSPNSYFMDVKCPGCFAITTVFSHAQTVVICGSCASILC  64

Query  315  QPTGGRARLTEGCSFRRK  368
            QPTGGRARLTEGCSFR+K
Sbjct  65   QPTGGRARLTEGCSFRKK  82



>dbj|GAN04920.1| glycerol-3-phosphate 1-acyltransferase [Mucor ambiguus]
Length=594

 Score =   129 bits (325),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 64/80 (80%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +3

Query  135  IDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQTVLC  314
            IDLLNP  E EK+ HKLKRLVQSPNS+FMDVKC GC NI+TVFSH+QTVV+C +C TVLC
Sbjct  515  IDLLNPSVEHEKRSHKLKRLVQSPNSYFMDVKCPGCLNISTVFSHAQTVVLCSSCGTVLC  574

Query  315  QPTGGRARLTEGCSFRRKGD  374
            QPTGGRARLTEGCSFRRK +
Sbjct  575  QPTGGRARLTEGCSFRRKAN  594



>gb|EUC67120.1| 40S ribosomal protein S27 [Rhizoctonia solani AG-3 Rhs1AP]
 gb|KEP55585.1| 40S ribosomal protein S27 [Rhizoctonia solani 123E]
Length=83

 Score =   120 bits (302),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 64/79 (81%), Positives = 71/79 (90%), Gaps = 0/79 (0%)
 Frame = +3

Query  135  IDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQTVLC  314
            IDLLNP  E EK++HKLKRLVQSPNS+FMDVKC GCF ITTVFSH+QTVV+C +C TVLC
Sbjct  5    IDLLNPSHEHEKRQHKLKRLVQSPNSYFMDVKCPGCFAITTVFSHAQTVVMCSSCATVLC  64

Query  315  QPTGGRARLTEGCSFRRKG  371
            QPTGG+ARLTEGCSFRRK 
Sbjct  65   QPTGGKARLTEGCSFRRKA  83



>emb|CEG74698.1| Putative 40S ribosomal protein S27 [Rhizopus microsporus]
 emb|CEG68820.1| Putative 40S ribosomal protein S27 [Rhizopus microsporus]
 emb|CEI96311.1| Putative 40S ribosomal protein S27 [Rhizopus microsporus]
Length=84

 Score =   120 bits (302),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +3

Query  135  IDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQTVLC  314
            +DLLNP  E EK+ HKLKRLVQSPNS+FMDVKC GC NI+TVFSH+QTVV+C +C TVLC
Sbjct  5    VDLLNPSVEHEKRSHKLKRLVQSPNSYFMDVKCPGCLNISTVFSHAQTVVLCSSCGTVLC  64

Query  315  QPTGGRARLTEGCSFRRKGD  374
            QPTGGRARLTEGCSFRRK +
Sbjct  65   QPTGGRARLTEGCSFRRKAN  84



>emb|CEP15743.1| hypothetical protein [Parasitella parasitica]
Length=550

 Score =   129 bits (324),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 63/80 (79%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +3

Query  135  IDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQTVLC  314
            +DLLNP  E EK+ HKLKRLVQSPNS+FMDVKC GC NI+TVFSH+QTVV+C +C TVLC
Sbjct  471  VDLLNPSVEHEKRSHKLKRLVQSPNSYFMDVKCPGCLNISTVFSHAQTVVLCSSCGTVLC  530

Query  315  QPTGGRARLTEGCSFRRKGD  374
            QPTGGRARLTEGCSFRRK +
Sbjct  531  QPTGGRARLTEGCSFRRKAN  550



>gb|KIK49593.1| hypothetical protein CY34DRAFT_797038 [Suillus luteus UH-Slu-Lm8-n1]
Length=83

 Score =   120 bits (302),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = +3

Query  123  LPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQ  302
            +P  IDLLNP AE E+K+HKLKRLVQSP+S+FMDVKC GCF ITTVFSH+Q+VV+CG+C 
Sbjct  1    MPLAIDLLNPSAEHERKQHKLKRLVQSPDSYFMDVKCPGCFAITTVFSHAQSVVLCGSCA  60

Query  303  TVLCQPTGGRARLTEGCSFRRK  368
            +VLCQPTGGRARLTEG SFRRK
Sbjct  61   SVLCQPTGGRARLTEGSSFRRK  82



>dbj|GAN04500.1| acyltransferase [Mucor ambiguus]
Length=552

 Score =   129 bits (324),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 63/80 (79%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +3

Query  135  IDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQTVLC  314
            +DLLNP  E EK+ HKLKRLVQSPNS+FMDVKC GC NI+TVFSH+QTVV+C +C TVLC
Sbjct  473  VDLLNPSVEHEKRSHKLKRLVQSPNSYFMDVKCPGCLNISTVFSHAQTVVLCSSCGTVLC  532

Query  315  QPTGGRARLTEGCSFRRKGD  374
            QPTGGRARLTEGCSFRRK +
Sbjct  533  QPTGGRARLTEGCSFRRKAN  552



>gb|EPB83252.1| hypothetical protein HMPREF1544_09996 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=553

 Score =   129 bits (324),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 63/80 (79%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +3

Query  135  IDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQTVLC  314
            +DLLNP  E EK+ HKLKRLVQSPNS+FMDVKC GC NI+TVFSH+QTVV+C +C TVLC
Sbjct  474  VDLLNPSVEHEKRSHKLKRLVQSPNSYFMDVKCPGCLNISTVFSHAQTVVLCSSCGTVLC  533

Query  315  QPTGGRARLTEGCSFRRKGD  374
            QPTGGRARLTEGCSFRRK +
Sbjct  534  QPTGGRARLTEGCSFRRKAN  553



>gb|KIJ21531.1| hypothetical protein PAXINDRAFT_165006 [Paxillus involutus ATCC 
200175]
Length=83

 Score =   120 bits (302),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 63/82 (77%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = +3

Query  123  LPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQ  302
            +P  +DLLNP  E EK++HKLKRLVQSPNS+FMDVKC GCF ITTVFSH+Q+VV+CG+C 
Sbjct  1    MPLAVDLLNPSLEHEKRQHKLKRLVQSPNSYFMDVKCPGCFAITTVFSHAQSVVLCGSCA  60

Query  303  TVLCQPTGGRARLTEGCSFRRK  368
            +VLCQPTGG+ARLTEGCSFRRK
Sbjct  61   SVLCQPTGGKARLTEGCSFRRK  82



>gb|KIO26317.1| hypothetical protein M407DRAFT_243776 [Tulasnella calospora MUT 
4182]
Length=83

 Score =   120 bits (301),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 71/84 (85%), Gaps = 2/84 (2%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL   +DLLNP A   K+ HKLKRLVQ PNS+FMDVKC GCF ITTVFSH+QTVV+CG+
Sbjct  1    MVLA--VDLLNPSAAQTKRTHKLKRLVQEPNSYFMDVKCPGCFAITTVFSHAQTVVMCGS  58

Query  297  CQTVLCQPTGGRARLTEGCSFRRK  368
            C  VLCQPTGG+ARLTEGCSFRRK
Sbjct  59   CSQVLCQPTGGKARLTEGCSFRRK  82



>ref|XP_009842102.1| 40S ribosomal protein S27-like protein [Aphanomyces astaci]
 gb|ETV68476.1| 40S ribosomal protein S27-like protein [Aphanomyces astaci]
Length=82

 Score =   120 bits (301),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/79 (78%), Positives = 71/79 (90%), Gaps = 0/79 (0%)
 Frame = +3

Query  138  DLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQTVLCQ  317
            DLL+P A  E+ KHKLKRLVQ+PNSFFMDVKC GCFNITTVFSH+QTVV+CG+C  +LCQ
Sbjct  4    DLLHPTATEERSKHKLKRLVQAPNSFFMDVKCPGCFNITTVFSHAQTVVLCGSCSVMLCQ  63

Query  318  PTGGRARLTEGCSFRRKGD  374
            PTGG+ARLTEGCSFR+K D
Sbjct  64   PTGGKARLTEGCSFRKKTD  82



>ref|XP_006446890.1| hypothetical protein CICLE_v10017799mg [Citrus clementina]
 gb|ESR60130.1| hypothetical protein CICLE_v10017799mg [Citrus clementina]
Length=81

 Score =   120 bits (301),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 70/86 (81%), Positives = 74/86 (86%), Gaps = 5/86 (6%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL NDIDLLNPP ELEKKK KLK L+QSPNSFFM     GCFNIT +FSHSQTVVVCGN
Sbjct  1    MVLQNDIDLLNPPVELEKKKCKLKHLIQSPNSFFM-----GCFNITIIFSHSQTVVVCGN  55

Query  297  CQTVLCQPTGGRARLTEGCSFRRKGD  374
            CQ+VL QPTGGRARLTEGC FR+KGD
Sbjct  56   CQSVLRQPTGGRARLTEGCYFRKKGD  81



>emb|CCA68832.1| probable 40S ribosomal protein S27 [Piriformospora indica DSM 
11827]
Length=83

 Score =   120 bits (301),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 64/79 (81%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +3

Query  135  IDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQTVLC  314
            +DLLNP  E EK KHKLKRLVQSPNS+FMDVKC GCF ITTVFSH+QTVV+C  C TVLC
Sbjct  5    VDLLNPSLEAEKSKHKLKRLVQSPNSYFMDVKCPGCFAITTVFSHAQTVVLCSACSTVLC  64

Query  315  QPTGGRARLTEGCSFRRKG  371
            QPTGG+ARLTEGCSFRRK 
Sbjct  65   QPTGGKARLTEGCSFRRKA  83



>gb|KDQ54756.1| hypothetical protein JAAARDRAFT_347609 [Jaapia argillacea MUCL 
33604]
Length=83

 Score =   120 bits (301),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/78 (82%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = +3

Query  135  IDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQTVLC  314
            IDLLNP  E EK+ HKLKRLVQSPNS+FMDVKC GCF ITTVFSH+QTVV+CG+C +VLC
Sbjct  5    IDLLNPLPESEKRSHKLKRLVQSPNSYFMDVKCPGCFAITTVFSHAQTVVLCGSCASVLC  64

Query  315  QPTGGRARLTEGCSFRRK  368
            QPTGG+ARLTEGCSFRRK
Sbjct  65   QPTGGKARLTEGCSFRRK  82



>emb|CEG63847.1| Putative 40S ribosomal protein S27 [Rhizopus microsporus]
 emb|CEI98018.1| Putative 40S ribosomal protein S27 [Rhizopus microsporus]
 emb|CEI96443.1| Putative 40S ribosomal protein S27 [Rhizopus microsporus]
Length=86

 Score =   120 bits (301),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +3

Query  135  IDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQTVLC  314
            +DLLNP  E EK+ HKLKRLVQSPNS+FMDVKC GC NI+TVFSH+QTVV+C +C TVLC
Sbjct  7    VDLLNPSVEHEKRSHKLKRLVQSPNSYFMDVKCPGCLNISTVFSHAQTVVLCSSCGTVLC  66

Query  315  QPTGGRARLTEGCSFRRKGD  374
            QPTGGRARLTEGCSFRRK +
Sbjct  67   QPTGGRARLTEGCSFRRKAN  86



>gb|KIK98514.1| hypothetical protein PAXRUDRAFT_823809 [Paxillus rubicundulus 
Ve08.2h10]
Length=83

 Score =   120 bits (301),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/82 (77%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = +3

Query  123  LPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQ  302
            +P  IDLLNP  E EK++HKLKRLVQSPNS+FMDVKC GCF ITTVFSH+Q+VV+CG+C 
Sbjct  1    MPLAIDLLNPSLEHEKRQHKLKRLVQSPNSYFMDVKCPGCFAITTVFSHAQSVVLCGSCA  60

Query  303  TVLCQPTGGRARLTEGCSFRRK  368
            +VLCQP+GG+ARLTEGCSFRRK
Sbjct  61   SVLCQPSGGKARLTEGCSFRRK  82



>gb|KIK26487.1| hypothetical protein PISMIDRAFT_28413 [Pisolithus microcarpus 
441]
Length=83

 Score =   120 bits (300),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = +3

Query  123  LPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQ  302
            +P  +DLLNP AE E KKHKLKRLVQSPNS+FMDVKC GCF ITTVFSH+Q+VV+CG+C 
Sbjct  1    MPLVVDLLNPSAEAENKKHKLKRLVQSPNSYFMDVKCPGCFAITTVFSHAQSVVLCGSCA  60

Query  303  TVLCQPTGGRARLTEGCSFRRK  368
            +VLCQPTGG+ARLTEG SFRRK
Sbjct  61   SVLCQPTGGKARLTEGSSFRRK  82



>ref|XP_009269072.1| 40S ribosomal protein S27 [Wallemia ichthyophaga EXF-994]
 gb|EOR00008.1| 40S ribosomal protein S27 [Wallemia ichthyophaga EXF-994]
Length=96

 Score =   120 bits (301),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 65/90 (72%), Positives = 75/90 (83%), Gaps = 0/90 (0%)
 Frame = +3

Query  99   SSTFNTMVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQT  278
            +ST +  V   ++DLLNP  + E +KHKLKRLV SPNSFFMDVKC GCF ITTVFSH+QT
Sbjct  6    NSTTDNAVFLKNVDLLNPSYQSEVQKHKLKRLVPSPNSFFMDVKCPGCFAITTVFSHAQT  65

Query  279  VVVCGNCQTVLCQPTGGRARLTEGCSFRRK  368
            VV+CG+C TVL QPTGG+ARLTEGCSFRRK
Sbjct  66   VVLCGSCSTVLSQPTGGKARLTEGCSFRRK  95



>emb|CEG76972.1| Putative 40S ribosomal protein S27 [Rhizopus microsporus]
Length=86

 Score =   120 bits (300),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +3

Query  135  IDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQTVLC  314
            +DLLNP  E EK+ HKLKRLVQSPNS+FMDVKC GC NI+TVFSH+QTVV+C +C TVLC
Sbjct  7    VDLLNPSVEHEKRSHKLKRLVQSPNSYFMDVKCPGCLNISTVFSHAQTVVLCSSCGTVLC  66

Query  315  QPTGGRARLTEGCSFRRKGD  374
            QPTGGRARLTEGCSFRRK +
Sbjct  67   QPTGGRARLTEGCSFRRKAN  86



>emb|CCO26109.1| 40S ribosomal protein S27 [Rhizoctonia solani AG-1 IB]
 gb|KDN49424.1| 40S ribosomal protein S27, partial [Rhizoctonia solani AG-8 WAC10335]
 emb|CEL52365.1| 40S ribosomal protein S27 OS=Schizosaccharomyces pombe (strain 
972 / ATCC 24843) GN=rps27 PE=3 SV=1 [Rhizoctonia solani AG-1 
IB]
Length=83

 Score =   120 bits (300),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/79 (80%), Positives = 71/79 (90%), Gaps = 0/79 (0%)
 Frame = +3

Query  135  IDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQTVLC  314
            +DLLNP  E EK++HKLKRLVQSPNS+FMDVKC GCF ITTVFSH+QTVV+C +C TVLC
Sbjct  5    VDLLNPSHEHEKRQHKLKRLVQSPNSYFMDVKCPGCFAITTVFSHAQTVVMCSSCATVLC  64

Query  315  QPTGGRARLTEGCSFRRKG  371
            QPTGG+ARLTEGCSFRRK 
Sbjct  65   QPTGGKARLTEGCSFRRKA  83



>ref|XP_006454760.1| 40S ribosomal protein S27 [Agaricus bisporus var. bisporus H97]
 gb|EKV51783.1| 40S ribosomal protein S27 [Agaricus bisporus var. bisporus H97]
Length=83

 Score =   119 bits (299),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 63/82 (77%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = +3

Query  123  LPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQ  302
            +P  +DLLNP  E EK++HKLKRLVQSPNS+FMDVKC GCF ITTVFSH+QTVVVC  C 
Sbjct  1    MPLAVDLLNPSPEYEKRQHKLKRLVQSPNSYFMDVKCPGCFAITTVFSHAQTVVVCAACT  60

Query  303  TVLCQPTGGRARLTEGCSFRRK  368
            ++LCQPTGG+ARLTEGCSFRRK
Sbjct  61   SILCQPTGGKARLTEGCSFRRK  82



>ref|XP_009541432.1| hypothetical protein HETIRDRAFT_378607 [Heterobasidion irregulare 
TC 32-1]
 gb|ETW87540.1| hypothetical protein HETIRDRAFT_378607 [Heterobasidion irregulare 
TC 32-1]
Length=83

 Score =   119 bits (299),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 62/78 (79%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +3

Query  135  IDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQTVLC  314
            +DLLNP AE EK+ HKLKRLVQSPNS+FMDVKC GCF ITTVFSH+QTVV+CG C +VLC
Sbjct  5    VDLLNPSAEHEKRSHKLKRLVQSPNSYFMDVKCPGCFAITTVFSHAQTVVICGACASVLC  64

Query  315  QPTGGRARLTEGCSFRRK  368
            QPTGG+ARLTEG S+RRK
Sbjct  65   QPTGGKARLTEGSSYRRK  82



>ref|XP_002176067.1| 40S ribosomal protein S27 [Schizosaccharomyces japonicus yFS275]
 gb|EEB09774.1| 40S ribosomal protein S27 [Schizosaccharomyces japonicus yFS275]
Length=83

 Score =   119 bits (299),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 66/84 (79%), Positives = 73/84 (87%), Gaps = 2/84 (2%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL   +DLLNP  E E KKHKLK+LVQSP S+FMDVKC GCFNITTVFSH+QTVV+CG+
Sbjct  1    MVLA--VDLLNPSPESELKKHKLKQLVQSPRSYFMDVKCSGCFNITTVFSHAQTVVICGS  58

Query  297  CQTVLCQPTGGRARLTEGCSFRRK  368
            C TVLCQPTGG+ARL EGCSFRRK
Sbjct  59   CATVLCQPTGGKARLMEGCSFRRK  82



>gb|KIK05557.1| hypothetical protein K443DRAFT_675114 [Laccaria amethystina LaAM-08-1]
Length=83

 Score =   119 bits (299),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 62/78 (79%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +3

Query  135  IDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQTVLC  314
            +DLLNP  E E K+HKLKRLVQSPNS+FMDVKC GCF ITTVFSH+QTVV+C +C +VLC
Sbjct  5    VDLLNPSTEYELKQHKLKRLVQSPNSYFMDVKCPGCFAITTVFSHAQTVVICASCTSVLC  64

Query  315  QPTGGRARLTEGCSFRRK  368
            QPTGG+ARLTEGCSFRRK
Sbjct  65   QPTGGKARLTEGCSFRRK  82



>ref|XP_007842411.1| 40s ribosomal protein s27 [Moniliophthora roreri MCA 2997]
 gb|ESK98476.1| 40s ribosomal protein s27 [Moniliophthora roreri MCA 2997]
Length=83

 Score =   119 bits (298),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 62/78 (79%), Positives = 73/78 (94%), Gaps = 0/78 (0%)
 Frame = +3

Query  135  IDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQTVLC  314
            +DLLNP  ELEK++HKLKRLVQSPNS+FMDVKC GCF ITTVFSH+QTVV+CG+C ++LC
Sbjct  5    VDLLNPSPELEKRQHKLKRLVQSPNSYFMDVKCPGCFTITTVFSHAQTVVICGSCASILC  64

Query  315  QPTGGRARLTEGCSFRRK  368
            QPTGG+ARLTEGCSFR+K
Sbjct  65   QPTGGKARLTEGCSFRKK  82



>gb|KIM19626.1| hypothetical protein M408DRAFT_18707 [Serendipita vermifera MAFF 
305830]
Length=83

 Score =   119 bits (298),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 62/79 (78%), Positives = 70/79 (89%), Gaps = 0/79 (0%)
 Frame = +3

Query  135  IDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQTVLC  314
            +DLLNP  E EK +HKLKRLVQSPNSFFMDVKC GCF +TTVFSH+QTVV+C +C TVLC
Sbjct  5    VDLLNPSPEAEKSRHKLKRLVQSPNSFFMDVKCPGCFAVTTVFSHAQTVVLCSSCSTVLC  64

Query  315  QPTGGRARLTEGCSFRRKG  371
            QPTGG+ARLTEGC+FRRK 
Sbjct  65   QPTGGKARLTEGCAFRRKA  83



>ref|XP_009804519.1| PREDICTED: 40S ribosomal protein S27-3-like [Nicotiana sylvestris]
 ref|XP_009804520.1| PREDICTED: 40S ribosomal protein S27-3-like [Nicotiana sylvestris]
Length=95

 Score =   119 bits (299),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = +3

Query  123  LPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQ  302
            + NDIDLL+PPAELEK+ HKLKRLV SP+S F+DVKC GCF ITT+FSHSQTVV C NCQ
Sbjct  6    ISNDIDLLHPPAELEKQNHKLKRLVPSPDSTFLDVKCPGCFQITTIFSHSQTVVTCANCQ  65

Query  303  TVLCQPTGGRARLTEGCSFRRK  368
             VLCQPTGGRA+LTEGCSFR K
Sbjct  66   QVLCQPTGGRAKLTEGCSFRVK  87



>ref|XP_005711226.1| unnamed protein product [Chondrus crispus]
 emb|CDF40932.1| unnamed protein product [Chondrus crispus]
Length=85

 Score =   119 bits (298),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 63/81 (78%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = +3

Query  132  DIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQTVL  311
            + DLLNP   +E KKHKLKRLVQSPNS+FMDVKC GC+ ITTVFSH+QTVVVCG+C  VL
Sbjct  5    ETDLLNPDHAVEMKKHKLKRLVQSPNSYFMDVKCPGCYVITTVFSHAQTVVVCGDCTMVL  64

Query  312  CQPTGGRARLTEGCSFRRKGD  374
            CQPTGG+ARLTEGCSFR+K D
Sbjct  65   CQPTGGKARLTEGCSFRKKVD  85



>gb|EXX70688.1| ribosomal 40S subunit protein S27B [Rhizophagus irregularis DAOM 
197198w]
Length=84

 Score =   119 bits (298),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 67/84 (80%), Positives = 75/84 (89%), Gaps = 2/84 (2%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL   +DLLNP  E EK++HKLKRLVQSPNS+FMDVKC GCF+ITTVFSH+QTVV+CG+
Sbjct  1    MVL--TVDLLNPTPECEKRQHKLKRLVQSPNSYFMDVKCPGCFSITTVFSHAQTVVLCGS  58

Query  297  CQTVLCQPTGGRARLTEGCSFRRK  368
            C  VLCQPTGGRARLTEGCSFRRK
Sbjct  59   CANVLCQPTGGRARLTEGCSFRRK  82



>gb|EIE92409.1| 40S ribosomal protein S27 [Rhizopus delemar RA 99-880]
Length=84

 Score =   119 bits (298),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +3

Query  135  IDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQTVLC  314
            +DLLNP  E EK+ HKLKRLVQSPNS+FMDVKC GC NI+TVFSH+QTVV+C +C TVLC
Sbjct  5    VDLLNPSIEHEKRSHKLKRLVQSPNSYFMDVKCPGCLNISTVFSHAQTVVLCSSCGTVLC  64

Query  315  QPTGGRARLTEGCSFRRKGD  374
            QPTGGRARLTEGCSFR+K +
Sbjct  65   QPTGGRARLTEGCSFRKKAN  84



>ref|XP_002173548.1| 40S ribosomal protein S27 [Schizosaccharomyces japonicus yFS275]
 gb|EEB07255.1| 40S ribosomal protein S27 [Schizosaccharomyces japonicus yFS275]
Length=83

 Score =   119 bits (298),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 63/78 (81%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +3

Query  135  IDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQTVLC  314
            +DLLNP  E E +KHKLK+LVQSP SFFMDVKC GCFNITTVFSH+QTVV+CG+C TVLC
Sbjct  5    VDLLNPSHESELRKHKLKQLVQSPRSFFMDVKCPGCFNITTVFSHAQTVVICGSCATVLC  64

Query  315  QPTGGRARLTEGCSFRRK  368
            QPTGG+ARL EGCSFRRK
Sbjct  65   QPTGGKARLMEGCSFRRK  82



>ref|XP_007230626.1| PREDICTED: 40S ribosomal protein S27-like [Astyanax mexicanus]
Length=84

 Score =   119 bits (298),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 61/82 (74%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = +3

Query  123  LPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQ  302
            +P   DLL+PP E E+++HK KRLVQSPNS+FMDVKC GC+ ITTVFSH+QTVV+C  C 
Sbjct  1    MPLAKDLLHPPPEEERRRHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVGCS  60

Query  303  TVLCQPTGGRARLTEGCSFRRK  368
            TVLCQPTGG+ARLTEGCSFRRK
Sbjct  61   TVLCQPTGGKARLTEGCSFRRK  82



>ref|XP_003384020.1| PREDICTED: 40S ribosomal protein S27 [Amphimedon queenslandica]
Length=84

 Score =   119 bits (297),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = +3

Query  123  LPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQ  302
            +P   DLL+P  E EK+KHKLKRLVQSPNSFFMDVKC GC+ ITTVFSH+QTVV+C NC+
Sbjct  1    MPLAKDLLHPSPEEEKRKHKLKRLVQSPNSFFMDVKCPGCYKITTVFSHAQTVVLCANCR  60

Query  303  TVLCQPTGGRARLTEGCSFRRK  368
             VLCQPTGG+ARLTEGCSFRRK
Sbjct  61   NVLCQPTGGKARLTEGCSFRRK  82



>ref|XP_003038484.1| 40S ribosomal protein S27 [Schizophyllum commune H4-8]
 gb|EFJ03582.1| 40S ribosomal protein S27 [Schizophyllum commune H4-8]
Length=83

 Score =   119 bits (297),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 63/78 (81%), Positives = 72/78 (92%), Gaps = 0/78 (0%)
 Frame = +3

Query  135  IDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQTVLC  314
            +DLLNP AE EK+KHKLKRLV SPNS+FMDVKC GCF ITTVFSH+QTVV+CG+C +VLC
Sbjct  5    VDLLNPSAEQEKRKHKLKRLVPSPNSYFMDVKCPGCFAITTVFSHAQTVVMCGSCASVLC  64

Query  315  QPTGGRARLTEGCSFRRK  368
            QPTGG+ARLTEGCSFR+K
Sbjct  65   QPTGGKARLTEGCSFRKK  82



>emb|CDH50073.1| 40s ribosomal protein s27 [Lichtheimia corymbifera JMRC:FSU:9682]
Length=122

 Score =   120 bits (300),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 65/94 (69%), Positives = 76/94 (81%), Gaps = 2/94 (2%)
 Frame = +3

Query  93   FRSSTFNTMVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHS  272
            FR+   + M L   +DLLNP  E EK+ HKLKRLVQSP+S+FMDVKC GC NI+TVFSH+
Sbjct  31   FRAPAADIMTLA--VDLLNPSVEHEKRSHKLKRLVQSPDSYFMDVKCPGCLNISTVFSHA  88

Query  273  QTVVVCGNCQTVLCQPTGGRARLTEGCSFRRKGD  374
            QTVV+C +C TVLCQPTGGRARLTEG SFRRK +
Sbjct  89   QTVVLCSSCGTVLCQPTGGRARLTEGSSFRRKHN  122



>ref|XP_011388013.1| ribosomal 40S subunit protein S27 [Ustilago maydis 521]
 emb|CBQ71847.1| probable 40S ribosomal protein S27 [Sporisorium reilianum SRZ2]
 gb|EST07599.1| 40S ribosomal protein S27 [Pseudozyma brasiliensis GHG001]
 emb|CDI52504.1| probable 40S ribosomal protein S27 [Melanopsichium pennsylvanicum 
4]
 gb|KIS70459.1| ribosomal 40S subunit protein S27 [Ustilago maydis 521]
Length=83

 Score =   118 bits (296),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 61/79 (77%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +3

Query  135  IDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQTVLC  314
            +DLLNP AE + + HKLKRLVQ+PNSFFMDVKC GCF ITTVFSH+QTVVVCG+C  VL 
Sbjct  5    VDLLNPSAEQQARSHKLKRLVQNPNSFFMDVKCPGCFAITTVFSHAQTVVVCGSCAQVLS  64

Query  315  QPTGGRARLTEGCSFRRKG  371
            QPTGG+ARLTEGCSFR+K 
Sbjct  65   QPTGGKARLTEGCSFRKKA  83



>ref|XP_007246542.1| PREDICTED: 40S ribosomal protein S27-like [Astyanax mexicanus]
Length=84

 Score =   118 bits (296),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 62/82 (76%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = +3

Query  123  LPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQ  302
            +P  IDLLNP  +LE+++HK KRLVQSPNS+FMDVKC GC+ ITTVFSH+QTVV+C  C 
Sbjct  1    MPLAIDLLNPSFDLERRRHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVGCS  60

Query  303  TVLCQPTGGRARLTEGCSFRRK  368
            TVLCQPTGG+ARLTEGCSFRRK
Sbjct  61   TVLCQPTGGKARLTEGCSFRRK  82



>ref|XP_007763247.1| ribosomal protein S27 [Coniophora puteana RWD-64-598 SS2]
 gb|EIW86429.1| ribosomal protein S27 [Coniophora puteana RWD-64-598 SS2]
Length=88

 Score =   119 bits (297),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 62/78 (79%), Positives = 72/78 (92%), Gaps = 0/78 (0%)
 Frame = +3

Query  135  IDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQTVLC  314
            +DLLNP  E EK++HKLKRLVQSPNS+FMDVKC GCF ITTVFSH+Q+VV+CG+C +VLC
Sbjct  10   VDLLNPSLEHEKRQHKLKRLVQSPNSYFMDVKCPGCFAITTVFSHAQSVVLCGSCASVLC  69

Query  315  QPTGGRARLTEGCSFRRK  368
            QPTGG+ARLTEGCSFRRK
Sbjct  70   QPTGGKARLTEGCSFRRK  87



>ref|XP_009038097.1| hypothetical protein AURANDRAFT_27981 [Aureococcus anophagefferens]
 gb|EGB07485.1| hypothetical protein AURANDRAFT_27981 [Aureococcus anophagefferens]
Length=82

 Score =   118 bits (296),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 62/79 (78%), Positives = 71/79 (90%), Gaps = 0/79 (0%)
 Frame = +3

Query  138  DLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQTVLCQ  317
            DLL+P +  EK+KHKLKRLVQSPNSFFMDVKC GCFNITTVFSH+QT V+CG+C  +LCQ
Sbjct  4    DLLHPSSVEEKRKHKLKRLVQSPNSFFMDVKCPGCFNITTVFSHAQTTVLCGSCSMMLCQ  63

Query  318  PTGGRARLTEGCSFRRKGD  374
            PTGG+ARLTEGCSFR+K D
Sbjct  64   PTGGKARLTEGCSFRKKLD  82



>ref|XP_009619646.1| PREDICTED: 40S ribosomal protein S27-3-like [Nicotiana tomentosiformis]
 ref|XP_009619647.1| PREDICTED: 40S ribosomal protein S27-3-like [Nicotiana tomentosiformis]
Length=95

 Score =   119 bits (297),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = +3

Query  123  LPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQ  302
            + NDIDLL+PPAELEK+KHKLKRLV SP+S F+DVKC GCF ITT+FSHSQTVV C NCQ
Sbjct  6    ISNDIDLLHPPAELEKQKHKLKRLVPSPDSTFLDVKCPGCFQITTIFSHSQTVVTCPNCQ  65

Query  303  TVLCQPTGGRARLTEGCSFRRK  368
             VLCQPTGGRA+LTEGCSFR K
Sbjct  66   QVLCQPTGGRAKLTEGCSFRVK  87



>gb|KDR72772.1| hypothetical protein GALMADRAFT_73283, partial [Galerina marginata 
CBS 339.88]
Length=83

 Score =   118 bits (296),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 62/78 (79%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = +3

Query  135  IDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQTVLC  314
            +DLL+P AE E ++HKLKRLVQSPNS+FMDVKC GCF ITTVFSH+QTVVVC +C +VLC
Sbjct  5    VDLLHPTAEYEARQHKLKRLVQSPNSYFMDVKCPGCFAITTVFSHAQTVVVCPSCTSVLC  64

Query  315  QPTGGRARLTEGCSFRRK  368
            QPTGG+ARLTEGCSFRRK
Sbjct  65   QPTGGKARLTEGCSFRRK  82



>emb|CCI43109.1| unnamed protein product [Albugo candida]
Length=82

 Score =   118 bits (296),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 59/79 (75%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +3

Query  138  DLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQTVLCQ  317
            DLL+P A  E  KHKLKRLVQSPNS+FMDVKC GCFNITTVFSH+QTVV+CG+C  +LCQ
Sbjct  4    DLLHPSASEEASKHKLKRLVQSPNSYFMDVKCAGCFNITTVFSHAQTVVLCGSCSLMLCQ  63

Query  318  PTGGRARLTEGCSFRRKGD  374
            PTGG+ARLT+GC +R+K D
Sbjct  64   PTGGKARLTDGCQYRKKTD  82



>ref|XP_007298188.1| 40S ribosomal protein S27 [Stereum hirsutum FP-91666 SS1]
 gb|EIM92680.1| 40S ribosomal protein S27 [Stereum hirsutum FP-91666 SS1]
Length=83

 Score =   118 bits (296),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 60/78 (77%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = +3

Query  135  IDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQTVLC  314
            +DLLNP A  E ++HKLKRLVQSPNS+FMDVKC GCF ITTVFSH+QTVV+CG C +VLC
Sbjct  5    VDLLNPSAGAETRRHKLKRLVQSPNSYFMDVKCPGCFAITTVFSHAQTVVLCGACASVLC  64

Query  315  QPTGGRARLTEGCSFRRK  368
            QPTGG+ARLTEG S+RRK
Sbjct  65   QPTGGKARLTEGSSYRRK  82



>ref|XP_007390302.1| hypothetical protein PHACADRAFT_247057 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EKM60859.1| hypothetical protein PHACADRAFT_247057 [Phanerochaete carnosa 
HHB-10118-sp]
Length=83

 Score =   118 bits (296),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 60/78 (77%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = +3

Query  135  IDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQTVLC  314
            +DLLNP A  E ++HKLKRLVQSPNS+FMDVKC GCF ITTVFSH+QTVV+CG C +VLC
Sbjct  5    VDLLNPSAGAEARRHKLKRLVQSPNSYFMDVKCPGCFAITTVFSHAQTVVLCGACTSVLC  64

Query  315  QPTGGRARLTEGCSFRRK  368
            QPTGG+ARLTEG S+RRK
Sbjct  65   QPTGGKARLTEGSSYRRK  82



>ref|NP_001187087.1| 40S ribosomal protein S27-1 [Ictalurus punctatus]
 gb|AAK95210.1|AF402836_1 40S ribosomal protein S27-1 [Ictalurus punctatus]
Length=84

 Score =   118 bits (296),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/82 (74%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = +3

Query  123  LPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQ  302
            +P   DLL+P AE E+++HK KRLVQSPNS+FMDVKC GC+ ITTVFSH+QTVV+C  C 
Sbjct  1    MPLAKDLLHPTAEEERRRHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVGCS  60

Query  303  TVLCQPTGGRARLTEGCSFRRK  368
            TVLCQPTGG+ARLTEGCSFRRK
Sbjct  61   TVLCQPTGGKARLTEGCSFRRK  82



>gb|KIK41858.1| hypothetical protein CY34DRAFT_805556 [Suillus luteus UH-Slu-Lm8-n1]
Length=83

 Score =   118 bits (295),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 63/78 (81%), Positives = 73/78 (94%), Gaps = 0/78 (0%)
 Frame = +3

Query  135  IDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQTVLC  314
            +DLLNP AE E+K+HKLKRLVQSP+SFFMDVKC GCF ITTVFS++Q+VV+CG+C +VLC
Sbjct  5    VDLLNPSAEHERKQHKLKRLVQSPDSFFMDVKCPGCFAITTVFSNAQSVVLCGSCASVLC  64

Query  315  QPTGGRARLTEGCSFRRK  368
            QPTGGRARLTEGCSFRRK
Sbjct  65   QPTGGRARLTEGCSFRRK  82



>gb|EJK74356.1| hypothetical protein THAOC_03970 [Thalassiosira oceanica]
Length=119

 Score =   119 bits (298),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 77/95 (81%), Gaps = 2/95 (2%)
 Frame = +3

Query  90   GFRSSTFNTMVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSH  269
            G  + + + + +P  +DLL+P AE E + HKLKRLVQ P+SFFMD+KC GCF ITTVFSH
Sbjct  27   GVSTESLHYIKMP--VDLLHPTAEQEARTHKLKRLVQGPDSFFMDIKCPGCFQITTVFSH  84

Query  270  SQTVVVCGNCQTVLCQPTGGRARLTEGCSFRRKGD  374
            +Q+VV+CG+C  +LCQPTGGRARLTEGCS+R+K D
Sbjct  85   AQSVVLCGSCNVMLCQPTGGRARLTEGCSYRKKVD  119



>gb|KJA26001.1| hypothetical protein HYPSUDRAFT_36856 [Hypholoma sublateritium 
FD-334 SS-4]
Length=83

 Score =   118 bits (295),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 62/78 (79%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = +3

Query  135  IDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQTVLC  314
            +DLL+P AE E K+HKLKRLVQSPNS+FMDVKC GCF ITTVFSH+QTVVVC +C +VLC
Sbjct  5    VDLLHPSAEHEAKQHKLKRLVQSPNSYFMDVKCPGCFAITTVFSHAQTVVVCPSCTSVLC  64

Query  315  QPTGGRARLTEGCSFRRK  368
            QPTGG+ARLTEGCSFR+K
Sbjct  65   QPTGGKARLTEGCSFRKK  82



>gb|KIP05171.1| hypothetical protein PHLGIDRAFT_92491 [Phlebiopsis gigantea 11061_1 
CR5-6]
Length=83

 Score =   118 bits (295),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/78 (77%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = +3

Query  135  IDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQTVLC  314
            +DLLNP A  E ++HKLKRLVQSPNS+FMDVKC GCF ITTVFSH+QTVV+CG C +VLC
Sbjct  5    VDLLNPSAPAEARRHKLKRLVQSPNSYFMDVKCPGCFAITTVFSHAQTVVLCGACTSVLC  64

Query  315  QPTGGRARLTEGCSFRRK  368
            QPTGG+ARLTEG S+RRK
Sbjct  65   QPTGGKARLTEGSSYRRK  82



>ref|XP_007265907.1| 40S ribosomal protein S27 [Fomitiporia mediterranea MF3/22]
 gb|EJD04306.1| 40S ribosomal protein S27 [Fomitiporia mediterranea MF3/22]
Length=83

 Score =   118 bits (295),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 63/78 (81%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = +3

Query  135  IDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQTVLC  314
            +DLLNP  E EK++HKLKRLVQSPNS+FMDVKC GCF ITTVFSH+QTVV+CG+C TVLC
Sbjct  5    VDLLNPSIESEKRRHKLKRLVQSPNSYFMDVKCPGCFAITTVFSHAQTVVLCGSCGTVLC  64

Query  315  QPTGGRARLTEGCSFRRK  368
            QPTGG+ARLTEG SFRRK
Sbjct  65   QPTGGKARLTEGSSFRRK  82



>ref|XP_007324980.1| hypothetical protein AGABI1DRAFT_32795, partial [Agaricus bisporus 
var. burnettii JB137-S8]
 gb|EKM83446.1| hypothetical protein AGABI1DRAFT_32795, partial [Agaricus bisporus 
var. burnettii JB137-S8]
Length=81

 Score =   117 bits (294),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 62/78 (79%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +3

Query  135  IDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQTVLC  314
            +DLLNP  E EK++HKLKRLVQSPNS+FMDVKC GCF ITTVFSH+QTVVVC  C ++LC
Sbjct  3    VDLLNPSPEYEKRQHKLKRLVQSPNSYFMDVKCPGCFAITTVFSHAQTVVVCAACTSILC  62

Query  315  QPTGGRARLTEGCSFRRK  368
            QPTGG+ARLTEGCSFRRK
Sbjct  63   QPTGGKARLTEGCSFRRK  80



>ref|XP_010892700.1| PREDICTED: 40S ribosomal protein S27 [Esox lucius]
 gb|ACO13689.1| 40S ribosomal protein S27 [Esox lucius]
Length=84

 Score =   118 bits (295),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/82 (74%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +3

Query  123  LPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQ  302
            +P   DLL+P +E EK+ HK KRLVQSPNS+FMDVKC GC+ ITTVFSH+QTVV+C  C 
Sbjct  1    MPLAKDLLHPSSEEEKRSHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVGCS  60

Query  303  TVLCQPTGGRARLTEGCSFRRK  368
            TVLCQPTGG+ARLTEGCSFRRK
Sbjct  61   TVLCQPTGGKARLTEGCSFRRK  82



>gb|KDN53570.1| putative 40S ribosomal protein S27 [Tilletiaria anomala UBC 951]
Length=83

 Score =   117 bits (294),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +3

Query  135  IDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQTVLC  314
            +DLLNP AE + ++HKLKRLVQ+PNSFFMDVKC GCF ITTVFSH+QTVV+CG+C  VL 
Sbjct  5    VDLLNPSAEQQARQHKLKRLVQNPNSFFMDVKCPGCFAITTVFSHAQTVVLCGSCAQVLS  64

Query  315  QPTGGRARLTEGCSFRRK  368
            QPTGG+ARLTEGCSFRRK
Sbjct  65   QPTGGKARLTEGCSFRRK  82



>ref|XP_002293775.1| RS27, ribosomal protein 27 40S small ribosomal subunit [Thalassiosira 
pseudonana CCMP1335]
 gb|EED88784.1| RS27, ribosomal protein 27 40S small ribosomal subunit [Thalassiosira 
pseudonana CCMP1335]
Length=82

 Score =   117 bits (294),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +3

Query  135  IDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQTVLC  314
            +DLL+P AE E + HKLKRLV SPNSFFMD+KC GCF ITTVFSH+QTVV+CG+C  +LC
Sbjct  3    VDLLHPTAEQEARTHKLKRLVASPNSFFMDIKCPGCFQITTVFSHAQTVVLCGSCNVMLC  62

Query  315  QPTGGRARLTEGCSFRRKGD  374
            QPTGGRARLTEGCS+R+K D
Sbjct  63   QPTGGRARLTEGCSYRKKVD  82



>gb|KIM48382.1| hypothetical protein M413DRAFT_230288 [Hebeloma cylindrosporum 
h7]
Length=83

 Score =   117 bits (294),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 63/78 (81%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +3

Query  135  IDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQTVLC  314
            IDLLNP +E E +KHKLKRLVQSPNS+FMDVKC GCF ITTVFSH+QTVVVC +C +VLC
Sbjct  5    IDLLNPSSEAEGRKHKLKRLVQSPNSYFMDVKCSGCFAITTVFSHAQTVVVCPSCTSVLC  64

Query  315  QPTGGRARLTEGCSFRRK  368
            QPTGG+ARLTEG SFRRK
Sbjct  65   QPTGGKARLTEGSSFRRK  82



>emb|CDQ93017.1| unnamed protein product [Oncorhynchus mykiss]
Length=119

 Score =   119 bits (297),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 67/118 (57%), Positives = 83/118 (70%), Gaps = 6/118 (5%)
 Frame = +3

Query  30   LSSPTFNEPILGSLHTAAF*GFR-----SSTFNTMVLPNDIDLLNPPAelekkkhklkRL  194
            +++  F   +LG +H      FR      + +    +P   DLL+P +E EK+ HK KRL
Sbjct  1    MATKHFRPLLLGPVHLLTI-NFRLILLFGNGYKLANMPLAKDLLHPTSEEEKRSHKKKRL  59

Query  195  VQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQTVLCQPTGGRARLTEGCSFRRK  368
            VQSPNS+FMDVKC GC+ ITTVFSH+QTVV+C  C TVLCQPTGG+ARLTEGCSFRRK
Sbjct  60   VQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVGCSTVLCQPTGGKARLTEGCSFRRK  117



>ref|XP_002473543.1| 40S ribosomal protein S27 [Postia placenta Mad-698-R]
 gb|EED81251.1| 40S ribosomal protein S27 [Postia placenta Mad-698-R]
Length=83

 Score =   117 bits (294),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/78 (79%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +3

Query  135  IDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQTVLC  314
            +DLLNP  E EK++HKLKRLVQSPNS+FMDVKC GCF ITTVFSH+QTVV+CG C +VLC
Sbjct  5    VDLLNPSIEAEKRRHKLKRLVQSPNSYFMDVKCPGCFAITTVFSHAQTVVLCGACASVLC  64

Query  315  QPTGGRARLTEGCSFRRK  368
            QPTGGRARLTEG S+RRK
Sbjct  65   QPTGGRARLTEGSSYRRK  82



>gb|ACH71004.1| ribosomal protein S27-2 [Salmo salar]
 gb|ACH71006.1| ribosomal protein S27-2 [Salmo salar]
 gb|ACI66295.1| 40S ribosomal protein S27 [Salmo salar]
 gb|ACO07604.1| 40S ribosomal protein S27 [Oncorhynchus mykiss]
 gb|ACO07613.1| 40S ribosomal protein S27 [Oncorhynchus mykiss]
 gb|ACO08525.1| 40S ribosomal protein S27 [Oncorhynchus mykiss]
 gb|ACO11240.1| 40S ribosomal protein S27 [Caligus rogercresseyi]
 gb|AGH92543.1| ribosomal protein S27 [Salmo salar]
Length=84

 Score =   117 bits (294),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/82 (74%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +3

Query  123  LPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQ  302
            +P   DLL+P +E EK+ HK KRLVQSPNS+FMDVKC GC+ ITTVFSH+QTVV+C  C 
Sbjct  1    MPLAKDLLHPTSEEEKRSHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVGCS  60

Query  303  TVLCQPTGGRARLTEGCSFRRK  368
            TVLCQPTGG+ARLTEGCSFRRK
Sbjct  61   TVLCQPTGGKARLTEGCSFRRK  82



>ref|XP_006959507.1| 40S ribosomal protein S27 [Wallemia sebi CBS 633.66]
 gb|EIM20481.1| 40S ribosomal protein S27 [Wallemia sebi CBS 633.66]
Length=83

 Score =   117 bits (294),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/78 (79%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +3

Query  135  IDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQTVLC  314
            +DLLNP ++ E +KHKLKRLV SPNSFFMDVKC GCF ITTVFSH+QTVV+CG+C TVL 
Sbjct  5    VDLLNPSSQTEVQKHKLKRLVPSPNSFFMDVKCPGCFAITTVFSHAQTVVLCGSCSTVLS  64

Query  315  QPTGGRARLTEGCSFRRK  368
            QPTGG+ARLTEGCSFRRK
Sbjct  65   QPTGGKARLTEGCSFRRK  82



>ref|XP_006629108.1| PREDICTED: 40S ribosomal protein S27-like [Lepisosteus oculatus]
Length=160

 Score =   120 bits (300),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/90 (69%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = +3

Query  99   SSTFNTMVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQT  278
            +++F   + P   DLL+P  E EK++HK KRLVQSPNS+FMDVKC GC+ ITTVFSH+QT
Sbjct  69   ATSFVNFIAPLAKDLLHPSLEEEKRQHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQT  128

Query  279  VVVCGNCQTVLCQPTGGRARLTEGCSFRRK  368
            VV+C  C TVLCQPTGG+ARLTEGCSFRRK
Sbjct  129  VVLCVGCSTVLCQPTGGKARLTEGCSFRRK  158



>gb|KDR84803.1| hypothetical protein GALMADRAFT_290729 [Galerina marginata CBS 
339.88]
Length=83

 Score =   117 bits (293),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = +3

Query  135  IDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQTVLC  314
            +DLL+P AE E ++HKLKRLVQSPNS+FMDVKC GCF ITTVFSH+QTVVVC +C +VLC
Sbjct  5    VDLLHPTAEYEARQHKLKRLVQSPNSYFMDVKCPGCFAITTVFSHAQTVVVCPSCTSVLC  64

Query  315  QPTGGRARLTEGCSFRRK  368
            QPTGG+ARLTEGCSFR+K
Sbjct  65   QPTGGKARLTEGCSFRKK  82



>ref|XP_004334523.1| ribosomal protein s27, putative [Acanthamoeba castellanii str. 
Neff]
 gb|ELR12510.1| ribosomal protein s27, putative [Acanthamoeba castellanii str. 
Neff]
Length=94

 Score =   117 bits (294),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 63/79 (80%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +3

Query  138  DLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQTVLCQ  317
            DLL+P  + E +KHKLKRLVQSPNS+FMDVKC GCFNITTVFSH+QTVV+C  C TVLCQ
Sbjct  16   DLLHPNPKAEARKHKLKRLVQSPNSYFMDVKCPGCFNITTVFSHAQTVVLCSGCSTVLCQ  75

Query  318  PTGGRARLTEGCSFRRKGD  374
            PTGGR RLTEGCSFRRK D
Sbjct  76   PTGGRCRLTEGCSFRRKVD  94



>ref|XP_784036.1| PREDICTED: 40S ribosomal protein S27-like isoform 3 [Strongylocentrotus 
purpuratus]
 ref|XP_003728181.1| PREDICTED: 40S ribosomal protein S27-like isoform 1 [Strongylocentrotus 
purpuratus]
 ref|XP_003728182.1| PREDICTED: 40S ribosomal protein S27-like isoform 2 [Strongylocentrotus 
purpuratus]
Length=84

 Score =   117 bits (293),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/84 (73%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = +3

Query  123  LPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQ  302
            +P   DLLNP  E E+++HK KRLVQSPNS+FMDVKC GC+ ITTVFSH+QTVV+C  C 
Sbjct  1    MPLAQDLLNPTLESERRRHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVGCS  60

Query  303  TVLCQPTGGRARLTEGCSFRRKGD  374
            TVLCQPTGG+ARLTEGCSFRRK  
Sbjct  61   TVLCQPTGGKARLTEGCSFRRKAH  84



>emb|CCM01651.1| predicted protein [Fibroporia radiculosa]
Length=144

 Score =   119 bits (297),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 63/78 (81%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = +3

Query  135  IDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQTVLC  314
            IDLLNP AE EK++HKLKRLVQSPNS+FMDVKC GCF ITTVFSH+QTVV+CG C +VLC
Sbjct  66   IDLLNPSAEAEKRRHKLKRLVQSPNSYFMDVKCPGCFAITTVFSHAQTVVLCGACASVLC  125

Query  315  QPTGGRARLTEGCSFRRK  368
            QPTGG+ARLTEG S+RRK
Sbjct  126  QPTGGKARLTEGSSYRRK  143



>ref|NP_001129418.1| ribosomal protein S27-1 [Acyrthosiphon pisum]
 ref|XP_008180321.1| PREDICTED: ribosomal protein S27-1 isoform X1 [Acyrthosiphon 
pisum]
Length=84

 Score =   117 bits (293),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = +3

Query  123  LPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQ  302
            +P   DLL+P A  E++KHKLKRLVQ PNSFFMDVKC GC+ ITTVFSH+Q+VV+C  C 
Sbjct  1    MPLAKDLLHPTAIEERRKHKLKRLVQHPNSFFMDVKCPGCYKITTVFSHAQSVVICTGCS  60

Query  303  TVLCQPTGGRARLTEGCSFRRKG  371
            T+LCQPTGGRARLTEGCSFR+K 
Sbjct  61   TILCQPTGGRARLTEGCSFRKKA  83



>ref|XP_005627537.1| PREDICTED: 40S ribosomal protein S27-like [Canis lupus familiaris]
Length=84

 Score =   117 bits (293),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 61/82 (74%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = +3

Query  123  LPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQ  302
            +P   DLL+P AE EK+KHK +RLVQSPNS+FMDVKC GC+ ITTVFSH+QTVV+C  C 
Sbjct  1    MPLAKDLLHPSAEEEKRKHKKQRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVGCS  60

Query  303  TVLCQPTGGRARLTEGCSFRRK  368
            TVLCQPTGG+ARLTEGCSFR+K
Sbjct  61   TVLCQPTGGKARLTEGCSFRQK  82



>emb|CCF53551.1| probable 40S ribosomal protein S27 [Ustilago hordei]
Length=83

 Score =   117 bits (292),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +3

Query  132  DIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQTVL  311
             +DLLNP AE + + HKLKRLVQ+PNSFFMDVKC GCF ITTVFSH+QTVVVCG+C  VL
Sbjct  4    SVDLLNPSAEQQARCHKLKRLVQNPNSFFMDVKCPGCFAITTVFSHAQTVVVCGSCAQVL  63

Query  312  CQPTGGRARLTEGCSFRRKG  371
             QPTGG+ARLTEGCSFR+K 
Sbjct  64   SQPTGGKARLTEGCSFRKKA  83



>gb|KDR18843.1| 40S ribosomal protein S27 [Zootermopsis nevadensis]
Length=84

 Score =   117 bits (292),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 61/82 (74%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = +3

Query  123  LPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQ  302
            +P   DLL+P    EK+KHKLKRLVQ PNS+FMDVKC GC+ ITTVFSH+Q+VVVC  C 
Sbjct  1    MPLAKDLLHPSPAEEKRKHKLKRLVQHPNSYFMDVKCPGCYKITTVFSHAQSVVVCAGCS  60

Query  303  TVLCQPTGGRARLTEGCSFRRK  368
            T+LCQPTGGRARLTEGCSFRRK
Sbjct  61   TILCQPTGGRARLTEGCSFRRK  82



>gb|ABM55459.1| ribosomal protein S27 [Xenopsylla cheopis]
Length=84

 Score =   117 bits (292),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 60/82 (73%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = +3

Query  123  LPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQ  302
            +P   DLL+P    EK++HKLKRLVQ PNS+FMDVKC GC+ ITTVFSH+Q+VVVC  C 
Sbjct  1    MPLAKDLLHPTIAEEKRRHKLKRLVQHPNSYFMDVKCPGCYKITTVFSHAQSVVVCAGCS  60

Query  303  TVLCQPTGGRARLTEGCSFRRK  368
            T+LCQPTGGRARLTEGCSFRRK
Sbjct  61   TILCQPTGGRARLTEGCSFRRK  82



>ref|XP_004541310.1| PREDICTED: 40S ribosomal protein S27-like isoform X1 [Maylandia 
zebra]
 ref|XP_004541311.1| PREDICTED: 40S ribosomal protein S27-like isoform X2 [Maylandia 
zebra]
Length=88

 Score =   117 bits (292),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 62/82 (76%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +3

Query  123  LPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQ  302
            LP   DLL+P  E EK++HK KRLVQSPNS+FMDVKC GC+ ITTVFSH+QTVV+C  C 
Sbjct  5    LPLAKDLLHPTPEQEKRRHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVGCS  64

Query  303  TVLCQPTGGRARLTEGCSFRRK  368
            TVLCQPTGG+ARLTEGCSFRRK
Sbjct  65   TVLCQPTGGKARLTEGCSFRRK  86



>ref|XP_007526209.1| PREDICTED: 40S ribosomal protein S27-like [Erinaceus europaeus]
Length=84

 Score =   117 bits (292),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 63/82 (77%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = +3

Query  123  LPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQ  302
            +P   DLL+P  E EK+KHK KRLVQSPNS+FMDVKCQGC+ ITTVFSH+QTVV+C  C 
Sbjct  1    MPLAKDLLHPSPEEEKQKHKKKRLVQSPNSYFMDVKCQGCYKITTVFSHAQTVVLCVGCS  60

Query  303  TVLCQPTGGRARLTEGCSFRRK  368
            TVLCQPTGG+ARLTEGCSFRRK
Sbjct  61   TVLCQPTGGKARLTEGCSFRRK  82



>emb|CCX29534.1| Similar to 40S ribosomal protein S27; acc. no. Q7RVN2 [Pyronema 
omphalodes CBS 100304]
Length=82

 Score =   116 bits (291),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 70/84 (83%), Gaps = 2/84 (2%)
 Frame = +3

Query  117  MVLPNDIDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN  296
            MVL  D  LLNP    E +KHKLK LV +P SFFMDVKC GCFNITTVFSH+QTVV+CG+
Sbjct  1    MVLAED--LLNPAPAAEARKHKLKTLVPAPRSFFMDVKCPGCFNITTVFSHAQTVVICGS  58

Query  297  CQTVLCQPTGGRARLTEGCSFRRK  368
            C TVLCQPTGG+ARLTEGCSFRRK
Sbjct  59   CATVLCQPTGGKARLTEGCSFRRK  82



>ref|XP_007861244.1| 40S ribosomal protein S27 [Gloeophyllum trabeum ATCC 11539]
 gb|EPQ60960.1| 40S ribosomal protein S27 [Gloeophyllum trabeum ATCC 11539]
Length=83

 Score =   116 bits (291),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 62/78 (79%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = +3

Query  135  IDLLNPPAelekkkhklkRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQTVLC  314
            +DLLNP  E EK++HKLKRLVQSPNS+FMDVKC GCF ITTVFSH+QTVV+CG+C +VLC
Sbjct  5    VDLLNPLPETEKRRHKLKRLVQSPNSYFMDVKCPGCFAITTVFSHAQTVVLCGSCSSVLC  64

Query  315  QPTGGRARLTEGCSFRRK  368
            QPTGG+ARLTEG SFRRK
Sbjct  65   QPTGGKARLTEGSSFRRK  82



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 592801777335