BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002B15

Length=543
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006354941.1|  PREDICTED: B3 domain-containing protein Os01...    137   8e-38   
ref|XP_009781397.1|  PREDICTED: B3 domain-containing protein Os01...    137   2e-34   Nicotiana sylvestris
ref|XP_009781396.1|  PREDICTED: B3 domain-containing protein Os01...    137   2e-34   Nicotiana sylvestris
ref|XP_009781392.1|  PREDICTED: B3 domain-containing protein Os01...    137   2e-34   Nicotiana sylvestris
ref|XP_009588428.1|  PREDICTED: B3 domain-containing protein Os01...    135   4e-34   Nicotiana tomentosiformis
ref|XP_009588431.1|  PREDICTED: B3 domain-containing protein Os01...    135   5e-34   
ref|XP_009588432.1|  PREDICTED: B3 domain-containing protein Os01...    135   5e-34   
ref|XP_004238198.1|  PREDICTED: B3 domain-containing protein Os01...    134   2e-33   
emb|CDP07598.1|  unnamed protein product                                132   8e-33   Coffea canephora [robusta coffee]
ref|XP_010664619.1|  PREDICTED: B3 domain-containing protein Os01...    130   4e-32   
ref|XP_010683984.1|  PREDICTED: B3 domain-containing protein Os01...    130   7e-32   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002282159.3|  PREDICTED: B3 domain-containing protein Os01...    130   9e-32   Vitis vinifera
ref|XP_010683976.1|  PREDICTED: B3 domain-containing protein Os01...    130   9e-32   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011083781.1|  PREDICTED: B3 domain-containing protein Os01...    124   5e-30   Sesamum indicum [beniseed]
gb|EYU45075.1|  hypothetical protein MIMGU_mgv1a004183mg                118   9e-28   Erythranthe guttata [common monkey flower]
ref|XP_010089923.1|  B3 domain-containing protein                       118   1e-27   Morus notabilis
ref|XP_007221817.1|  hypothetical protein PRUPE_ppa003541mg             116   6e-27   Prunus persica
ref|XP_008220724.1|  PREDICTED: B3 domain-containing protein Os01...    116   6e-27   Prunus mume [ume]
ref|XP_008378454.1|  PREDICTED: B3 domain-containing protein Os01...    114   3e-26   
ref|XP_003589266.1|  B3 domain-containing protein                       113   1e-25   Medicago truncatula
ref|XP_004291931.1|  PREDICTED: B3 domain-containing protein Os11...    112   1e-25   Fragaria vesca subsp. vesca
ref|XP_009364120.1|  PREDICTED: B3 domain-containing protein Os01...    111   3e-25   Pyrus x bretschneideri [bai li]
ref|XP_008357222.1|  PREDICTED: uncharacterized protein LOC103420963    109   3e-24   
ref|XP_009365640.1|  PREDICTED: B3 domain-containing protein Os01...    107   1e-23   Pyrus x bretschneideri [bai li]
gb|KCW68795.1|  hypothetical protein EUGRSUZ_F02399                     106   2e-23   Eucalyptus grandis [rose gum]
gb|KCW68798.1|  hypothetical protein EUGRSUZ_F02399                     105   2e-23   Eucalyptus grandis [rose gum]
ref|XP_002510291.1|  conserved hypothetical protein                     106   3e-23   
ref|XP_010061800.1|  PREDICTED: B3 domain-containing protein Os11...    105   5e-23   
ref|XP_006473396.1|  PREDICTED: B3 domain-containing protein LOC_...    101   1e-21   Citrus sinensis [apfelsine]
gb|KGN59902.1|  hypothetical protein Csa_3G852510                       100   3e-21   Cucumis sativus [cucumbers]
ref|XP_006434877.1|  hypothetical protein CICLE_v10000881mg           99.0    3e-21   
ref|XP_004147830.1|  PREDICTED: B3 domain-containing protein Os01...    100   3e-21   
ref|XP_004499102.1|  PREDICTED: B3 domain-containing protein Os01...    100   3e-21   Cicer arietinum [garbanzo]
ref|XP_007160809.1|  hypothetical protein PHAVU_001G018500g           99.8    6e-21   Phaseolus vulgaris [French bean]
ref|XP_007160811.1|  hypothetical protein PHAVU_001G018500g           99.8    8e-21   Phaseolus vulgaris [French bean]
ref|XP_006375016.1|  hypothetical protein POPTR_0014s03610g           99.8    9e-21   
ref|XP_006434882.1|  hypothetical protein CICLE_v10000881mg           99.0    1e-20   Citrus clementina [clementine]
ref|XP_011030811.1|  PREDICTED: B3 domain-containing protein Os01...  98.6    2e-20   Populus euphratica
ref|XP_011030803.1|  PREDICTED: B3 domain-containing protein Os01...  98.6    2e-20   Populus euphratica
ref|XP_011030796.1|  PREDICTED: B3 domain-containing protein Os01...  98.6    2e-20   Populus euphratica
ref|XP_011030771.1|  PREDICTED: B3 domain-containing protein Os01...  98.6    2e-20   Populus euphratica
ref|XP_008454672.1|  PREDICTED: B3 domain-containing protein Os01...  97.4    4e-20   
ref|XP_010263794.1|  PREDICTED: B3 domain-containing protein Os11...  94.7    3e-19   Nelumbo nucifera [Indian lotus]
ref|XP_010263793.1|  PREDICTED: B3 domain-containing protein Os11...  94.4    3e-19   
ref|XP_010263792.1|  PREDICTED: B3 domain-containing protein Os11...  94.4    4e-19   Nelumbo nucifera [Indian lotus]
ref|XP_003549416.2|  PREDICTED: B3 domain-containing protein Os01...  94.4    5e-19   Glycine max [soybeans]
gb|KHN12748.1|  B3 domain-containing protein                          94.4    5e-19   Glycine soja [wild soybean]
ref|XP_006595949.1|  PREDICTED: B3 domain-containing protein Os01...  94.0    8e-19   Glycine max [soybeans]
ref|XP_007017394.1|  AP2/B3-like transcriptional factor family pr...  93.6    8e-19   Theobroma cacao [chocolate]
gb|KHN21020.1|  B3 domain-containing protein                          92.4    2e-18   Glycine soja [wild soybean]
gb|KJB29522.1|  hypothetical protein B456_005G105400                  91.7    3e-18   Gossypium raimondii
gb|KJB29524.1|  hypothetical protein B456_005G105400                  91.7    3e-18   Gossypium raimondii
gb|KJB29523.1|  hypothetical protein B456_005G105400                  91.7    4e-18   Gossypium raimondii
ref|XP_010255057.1|  PREDICTED: B3 domain-containing protein At1g...  88.2    5e-18   Nelumbo nucifera [Indian lotus]
gb|KHG05520.1|  hypothetical protein F383_30454                       91.3    6e-18   Gossypium arboreum [tree cotton]
ref|XP_010255056.1|  PREDICTED: putative B3 domain-containing pro...  88.2    1e-17   Nelumbo nucifera [Indian lotus]
ref|XP_010255065.1|  PREDICTED: B3 domain-containing protein Os01...  87.8    8e-17   Nelumbo nucifera [Indian lotus]
ref|XP_010924500.1|  PREDICTED: B3 domain-containing protein Os11...  85.1    1e-16   
ref|XP_010924491.1|  PREDICTED: B3 domain-containing protein Os11...  85.1    1e-16   
ref|XP_010924483.1|  PREDICTED: B3 domain-containing protein Os11...  85.1    2e-16   Elaeis guineensis
ref|XP_008787670.1|  PREDICTED: B3 domain-containing protein Os11...  84.3    4e-16   
ref|XP_010924476.1|  PREDICTED: B3 domain-containing protein Os11...  84.7    4e-16   Elaeis guineensis
ref|XP_010924451.1|  PREDICTED: B3 domain-containing protein Os11...  85.1    4e-16   Elaeis guineensis
ref|XP_010924459.1|  PREDICTED: B3 domain-containing protein Os11...  85.1    5e-16   Elaeis guineensis
ref|XP_010924468.1|  PREDICTED: B3 domain-containing protein Os11...  85.1    5e-16   Elaeis guineensis
ref|XP_010924436.1|  PREDICTED: B3 domain-containing protein Os11...  85.1    5e-16   Elaeis guineensis
ref|XP_010924443.1|  PREDICTED: B3 domain-containing protein Os11...  85.1    5e-16   Elaeis guineensis
ref|XP_008787669.1|  PREDICTED: B3 domain-containing protein Os11...  84.3    8e-16   Phoenix dactylifera
ref|XP_008787668.1|  PREDICTED: B3 domain-containing protein Os11...  84.3    9e-16   Phoenix dactylifera
ref|XP_008787667.1|  PREDICTED: B3 domain-containing protein Os11...  84.3    9e-16   Phoenix dactylifera
ref|XP_006375017.1|  hypothetical protein POPTR_0014s03610g           84.7    1e-15   
ref|XP_010255069.1|  PREDICTED: putative B3 domain-containing pro...  83.2    2e-15   Nelumbo nucifera [Indian lotus]
ref|XP_010255068.1|  PREDICTED: putative B3 domain-containing pro...  83.2    2e-15   Nelumbo nucifera [Indian lotus]
ref|XP_010255066.1|  PREDICTED: putative B3 domain-containing pro...  83.2    3e-15   Nelumbo nucifera [Indian lotus]
ref|XP_009389534.1|  PREDICTED: B3 domain-containing protein Os11...  82.0    5e-15   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMT26018.1|  B3 domain-containing protein                          81.3    1e-14   
ref|XP_004978926.1|  PREDICTED: B3 domain-containing protein Os11...  80.5    2e-14   Setaria italica
ref|XP_008226602.1|  PREDICTED: putative B3 domain-containing pro...  77.4    6e-14   Prunus mume [ume]
ref|XP_008226600.1|  PREDICTED: B3 domain-containing protein Os01...  75.9    2e-13   Prunus mume [ume]
ref|XP_006839026.1|  hypothetical protein AMTR_s00002p00272200        77.8    2e-13   Amborella trichopoda
ref|XP_007212879.1|  hypothetical protein PRUPE_ppa021660mg           73.6    4e-13   
ref|XP_006840809.1|  hypothetical protein AMTR_s00214p00019140        74.3    4e-13   
ref|XP_010255054.1|  PREDICTED: B3 domain-containing protein Os03...  74.3    4e-13   Nelumbo nucifera [Indian lotus]
ref|XP_008226826.1|  PREDICTED: putative B3 domain-containing pro...  74.7    5e-13   Prunus mume [ume]
dbj|BAJ97129.1|  predicted protein                                    77.0    5e-13   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDP12499.1|  unnamed protein product                              75.1    7e-13   Coffea canephora [robusta coffee]
ref|XP_009365669.1|  PREDICTED: B3 domain-containing protein REM5...  73.9    8e-13   
ref|XP_007214340.1|  hypothetical protein PRUPE_ppb025337mg           72.8    9e-13   
ref|XP_010255053.1|  PREDICTED: putative B3 domain-containing pro...  74.3    9e-13   Nelumbo nucifera [Indian lotus]
ref|XP_010237857.1|  PREDICTED: B3 domain-containing protein Os11...  75.5    2e-12   Brachypodium distachyon [annual false brome]
ref|XP_003576206.1|  PREDICTED: B3 domain-containing protein Os11...  75.5    2e-12   Brachypodium distachyon [annual false brome]
ref|XP_010026398.1|  PREDICTED: putative B3 domain-containing pro...  71.6    2e-12   Eucalyptus grandis [rose gum]
ref|XP_007017395.1|  AP2/B3-like transcriptional factor family pr...  74.7    2e-12   
ref|XP_009769341.1|  PREDICTED: B3 domain-containing protein REM2...  73.6    2e-12   Nicotiana sylvestris
ref|XP_004288671.1|  PREDICTED: putative B3 domain-containing pro...  73.2    2e-12   Fragaria vesca subsp. vesca
ref|XP_011017257.1|  PREDICTED: B3 domain-containing protein REM1...  74.3    2e-12   Populus euphratica
ref|XP_002301205.2|  transcriptional factor B3 family protein         74.3    3e-12   Populus trichocarpa [western balsam poplar]
dbj|BAK04345.1|  predicted protein                                    75.1    3e-12   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004305410.1|  PREDICTED: B3 domain-containing protein REM5...  72.0    3e-12   Fragaria vesca subsp. vesca
gb|EMT26093.1|  B3 domain-containing protein                          75.1    3e-12   
ref|XP_009769340.1|  PREDICTED: B3 domain-containing protein At4g...  73.2    4e-12   Nicotiana sylvestris
ref|XP_007224954.1|  hypothetical protein PRUPE_ppa021314mg           71.6    4e-12   
ref|XP_006434875.1|  hypothetical protein CICLE_v10000881mg           73.2    4e-12   
ref|XP_002450488.1|  hypothetical protein SORBIDRAFT_05g006090        73.6    4e-12   
ref|XP_007214527.1|  hypothetical protein PRUPE_ppa015343mg           70.9    4e-12   
ref|XP_010525640.1|  PREDICTED: B3 domain-containing protein Os11...  73.6    5e-12   Tarenaya hassleriana [spider flower]
ref|XP_007214051.1|  hypothetical protein PRUPE_ppa017456mg           70.9    5e-12   
gb|EMT00295.1|  B3 domain-containing protein                          73.9    6e-12   
ref|XP_009389369.1|  PREDICTED: B3 domain-containing protein Os01...  72.4    6e-12   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006473400.1|  PREDICTED: B3 domain-containing protein LOC_...  73.2    7e-12   Citrus sinensis [apfelsine]
ref|XP_006840490.1|  hypothetical protein AMTR_s00045p00193040        73.2    7e-12   
ref|XP_006434878.1|  hypothetical protein CICLE_v10000881mg           73.2    8e-12   
ref|XP_008220725.1|  PREDICTED: B3 domain-containing protein REM5...  70.9    8e-12   
ref|XP_006833221.1|  hypothetical protein AMTR_s00072p00182810        72.8    9e-12   Amborella trichopoda
ref|XP_010229963.1|  PREDICTED: uncharacterized protein LOC104582255  73.6    9e-12   
gb|KDP38416.1|  hypothetical protein JCGZ_04341                       72.8    1e-11   Jatropha curcas
ref|XP_011030819.1|  PREDICTED: B3 domain-containing protein Os01...  72.8    1e-11   Populus euphratica
ref|XP_010924666.1|  PREDICTED: B3 domain-containing protein Os01...  71.2    2e-11   Elaeis guineensis
emb|CAN82365.1|  hypothetical protein VITISV_027616                   72.8    2e-11   Vitis vinifera
ref|XP_009613232.1|  PREDICTED: B3 domain-containing protein At5g...  70.9    2e-11   Nicotiana tomentosiformis
ref|XP_008440210.1|  PREDICTED: uncharacterized protein LOC103484...  72.4    2e-11   
ref|XP_008440215.1|  PREDICTED: uncharacterized protein LOC103484...  72.4    2e-11   
ref|XP_007202358.1|  hypothetical protein PRUPE_ppa009186mg           70.5    2e-11   Prunus persica
ref|XP_008440214.1|  PREDICTED: uncharacterized protein LOC103484...  72.4    2e-11   Cucumis melo [Oriental melon]
ref|XP_008440211.1|  PREDICTED: uncharacterized protein LOC103484...  72.4    2e-11   
ref|XP_008440209.1|  PREDICTED: uncharacterized protein LOC103484...  72.4    2e-11   Cucumis melo [Oriental melon]
ref|XP_008440208.1|  PREDICTED: uncharacterized protein LOC103484...  72.4    2e-11   Cucumis melo [Oriental melon]
ref|XP_008440207.1|  PREDICTED: uncharacterized protein LOC103484...  72.4    2e-11   Cucumis melo [Oriental melon]
ref|XP_008440213.1|  PREDICTED: uncharacterized protein LOC103484...  72.4    2e-11   Cucumis melo [Oriental melon]
ref|XP_009769346.1|  PREDICTED: B3 domain-containing protein Os11...  70.5    2e-11   Nicotiana sylvestris
ref|XP_002284808.2|  PREDICTED: putative B3 domain-containing pro...  71.2    2e-11   Vitis vinifera
ref|XP_010647775.1|  PREDICTED: B3 domain-containing protein REM2...  68.6    3e-11   Vitis vinifera
ref|XP_009613231.1|  PREDICTED: B3 domain-containing protein At5g...  70.9    3e-11   Nicotiana tomentosiformis
ref|XP_009341395.1|  PREDICTED: putative B3 domain-containing pro...  70.1    3e-11   
ref|XP_010315502.1|  PREDICTED: putative B3 domain-containing pro...  71.6    3e-11   
gb|KCW66218.1|  hypothetical protein EUGRSUZ_F00044                   70.5    3e-11   Eucalyptus grandis [rose gum]
ref|XP_010059786.1|  PREDICTED: B3 domain-containing protein REM1...  70.5    3e-11   Eucalyptus grandis [rose gum]
ref|XP_002510293.1|  DNA binding protein, putative                    70.1    3e-11   
ref|XP_008810645.1|  PREDICTED: B3 domain-containing protein Os01...  70.1    4e-11   
ref|XP_006840489.1|  hypothetical protein AMTR_s00045p00192570        70.1    4e-11   
ref|XP_007224197.1|  hypothetical protein PRUPE_ppa017317mg           66.2    4e-11   
emb|CDP08404.1|  unnamed protein product                              68.9    5e-11   Coffea canephora [robusta coffee]
ref|XP_010064142.1|  PREDICTED: B3 domain-containing protein REM2...  67.8    6e-11   
ref|XP_004145348.1|  PREDICTED: B3 domain-containing transcriptio...  70.1    6e-11   Cucumis sativus [cucumbers]
ref|XP_010647802.1|  PREDICTED: B3 domain-containing protein Os01...  67.8    6e-11   Vitis vinifera
ref|XP_006423126.1|  hypothetical protein CICLE_v10028843mg           69.3    6e-11   Citrus clementina [clementine]
ref|XP_004292711.1|  PREDICTED: B3 domain-containing protein REM5...  68.2    7e-11   Fragaria vesca subsp. vesca
ref|XP_004308266.1|  PREDICTED: putative B3 domain-containing pro...  67.8    8e-11   Fragaria vesca subsp. vesca
ref|XP_010064141.1|  PREDICTED: B3 domain-containing protein Os03...  68.2    9e-11   
ref|XP_010277224.1|  PREDICTED: B3 domain-containing protein LOC_...  69.3    9e-11   
ref|XP_004152721.1|  PREDICTED: B3 domain-containing protein REM1...  69.3    9e-11   Cucumis sativus [cucumbers]
emb|CBI32504.3|  unnamed protein product                              70.5    1e-10   Vitis vinifera
ref|XP_011030831.1|  PREDICTED: B3 domain-containing protein REM1...  68.9    1e-10   Populus euphratica
ref|XP_004160048.1|  PREDICTED: B3 domain-containing protein Os12...  69.3    1e-10   
ref|XP_009341402.1|  PREDICTED: putative B3 domain-containing pro...  68.2    1e-10   Pyrus x bretschneideri [bai li]
ref|XP_009769345.1|  PREDICTED: B3 domain-containing protein Os01...  65.5    1e-10   Nicotiana sylvestris
ref|XP_006375018.1|  transcriptional factor B3 family protein         68.2    1e-10   
ref|XP_010263799.1|  PREDICTED: B3 domain-containing transcriptio...  68.6    1e-10   Nelumbo nucifera [Indian lotus]
ref|XP_010263798.1|  PREDICTED: B3 domain-containing transcriptio...  68.6    2e-10   Nelumbo nucifera [Indian lotus]
gb|KGN48479.1|  hypothetical protein Csa_6G489950                     69.7    2e-10   Cucumis sativus [cucumbers]
ref|XP_008380674.1|  PREDICTED: B3 domain-containing protein Os12...  67.4    2e-10   Malus domestica [apple tree]
ref|XP_009341411.1|  PREDICTED: uncharacterized protein LOC103933435  68.6    2e-10   
ref|XP_009340826.1|  PREDICTED: B3 domain-containing protein At4g...  67.0    2e-10   
ref|XP_009613235.1|  PREDICTED: B3 domain-containing protein Os01...  65.1    2e-10   Nicotiana tomentosiformis
ref|XP_008386193.1|  PREDICTED: putative B3 domain-containing pro...  67.4    2e-10   
ref|XP_008459236.1|  PREDICTED: B3 domain-containing transcriptio...  68.2    2e-10   Cucumis melo [Oriental melon]
ref|XP_008444660.1|  PREDICTED: B3 domain-containing protein REM1...  68.2    2e-10   Cucumis melo [Oriental melon]
ref|XP_010059785.1|  PREDICTED: B3 domain-containing protein REM1...  68.2    2e-10   Eucalyptus grandis [rose gum]
ref|XP_010059782.1|  PREDICTED: B3 domain-containing protein REM1...  68.2    2e-10   Eucalyptus grandis [rose gum]
ref|XP_004145349.1|  PREDICTED: B3 domain-containing transcriptio...  68.2    3e-10   
ref|XP_010059783.1|  PREDICTED: B3 domain-containing protein REM1...  68.2    3e-10   Eucalyptus grandis [rose gum]
gb|KJB48489.1|  hypothetical protein B456_008G071300                  68.9    3e-10   Gossypium raimondii
ref|XP_011461326.1|  PREDICTED: putative B3 domain-containing pro...  67.0    3e-10   Fragaria vesca subsp. vesca
gb|EMT01422.1|  B3 domain-containing protein                          68.9    3e-10   
ref|XP_010266788.1|  PREDICTED: B3 domain-containing protein Os01...  65.9    3e-10   Nelumbo nucifera [Indian lotus]
ref|XP_010266787.1|  PREDICTED: B3 domain-containing protein Os01...  65.9    3e-10   Nelumbo nucifera [Indian lotus]
ref|XP_004230835.1|  PREDICTED: B3 domain-containing protein Os11...  66.6    4e-10   
ref|XP_010315280.1|  PREDICTED: B3 domain-containing protein Os11...  66.6    4e-10   
gb|KJB48488.1|  hypothetical protein B456_008G071300                  68.6    4e-10   Gossypium raimondii
ref|NP_001144632.1|  uncharacterized protein LOC100277651             67.8    4e-10   
gb|KDO52155.1|  hypothetical protein CISIN_1g020807mg                 67.0    4e-10   Citrus sinensis [apfelsine]
ref|XP_010039406.1|  PREDICTED: B3 domain-containing protein At3g...  65.5    4e-10   Eucalyptus grandis [rose gum]
ref|XP_008440206.1|  PREDICTED: putative B3 domain-containing pro...  65.5    4e-10   Cucumis melo [Oriental melon]
ref|XP_006361103.1|  PREDICTED: putative B3 domain-containing pro...  65.9    4e-10   Solanum tuberosum [potatoes]
ref|XP_010647820.1|  PREDICTED: B3 domain-containing protein REM2...  67.0    4e-10   
ref|XP_008786201.1|  PREDICTED: putative B3 domain-containing pro...  67.8    5e-10   Phoenix dactylifera
ref|XP_009613237.1|  PREDICTED: B3 domain-containing protein Os11...  65.9    6e-10   Nicotiana tomentosiformis
ref|XP_010266786.1|  PREDICTED: putative B3 domain-containing pro...  65.9    6e-10   Nelumbo nucifera [Indian lotus]
ref|XP_010263796.1|  PREDICTED: B3 domain-containing protein REM1...  67.0    6e-10   Nelumbo nucifera [Indian lotus]
gb|KDP38417.1|  hypothetical protein JCGZ_04342                       66.6    6e-10   Jatropha curcas
ref|XP_004969798.1|  PREDICTED: B3 domain-containing protein Os01...  67.0    7e-10   Setaria italica
ref|XP_004153259.1|  PREDICTED: B3 domain-containing transcriptio...  67.0    7e-10   
ref|XP_010070479.1|  PREDICTED: putative B3 domain-containing pro...  66.2    7e-10   Eucalyptus grandis [rose gum]
ref|XP_008440203.1|  PREDICTED: putative B3 domain-containing pro...  65.9    7e-10   Cucumis melo [Oriental melon]
emb|CDY40646.1|  BnaA03g53170D                                        64.7    8e-10   Brassica napus [oilseed rape]
ref|XP_010266779.1|  PREDICTED: B3 domain-containing protein Os01...  65.5    9e-10   
ref|XP_004233644.1|  PREDICTED: B3 domain-containing protein REM1...  66.2    9e-10   Solanum lycopersicum
ref|XP_004231373.1|  PREDICTED: B3 domain-containing protein At5g...  65.9    9e-10   Solanum lycopersicum
gb|ABF70122.1|  transcriptional factor B3 family protein / AT hoo...  65.9    9e-10   Musa balbisiana [starchy banana]
dbj|BAK05045.1|  predicted protein                                    66.2    1e-09   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007017397.1|  AP2/B3-like transcriptional factor family pr...  66.2    1e-09   
ref|XP_008386195.1|  PREDICTED: B3 domain-containing protein REM1...  65.5    1e-09   
ref|XP_007017396.1|  AP2/B3-like transcriptional factor family pr...  66.2    1e-09   
gb|EMT25326.1|  B3 domain-containing protein                          65.1    1e-09   
dbj|BAK07954.1|  predicted protein                                    66.6    1e-09   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010245897.1|  PREDICTED: putative B3 domain-containing pro...  65.5    1e-09   Nelumbo nucifera [Indian lotus]
ref|XP_003567062.1|  PREDICTED: B3 domain-containing protein Os01...  65.9    2e-09   
emb|CAN82372.1|  hypothetical protein VITISV_027623                   66.2    2e-09   Vitis vinifera
ref|XP_006842132.1|  hypothetical protein AMTR_s00078p00115450        65.9    2e-09   Amborella trichopoda
gb|KJB58376.1|  hypothetical protein B456_009G207400                  63.9    2e-09   Gossypium raimondii
gb|AFW60660.1|  hypothetical protein ZEAMMB73_443682                  65.9    2e-09   
ref|XP_004167398.1|  PREDICTED: putative B3 domain-containing pro...  65.1    2e-09   
gb|KJB17862.1|  hypothetical protein B456_003G020000                  66.2    2e-09   Gossypium raimondii
gb|KDP38418.1|  hypothetical protein JCGZ_04343                       65.5    2e-09   Jatropha curcas
ref|NP_001130957.1|  hypothetical protein                             65.9    2e-09   Zea mays [maize]
ref|XP_006851101.1|  hypothetical protein AMTR_s00025p00247140        63.5    2e-09   
ref|XP_008240883.1|  PREDICTED: putative B3 domain-containing pro...  64.7    2e-09   Prunus mume [ume]
ref|XP_003589270.1|  B3 domain-containing protein                     66.2    2e-09   
ref|XP_010255064.1|  PREDICTED: B3 domain-containing protein REM1...  65.5    2e-09   
ref|XP_008226603.1|  PREDICTED: B3 domain-containing protein Os01...  64.3    2e-09   
ref|XP_006338757.1|  PREDICTED: B3 domain-containing protein REM1...  65.1    2e-09   Solanum tuberosum [potatoes]
ref|NP_001172546.1|  Os01g0723500                                     65.5    2e-09   
ref|XP_008459235.1|  PREDICTED: B3 domain-containing transcriptio...  65.5    2e-09   Cucumis melo [Oriental melon]
ref|XP_010255062.1|  PREDICTED: B3 domain-containing protein REM1...  65.5    2e-09   Nelumbo nucifera [Indian lotus]
gb|AES59521.2|  plant-specific B3-DNA-binding domain protein          66.2    2e-09   Medicago truncatula
gb|EEC71407.1|  hypothetical protein OsI_03573                        65.5    2e-09   Oryza sativa Indica Group [Indian rice]
ref|XP_009356789.1|  PREDICTED: putative B3 domain-containing pro...  64.7    3e-09   Pyrus x bretschneideri [bai li]
ref|XP_007047113.1|  AP2/B3-like transcriptional factor family pr...  65.5    3e-09   
ref|XP_004160514.1|  PREDICTED: uncharacterized LOC101221625          65.9    3e-09   
gb|ADN97106.1|  reduced vernalization response 1                      65.1    3e-09   Gossypium hirsutum [American cotton]
gb|KJB58378.1|  hypothetical protein B456_009G207400                  64.3    3e-09   Gossypium raimondii
ref|XP_004304357.1|  PREDICTED: putative B3 domain-containing pro...  64.7    3e-09   Fragaria vesca subsp. vesca
ref|XP_006644645.1|  PREDICTED: B3 domain-containing protein Os01...  64.7    3e-09   Oryza brachyantha
gb|KJB58374.1|  hypothetical protein B456_009G207400                  63.9    4e-09   Gossypium raimondii
gb|KJB58377.1|  hypothetical protein B456_009G207400                  63.9    4e-09   Gossypium raimondii
emb|CDM84156.1|  unnamed protein product                              64.7    4e-09   Triticum aestivum [Canadian hard winter wheat]
gb|KJB48485.1|  hypothetical protein B456_008G071200                  65.1    4e-09   Gossypium raimondii
ref|XP_011086144.1|  PREDICTED: putative B3 domain-containing pro...  61.6    4e-09   Sesamum indicum [beniseed]
ref|XP_006403705.1|  hypothetical protein EUTSA_v10010633mg           63.5    4e-09   Eutrema salsugineum [saltwater cress]
gb|KJB48487.1|  hypothetical protein B456_008G071200                  65.1    4e-09   Gossypium raimondii
gb|KJB48484.1|  hypothetical protein B456_008G071200                  65.1    4e-09   Gossypium raimondii
gb|KJB48486.1|  hypothetical protein B456_008G071200                  65.1    4e-09   Gossypium raimondii
ref|XP_004142021.1|  PREDICTED: uncharacterized protein LOC101221625  65.5    4e-09   
gb|KCW63848.1|  hypothetical protein EUGRSUZ_G01517                   63.9    5e-09   Eucalyptus grandis [rose gum]
gb|KDP46179.1|  hypothetical protein JCGZ_10019                       64.3    5e-09   Jatropha curcas
ref|XP_008380676.1|  PREDICTED: B3 domain-containing protein REM1...  63.2    5e-09   
ref|XP_010279604.1|  PREDICTED: B3 domain-containing transcriptio...  64.3    5e-09   Nelumbo nucifera [Indian lotus]
gb|KJB58381.1|  hypothetical protein B456_009G207400                  63.9    5e-09   Gossypium raimondii
emb|CDP07597.1|  unnamed protein product                              63.9    6e-09   Coffea canephora [robusta coffee]
ref|XP_007147158.1|  hypothetical protein PHAVU_006G100700g           63.5    6e-09   Phaseolus vulgaris [French bean]
ref|XP_011017261.1|  PREDICTED: B3 domain-containing protein REM1...  63.9    6e-09   Populus euphratica
sp|Q7XS75.2|Y4469_ORYSJ  RecName: Full=Putative B3 domain-contain...  64.3    6e-09   Oryza sativa Japonica Group [Japonica rice]
gb|AES59525.2|  plant-specific B3-DNA-binding domain protein          64.3    6e-09   Medicago truncatula
gb|KHG11795.1|  B3 domain-containing REM16 -like protein              63.9    6e-09   Gossypium arboreum [tree cotton]
ref|XP_010255061.1|  PREDICTED: B3 domain-containing protein Os01...  63.9    7e-09   Nelumbo nucifera [Indian lotus]
ref|XP_010657897.1|  PREDICTED: uncharacterized protein LOC104881...  63.9    7e-09   
gb|KJB58379.1|  hypothetical protein B456_009G207400                  63.9    7e-09   Gossypium raimondii
gb|KJB58380.1|  hypothetical protein B456_009G207400                  63.9    7e-09   Gossypium raimondii
gb|KCW63847.1|  hypothetical protein EUGRSUZ_G01517                   63.9    7e-09   Eucalyptus grandis [rose gum]
ref|XP_004164091.1|  PREDICTED: B3 domain-containing transcriptio...  63.9    7e-09   
ref|XP_010066068.1|  PREDICTED: B3 domain-containing transcriptio...  63.9    7e-09   Eucalyptus grandis [rose gum]
ref|XP_007199855.1|  hypothetical protein PRUPE_ppa006275mg           63.9    7e-09   Prunus persica
ref|XP_007199856.1|  hypothetical protein PRUPE_ppa006275mg           63.9    7e-09   Prunus persica
gb|KDO84371.1|  hypothetical protein CISIN_1g039936mg                 64.3    7e-09   Citrus sinensis [apfelsine]
ref|XP_009340814.1|  PREDICTED: B3 domain-containing protein REM1...  63.2    7e-09   Pyrus x bretschneideri [bai li]
ref|XP_003589274.1|  B3 domain-containing protein                     64.3    7e-09   
ref|XP_010647801.1|  PREDICTED: B3 domain-containing protein Os01...  63.9    8e-09   Vitis vinifera
ref|XP_009138341.1|  PREDICTED: B3 domain-containing protein REM2...  62.8    8e-09   Brassica rapa
ref|XP_009138339.1|  PREDICTED: B3 domain-containing protein REM2...  62.8    8e-09   Brassica rapa
ref|XP_011083780.1|  PREDICTED: B3 domain-containing protein REM1...  63.5    8e-09   Sesamum indicum [beniseed]
gb|KFK39227.1|  b3 domain-containing transcription factor vrn1-like   63.2    8e-09   Arabis alpina [alpine rockcress]
gb|AFK45994.1|  unknown                                               61.6    8e-09   Medicago truncatula
gb|ACJ86297.1|  unknown                                               61.6    9e-09   Medicago truncatula
ref|XP_003589278.1|  B3 domain-containing protein                     63.5    9e-09   Medicago truncatula
emb|CDP19095.1|  unnamed protein product                              62.4    9e-09   Coffea canephora [robusta coffee]
ref|XP_002281517.2|  PREDICTED: putative B3 domain-containing pro...  63.9    1e-08   
ref|XP_010229964.1|  PREDICTED: B3 domain-containing protein Os11...  61.2    1e-08   Brachypodium distachyon [annual false brome]
ref|XP_010255210.1|  PREDICTED: B3 domain-containing transcriptio...  60.1    1e-08   
gb|KHG00437.1|  B3 domain-containing transcription factor VRN1 -l...  63.2    1e-08   Gossypium arboreum [tree cotton]
ref|XP_007017398.1|  AP2/B3-like transcriptional factor family pr...  63.2    1e-08   
ref|XP_004141939.1|  PREDICTED: putative B3 domain-containing pro...  62.8    1e-08   
ref|XP_010275849.1|  PREDICTED: B3 domain-containing protein Os01...  62.4    1e-08   
ref|XP_010263945.1|  PREDICTED: B3 domain-containing protein Os01...  63.2    1e-08   
gb|KEH40066.1|  plant-specific B3-DNA-binding domain protein          62.4    1e-08   
gb|KGN48478.1|  hypothetical protein Csa_6G489940                     62.4    1e-08   
gb|KJB77618.1|  hypothetical protein B456_012G150900                  62.8    1e-08   
gb|KJB17863.1|  hypothetical protein B456_003G020000                  62.8    2e-08   
gb|KEH40067.1|  plant-specific B3-DNA-binding domain protein          62.4    2e-08   
ref|XP_010030660.1|  PREDICTED: B3 domain-containing protein REM2...  62.0    2e-08   
ref|XP_010487822.1|  PREDICTED: B3 domain-containing transcriptio...  62.4    2e-08   
ref|XP_010466027.1|  PREDICTED: B3 domain-containing transcriptio...  62.4    2e-08   
ref|XP_006299472.1|  hypothetical protein CARUB_v10015637mg           62.4    2e-08   
gb|EEE51804.1|  hypothetical protein OsJ_33271                        62.8    2e-08   
gb|KHG03184.1|  B3 domain-containing transcription factor VRN1        62.4    2e-08   
ref|NP_188529.2|  B3 domain-containing transcription factor VRN1      62.4    2e-08   
ref|XP_002885287.1|  hypothetical protein ARALYDRAFT_479415           62.4    2e-08   
ref|XP_010691759.1|  PREDICTED: B3 domain-containing protein At4g...  63.2    2e-08   
gb|KJB79248.1|  hypothetical protein B456_013G040000                  62.4    2e-08   
gb|KJB79249.1|  hypothetical protein B456_013G040000                  62.4    2e-08   
ref|XP_003589273.1|  B3 domain-containing protein                     62.4    2e-08   
ref|XP_010101937.1|  B3 domain-containing protein                     62.8    2e-08   
ref|NP_001067431.1|  Os11g0197600                                     62.4    2e-08   
ref|XP_006577282.1|  PREDICTED: putative B3 domain-containing pro...  62.0    2e-08   
ref|XP_003564287.2|  PREDICTED: B3 domain-containing protein Os02...  62.8    2e-08   
ref|XP_010647813.1|  PREDICTED: B3 domain-containing protein REM2...  62.0    2e-08   
ref|XP_007131907.1|  hypothetical protein PHAVU_011G050700g           62.0    2e-08   
ref|XP_004499104.1|  PREDICTED: B3 domain-containing protein REM1...  62.4    2e-08   
ref|XP_010647819.1|  PREDICTED: putative B3 domain-containing pro...  62.0    2e-08   
ref|XP_008236690.1|  PREDICTED: B3 domain-containing transcriptio...  62.0    2e-08   
ref|XP_009787704.1|  PREDICTED: putative B3 domain-containing pro...  60.8    2e-08   
emb|CAH66511.1|  OSIGBa0111I14.6                                      62.4    2e-08   
ref|XP_008236689.1|  PREDICTED: B3 domain-containing transcriptio...  62.4    2e-08   
gb|EEC67837.1|  hypothetical protein OsI_35443                        62.4    3e-08   
ref|XP_007212676.1|  hypothetical protein PRUPE_ppa018424mg           58.2    3e-08   
ref|XP_011083918.1|  PREDICTED: B3 domain-containing protein REM1...  61.6    3e-08   
ref|XP_008236688.1|  PREDICTED: B3 domain-containing transcriptio...  62.4    3e-08   
gb|KEH40065.1|  plant-specific B3-DNA-binding domain protein          62.0    3e-08   
ref|XP_003589279.1|  B3 domain-containing protein                     62.0    3e-08   
ref|XP_007042309.1|  DNA binding protein, putative isoform 1          61.6    3e-08   
ref|XP_009367926.1|  PREDICTED: B3 domain-containing protein At1g...  60.8    3e-08   
ref|XP_009631052.1|  PREDICTED: B3 domain-containing protein REM1...  62.0    3e-08   
gb|EEC77050.1|  hypothetical protein OsI_15430                        62.4    3e-08   
gb|KHN12746.1|  B3 domain-containing protein REM16                    62.0    3e-08   
ref|XP_007042311.1|  DNA binding protein, putative isoform 3          61.6    3e-08   
ref|XP_007047109.1|  DSBA oxidoreductase family protein isoform 1     62.0    3e-08   
ref|XP_011458372.1|  PREDICTED: B3 domain-containing protein Os11...  60.8    3e-08   
ref|XP_004146931.1|  PREDICTED: putative B3 domain-containing pro...  61.6    3e-08   
ref|XP_008440212.1|  PREDICTED: uncharacterized protein LOC103484...  62.8    3e-08   
ref|XP_008362136.1|  PREDICTED: B3 domain-containing transcriptio...  62.0    3e-08   
gb|KJB14543.1|  hypothetical protein B456_002G130300                  62.0    3e-08   
ref|XP_007042310.1|  DNA binding protein, putative isoform 2          61.6    3e-08   
ref|XP_009613987.1|  PREDICTED: B3 domain-containing protein At3g...  60.5    3e-08   
ref|XP_006346537.1|  PREDICTED: B3 domain-containing protein Os11...  60.5    3e-08   
ref|XP_010245898.1|  PREDICTED: putative B3 domain-containing pro...  61.2    3e-08   
ref|XP_008362130.1|  PREDICTED: B3 domain-containing transcriptio...  61.6    4e-08   
ref|XP_004290347.1|  PREDICTED: B3 domain-containing protein Os01...  60.5    4e-08   
ref|XP_010532431.1|  PREDICTED: B3 domain-containing transcriptio...  61.2    4e-08   
ref|XP_010663041.1|  PREDICTED: uncharacterized protein LOC104882...  62.0    4e-08   
gb|KJB14544.1|  hypothetical protein B456_002G130300                  61.6    4e-08   
ref|XP_011459603.1|  PREDICTED: B3 domain-containing protein REM9...  60.5    4e-08   
ref|XP_006386516.1|  hypothetical protein POPTR_0002s13140g           59.3    4e-08   
ref|XP_002510292.1|  DNA binding protein, putative                    61.6    4e-08   
ref|XP_002456269.1|  hypothetical protein SORBIDRAFT_03g033260        61.6    4e-08   
ref|XP_010263946.1|  PREDICTED: B3 domain-containing protein Os01...  61.2    4e-08   
ref|XP_010096266.1|  B3 domain-containing transcription factor VRN1   61.6    4e-08   
ref|XP_011035988.1|  PREDICTED: B3 domain-containing transcriptio...  61.2    4e-08   
emb|CBI32503.3|  unnamed protein product                              61.2    5e-08   
ref|XP_003589277.1|  B3 domain-containing protein                     61.2    5e-08   
ref|NP_001050682.1|  Os03g0622200                                     61.2    5e-08   
ref|XP_006601305.1|  PREDICTED: B3 domain-containing protein REM1...  61.6    5e-08   
gb|KJB32443.1|  hypothetical protein B456_005G240900                  60.8    5e-08   
ref|XP_010263797.1|  PREDICTED: putative B3 domain-containing pro...  61.2    5e-08   
ref|XP_006473401.1|  PREDICTED: B3 domain-containing protein REM1...  61.6    5e-08   
ref|XP_004231660.1|  PREDICTED: B3 domain-containing protein At5g...  61.2    5e-08   
ref|XP_006595619.1|  PREDICTED: uncharacterized protein LOC100813...  61.2    5e-08   
ref|XP_004290392.1|  PREDICTED: B3 domain-containing protein Os01...  60.5    5e-08   
ref|XP_009793339.1|  PREDICTED: B3 domain-containing protein REM1...  60.8    5e-08   
ref|XP_006423105.1|  hypothetical protein CICLE_v10028642mg           61.2    5e-08   
ref|XP_006434884.1|  hypothetical protein CICLE_v10001063mg           61.2    5e-08   
ref|XP_006595618.1|  PREDICTED: uncharacterized protein LOC100813...  61.2    5e-08   
ref|XP_006423107.1|  hypothetical protein CICLE_v10028642mg           60.8    5e-08   
ref|XP_006406545.1|  hypothetical protein EUTSA_v10021075mg           60.8    6e-08   
ref|XP_008362156.1|  PREDICTED: B3 domain-containing protein Os03...  59.3    6e-08   
ref|XP_008241585.1|  PREDICTED: putative B3 domain-containing pro...  60.8    6e-08   
gb|KDO52176.1|  hypothetical protein CISIN_1g016655mg                 61.2    6e-08   
ref|XP_009342414.1|  PREDICTED: B3 domain-containing transcriptio...  61.2    6e-08   
ref|XP_006401913.1|  hypothetical protein EUTSA_v10014972mg           58.5    6e-08   
ref|XP_002866723.1|  transcriptional factor B3 family protein         60.8    6e-08   
ref|XP_009345495.1|  PREDICTED: B3 domain-containing transcriptio...  60.8    6e-08   
gb|KJB32442.1|  hypothetical protein B456_005G240900                  60.8    7e-08   
ref|XP_004499103.1|  PREDICTED: B3 domain-containing protein REM1...  59.3    7e-08   
ref|XP_009342413.1|  PREDICTED: B3 domain-containing transcriptio...  60.8    7e-08   
gb|KJB32441.1|  hypothetical protein B456_005G240900                  60.8    7e-08   
ref|XP_007042308.1|  Uncharacterized protein TCM_006970               60.8    7e-08   
ref|XP_002466799.1|  hypothetical protein SORBIDRAFT_01g014370        60.5    7e-08   
ref|XP_008453827.1|  PREDICTED: B3 domain-containing protein At3g...  60.5    8e-08   
ref|XP_011467595.1|  PREDICTED: B3 domain-containing protein LOC_...  61.2    8e-08   
ref|XP_004982409.1|  PREDICTED: B3 domain-containing protein Os03...  60.5    8e-08   
ref|XP_006384478.1|  hypothetical protein POPTR_0004s15430g           60.5    8e-08   
ref|NP_001239771.1|  uncharacterized protein LOC100813851             60.5    9e-08   
ref|XP_008386194.1|  PREDICTED: putative B3 domain-containing pro...  60.1    9e-08   
ref|XP_008453826.1|  PREDICTED: B3 domain-containing transcriptio...  60.5    9e-08   
ref|XP_011467596.1|  PREDICTED: B3 domain-containing protein LOC_...  60.8    9e-08   
ref|XP_010426969.1|  PREDICTED: B3 domain-containing protein REM2...  59.7    9e-08   
emb|CAN64872.1|  hypothetical protein VITISV_026093                   59.7    9e-08   
ref|XP_006586585.1|  PREDICTED: B3 domain-containing transcriptio...  59.7    1e-07   
ref|XP_011005664.1|  PREDICTED: B3 domain-containing transcriptio...  60.5    1e-07   
ref|XP_002447504.1|  hypothetical protein SORBIDRAFT_06g002075        60.5    1e-07   
gb|KHN01836.1|  B3 domain-containing transcription factor VRN1        59.7    1e-07   
ref|XP_008352817.1|  PREDICTED: B3 domain-containing transcriptio...  60.5    1e-07   
ref|XP_004242112.1|  PREDICTED: B3 domain-containing transcriptio...  59.3    1e-07   
ref|XP_010504088.1|  PREDICTED: B3 domain-containing protein REM2...  59.7    1e-07   
gb|AFK42404.1|  unknown                                               60.5    1e-07   
ref|XP_008354683.1|  PREDICTED: B3 domain-containing transcriptio...  60.5    1e-07   
gb|ACJ86285.1|  unknown                                               60.5    1e-07   
ref|XP_009613984.1|  PREDICTED: B3 domain-containing protein At3g...  59.7    1e-07   
ref|XP_004241347.1|  PREDICTED: B3 domain-containing protein REM5...  59.3    1e-07   
emb|CDY22996.1|  BnaC03g40730D                                        60.1    1e-07   
ref|XP_008352816.1|  PREDICTED: B3 domain-containing transcriptio...  60.1    1e-07   
ref|XP_010519311.1|  PREDICTED: B3 domain-containing transcriptio...  60.1    1e-07   
ref|XP_007042301.1|  Uncharacterized protein TCM_006967               60.1    1e-07   
ref|XP_006653278.1|  PREDICTED: putative B3 domain-containing pro...  59.7    1e-07   
ref|XP_008440204.1|  PREDICTED: putative B3 domain-containing pro...  59.3    1e-07   
ref|XP_010656662.1|  PREDICTED: B3 domain-containing transcriptio...  60.5    1e-07   
ref|XP_011459755.1|  PREDICTED: B3 domain-containing protein Os01...  58.9    1e-07   
ref|XP_011465435.1|  PREDICTED: B3 domain-containing transcriptio...  59.7    1e-07   
ref|XP_010942229.1|  PREDICTED: putative B3 domain-containing pro...  59.3    1e-07   
gb|KHG05314.1|  B3 domain-containing REM16 -like protein              59.7    2e-07   
ref|XP_006351837.1|  PREDICTED: B3 domain-containing protein At5g...  59.7    2e-07   
ref|XP_007047110.1|  Thioredoxin superfamily protein isoform 2        59.7    2e-07   
ref|XP_002519138.1|  hypothetical protein RCOM_0939100                60.1    2e-07   
gb|KHG00016.1|  B3 domain-containing transcription factor VRN1 -l...  59.3    2e-07   
ref|XP_009145836.1|  PREDICTED: B3 domain-containing transcriptio...  59.3    2e-07   
ref|XP_002515369.1|  DNA binding protein, putative                    59.3    2e-07   
ref|XP_003589275.1|  B3 domain-containing protein                     59.3    2e-07   
ref|XP_010663044.1|  PREDICTED: uncharacterized protein LOC104882...  59.7    2e-07   
ref|XP_010526004.1|  PREDICTED: B3 domain-containing protein REM1...  59.3    2e-07   
ref|XP_002456271.1|  hypothetical protein SORBIDRAFT_03g033280        59.7    2e-07   
ref|XP_006423121.1|  hypothetical protein CICLE_v10028745mg           59.3    2e-07   
ref|XP_003589271.1|  B3 domain-containing protein                     59.3    2e-07   
ref|XP_007140766.1|  hypothetical protein PHAVU_008G140100g           57.0    2e-07   
ref|XP_010229534.1|  PREDICTED: putative B3 domain-containing pro...  59.7    2e-07   
emb|CAN82369.1|  hypothetical protein VITISV_027620                   59.7    2e-07   
gb|KDO52156.1|  hypothetical protein CISIN_1g018886mg                 58.9    2e-07   
ref|XP_007047115.1|  AP2/B3-like transcriptional factor family pr...  59.3    3e-07   
gb|KJB17869.1|  hypothetical protein B456_003G020600                  59.3    3e-07   
gb|EMT08925.1|  B3 domain-containing protein                          59.7    3e-07   
ref|XP_010515820.1|  PREDICTED: B3 domain-containing protein REM2...  58.5    3e-07   
ref|XP_010469086.1|  PREDICTED: B3 domain-containing protein REM2...  58.5    3e-07   
emb|CDX92293.1|  BnaA05g21140D                                        58.9    3e-07   
sp|Q7XS74.3|Y4474_ORYSJ  RecName: Full=Putative B3 domain-contain...  58.9    3e-07   
gb|KCW66219.1|  hypothetical protein EUGRSUZ_F00044                   58.9    3e-07   
ref|XP_009103858.1|  PREDICTED: B3 domain-containing protein REM2...  58.5    3e-07   
emb|CAN76392.1|  hypothetical protein VITISV_011465                   59.3    3e-07   
emb|CDP04824.1|  unnamed protein product                              57.8    3e-07   
ref|XP_010526005.1|  PREDICTED: B3 domain-containing protein REM1...  58.9    3e-07   
emb|CAN71750.1|  hypothetical protein VITISV_040593                   59.3    3e-07   
ref|XP_006293000.1|  hypothetical protein CARUB_v10019277mg           58.2    3e-07   
ref|XP_008226604.1|  PREDICTED: B3 domain-containing protein REM6...  58.2    3e-07   
ref|XP_002268915.2|  PREDICTED: cytochrome P450 82C2                  59.3    4e-07   
gb|KFK38646.1|  hypothetical protein AALP_AA3G142000                  58.5    4e-07   
ref|XP_009801950.1|  PREDICTED: B3 domain-containing protein REM5...  57.8    4e-07   
ref|XP_004963038.1|  PREDICTED: B3 domain-containing protein Os12...  58.5    4e-07   
ref|XP_011462396.1|  PREDICTED: B3 domain-containing protein REM5...  58.2    4e-07   
ref|XP_008792612.1|  PREDICTED: putative B3 domain-containing pro...  58.5    4e-07   
gb|KJB77619.1|  hypothetical protein B456_012G150900                  58.5    4e-07   
ref|XP_009396674.1|  PREDICTED: B3 domain-containing protein REM1...  58.5    4e-07   
gb|KJB77620.1|  hypothetical protein B456_012G150900                  58.5    5e-07   
emb|CDX99291.1|  BnaC05g34060D                                        58.2    5e-07   
ref|XP_004982412.1|  PREDICTED: putative B3 domain-containing pro...  58.2    5e-07   
ref|XP_004982411.1|  PREDICTED: putative B3 domain-containing pro...  58.2    5e-07   
ref|NP_001288881.1|  B3 domain-containing transcription factor VR...  58.2    5e-07   
ref|XP_009112206.1|  PREDICTED: B3 domain-containing transcriptio...  58.2    5e-07   
emb|CDY45798.1|  BnaC03g16210D                                        57.0    5e-07   
ref|XP_003539033.2|  PREDICTED: B3 domain-containing protein Os11...  58.2    5e-07   
ref|XP_011466836.1|  PREDICTED: B3 domain-containing transcriptio...  58.5    5e-07   
emb|CDY18562.1|  BnaA01g26330D                                        58.2    5e-07   
gb|AAX96729.1|  B3 DNA binding domain, putative                       58.2    5e-07   
emb|CDX95476.1|  BnaC01g33680D                                        58.2    6e-07   
ref|XP_010492301.1|  PREDICTED: B3 domain-containing protein At3g...  55.5    6e-07   
ref|XP_004305403.1|  PREDICTED: B3 domain-containing transcriptio...  58.2    6e-07   
gb|EEC75758.1|  hypothetical protein OsI_12653                        58.2    6e-07   
ref|XP_010113419.1|  B3 domain-containing transcription factor VRN1   58.2    6e-07   
ref|XP_008354682.1|  PREDICTED: B3 domain-containing protein At1g...  55.5    6e-07   
gb|KDP44999.1|  hypothetical protein JCGZ_01499                       58.2    6e-07   
ref|XP_006663274.1|  PREDICTED: B3 domain-containing protein Os11...  58.2    6e-07   
gb|KJB43592.1|  hypothetical protein B456_007G208600                  57.8    6e-07   
ref|XP_010324665.1|  PREDICTED: B3 domain-containing protein REM1...  58.2    7e-07   
ref|XP_006494701.1|  PREDICTED: B3 domain-containing transcriptio...  57.4    7e-07   
gb|AAQ55453.1|  reduced vernalization response 1                      57.8    7e-07   
gb|KJB12216.1|  hypothetical protein B456_002G006500                  57.8    7e-07   
gb|KJB83967.1|  hypothetical protein B456_013G039700                  57.8    8e-07   
gb|KJB12217.1|  hypothetical protein B456_002G006500                  57.8    8e-07   
gb|KJB83973.1|  hypothetical protein B456_013G039700                  57.4    8e-07   
ref|XP_010420133.1|  PREDICTED: B3 domain-containing protein At3g...  55.1    8e-07   
ref|XP_010512501.1|  PREDICTED: B3 domain-containing protein REM2...  57.0    8e-07   
ref|XP_004507369.1|  PREDICTED: B3 domain-containing transcriptio...  57.8    8e-07   
gb|KHG28570.1|  B3 domain-containing transcription factor VRN1        57.8    8e-07   
gb|KJB83968.1|  hypothetical protein B456_013G039700                  57.8    8e-07   
gb|KJB83974.1|  hypothetical protein B456_013G039700                  57.4    8e-07   
gb|AAO34502.1|  putative auxin response factor                        58.2    8e-07   
gb|KFK30083.1|  hypothetical protein AALP_AA7G214300                  57.4    9e-07   
gb|KHG28569.1|  B3 domain-containing transcription factor VRN1        57.4    9e-07   
ref|XP_004977886.1|  PREDICTED: putative B3 domain-containing pro...  56.6    9e-07   
ref|XP_010255211.1|  PREDICTED: putative B3 domain-containing pro...  55.8    9e-07   
ref|XP_008457960.1|  PREDICTED: putative B3 domain-containing pro...  57.8    9e-07   
ref|XP_006436970.1|  hypothetical protein CICLE_v10032216mg           57.4    9e-07   
emb|CAN82366.1|  hypothetical protein VITISV_027617                   57.4    9e-07   
ref|XP_004507368.1|  PREDICTED: B3 domain-containing transcriptio...  57.8    9e-07   
ref|XP_007047114.1|  AP2/B3-like transcriptional factor family pr...  57.8    1e-06   
gb|KEH40759.1|  B3 domain transcription factor VRN1-like protein      57.4    1e-06   
ref|XP_006398097.1|  hypothetical protein EUTSA_v10000999mg           56.6    1e-06   
gb|EEE59515.1|  hypothetical protein OsJ_11767                        57.4    1e-06   
ref|XP_010530864.1|  PREDICTED: B3 domain-containing protein REM21    56.6    1e-06   
emb|CDY67388.1|  BnaAnng24200D                                        56.6    1e-06   
ref|NP_001050681.1|  Os03g0622100                                     57.0    1e-06   
ref|XP_010089922.1|  B3 domain-containing protein REM16               57.0    1e-06   
ref|XP_006476960.1|  PREDICTED: uncharacterized protein LOC102617...  57.4    1e-06   
gb|KDO52174.1|  hypothetical protein CISIN_1g017237mg                 57.0    1e-06   
ref|XP_006425800.1|  hypothetical protein CICLE_v10026137mg           56.6    1e-06   



>ref|XP_006354941.1| PREDICTED: B3 domain-containing protein Os01g0723500-like [Solanum 
tuberosum]
Length=113

 Score =   137 bits (345),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 65/90 (72%), Positives = 72/90 (80%), Gaps = 0/90 (0%)
 Frame = +2

Query  269  MSNGRKPHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGG  448
            M + R+PHFL GFNPS++SEKLKIPSKF KHM+G  SG   LVGPSGN W V + Q D G
Sbjct  1    MLDARRPHFLVGFNPSMNSEKLKIPSKFIKHMEGRDSGTTVLVGPSGNAWPVDLIQQDDG  60

Query  449  LFFHDGWTVFVKDHCLEYGDSLVFRYDGDL  538
            LFFH+GW  FVKDHCLE GDSLVFRYDGDL
Sbjct  61   LFFHNGWVSFVKDHCLETGDSLVFRYDGDL  90



>ref|XP_009781397.1| PREDICTED: B3 domain-containing protein Os01g0723500-like isoform 
X3 [Nicotiana sylvestris]
Length=535

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 72/90 (80%), Gaps = 0/90 (0%)
 Frame = +2

Query  269  MSNGRKPHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGG  448
            M + ++PHFL GFNPSI SE LKIPSKF KHM+G  SG A LVGPSGN+W + + Q D G
Sbjct  1    MWDAKRPHFLVGFNPSIQSETLKIPSKFIKHMEGRASGTAFLVGPSGNSWPMDLIQQDDG  60

Query  449  LFFHDGWTVFVKDHCLEYGDSLVFRYDGDL  538
            LFFH+GW  FVKDHCLE GD+LVFRYDGDL
Sbjct  61   LFFHNGWASFVKDHCLESGDALVFRYDGDL  90



>ref|XP_009781396.1| PREDICTED: B3 domain-containing protein Os01g0723500-like isoform 
X2 [Nicotiana sylvestris]
Length=538

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 72/90 (80%), Gaps = 0/90 (0%)
 Frame = +2

Query  269  MSNGRKPHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGG  448
            M + ++PHFL GFNPSI SE LKIPSKF KHM+G  SG A LVGPSGN+W + + Q D G
Sbjct  1    MWDAKRPHFLVGFNPSIQSETLKIPSKFIKHMEGRASGTAFLVGPSGNSWPMDLIQQDDG  60

Query  449  LFFHDGWTVFVKDHCLEYGDSLVFRYDGDL  538
            LFFH+GW  FVKDHCLE GD+LVFRYDGDL
Sbjct  61   LFFHNGWASFVKDHCLESGDALVFRYDGDL  90



>ref|XP_009781392.1| PREDICTED: B3 domain-containing protein Os01g0723500-like isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009781393.1| PREDICTED: B3 domain-containing protein Os01g0723500-like isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009781394.1| PREDICTED: B3 domain-containing protein Os01g0723500-like isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009781395.1| PREDICTED: B3 domain-containing protein Os01g0723500-like isoform 
X1 [Nicotiana sylvestris]
Length=539

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 72/90 (80%), Gaps = 0/90 (0%)
 Frame = +2

Query  269  MSNGRKPHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGG  448
            M + ++PHFL GFNPSI SE LKIPSKF KHM+G  SG A LVGPSGN+W + + Q D G
Sbjct  1    MWDAKRPHFLVGFNPSIQSETLKIPSKFIKHMEGRASGTAFLVGPSGNSWPMDLIQQDDG  60

Query  449  LFFHDGWTVFVKDHCLEYGDSLVFRYDGDL  538
            LFFH+GW  FVKDHCLE GD+LVFRYDGDL
Sbjct  61   LFFHNGWASFVKDHCLESGDALVFRYDGDL  90



>ref|XP_009588428.1| PREDICTED: B3 domain-containing protein Os01g0723500-like isoform 
X1 [Nicotiana tomentosiformis]
 ref|XP_009588429.1| PREDICTED: B3 domain-containing protein Os01g0723500-like isoform 
X1 [Nicotiana tomentosiformis]
 ref|XP_009588430.1| PREDICTED: B3 domain-containing protein Os01g0723500-like isoform 
X1 [Nicotiana tomentosiformis]
Length=539

 Score =   135 bits (341),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = +2

Query  269  MSNGRKPHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGG  448
            M + R+PHFL GFNPSI SE LKIPSKF KHM+G  SG A LVGPSGN+W + + Q D G
Sbjct  1    MWDARRPHFLVGFNPSIHSETLKIPSKFIKHMEGKASGTAFLVGPSGNSWPMDLIQQDDG  60

Query  449  LFFHDGWTVFVKDHCLEYGDSLVFRYDGDL  538
            LFFH+GW   VKDHCLE GD+LVFRYDGDL
Sbjct  61   LFFHNGWASLVKDHCLESGDALVFRYDGDL  90



>ref|XP_009588431.1| PREDICTED: B3 domain-containing protein Os01g0723500-like isoform 
X2 [Nicotiana tomentosiformis]
Length=538

 Score =   135 bits (341),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = +2

Query  269  MSNGRKPHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGG  448
            M + R+PHFL GFNPSI SE LKIPSKF KHM+G  SG A LVGPSGN+W + + Q D G
Sbjct  1    MWDARRPHFLVGFNPSIHSETLKIPSKFIKHMEGKASGTAFLVGPSGNSWPMDLIQQDDG  60

Query  449  LFFHDGWTVFVKDHCLEYGDSLVFRYDGDL  538
            LFFH+GW   VKDHCLE GD+LVFRYDGDL
Sbjct  61   LFFHNGWASLVKDHCLESGDALVFRYDGDL  90



>ref|XP_009588432.1| PREDICTED: B3 domain-containing protein Os01g0723500-like isoform 
X3 [Nicotiana tomentosiformis]
Length=535

 Score =   135 bits (340),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = +2

Query  269  MSNGRKPHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGG  448
            M + R+PHFL GFNPSI SE LKIPSKF KHM+G  SG A LVGPSGN+W + + Q D G
Sbjct  1    MWDARRPHFLVGFNPSIHSETLKIPSKFIKHMEGKASGTAFLVGPSGNSWPMDLIQQDDG  60

Query  449  LFFHDGWTVFVKDHCLEYGDSLVFRYDGDL  538
            LFFH+GW   VKDHCLE GD+LVFRYDGDL
Sbjct  61   LFFHNGWASLVKDHCLESGDALVFRYDGDL  90



>ref|XP_004238198.1| PREDICTED: B3 domain-containing protein Os01g0723500-like [Solanum 
lycopersicum]
Length=580

 Score =   134 bits (337),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = +2

Query  269  MSNGRKPHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGG  448
            M + R+PHFL GFNP ++SEKLKIPSKF KHM+G  SG   LVGPSGN W V + Q D G
Sbjct  1    MLDARRPHFLVGFNPFMNSEKLKIPSKFIKHMEGGDSGTTVLVGPSGNAWPVDLIQQDDG  60

Query  449  LFFHDGWTVFVKDHCLEYGDSLVFRYDGDL  538
            LFF++GW  FVKDHCLE GDSLVFRYDGDL
Sbjct  61   LFFNNGWVSFVKDHCLETGDSLVFRYDGDL  90



>emb|CDP07598.1| unnamed protein product [Coffea canephora]
Length=570

 Score =   132 bits (332),  Expect = 8e-33, Method: Composition-based stats.
 Identities = 58/90 (64%), Positives = 68/90 (76%), Gaps = 0/90 (0%)
 Frame = +2

Query  269  MSNGRKPHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGG  448
            M + +KPHFL GFNPS SSE LK+P KF KH+DG T G A L+GPSGNTWY  ++Q +  
Sbjct  1    MWDDKKPHFLVGFNPSSSSEALKLPFKFKKHIDGTTPGTAFLLGPSGNTWYANLTQQNDD  60

Query  449  LFFHDGWTVFVKDHCLEYGDSLVFRYDGDL  538
            LF  DGW  FV+DH LE GDSLVFRYDG+L
Sbjct  61   LFLQDGWVAFVRDHSLESGDSLVFRYDGNL  90



>ref|XP_010664619.1| PREDICTED: B3 domain-containing protein Os01g0723500-like isoform 
X2 [Vitis vinifera]
Length=485

 Score =   130 bits (326),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 68/90 (76%), Gaps = 0/90 (0%)
 Frame = +2

Query  269  MSNGRKPHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGG  448
            M N ++PHF   F P  SSE+LKIPS+F KHM+G TSG  SLVGPS NTW+V + Q +  
Sbjct  1    MKNSKRPHFFEVFQPDASSERLKIPSRFIKHMEGRTSGFVSLVGPSDNTWHVDLIQQNSD  60

Query  449  LFFHDGWTVFVKDHCLEYGDSLVFRYDGDL  538
            L  HDGW VFV+DHC+E GDSLVFRYDG+L
Sbjct  61   LLLHDGWPVFVRDHCIECGDSLVFRYDGNL  90



>ref|XP_010683984.1| PREDICTED: B3 domain-containing protein Os01g0723500-like isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=632

 Score =   130 bits (328),  Expect = 7e-32, Method: Composition-based stats.
 Identities = 56/89 (63%), Positives = 69/89 (78%), Gaps = 0/89 (0%)
 Frame = +2

Query  269  MSNGRKPHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGG  448
            M +GR+PHFL  F P++SS +LK+PSKF KH+ G TSG  SLVGPSGN W+V + + +G 
Sbjct  1    MMSGRRPHFLEVFLPNLSSNRLKVPSKFVKHLGGRTSGSLSLVGPSGNIWHVNLFEYNGH  60

Query  449  LFFHDGWTVFVKDHCLEYGDSLVFRYDGD  535
            LFF DGW+ FVKDH +E GDSLVF YDGD
Sbjct  61   LFFQDGWSTFVKDHSIECGDSLVFEYDGD  89



>ref|XP_002282159.3| PREDICTED: B3 domain-containing protein Os01g0723500-like isoform 
X1 [Vitis vinifera]
 ref|XP_010664617.1| PREDICTED: B3 domain-containing protein Os01g0723500-like isoform 
X1 [Vitis vinifera]
 ref|XP_010664618.1| PREDICTED: B3 domain-containing protein Os01g0723500-like isoform 
X1 [Vitis vinifera]
 emb|CBI19591.3| unnamed protein product [Vitis vinifera]
Length=604

 Score =   130 bits (326),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 68/90 (76%), Gaps = 0/90 (0%)
 Frame = +2

Query  269  MSNGRKPHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGG  448
            M N ++PHF   F P  SSE+LKIPS+F KHM+G TSG  SLVGPS NTW+V + Q +  
Sbjct  1    MKNSKRPHFFEVFQPDASSERLKIPSRFIKHMEGRTSGFVSLVGPSDNTWHVDLIQQNSD  60

Query  449  LFFHDGWTVFVKDHCLEYGDSLVFRYDGDL  538
            L  HDGW VFV+DHC+E GDSLVFRYDG+L
Sbjct  61   LLLHDGWPVFVRDHCIECGDSLVFRYDGNL  90



>ref|XP_010683976.1| PREDICTED: B3 domain-containing protein Os01g0723500-like isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=638

 Score =   130 bits (327),  Expect = 9e-32, Method: Composition-based stats.
 Identities = 56/89 (63%), Positives = 69/89 (78%), Gaps = 0/89 (0%)
 Frame = +2

Query  269  MSNGRKPHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGG  448
            M +GR+PHFL  F P++SS +LK+PSKF KH+ G TSG  SLVGPSGN W+V + + +G 
Sbjct  1    MMSGRRPHFLEVFLPNLSSNRLKVPSKFVKHLGGRTSGSLSLVGPSGNIWHVNLFEYNGH  60

Query  449  LFFHDGWTVFVKDHCLEYGDSLVFRYDGD  535
            LFF DGW+ FVKDH +E GDSLVF YDGD
Sbjct  61   LFFQDGWSTFVKDHSIECGDSLVFEYDGD  89



>ref|XP_011083781.1| PREDICTED: B3 domain-containing protein Os01g0723500-like [Sesamum 
indicum]
 ref|XP_011083782.1| PREDICTED: B3 domain-containing protein Os01g0723500-like [Sesamum 
indicum]
 ref|XP_011083783.1| PREDICTED: B3 domain-containing protein Os01g0723500-like [Sesamum 
indicum]
Length=539

 Score =   124 bits (311),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 67/86 (78%), Gaps = 0/86 (0%)
 Frame = +2

Query  281  RKPHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFH  460
            R+PHF+ GF+PS+ SE+L IP  F KHM+G   G+A LVGPSGN WYVG+  +D GLF +
Sbjct  5    RRPHFITGFDPSLCSERLNIPCSFIKHMEGRAPGLALLVGPSGNNWYVGLIIVDNGLFLN  64

Query  461  DGWTVFVKDHCLEYGDSLVFRYDGDL  538
            DGW  FV+DH LE GDSLVFRYDG+L
Sbjct  65   DGWADFVRDHFLEQGDSLVFRYDGNL  90



>gb|EYU45075.1| hypothetical protein MIMGU_mgv1a004183mg [Erythranthe guttata]
Length=540

 Score =   118 bits (296),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 66/86 (77%), Gaps = 0/86 (0%)
 Frame = +2

Query  281  RKPHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFH  460
            R+PHFL GF+ S+SSE+L IP  F KH++G T G A LVGPSGN WYV +   D GLF +
Sbjct  5    RRPHFLLGFDSSLSSERLNIPYNFVKHLEGKTPGTALLVGPSGNDWYVNLIHTDNGLFLN  64

Query  461  DGWTVFVKDHCLEYGDSLVFRYDGDL  538
            DGW  FV+DH LE+GD++VFRYDG+L
Sbjct  65   DGWADFVRDHFLEHGDAMVFRYDGEL  90



>ref|XP_010089923.1| B3 domain-containing protein [Morus notabilis]
 gb|EXB38619.1| B3 domain-containing protein [Morus notabilis]
Length=623

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 69/91 (76%), Gaps = 0/91 (0%)
 Frame = +2

Query  266  EMSNGRKPHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDG  445
            +MS+GR+PHF   ++ ++SSE+LKIP+KF K M+G TSG  SL GPSGNTW V + Q +G
Sbjct  8    KMSSGRRPHFFAFYSANLSSERLKIPTKFMKRMEGKTSGSVSLEGPSGNTWQVDLVQQNG  67

Query  446  GLFFHDGWTVFVKDHCLEYGDSLVFRYDGDL  538
             LF H GW  FV+DH +E GD L+FRYDGDL
Sbjct  68   DLFLHYGWPAFVRDHFVECGDFLIFRYDGDL  98



>ref|XP_007221817.1| hypothetical protein PRUPE_ppa003541mg [Prunus persica]
 gb|EMJ23016.1| hypothetical protein PRUPE_ppa003541mg [Prunus persica]
Length=567

 Score =   116 bits (291),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 66/91 (73%), Gaps = 0/91 (0%)
 Frame = +2

Query  266  EMSNGRKPHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDG  445
            E SN R+PHF   ++  +SSE+LKIP +F  HM+G TSG+ SL GPSGN W V + Q +G
Sbjct  8    ETSNARRPHFFAFYSADLSSERLKIPERFMIHMEGRTSGLVSLFGPSGNAWNVDLIQKNG  67

Query  446  GLFFHDGWTVFVKDHCLEYGDSLVFRYDGDL  538
             LFFH GW  FV+DH +E GD L+FRYDG+L
Sbjct  68   DLFFHHGWPAFVRDHFVECGDFLIFRYDGEL  98



>ref|XP_008220724.1| PREDICTED: B3 domain-containing protein Os01g0723500-like [Prunus 
mume]
Length=567

 Score =   116 bits (290),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 66/91 (73%), Gaps = 0/91 (0%)
 Frame = +2

Query  266  EMSNGRKPHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDG  445
            E SN R+PHF   ++  +SSE+LKIP +F  HM+G TSG+ SL GPSGN W V + Q +G
Sbjct  8    ETSNARRPHFFAFYSADLSSERLKIPERFMIHMEGRTSGLVSLFGPSGNAWNVDLIQKNG  67

Query  446  GLFFHDGWTVFVKDHCLEYGDSLVFRYDGDL  538
             LFFH GW  FV+DH +E GD L+FRYDG+L
Sbjct  68   DLFFHHGWPAFVRDHFVECGDFLIFRYDGEL  98



>ref|XP_008378454.1| PREDICTED: B3 domain-containing protein Os01g0723500-like [Malus 
domestica]
Length=565

 Score =   114 bits (285),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 65/94 (69%), Gaps = 0/94 (0%)
 Frame = +2

Query  257  FGAEMSNGRKPHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQ  436
               E  N R PHF   ++  +SSE+LKIP +F +HM+G TSG+ SL GPSG+ W V + Q
Sbjct  1    MAEEARNVRSPHFFAFYSADLSSERLKIPERFMRHMEGRTSGLVSLFGPSGSEWSVELIQ  60

Query  437  LDGGLFFHDGWTVFVKDHCLEYGDSLVFRYDGDL  538
             +GGLF H GW  FV+DH +E GD L+FRYDGDL
Sbjct  61   QNGGLFLHRGWPAFVRDHYVECGDFLIFRYDGDL  94



>ref|XP_003589266.1| B3 domain-containing protein [Medicago truncatula]
 gb|AES59517.1| B3 DNA-binding domain protein [Medicago truncatula]
Length=596

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 62/88 (70%), Gaps = 0/88 (0%)
 Frame = +2

Query  275  NGRKPHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLF  454
            N RKPHF H FNPS +S+ L++P  F   M+G T G+ SL GPSGNTW V + + D  LF
Sbjct  10   NVRKPHFYHLFNPSSTSQSLRVPDGFVHQMEGATCGLVSLTGPSGNTWQVRLVEQDNHLF  69

Query  455  FHDGWTVFVKDHCLEYGDSLVFRYDGDL  538
            FH GW+ FV DH L+YGD LVFRY+G L
Sbjct  70   FHHGWSTFVGDHHLQYGDLLVFRYEGHL  97



>ref|XP_004291931.1| PREDICTED: B3 domain-containing protein Os11g0197600-like [Fragaria 
vesca subsp. vesca]
Length=517

 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 66/96 (69%), Gaps = 0/96 (0%)
 Frame = +2

Query  251  QAFGAEMSNGRKPHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGV  430
            +A    M N R+PHF   F+  +SS++LKIP +F  HM+G TSG+  L GPSGN W V +
Sbjct  4    EALRVMMPNPRRPHFFAFFSADLSSDRLKIPERFMIHMEGRTSGVVVLSGPSGNVWNVHL  63

Query  431  SQLDGGLFFHDGWTVFVKDHCLEYGDSLVFRYDGDL  538
             + +G LFFH GW  FV+DH LE GD L+FRYDG+L
Sbjct  64   IEQNGDLFFHYGWPAFVRDHSLECGDFLIFRYDGEL  99



>ref|XP_009364120.1| PREDICTED: B3 domain-containing protein Os01g0723500-like [Pyrus 
x bretschneideri]
Length=561

 Score =   111 bits (278),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 65/94 (69%), Gaps = 0/94 (0%)
 Frame = +2

Query  257  FGAEMSNGRKPHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQ  436
               E  N R PHF   ++  +SSE+LKIP +F +HM+G TSG+ +L GPSG+ W V + +
Sbjct  1    MAEEAGNVRSPHFFAFYSADLSSERLKIPERFMRHMEGKTSGLVALFGPSGSAWSVELIE  60

Query  437  LDGGLFFHDGWTVFVKDHCLEYGDSLVFRYDGDL  538
             +GGLF H GW  FV+DH +E GD L+FRYDGDL
Sbjct  61   QNGGLFLHHGWPAFVRDHYVECGDFLIFRYDGDL  94



>ref|XP_008357222.1| PREDICTED: uncharacterized protein LOC103420963 [Malus domestica]
Length=739

 Score =   109 bits (273),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 63/94 (67%), Gaps = 0/94 (0%)
 Frame = +2

Query  257  FGAEMSNGRKPHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQ  436
               E  N R PHF   ++  +SSE+LKIP +F +HM+G TSG+  L GPSG+ W V + Q
Sbjct  1    MAKEARNVRSPHFFAFYSADLSSERLKIPDRFMRHMEGRTSGLVLLFGPSGSAWSVELIQ  60

Query  437  LDGGLFFHDGWTVFVKDHCLEYGDSLVFRYDGDL  538
             +GGLF H GW  FV+DH +E GD LVFRYD DL
Sbjct  61   QNGGLFLHHGWPAFVRDHYVECGDFLVFRYDSDL  94



>ref|XP_009365640.1| PREDICTED: B3 domain-containing protein Os01g0723500-like [Pyrus 
x bretschneideri]
Length=565

 Score =   107 bits (267),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 62/94 (66%), Gaps = 0/94 (0%)
 Frame = +2

Query  257  FGAEMSNGRKPHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQ  436
               E  N R PHF   ++  +SSE+LKIP +F +HM+G TSG+  L GPSG+ W V + Q
Sbjct  1    MAKEARNVRSPHFFAFYSADLSSERLKIPDRFMRHMEGRTSGLVLLFGPSGSAWSVELIQ  60

Query  437  LDGGLFFHDGWTVFVKDHCLEYGDSLVFRYDGDL  538
             +GGLF H GW  FV+DH +E GD LVF YD DL
Sbjct  61   QNGGLFLHHGWPAFVRDHYVECGDFLVFSYDADL  94



>gb|KCW68795.1| hypothetical protein EUGRSUZ_F02399 [Eucalyptus grandis]
Length=508

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 66/91 (73%), Gaps = 0/91 (0%)
 Frame = +2

Query  266  EMSNGRKPHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDG  445
            +M NG++PHF   ++ S+SS +LKIP KF KHM+G  SG+A L GPSGNTW+V + + + 
Sbjct  9    KMPNGKRPHFFEIYSSSVSSRRLKIPDKFVKHMEGWMSGLALLEGPSGNTWHVELIEENH  68

Query  446  GLFFHDGWTVFVKDHCLEYGDSLVFRYDGDL  538
             LF + GW  F++DH +  GD LVFR+DG+L
Sbjct  69   ELFLNSGWHSFIRDHSIVSGDLLVFRHDGNL  99



>gb|KCW68798.1| hypothetical protein EUGRSUZ_F02399 [Eucalyptus grandis]
Length=506

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 66/91 (73%), Gaps = 0/91 (0%)
 Frame = +2

Query  266  EMSNGRKPHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDG  445
            +M NG++PHF   ++ S+SS +LKIP KF KHM+G  SG+A L GPSGNTW+V + + + 
Sbjct  9    KMPNGKRPHFFEIYSSSVSSRRLKIPDKFVKHMEGWMSGLALLEGPSGNTWHVELIEENH  68

Query  446  GLFFHDGWTVFVKDHCLEYGDSLVFRYDGDL  538
             LF + GW  F++DH +  GD LVFR+DG+L
Sbjct  69   ELFLNSGWHSFIRDHSIVSGDLLVFRHDGNL  99



>ref|XP_002510291.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF52478.1| conserved hypothetical protein [Ricinus communis]
Length=567

 Score =   106 bits (264),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 45/91 (49%), Positives = 64/91 (70%), Gaps = 0/91 (0%)
 Frame = +2

Query  266  EMSNGRKPHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDG  445
            E+ N R+P F   F+ ++SS++L+IP++F +H++G TSG  SL GPSGN W V + Q   
Sbjct  9    ELINARRPCFFEIFSSNLSSDRLRIPARFTRHLEGRTSGSVSLTGPSGNIWTVNLIQQSE  68

Query  446  GLFFHDGWTVFVKDHCLEYGDSLVFRYDGDL  538
             +FF  GW VFVKDH +  GD L+FR+DG+L
Sbjct  69   DIFFDHGWPVFVKDHFIACGDLLLFRFDGEL  99



>ref|XP_010061800.1| PREDICTED: B3 domain-containing protein Os11g0197600-like [Eucalyptus 
grandis]
 ref|XP_010061801.1| PREDICTED: B3 domain-containing protein Os11g0197600-like [Eucalyptus 
grandis]
 gb|KCW68796.1| hypothetical protein EUGRSUZ_F02399 [Eucalyptus grandis]
 gb|KCW68797.1| hypothetical protein EUGRSUZ_F02399 [Eucalyptus grandis]
Length=585

 Score =   105 bits (262),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 66/91 (73%), Gaps = 0/91 (0%)
 Frame = +2

Query  266  EMSNGRKPHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDG  445
            +M NG++PHF   ++ S+SS +LKIP KF KHM+G  SG+A L GPSGNTW+V + + + 
Sbjct  9    KMPNGKRPHFFEIYSSSVSSRRLKIPDKFVKHMEGWMSGLALLEGPSGNTWHVELIEENH  68

Query  446  GLFFHDGWTVFVKDHCLEYGDSLVFRYDGDL  538
             LF + GW  F++DH +  GD LVFR+DG+L
Sbjct  69   ELFLNSGWHSFIRDHSIVSGDLLVFRHDGNL  99



>ref|XP_006473396.1| PREDICTED: B3 domain-containing protein LOC_Os12g40080-like isoform 
X1 [Citrus sinensis]
 ref|XP_006473397.1| PREDICTED: B3 domain-containing protein LOC_Os12g40080-like isoform 
X2 [Citrus sinensis]
 ref|XP_006473398.1| PREDICTED: B3 domain-containing protein LOC_Os12g40080-like isoform 
X3 [Citrus sinensis]
 ref|XP_006473399.1| PREDICTED: B3 domain-containing protein LOC_Os12g40080-like isoform 
X4 [Citrus sinensis]
Length=554

 Score =   101 bits (252),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 43/86 (50%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = +2

Query  281  RKPHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFH  460
            R+P F + F+ ++S+E LK+P +F +HM+G TSG  +L+GPS +TW++ + Q D  LFF 
Sbjct  11   RRPCFFNIFSSNLSAECLKLPLQFVRHMEGRTSGSVTLIGPSWDTWHIDLIQQDDNLFFD  70

Query  461  DGWTVFVKDHCLEYGDSLVFRYDGDL  538
             GW VF++D+ +E GD LVFRYDG+L
Sbjct  71   KGWPVFLRDNFIECGDLLVFRYDGEL  96



>gb|KGN59902.1| hypothetical protein Csa_3G852510 [Cucumis sativus]
Length=575

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/92 (48%), Positives = 61/92 (66%), Gaps = 0/92 (0%)
 Frame = +2

Query  266  EMSNGRKPHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDG  445
            EM   R+P F   ++ ++SSE+LK+P KF KH++ +      L+GPSG TW+V + Q + 
Sbjct  9    EMVAARRPSFYTFYSSTLSSERLKLPLKFVKHLEEIIGRSVVLIGPSGQTWHVNLIQEND  68

Query  446  GLFFHDGWTVFVKDHCLEYGDSLVFRYDGDLD  541
             LFF DGW  F +DH LE GD LVFRYD +L+
Sbjct  69   NLFFCDGWPTFARDHALECGDFLVFRYDSELN  100



>ref|XP_006434877.1| hypothetical protein CICLE_v10000881mg [Citrus clementina]
 gb|ESR48117.1| hypothetical protein CICLE_v10000881mg [Citrus clementina]
Length=395

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = +2

Query  281  RKPHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFH  460
            R+P F + F+ ++S+E LK+P +F +HM+G TSG  +L+GPS +TW++ + Q D  LFF 
Sbjct  11   RRPCFFNIFSSNLSAECLKLPLQFVRHMEGRTSGSVTLIGPSWDTWHIDLIQQDDNLFFD  70

Query  461  DGWTVFVKDHCLEYGDSLVFRYDGDL  538
             GW VF++D+ +E GD LVFRYDG+L
Sbjct  71   KGWPVFLRDNFIECGDLLVFRYDGEL  96



>ref|XP_004147830.1| PREDICTED: B3 domain-containing protein Os01g0723500-like [Cucumis 
sativus]
Length=580

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/92 (48%), Positives = 61/92 (66%), Gaps = 0/92 (0%)
 Frame = +2

Query  266  EMSNGRKPHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDG  445
            EM   R+P F   ++ ++SSE+LK+P KF KH++ +      L+GPSG TW+V + Q + 
Sbjct  9    EMVAARRPSFYTFYSSTLSSERLKLPLKFVKHLEEIIGRSVVLIGPSGQTWHVNLIQEND  68

Query  446  GLFFHDGWTVFVKDHCLEYGDSLVFRYDGDLD  541
             LFF DGW  F +DH LE GD LVFRYD +L+
Sbjct  69   NLFFCDGWPTFARDHALECGDFLVFRYDSELN  100



>ref|XP_004499102.1| PREDICTED: B3 domain-containing protein Os01g0723500-like [Cicer 
arietinum]
Length=595

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 60/88 (68%), Gaps = 0/88 (0%)
 Frame = +2

Query  275  NGRKPHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLF  454
            N R+PHF   ++ + SSE ++IP  F   M+G T G+ SL GPSGNTW V + + +  LF
Sbjct  10   NVRRPHFYEVYSLASSSETMRIPDGFICQMEGRTCGLVSLTGPSGNTWQVRLVEQNNYLF  69

Query  455  FHDGWTVFVKDHCLEYGDSLVFRYDGDL  538
            FH GW+ FV DH L+YGD LVFRY+G L
Sbjct  70   FHHGWSTFVGDHNLKYGDLLVFRYEGQL  97



>ref|XP_007160809.1| hypothetical protein PHAVU_001G018500g [Phaseolus vulgaris]
 ref|XP_007160810.1| hypothetical protein PHAVU_001G018500g [Phaseolus vulgaris]
 gb|ESW32803.1| hypothetical protein PHAVU_001G018500g [Phaseolus vulgaris]
 gb|ESW32804.1| hypothetical protein PHAVU_001G018500g [Phaseolus vulgaris]
Length=559

 Score = 99.8 bits (247),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 49/88 (56%), Positives = 58/88 (66%), Gaps = 0/88 (0%)
 Frame = +2

Query  275  NGRKPHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLF  454
            N RKPHF   F+ + SS +LKIP  F   M+G T G  SL+GPSGN W V + + D  LF
Sbjct  10   NLRKPHFYEVFSSAFSSHRLKIPDGFVCRMEGRTYGSLSLIGPSGNVWTVQLLKQDNDLF  69

Query  455  FHDGWTVFVKDHCLEYGDSLVFRYDGDL  538
            FH GW+ FV DH LE GD LVFRY+G L
Sbjct  70   FHHGWSSFVVDHSLECGDLLVFRYEGHL  97



>ref|XP_007160811.1| hypothetical protein PHAVU_001G018500g [Phaseolus vulgaris]
 ref|XP_007160812.1| hypothetical protein PHAVU_001G018500g [Phaseolus vulgaris]
 gb|ESW32805.1| hypothetical protein PHAVU_001G018500g [Phaseolus vulgaris]
 gb|ESW32806.1| hypothetical protein PHAVU_001G018500g [Phaseolus vulgaris]
Length=593

 Score = 99.8 bits (247),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 49/88 (56%), Positives = 58/88 (66%), Gaps = 0/88 (0%)
 Frame = +2

Query  275  NGRKPHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLF  454
            N RKPHF   F+ + SS +LKIP  F   M+G T G  SL+GPSGN W V + + D  LF
Sbjct  10   NLRKPHFYEVFSSAFSSHRLKIPDGFVCRMEGRTYGSLSLIGPSGNVWTVQLLKQDNDLF  69

Query  455  FHDGWTVFVKDHCLEYGDSLVFRYDGDL  538
            FH GW+ FV DH LE GD LVFRY+G L
Sbjct  70   FHHGWSSFVVDHSLECGDLLVFRYEGHL  97



>ref|XP_006375016.1| hypothetical protein POPTR_0014s03610g [Populus trichocarpa]
 gb|ERP52813.1| hypothetical protein POPTR_0014s03610g [Populus trichocarpa]
Length=713

 Score = 99.8 bits (247),  Expect = 9e-21, Method: Composition-based stats.
 Identities = 43/86 (50%), Positives = 61/86 (71%), Gaps = 0/86 (0%)
 Frame = +2

Query  281  RKPHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFH  460
            R+P F   F+ ++SSE+L+IP  F KHM+G T G+ SL+GPSG+ W   ++Q +  + F 
Sbjct  15   RRPCFFVIFSSNLSSERLRIPVSFIKHMEGKTPGLVSLLGPSGDVWTADLTQENDDVLFS  74

Query  461  DGWTVFVKDHCLEYGDSLVFRYDGDL  538
            +GW+ FV+DH LE GD LVFRY G+L
Sbjct  75   NGWSEFVRDHFLECGDLLVFRYHGEL  100



>ref|XP_006434882.1| hypothetical protein CICLE_v10000881mg [Citrus clementina]
 ref|XP_006434883.1| hypothetical protein CICLE_v10000881mg [Citrus clementina]
 gb|ESR48122.1| hypothetical protein CICLE_v10000881mg [Citrus clementina]
 gb|ESR48123.1| hypothetical protein CICLE_v10000881mg [Citrus clementina]
Length=554

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = +2

Query  281  RKPHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFH  460
            R+P F + F+ ++S+E LK+P +F +HM+G TSG  +L+GPS +TW++ + Q D  LFF 
Sbjct  11   RRPCFFNIFSSNLSAECLKLPLQFVRHMEGRTSGSVTLIGPSWDTWHIDLIQQDDNLFFD  70

Query  461  DGWTVFVKDHCLEYGDSLVFRYDGDL  538
             GW VF++D+ +E GD LVFRYDG+L
Sbjct  71   KGWPVFLRDNFIECGDLLVFRYDGEL  96



>ref|XP_011030811.1| PREDICTED: B3 domain-containing protein Os01g0723500-like isoform 
X4 [Populus euphratica]
Length=619

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 43/85 (51%), Positives = 60/85 (71%), Gaps = 0/85 (0%)
 Frame = +2

Query  284  KPHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHD  463
            +P F   F+ ++SSE+L+IP  F KHM+G T G+ SL+GPSG+ W   ++Q +  L F +
Sbjct  16   RPCFFVIFSSNLSSERLRIPVSFIKHMEGKTPGLVSLLGPSGDVWTAELTQENDDLLFSN  75

Query  464  GWTVFVKDHCLEYGDSLVFRYDGDL  538
            GW+ FV+DH LE GD LVFRY G+L
Sbjct  76   GWSEFVRDHFLECGDLLVFRYHGEL  100



>ref|XP_011030803.1| PREDICTED: B3 domain-containing protein Os01g0723500-like isoform 
X3 [Populus euphratica]
Length=623

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 43/85 (51%), Positives = 60/85 (71%), Gaps = 0/85 (0%)
 Frame = +2

Query  284  KPHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHD  463
            +P F   F+ ++SSE+L+IP  F KHM+G T G+ SL+GPSG+ W   ++Q +  L F +
Sbjct  16   RPCFFVIFSSNLSSERLRIPVSFIKHMEGKTPGLVSLLGPSGDVWTAELTQENDDLLFSN  75

Query  464  GWTVFVKDHCLEYGDSLVFRYDGDL  538
            GW+ FV+DH LE GD LVFRY G+L
Sbjct  76   GWSEFVRDHFLECGDLLVFRYHGEL  100



>ref|XP_011030796.1| PREDICTED: B3 domain-containing protein Os01g0723500-like isoform 
X2 [Populus euphratica]
Length=624

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 43/85 (51%), Positives = 60/85 (71%), Gaps = 0/85 (0%)
 Frame = +2

Query  284  KPHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHD  463
            +P F   F+ ++SSE+L+IP  F KHM+G T G+ SL+GPSG+ W   ++Q +  L F +
Sbjct  16   RPCFFVIFSSNLSSERLRIPVSFIKHMEGKTPGLVSLLGPSGDVWTAELTQENDDLLFSN  75

Query  464  GWTVFVKDHCLEYGDSLVFRYDGDL  538
            GW+ FV+DH LE GD LVFRY G+L
Sbjct  76   GWSEFVRDHFLECGDLLVFRYHGEL  100



>ref|XP_011030771.1| PREDICTED: B3 domain-containing protein Os01g0723500-like isoform 
X1 [Populus euphratica]
 ref|XP_011030779.1| PREDICTED: B3 domain-containing protein Os01g0723500-like isoform 
X1 [Populus euphratica]
 ref|XP_011030787.1| PREDICTED: B3 domain-containing protein Os01g0723500-like isoform 
X1 [Populus euphratica]
Length=630

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 43/85 (51%), Positives = 60/85 (71%), Gaps = 0/85 (0%)
 Frame = +2

Query  284  KPHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHD  463
            +P F   F+ ++SSE+L+IP  F KHM+G T G+ SL+GPSG+ W   ++Q +  L F +
Sbjct  16   RPCFFVIFSSNLSSERLRIPVSFIKHMEGKTPGLVSLLGPSGDVWTAELTQENDDLLFSN  75

Query  464  GWTVFVKDHCLEYGDSLVFRYDGDL  538
            GW+ FV+DH LE GD LVFRY G+L
Sbjct  76   GWSEFVRDHFLECGDLLVFRYHGEL  100



>ref|XP_008454672.1| PREDICTED: B3 domain-containing protein Os01g0723500-like [Cucumis 
melo]
Length=574

 Score = 97.4 bits (241),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 42/92 (46%), Positives = 59/92 (64%), Gaps = 0/92 (0%)
 Frame = +2

Query  266  EMSNGRKPHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDG  445
            EM   R+P F   ++ ++ SE+LK+P KF KH++ +      L+GPSG TW V + Q + 
Sbjct  9    EMVAARRPSFYTFYSSTLCSERLKVPLKFVKHLEEIIGRSVVLIGPSGQTWLVNLIQEND  68

Query  446  GLFFHDGWTVFVKDHCLEYGDSLVFRYDGDLD  541
             LFF +GW  F +DH LE GD LVFRYD +L+
Sbjct  69   NLFFCEGWPTFARDHALECGDFLVFRYDSELN  100



>ref|XP_010263794.1| PREDICTED: B3 domain-containing protein Os11g0197600-like isoform 
X3 [Nelumbo nucifera]
Length=507

 Score = 94.7 bits (234),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 56/86 (65%), Gaps = 0/86 (0%)
 Frame = +2

Query  281  RKPHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFH  460
            R+PHF   F P ++SE+L+IP  F KH+ G TSG A L GP  N W V + +   GL+F 
Sbjct  11   RRPHFFKVFLPELNSERLQIPLGFLKHLKGQTSGTAYLTGPGKNVWRVDLVRRREGLYFE  70

Query  461  DGWTVFVKDHCLEYGDSLVFRYDGDL  538
             GW VF+ DH  ++GD  VFRYDG+L
Sbjct  71   HGWEVFLSDHSSQFGDFFVFRYDGNL  96



>ref|XP_010263793.1| PREDICTED: B3 domain-containing protein Os11g0197600-like isoform 
X2 [Nelumbo nucifera]
Length=519

 Score = 94.4 bits (233),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 56/86 (65%), Gaps = 0/86 (0%)
 Frame = +2

Query  281  RKPHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFH  460
            R+PHF   F P ++SE+L+IP  F KH+ G TSG A L GP  N W V + +   GL+F 
Sbjct  11   RRPHFFKVFLPELNSERLQIPLGFLKHLKGQTSGTAYLTGPGKNVWRVDLVRRREGLYFE  70

Query  461  DGWTVFVKDHCLEYGDSLVFRYDGDL  538
             GW VF+ DH  ++GD  VFRYDG+L
Sbjct  71   HGWEVFLSDHSSQFGDFFVFRYDGNL  96



>ref|XP_010263792.1| PREDICTED: B3 domain-containing protein Os11g0197600-like isoform 
X1 [Nelumbo nucifera]
Length=526

 Score = 94.4 bits (233),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 56/86 (65%), Gaps = 0/86 (0%)
 Frame = +2

Query  281  RKPHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFH  460
            R+PHF   F P ++SE+L+IP  F KH+ G TSG A L GP  N W V + +   GL+F 
Sbjct  11   RRPHFFKVFLPELNSERLQIPLGFLKHLKGQTSGTAYLTGPGKNVWRVDLVRRREGLYFE  70

Query  461  DGWTVFVKDHCLEYGDSLVFRYDGDL  538
             GW VF+ DH  ++GD  VFRYDG+L
Sbjct  71   HGWEVFLSDHSSQFGDFFVFRYDGNL  96



>ref|XP_003549416.2| PREDICTED: B3 domain-containing protein Os01g0723500-like [Glycine 
max]
Length=562

 Score = 94.4 bits (233),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 56/86 (65%), Gaps = 0/86 (0%)
 Frame = +2

Query  281  RKPHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFH  460
            RKPHF   ++ + SS +LK+P  F  HM+G T G  SL GPSG TW V + + +  LF H
Sbjct  3    RKPHFYEVYSSAFSSHRLKLPDGFVCHMEGRTYGSVSLTGPSGKTWTVQLIKQENDLFLH  62

Query  461  DGWTVFVKDHCLEYGDSLVFRYDGDL  538
             GW+ FV DH LE G+ LVFRY+G L
Sbjct  63   HGWSTFVVDHQLECGELLVFRYEGHL  88



>gb|KHN12748.1| B3 domain-containing protein [Glycine soja]
Length=561

 Score = 94.4 bits (233),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 56/86 (65%), Gaps = 0/86 (0%)
 Frame = +2

Query  281  RKPHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFH  460
            RKPHF   ++ + SS +LK+P  F  HM+G T G  SL GPSG TW V + + +  LF H
Sbjct  2    RKPHFYEVYSSAFSSHRLKLPDGFVCHMEGRTYGSVSLTGPSGKTWTVQLIKQENDLFLH  61

Query  461  DGWTVFVKDHCLEYGDSLVFRYDGDL  538
             GW+ FV DH LE G+ LVFRY+G L
Sbjct  62   HGWSTFVVDHQLECGELLVFRYEGHL  87



>ref|XP_006595949.1| PREDICTED: B3 domain-containing protein Os01g0723500-like [Glycine 
max]
Length=600

 Score = 94.0 bits (232),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 44/88 (50%), Positives = 57/88 (65%), Gaps = 0/88 (0%)
 Frame = +2

Query  275  NGRKPHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLF  454
            N RKPHF   ++ + SS +L++P  F  +M+G   G  SL GPSGN W V + + D  LF
Sbjct  10   NVRKPHFYEVYSSAFSSHRLRLPDGFVCYMEGRAYGSVSLTGPSGNIWTVQLIKQDNDLF  69

Query  455  FHDGWTVFVKDHCLEYGDSLVFRYDGDL  538
            FH GW+ FV DH LE G+ LVFRY+G L
Sbjct  70   FHHGWSTFVVDHRLECGELLVFRYEGHL  97



>ref|XP_007017394.1| AP2/B3-like transcriptional factor family protein, putative isoform 
1 [Theobroma cacao]
 gb|EOY14619.1| AP2/B3-like transcriptional factor family protein, putative isoform 
1 [Theobroma cacao]
Length=549

 Score = 93.6 bits (231),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 60/86 (70%), Gaps = 0/86 (0%)
 Frame = +2

Query  281  RKPHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFH  460
            R+PHFL+ F+ + S+ +LKIP  F ++++G TSG   L GPSG +W V + + D  L F 
Sbjct  6    RRPHFLNVFSSTSSANRLKIPVGFNRNLEGRTSGSVLLRGPSGYSWVVELVRKDDDLLFV  65

Query  461  DGWTVFVKDHCLEYGDSLVFRYDGDL  538
            +GW  FV+DH +E GD LVFRYDGDL
Sbjct  66   EGWADFVRDHSVECGDFLVFRYDGDL  91



>gb|KHN21020.1| B3 domain-containing protein [Glycine soja]
Length=600

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/88 (50%), Positives = 56/88 (64%), Gaps = 0/88 (0%)
 Frame = +2

Query  275  NGRKPHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLF  454
            N RKPHF   ++ + SS +L++P  F   M+G   G  SL GPSGN W V + + D  LF
Sbjct  10   NVRKPHFYEVYSSAFSSHRLRLPDGFVCCMEGRAYGSVSLTGPSGNIWTVQLIKQDNDLF  69

Query  455  FHDGWTVFVKDHCLEYGDSLVFRYDGDL  538
            FH GW+ FV DH LE G+ LVFRY+G L
Sbjct  70   FHHGWSTFVVDHRLECGELLVFRYEGHL  97



>gb|KJB29522.1| hypothetical protein B456_005G105400 [Gossypium raimondii]
 gb|KJB29526.1| hypothetical protein B456_005G105400 [Gossypium raimondii]
 gb|KJB29527.1| hypothetical protein B456_005G105400 [Gossypium raimondii]
Length=535

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 44/90 (49%), Positives = 58/90 (64%), Gaps = 0/90 (0%)
 Frame = +2

Query  269  MSNGRKPHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGG  448
            MS  R+PHFL+ F+ + S+  L+IP  F ++++G  S    L GPSG +W V + Q +  
Sbjct  1    MSKPRRPHFLNVFSSTSSANSLRIPVGFNRNLEGRVSASVLLKGPSGYSWNVKLVQRNDD  60

Query  449  LFFHDGWTVFVKDHCLEYGDSLVFRYDGDL  538
            L F +GW  FV DH LE GD LVFRYDGDL
Sbjct  61   LLFDEGWADFVADHSLECGDFLVFRYDGDL  90



>gb|KJB29524.1| hypothetical protein B456_005G105400 [Gossypium raimondii]
Length=534

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 44/90 (49%), Positives = 58/90 (64%), Gaps = 0/90 (0%)
 Frame = +2

Query  269  MSNGRKPHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGG  448
            MS  R+PHFL+ F+ + S+  L+IP  F ++++G  S    L GPSG +W V + Q +  
Sbjct  1    MSKPRRPHFLNVFSSTSSANSLRIPVGFNRNLEGRVSASVLLKGPSGYSWNVKLVQRNDD  60

Query  449  LFFHDGWTVFVKDHCLEYGDSLVFRYDGDL  538
            L F +GW  FV DH LE GD LVFRYDGDL
Sbjct  61   LLFDEGWADFVADHSLECGDFLVFRYDGDL  90



>gb|KJB29523.1| hypothetical protein B456_005G105400 [Gossypium raimondii]
Length=533

 Score = 91.7 bits (226),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 44/90 (49%), Positives = 58/90 (64%), Gaps = 0/90 (0%)
 Frame = +2

Query  269  MSNGRKPHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGG  448
            MS  R+PHFL+ F+ + S+  L+IP  F ++++G  S    L GPSG +W V + Q +  
Sbjct  1    MSKPRRPHFLNVFSSTSSANSLRIPVGFNRNLEGRVSASVLLKGPSGYSWNVKLVQRNDD  60

Query  449  LFFHDGWTVFVKDHCLEYGDSLVFRYDGDL  538
            L F +GW  FV DH LE GD LVFRYDGDL
Sbjct  61   LLFDEGWADFVADHSLECGDFLVFRYDGDL  90



>ref|XP_010255057.1| PREDICTED: B3 domain-containing protein At1g16640-like isoform 
X2 [Nelumbo nucifera]
Length=219

 Score = 88.2 bits (217),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 41/90 (46%), Positives = 56/90 (62%), Gaps = 0/90 (0%)
 Frame = +2

Query  266  EMSNGRKPHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDG  445
            ++S+  +P F   F PS SS+KL IP  F +H +GV      L  P+G TW V + Q++ 
Sbjct  8    KISSLERPQFFKIFYPSRSSDKLCIPPAFIEHFNGVVPNWTILKNPTGKTWSVELQQIEN  67

Query  446  GLFFHDGWTVFVKDHCLEYGDSLVFRYDGD  535
             +FF +GW  FVK H LE GD LVF+YDG+
Sbjct  68   DIFFQNGWQGFVKHHSLELGDFLVFKYDGN  97



>gb|KHG05520.1| hypothetical protein F383_30454 [Gossypium arboreum]
Length=553

 Score = 91.3 bits (225),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 44/90 (49%), Positives = 59/90 (66%), Gaps = 0/90 (0%)
 Frame = +2

Query  269  MSNGRKPHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGG  448
            MS  R+PHFL+ F+ + S+  L+IP  F ++++G  SG   L GPSG +W V + Q +  
Sbjct  1    MSKPRRPHFLNVFSSTSSANSLRIPVGFNRNLEGRGSGSVLLKGPSGYSWNVKLVQRNDD  60

Query  449  LFFHDGWTVFVKDHCLEYGDSLVFRYDGDL  538
            L F +GW  FV DH LE G+ LVFRYDGDL
Sbjct  61   LLFDEGWADFVADHSLECGEILVFRYDGDL  90



>ref|XP_010255056.1| PREDICTED: putative B3 domain-containing protein At5g66980 isoform 
X1 [Nelumbo nucifera]
Length=338

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/90 (46%), Positives = 56/90 (62%), Gaps = 0/90 (0%)
 Frame = +2

Query  266  EMSNGRKPHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDG  445
            ++S+  +P F   F PS SS+KL IP  F +H +GV      L  P+G TW V + Q++ 
Sbjct  8    KISSLERPQFFKIFYPSRSSDKLCIPPAFIEHFNGVVPNWTILKNPTGKTWSVELQQIEN  67

Query  446  GLFFHDGWTVFVKDHCLEYGDSLVFRYDGD  535
             +FF +GW  FVK H LE GD LVF+YDG+
Sbjct  68   DIFFQNGWQGFVKHHSLELGDFLVFKYDGN  97



>ref|XP_010255065.1| PREDICTED: B3 domain-containing protein Os01g0723500-like isoform 
X1 [Nelumbo nucifera]
Length=547

 Score = 87.8 bits (216),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 43/90 (48%), Positives = 55/90 (61%), Gaps = 2/90 (2%)
 Frame = +2

Query  275  NGRKPHFLHGF--NPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGG  448
            +GR P F   F   P+I+ E+L+IP  F KH+ G  SG   L GPSGN W V +++   G
Sbjct  9    SGRHPCFFKVFLPKPNINPERLRIPFGFLKHIKGEGSGTVWLRGPSGNMWRVNLTKNPDG  68

Query  449  LFFHDGWTVFVKDHCLEYGDSLVFRYDGDL  538
             FF DGW VF+KDH  + GD  VFRY G+ 
Sbjct  69   WFFEDGWEVFLKDHISKPGDFFVFRYIGNF  98



>ref|XP_010924500.1| PREDICTED: B3 domain-containing protein Os11g0197600-like isoform 
X9 [Elaeis guineensis]
Length=329

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 51/84 (61%), Gaps = 0/84 (0%)
 Frame = +2

Query  287  PHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDG  466
            PHF   + P +SS+ LKIP  F K+++    G  SL GPSG TW V   +   GL F +G
Sbjct  6    PHFFKVYFPELSSDHLKIPPAFRKYIEHELPGTVSLKGPSGGTWNVEFVKSSKGLLFANG  65

Query  467  WTVFVKDHCLEYGDSLVFRYDGDL  538
            W  FV DH +E GD LVFRYDG L
Sbjct  66   WKKFVADHSIELGDFLVFRYDGGL  89



>ref|XP_010924491.1| PREDICTED: B3 domain-containing protein Os11g0197600-like isoform 
X8 [Elaeis guineensis]
Length=337

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 51/84 (61%), Gaps = 0/84 (0%)
 Frame = +2

Query  287  PHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDG  466
            PHF   + P +SS+ LKIP  F K+++    G  SL GPSG TW V   +   GL F +G
Sbjct  6    PHFFKVYFPELSSDHLKIPPAFRKYIEHELPGTVSLKGPSGGTWNVEFVKSSKGLLFANG  65

Query  467  WTVFVKDHCLEYGDSLVFRYDGDL  538
            W  FV DH +E GD LVFRYDG L
Sbjct  66   WKKFVADHSIELGDFLVFRYDGGL  89



>ref|XP_010924483.1| PREDICTED: B3 domain-containing protein Os11g0197600-like isoform 
X7 [Elaeis guineensis]
Length=389

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 51/84 (61%), Gaps = 0/84 (0%)
 Frame = +2

Query  287  PHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDG  466
            PHF   + P +SS+ LKIP  F K+++    G  SL GPSG TW V   +   GL F +G
Sbjct  6    PHFFKVYFPELSSDHLKIPPAFRKYIEHELPGTVSLKGPSGGTWNVEFVKSSKGLLFANG  65

Query  467  WTVFVKDHCLEYGDSLVFRYDGDL  538
            W  FV DH +E GD LVFRYDG L
Sbjct  66   WKKFVADHSIELGDFLVFRYDGGL  89



>ref|XP_008787670.1| PREDICTED: B3 domain-containing protein Os11g0197600-like isoform 
X4 [Phoenix dactylifera]
Length=372

 Score = 84.3 bits (207),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 51/84 (61%), Gaps = 0/84 (0%)
 Frame = +2

Query  287  PHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDG  466
            PHF   + P +SS+ LKIP  F ++++    G  SL GPSG TW V   +   GL F +G
Sbjct  6    PHFFKVYFPQLSSDHLKIPPAFREYIEHELPGTVSLKGPSGGTWNVEFVKTSKGLLFANG  65

Query  467  WTVFVKDHCLEYGDSLVFRYDGDL  538
            W  FV DH +E GD LVFRYDG L
Sbjct  66   WKKFVADHSIELGDFLVFRYDGGL  89



>ref|XP_010924476.1| PREDICTED: B3 domain-containing protein Os11g0197600-like isoform 
X6 [Elaeis guineensis]
Length=411

 Score = 84.7 bits (208),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 51/84 (61%), Gaps = 0/84 (0%)
 Frame = +2

Query  287  PHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDG  466
            PHF   + P +SS+ LKIP  F K+++    G  SL GPSG TW V   +   GL F +G
Sbjct  6    PHFFKVYFPELSSDHLKIPPAFRKYIEHELPGTVSLKGPSGGTWNVEFVKSSKGLLFANG  65

Query  467  WTVFVKDHCLEYGDSLVFRYDGDL  538
            W  FV DH +E GD LVFRYDG L
Sbjct  66   WKKFVADHSIELGDFLVFRYDGGL  89



>ref|XP_010924451.1| PREDICTED: B3 domain-containing protein Os11g0197600-like isoform 
X3 [Elaeis guineensis]
Length=455

 Score = 85.1 bits (209),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 51/84 (61%), Gaps = 0/84 (0%)
 Frame = +2

Query  287  PHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDG  466
            PHF   + P +SS+ LKIP  F K+++    G  SL GPSG TW V   +   GL F +G
Sbjct  6    PHFFKVYFPELSSDHLKIPPAFRKYIEHELPGTVSLKGPSGGTWNVEFVKSSKGLLFANG  65

Query  467  WTVFVKDHCLEYGDSLVFRYDGDL  538
            W  FV DH +E GD LVFRYDG L
Sbjct  66   WKKFVADHSIELGDFLVFRYDGGL  89



>ref|XP_010924459.1| PREDICTED: B3 domain-containing protein Os11g0197600-like isoform 
X4 [Elaeis guineensis]
Length=454

 Score = 85.1 bits (209),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 51/84 (61%), Gaps = 0/84 (0%)
 Frame = +2

Query  287  PHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDG  466
            PHF   + P +SS+ LKIP  F K+++    G  SL GPSG TW V   +   GL F +G
Sbjct  6    PHFFKVYFPELSSDHLKIPPAFRKYIEHELPGTVSLKGPSGGTWNVEFVKSSKGLLFANG  65

Query  467  WTVFVKDHCLEYGDSLVFRYDGDL  538
            W  FV DH +E GD LVFRYDG L
Sbjct  66   WKKFVADHSIELGDFLVFRYDGGL  89



>ref|XP_010924468.1| PREDICTED: B3 domain-containing protein Os11g0197600-like isoform 
X5 [Elaeis guineensis]
Length=451

 Score = 85.1 bits (209),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 51/84 (61%), Gaps = 0/84 (0%)
 Frame = +2

Query  287  PHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDG  466
            PHF   + P +SS+ LKIP  F K+++    G  SL GPSG TW V   +   GL F +G
Sbjct  6    PHFFKVYFPELSSDHLKIPPAFRKYIEHELPGTVSLKGPSGGTWNVEFVKSSKGLLFANG  65

Query  467  WTVFVKDHCLEYGDSLVFRYDGDL  538
            W  FV DH +E GD LVFRYDG L
Sbjct  66   WKKFVADHSIELGDFLVFRYDGGL  89



>ref|XP_010924436.1| PREDICTED: B3 domain-containing protein Os11g0197600-like isoform 
X1 [Elaeis guineensis]
Length=463

 Score = 85.1 bits (209),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 51/84 (61%), Gaps = 0/84 (0%)
 Frame = +2

Query  287  PHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDG  466
            PHF   + P +SS+ LKIP  F K+++    G  SL GPSG TW V   +   GL F +G
Sbjct  6    PHFFKVYFPELSSDHLKIPPAFRKYIEHELPGTVSLKGPSGGTWNVEFVKSSKGLLFANG  65

Query  467  WTVFVKDHCLEYGDSLVFRYDGDL  538
            W  FV DH +E GD LVFRYDG L
Sbjct  66   WKKFVADHSIELGDFLVFRYDGGL  89



>ref|XP_010924443.1| PREDICTED: B3 domain-containing protein Os11g0197600-like isoform 
X2 [Elaeis guineensis]
Length=462

 Score = 85.1 bits (209),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 51/84 (61%), Gaps = 0/84 (0%)
 Frame = +2

Query  287  PHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDG  466
            PHF   + P +SS+ LKIP  F K+++    G  SL GPSG TW V   +   GL F +G
Sbjct  6    PHFFKVYFPELSSDHLKIPPAFRKYIEHELPGTVSLKGPSGGTWNVEFVKSSKGLLFANG  65

Query  467  WTVFVKDHCLEYGDSLVFRYDGDL  538
            W  FV DH +E GD LVFRYDG L
Sbjct  66   WKKFVADHSIELGDFLVFRYDGGL  89



>ref|XP_008787669.1| PREDICTED: B3 domain-containing protein Os11g0197600-like isoform 
X3 [Phoenix dactylifera]
Length=444

 Score = 84.3 bits (207),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 51/84 (61%), Gaps = 0/84 (0%)
 Frame = +2

Query  287  PHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDG  466
            PHF   + P +SS+ LKIP  F ++++    G  SL GPSG TW V   +   GL F +G
Sbjct  6    PHFFKVYFPQLSSDHLKIPPAFREYIEHELPGTVSLKGPSGGTWNVEFVKTSKGLLFANG  65

Query  467  WTVFVKDHCLEYGDSLVFRYDGDL  538
            W  FV DH +E GD LVFRYDG L
Sbjct  66   WKKFVADHSIELGDFLVFRYDGGL  89



>ref|XP_008787668.1| PREDICTED: B3 domain-containing protein Os11g0197600-like isoform 
X2 [Phoenix dactylifera]
Length=455

 Score = 84.3 bits (207),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 51/84 (61%), Gaps = 0/84 (0%)
 Frame = +2

Query  287  PHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDG  466
            PHF   + P +SS+ LKIP  F ++++    G  SL GPSG TW V   +   GL F +G
Sbjct  6    PHFFKVYFPQLSSDHLKIPPAFREYIEHELPGTVSLKGPSGGTWNVEFVKTSKGLLFANG  65

Query  467  WTVFVKDHCLEYGDSLVFRYDGDL  538
            W  FV DH +E GD LVFRYDG L
Sbjct  66   WKKFVADHSIELGDFLVFRYDGGL  89



>ref|XP_008787667.1| PREDICTED: B3 domain-containing protein Os11g0197600-like isoform 
X1 [Phoenix dactylifera]
Length=456

 Score = 84.3 bits (207),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 51/84 (61%), Gaps = 0/84 (0%)
 Frame = +2

Query  287  PHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDG  466
            PHF   + P +SS+ LKIP  F ++++    G  SL GPSG TW V   +   GL F +G
Sbjct  6    PHFFKVYFPQLSSDHLKIPPAFREYIEHELPGTVSLKGPSGGTWNVEFVKTSKGLLFANG  65

Query  467  WTVFVKDHCLEYGDSLVFRYDGDL  538
            W  FV DH +E GD LVFRYDG L
Sbjct  66   WKKFVADHSIELGDFLVFRYDGGL  89



>ref|XP_006375017.1| hypothetical protein POPTR_0014s03610g [Populus trichocarpa]
 gb|ERP52814.1| hypothetical protein POPTR_0014s03610g [Populus trichocarpa]
Length=735

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 43/108 (40%), Positives = 61/108 (56%), Gaps = 22/108 (20%)
 Frame = +2

Query  281  RKPHFLHGFNPSISSEKL----------------------KIPSKFAKHMDGVTSGMASL  394
            R+P F   F+ ++SSE+L                      +IP  F KHM+G T G+ SL
Sbjct  15   RRPCFFVIFSSNLSSERLILDLLDISLITGLTQSKLFTWQRIPVSFIKHMEGKTPGLVSL  74

Query  395  VGPSGNTWYVGVSQLDGGLFFHDGWTVFVKDHCLEYGDSLVFRYDGDL  538
            +GPSG+ W   ++Q +  + F +GW+ FV+DH LE GD LVFRY G+L
Sbjct  75   LGPSGDVWTADLTQENDDVLFSNGWSEFVRDHFLECGDLLVFRYHGEL  122



>ref|XP_010255069.1| PREDICTED: putative B3 domain-containing protein Os03g0621600 
isoform X4 [Nelumbo nucifera]
Length=466

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 56/97 (58%), Gaps = 2/97 (2%)
 Frame = +2

Query  254  AFGAEMSNGRKPHFLHGF--NPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVG  427
            A      +GR P F   F   P+I+ E+L+IP  F KH+ G  SG   L GPSGN W V 
Sbjct  2    ARSNRFCSGRHPCFFKVFLPKPNINPERLRIPFGFLKHIKGEGSGTVWLRGPSGNMWRVN  61

Query  428  VSQLDGGLFFHDGWTVFVKDHCLEYGDSLVFRYDGDL  538
            +++   G FF DGW VF+KDH  + GD  VFRY G+ 
Sbjct  62   LTKNPDGWFFEDGWEVFLKDHISKPGDFFVFRYIGNF  98



>ref|XP_010255068.1| PREDICTED: putative B3 domain-containing protein Os03g0621600 
isoform X3 [Nelumbo nucifera]
Length=473

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 56/97 (58%), Gaps = 2/97 (2%)
 Frame = +2

Query  254  AFGAEMSNGRKPHFLHGF--NPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVG  427
            A      +GR P F   F   P+I+ E+L+IP  F KH+ G  SG   L GPSGN W V 
Sbjct  2    ARSNRFCSGRHPCFFKVFLPKPNINPERLRIPFGFLKHIKGEGSGTVWLRGPSGNMWRVN  61

Query  428  VSQLDGGLFFHDGWTVFVKDHCLEYGDSLVFRYDGDL  538
            +++   G FF DGW VF+KDH  + GD  VFRY G+ 
Sbjct  62   LTKNPDGWFFEDGWEVFLKDHISKPGDFFVFRYIGNF  98



>ref|XP_010255066.1| PREDICTED: putative B3 domain-containing protein Os03g0621600 
isoform X2 [Nelumbo nucifera]
 ref|XP_010255067.1| PREDICTED: putative B3 domain-containing protein Os03g0621600 
isoform X2 [Nelumbo nucifera]
Length=491

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 56/97 (58%), Gaps = 2/97 (2%)
 Frame = +2

Query  254  AFGAEMSNGRKPHFLHGF--NPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVG  427
            A      +GR P F   F   P+I+ E+L+IP  F KH+ G  SG   L GPSGN W V 
Sbjct  2    ARSNRFCSGRHPCFFKVFLPKPNINPERLRIPFGFLKHIKGEGSGTVWLRGPSGNMWRVN  61

Query  428  VSQLDGGLFFHDGWTVFVKDHCLEYGDSLVFRYDGDL  538
            +++   G FF DGW VF+KDH  + GD  VFRY G+ 
Sbjct  62   LTKNPDGWFFEDGWEVFLKDHISKPGDFFVFRYIGNF  98



>ref|XP_009389534.1| PREDICTED: B3 domain-containing protein Os11g0197600-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=410

 Score = 82.0 bits (201),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 48/82 (59%), Gaps = 0/82 (0%)
 Frame = +2

Query  287  PHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDG  466
            PHF+  F P + SE LKIP  F  H++  + GM SL GPSG  W V +     GL F  G
Sbjct  11   PHFVKVFFPELCSEYLKIPPAFRVHLENESLGMVSLRGPSGKIWDVELVDSSNGLRFESG  70

Query  467  WTVFVKDHCLEYGDSLVFRYDG  532
            W  FV DH +E GD LVFR +G
Sbjct  71   WKEFVVDHAMEIGDFLVFRLEG  92



>gb|EMT26018.1| B3 domain-containing protein [Aegilops tauschii]
Length=557

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 41/101 (41%), Positives = 55/101 (54%), Gaps = 5/101 (5%)
 Frame = +2

Query  245  RTQAFGAEMSNGRK-----PHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSG  409
            R +  G E  NG +       F   F P +  E+LKIP  F +++    +G+ SL G SG
Sbjct  8    RAREKGKEKENGGEGGKFGQQFARVFLPQLYGERLKIPPSFNQYLQDQPTGVVSLKGQSG  67

Query  410  NTWYVGVSQLDGGLFFHDGWTVFVKDHCLEYGDSLVFRYDG  532
            NTW   ++  + GLFF  GW  FV+DH +E G  L FRYDG
Sbjct  68   NTWLAELASDNEGLFFVKGWKEFVRDHSIEMGHFLTFRYDG  108



>ref|XP_004978926.1| PREDICTED: B3 domain-containing protein Os11g0197600-like [Setaria 
italica]
Length=475

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 48/81 (59%), Gaps = 0/81 (0%)
 Frame = +2

Query  290  HFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDGW  469
             F   F P  S E+LKIP+ F +H+    +G+ SL GPSGNTW   ++    GLFF  GW
Sbjct  106  QFFKIFFPDQSRERLKIPTAFHQHLKEQPTGLVSLKGPSGNTWQAVLTSDSEGLFFEQGW  165

Query  470  TVFVKDHCLEYGDSLVFRYDG  532
              FV DH ++ G  LVF YDG
Sbjct  166  KEFVTDHSVKQGHFLVFTYDG  186



>ref|XP_008226602.1| PREDICTED: putative B3 domain-containing protein At5g66980 [Prunus 
mume]
Length=294

 Score = 77.4 bits (189),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 45/68 (66%), Gaps = 0/68 (0%)
 Frame = +2

Query  332  LKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDGWTVFVKDHCLEYGDS  511
            L++P  F + +DG +    +L GP+G  W V + + + G FFHDGW  FV+DHCLE G+ 
Sbjct  27   LRLPPVFIEKLDGQSLPKCALRGPNGKLWTVELEERENGFFFHDGWQGFVRDHCLEIGNF  86

Query  512  LVFRYDGD  535
            LVF YDGD
Sbjct  87   LVFDYDGD  94



>ref|XP_008226600.1| PREDICTED: B3 domain-containing protein Os01g0723500-like [Prunus 
mume]
Length=296

 Score = 75.9 bits (185),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 46/70 (66%), Gaps = 0/70 (0%)
 Frame = +2

Query  323  SEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDGWTVFVKDHCLEY  502
            S++L+IP KF K+ +G +    +L GPS   W V + + +  LFF DGW  FVKDH LE+
Sbjct  23   SQRLRIPPKFIKNFNGQSLRKCALRGPSRQWWDVKLEERENSLFFRDGWQGFVKDHVLEF  82

Query  503  GDSLVFRYDG  532
            GD LVF Y+G
Sbjct  83   GDLLVFSYNG  92



>ref|XP_006839026.1| hypothetical protein AMTR_s00002p00272200 [Amborella trichopoda]
 gb|ERN01595.1| hypothetical protein AMTR_s00002p00272200 [Amborella trichopoda]
Length=494

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 51/85 (60%), Gaps = 1/85 (1%)
 Frame = +2

Query  284  KPHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHD  463
            +P FL       S E L +P +  KH++GV S  A L  PSG  W V + + + G FF +
Sbjct  26   RPRFLKEMAGDFSKE-LALPQELYKHINGVASERAILESPSGKLWLVELKKTEEGAFFQN  84

Query  464  GWTVFVKDHCLEYGDSLVFRYDGDL  538
            GW  F+K H ++ G+S+VFRYDG+L
Sbjct  85   GWKEFIKGHSVKLGESIVFRYDGNL  109



>ref|XP_007212879.1| hypothetical protein PRUPE_ppa021660mg [Prunus persica]
 gb|EMJ14078.1| hypothetical protein PRUPE_ppa021660mg [Prunus persica]
Length=166

 Score = 73.6 bits (179),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 45/69 (65%), Gaps = 1/69 (1%)
 Frame = +2

Query  332  LKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQL-DGGLFFHDGWTVFVKDHCLEYGD  508
            L++P  F + +DG +     L GP+G  W V + ++ + G FFHDGW  FV+DHCLE G+
Sbjct  27   LRLPPVFIEKLDGESLPKCDLRGPNGKLWTVELEEIRENGFFFHDGWQGFVRDHCLEIGN  86

Query  509  SLVFRYDGD  535
             LVF YDGD
Sbjct  87   FLVFDYDGD  95



>ref|XP_006840809.1| hypothetical protein AMTR_s00214p00019140 [Amborella trichopoda]
 gb|ERN02484.1| hypothetical protein AMTR_s00214p00019140 [Amborella trichopoda]
Length=222

 Score = 74.3 bits (181),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 45/72 (63%), Gaps = 0/72 (0%)
 Frame = +2

Query  323  SEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDGWTVFVKDHCLEY  502
            SE+L IP  F  +++   S    L GPSG+ W V + +  GG+ F +GW  FV DHCL+ 
Sbjct  30   SEQLSIPPAFRTYLEHEVSRKVFLKGPSGDVWPVDLKKTVGGMLFQNGWKDFVNDHCLQL  89

Query  503  GDSLVFRYDGDL  538
            G  LVFRYDGD+
Sbjct  90   GHFLVFRYDGDV  101



>ref|XP_010255054.1| PREDICTED: B3 domain-containing protein Os03g0622200-like isoform 
X2 [Nelumbo nucifera]
Length=234

 Score = 74.3 bits (181),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 51/96 (53%), Gaps = 4/96 (4%)
 Frame = +2

Query  242  GRTQAFGAEMSNGRKPHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWY  421
             R +AF  + S    PHF   F P  SSE+L++P  F KH +GV      L    G  W 
Sbjct  4    ARRRAFNHDKS----PHFFKVFFPDQSSERLRVPPPFIKHFNGVIPERVILRSRIGRFWS  59

Query  422  VGVSQLDGGLFFHDGWTVFVKDHCLEYGDSLVFRYD  529
            V ++Q +   FF DGW  FV+D+ L  G  LVFRY+
Sbjct  60   VEMAQDEDNWFFQDGWKEFVQDNSLRSGYFLVFRYN  95



>ref|XP_008226826.1| PREDICTED: putative B3 domain-containing protein Os04g0347400 
[Prunus mume]
Length=297

 Score = 74.7 bits (182),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 47/71 (66%), Gaps = 0/71 (0%)
 Frame = +2

Query  323  SEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDGWTVFVKDHCLEY  502
            S++L+IP KF K+ +       +L GPSG  W V + + + GLFF +GW  FVKDH LE 
Sbjct  24   SQRLRIPPKFVKNFNVRPLHKCALSGPSGIRWTVELEERENGLFFQNGWQGFVKDHHLED  83

Query  503  GDSLVFRYDGD  535
            GD LVF+YDG+
Sbjct  84   GDFLVFKYDGE  94



>dbj|BAJ97129.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=701

 Score = 77.0 bits (188),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 34/81 (42%), Positives = 47/81 (58%), Gaps = 0/81 (0%)
 Frame = +2

Query  290  HFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDGW  469
             F   F P +  ++LKIP  F +++    +G+ SL G SGNTW   ++  + G FF  GW
Sbjct  66   QFARVFLPQLYGDRLKIPPSFNQYLQNQPTGLVSLKGQSGNTWRAELASDNEGFFFVKGW  125

Query  470  TVFVKDHCLEYGDSLVFRYDG  532
              FV+DH +E G  L FRYDG
Sbjct  126  KEFVRDHSIETGHFLTFRYDG  146



>emb|CDP12499.1| unnamed protein product [Coffea canephora]
Length=337

 Score = 75.1 bits (183),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 51/87 (59%), Gaps = 0/87 (0%)
 Frame = +2

Query  275  NGRKPHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLF  454
            + R P F   F P+ S+E+LKIP  F K + G     A L    GN W V +++++   F
Sbjct  10   SNRIPAFFKAFIPNTSTERLKIPIAFTKMIRGSLPDKAFLRDRYGNIWPVELARIENATF  69

Query  455  FHDGWTVFVKDHCLEYGDSLVFRYDGD  535
            F +GW  FVKD+ +E GD LVF +DG+
Sbjct  70   FLEGWAKFVKDNSVELGDFLVFHFDGN  96



>ref|XP_009365669.1| PREDICTED: B3 domain-containing protein REM5-like [Pyrus x bretschneideri]
Length=265

 Score = 73.9 bits (180),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 45/70 (64%), Gaps = 0/70 (0%)
 Frame = +2

Query  323  SEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDGWTVFVKDHCLEY  502
            S+ L+IPS F K+  G +    +L  PSG+ W V + Q + GLFF  GW VFVKDH LE+
Sbjct  23   SKHLRIPSAFIKNFGGRSLRKCTLRNPSGDCWGVKLKQKEDGLFFRKGWKVFVKDHFLEH  82

Query  503  GDSLVFRYDG  532
            GD LVF Y G
Sbjct  83   GDFLVFEYRG  92



>ref|XP_007214340.1| hypothetical protein PRUPE_ppb025337mg, partial [Prunus persica]
 gb|EMJ15539.1| hypothetical protein PRUPE_ppb025337mg, partial [Prunus persica]
Length=160

 Score = 72.8 bits (177),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 46/71 (65%), Gaps = 0/71 (0%)
 Frame = +2

Query  323  SEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDGWTVFVKDHCLEY  502
            S+ L+IP  F K+ +G + G  SL GPSG    V + + + GLFF  GW  FVKDH LE 
Sbjct  24   SKHLRIPPAFIKNFNGGSLGKCSLRGPSGKGRAVELEERENGLFFSKGWQGFVKDHHLEV  83

Query  503  GDSLVFRYDGD  535
            G+ LVFRYDG+
Sbjct  84   GNFLVFRYDGE  94



>ref|XP_010255053.1| PREDICTED: putative B3 domain-containing protein At5g66980 isoform 
X1 [Nelumbo nucifera]
Length=307

 Score = 74.3 bits (181),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 51/96 (53%), Gaps = 4/96 (4%)
 Frame = +2

Query  242  GRTQAFGAEMSNGRKPHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWY  421
             R +AF  + S    PHF   F P  SSE+L++P  F KH +GV      L    G  W 
Sbjct  4    ARRRAFNHDKS----PHFFKVFFPDQSSERLRVPPPFIKHFNGVIPERVILRSRIGRFWS  59

Query  422  VGVSQLDGGLFFHDGWTVFVKDHCLEYGDSLVFRYD  529
            V ++Q +   FF DGW  FV+D+ L  G  LVFRY+
Sbjct  60   VEMAQDEDNWFFQDGWKEFVQDNSLRSGYFLVFRYN  95



>ref|XP_010237857.1| PREDICTED: B3 domain-containing protein Os11g0197600-like isoform 
X2 [Brachypodium distachyon]
Length=578

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 35/81 (43%), Positives = 46/81 (57%), Gaps = 0/81 (0%)
 Frame = +2

Query  290  HFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDGW  469
             F   F P    E+L+IP  F +++    +GM SL G SGN W   ++    GLFF +GW
Sbjct  78   QFFRVFLPQQYGERLRIPLSFNQYLRNQPAGMVSLKGQSGNIWLAELAVDTEGLFFANGW  137

Query  470  TVFVKDHCLEYGDSLVFRYDG  532
              FV+DH +E G  L FRYDG
Sbjct  138  KEFVRDHSIETGHFLTFRYDG  158



>ref|XP_003576206.1| PREDICTED: B3 domain-containing protein Os11g0197600-like isoform 
X1 [Brachypodium distachyon]
Length=582

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 35/81 (43%), Positives = 46/81 (57%), Gaps = 0/81 (0%)
 Frame = +2

Query  290  HFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDGW  469
             F   F P    E+L+IP  F +++    +GM SL G SGN W   ++    GLFF +GW
Sbjct  78   QFFRVFLPQQYGERLRIPLSFNQYLRNQPAGMVSLKGQSGNIWLAELAVDTEGLFFANGW  137

Query  470  TVFVKDHCLEYGDSLVFRYDG  532
              FV+DH +E G  L FRYDG
Sbjct  138  KEFVRDHSIETGHFLTFRYDG  158



>ref|XP_010026398.1| PREDICTED: putative B3 domain-containing protein At5g66980 [Eucalyptus 
grandis]
Length=162

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 52/92 (57%), Gaps = 1/92 (1%)
 Frame = +2

Query  263  AEMSNGRKP-HFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQL  439
            A+ S+   P  F   + PS SS +L IP  F KH+ GV    A L   +G +W +G++++
Sbjct  7    AKTSSSDMPLEFFKVYLPSFSSHQLLIPPDFVKHLKGVVPEKAFLKDTTGRSWPIGIAEV  66

Query  440  DGGLFFHDGWTVFVKDHCLEYGDSLVFRYDGD  535
               LF   GW  FV  H L++ D L+FRY+GD
Sbjct  67   GNKLFIKSGWRDFVIGHSLDFADFLIFRYNGD  98



>ref|XP_007017395.1| AP2/B3-like transcriptional factor family protein, putative isoform 
2, partial [Theobroma cacao]
 gb|EOY14620.1| AP2/B3-like transcriptional factor family protein, putative isoform 
2, partial [Theobroma cacao]
Length=524

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 46/68 (68%), Gaps = 0/68 (0%)
 Frame = +2

Query  335  KIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDGWTVFVKDHCLEYGDSL  514
            KIP  F ++++G TSG   L GPSG +W V + + D  L F +GW  FV+DH +E GD L
Sbjct  1    KIPVGFNRNLEGRTSGSVLLRGPSGYSWVVELVRKDDDLLFVEGWADFVRDHSVECGDFL  60

Query  515  VFRYDGDL  538
            VFRYDGDL
Sbjct  61   VFRYDGDL  68



>ref|XP_009769341.1| PREDICTED: B3 domain-containing protein REM20-like isoform X2 
[Nicotiana sylvestris]
Length=330

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 50/81 (62%), Gaps = 0/81 (0%)
 Frame = +2

Query  293  FLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDGWT  472
            F   F P  SS+KLKIP+ F ++ +G      SL    GN W +G+++    L+F DGW 
Sbjct  11   FFKLFYPENSSQKLKIPTAFTEYKNGKLPKRVSLRDRFGNVWPIGMAKKGRYLYFQDGWV  70

Query  473  VFVKDHCLEYGDSLVFRYDGD  535
             F++D+ LE+GD L+F YDG+
Sbjct  71   KFIEDNSLEFGDFLIFDYDGN  91



>ref|XP_004288671.1| PREDICTED: putative B3 domain-containing protein Os03g0621600 
isoform X1 [Fragaria vesca subsp. vesca]
Length=315

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/91 (43%), Positives = 53/91 (58%), Gaps = 3/91 (3%)
 Frame = +2

Query  269  MSNGRKPHFLHGFNPSISSEKLKIPSKFAKHM--DGVTSGMASLVGPSGNTWYVGVSQLD  442
            M+  RKP F        S ++L IP +F K++  +G+     +L GPSG      V   +
Sbjct  7    MNKCRKPSFFKVLIGDFS-KRLLIPPEFTKNLVWNGIFPHKCALRGPSGLLCAAEVESTE  65

Query  443  GGLFFHDGWTVFVKDHCLEYGDSLVFRYDGD  535
             G+FFH+GW  FVKDH LE GD L+FRYDG+
Sbjct  66   NGMFFHNGWECFVKDHHLELGDFLIFRYDGE  96



>ref|XP_011017257.1| PREDICTED: B3 domain-containing protein REM16-like [Populus euphratica]
 ref|XP_011017258.1| PREDICTED: B3 domain-containing protein REM16-like [Populus euphratica]
Length=433

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 51/85 (60%), Gaps = 6/85 (7%)
 Frame = +2

Query  290  HFLH-GFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDG  466
             FLH GF+     ++L IP  FA+H+        +L GPSG  W VG++  +  LFF+ G
Sbjct  28   QFLHSGFD-----QRLAIPEIFARHLRKKLPDTVNLKGPSGAAWEVGLTTYNNTLFFNHG  82

Query  467  WTVFVKDHCLEYGDSLVFRYDGDLD  541
            W  FVKDH LE  D L+F+Y+G+ D
Sbjct  83   WQEFVKDHALEENDFLIFKYNGESD  107



>ref|XP_002301205.2| transcriptional factor B3 family protein [Populus trichocarpa]
 gb|EEE80478.2| transcriptional factor B3 family protein [Populus trichocarpa]
Length=430

 Score = 74.3 bits (181),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 51/85 (60%), Gaps = 6/85 (7%)
 Frame = +2

Query  290  HFLH-GFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDG  466
             FLH GF+     ++L IP  FA+H+        +L GPSG  W VG++  +  LFF+ G
Sbjct  28   QFLHSGFD-----QRLAIPEIFARHLRKKLPDTVNLKGPSGAAWEVGLTTYNNTLFFNHG  82

Query  467  WTVFVKDHCLEYGDSLVFRYDGDLD  541
            W  FVKDH LE  D L+F+Y+G+ D
Sbjct  83   WQEFVKDHALEENDFLIFKYNGESD  107



>dbj|BAK04345.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=710

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 40/88 (45%), Positives = 51/88 (58%), Gaps = 3/88 (3%)
 Frame = +2

Query  275  NGRK--PHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGG  448
            NG+K  P F   F      E + IP  F K+++  T GM SL GPSGN W V ++++ G 
Sbjct  167  NGKKSCPQFFRVFMSDSFMEHVTIPLGFHKYLEECT-GMVSLRGPSGNKWSVELTKISGE  225

Query  449  LFFHDGWTVFVKDHCLEYGDSLVFRYDG  532
            L F  GW  F+ DH + YG  LVFRYDG
Sbjct  226  LCFARGWKEFLYDHRVRYGYLLVFRYDG  253



>ref|XP_004305410.1| PREDICTED: B3 domain-containing protein REM5-like [Fragaria vesca 
subsp. vesca]
 ref|XP_011466851.1| PREDICTED: B3 domain-containing protein REM5-like [Fragaria vesca 
subsp. vesca]
 ref|XP_011466852.1| PREDICTED: B3 domain-containing protein REM5-like [Fragaria vesca 
subsp. vesca]
 ref|XP_011466853.1| PREDICTED: B3 domain-containing protein REM5-like [Fragaria vesca 
subsp. vesca]
 ref|XP_011466854.1| PREDICTED: B3 domain-containing protein REM5-like [Fragaria vesca 
subsp. vesca]
 ref|XP_011466855.1| PREDICTED: B3 domain-containing protein REM5-like [Fragaria vesca 
subsp. vesca]
Length=241

 Score = 72.0 bits (175),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 44/71 (62%), Gaps = 2/71 (3%)
 Frame = +2

Query  323  SEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDGWTVFVKDHCLEY  502
            SEK+KIP  F  H +G    +  L GP+GN W V + + +   FFH GW  FVKD+ L+ 
Sbjct  19   SEKMKIPRAFVNHFNG--PALCQLEGPNGNCWDVKLEEKNNDFFFHKGWKKFVKDNFLDE  76

Query  503  GDSLVFRYDGD  535
            GD LVF YDG+
Sbjct  77   GDFLVFNYDGN  87



>gb|EMT26093.1| B3 domain-containing protein [Aegilops tauschii]
Length=1143

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 37/82 (45%), Positives = 49/82 (60%), Gaps = 1/82 (1%)
 Frame = +2

Query  287  PHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDG  466
            PHF      +   E + IP+ F K+++  T GM SL GPSGN W V ++++ G L F  G
Sbjct  314  PHFFRALISNSFMEHVTIPAGFHKYLEDCT-GMVSLRGPSGNKWPVELAKISGELCFARG  372

Query  467  WTVFVKDHCLEYGDSLVFRYDG  532
            W  F+ DH + YG  LVFRYDG
Sbjct  373  WKEFLSDHRVGYGYLLVFRYDG  394



>ref|XP_009769340.1| PREDICTED: B3 domain-containing protein At4g34400-like isoform 
X1 [Nicotiana sylvestris]
Length=375

 Score = 73.2 bits (178),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 50/81 (62%), Gaps = 0/81 (0%)
 Frame = +2

Query  293  FLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDGWT  472
            F   F P  SS+KLKIP+ F ++ +G      SL    GN W +G+++    L+F DGW 
Sbjct  11   FFKLFYPENSSQKLKIPTAFTEYKNGKLPKRVSLRDRFGNVWPIGMAKKGRYLYFQDGWV  70

Query  473  VFVKDHCLEYGDSLVFRYDGD  535
             F++D+ LE+GD L+F YDG+
Sbjct  71   KFIEDNSLEFGDFLIFDYDGN  91



>ref|XP_007224954.1| hypothetical protein PRUPE_ppa021314mg [Prunus persica]
 gb|EMJ26153.1| hypothetical protein PRUPE_ppa021314mg [Prunus persica]
Length=218

 Score = 71.6 bits (174),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 43/70 (61%), Gaps = 0/70 (0%)
 Frame = +2

Query  323  SEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDGWTVFVKDHCLEY  502
            S+ L+IP  F K+ +G   G  ++ GP+G  W V + Q   GLFFH GW  FVKDH +E 
Sbjct  24   SQHLRIPPAFIKNFNGRRLGKCTMRGPTGKCWAVELEQRRDGLFFHKGWPGFVKDHFIES  83

Query  503  GDSLVFRYDG  532
             D L+F YDG
Sbjct  84   EDFLIFDYDG  93



>ref|XP_006434875.1| hypothetical protein CICLE_v10000881mg [Citrus clementina]
 ref|XP_006434876.1| hypothetical protein CICLE_v10000881mg [Citrus clementina]
 gb|ESR48115.1| hypothetical protein CICLE_v10000881mg [Citrus clementina]
 gb|ESR48116.1| hypothetical protein CICLE_v10000881mg [Citrus clementina]
Length=358

 Score = 73.2 bits (178),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = +2

Query  362  MDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDGWTVFVKDHCLEYGDSLVFRYDGDL  538
            M+G TSG  +L+GPS +TW++ + Q D  LFF  GW VF++D+ +E GD LVFRYDG+L
Sbjct  1    MEGRTSGSVTLIGPSWDTWHIDLIQQDDNLFFDKGWPVFLRDNFIECGDLLVFRYDGEL  59



>ref|XP_002450488.1| hypothetical protein SORBIDRAFT_05g006090 [Sorghum bicolor]
 gb|EES09476.1| hypothetical protein SORBIDRAFT_05g006090 [Sorghum bicolor]
Length=443

 Score = 73.6 bits (179),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  287  PHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDG  466
            P F   F P +S E+LKIP  F +H+    +G  SL GPSG  W   ++      FF  G
Sbjct  57   PQFFKVFFPELSGERLKIPPMFRQHLQEQPTGPVSLRGPSGKKWQATLASESEAWFFEQG  116

Query  467  WTVFVKDHCLEYGDSLVFRYDG  532
            W  FV DH +  G  LVF YDG
Sbjct  117  WKEFVTDHSINKGYFLVFTYDG  138



>ref|XP_007214527.1| hypothetical protein PRUPE_ppa015343mg, partial [Prunus persica]
 gb|EMJ15726.1| hypothetical protein PRUPE_ppa015343mg, partial [Prunus persica]
Length=177

 Score = 70.9 bits (172),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 44/68 (65%), Gaps = 0/68 (0%)
 Frame = +2

Query  332  LKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDGWTVFVKDHCLEYGDS  511
            ++IP KF K+ +       +L GP+G  W V + + + GLFF DGW  FVKDH LE GD 
Sbjct  1    MRIPPKFVKNFNVRPLHKCALSGPTGIRWAVELEERENGLFFQDGWQGFVKDHHLEDGDF  60

Query  512  LVFRYDGD  535
            LVF+YDG+
Sbjct  61   LVFKYDGE  68



>ref|XP_010525640.1| PREDICTED: B3 domain-containing protein Os11g0197600-like [Tarenaya 
hassleriana]
Length=487

 Score = 73.6 bits (179),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = +2

Query  362  MDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDGWTVFVKDHCLEYGDSLVFRYDGD  535
            M+G  SG  SL+GPSGNTW+V +      LFF+ GW  FV+DH +E GDS+VFRY+G+
Sbjct  1    MEGRNSGWVSLLGPSGNTWHVELIHQGADLFFNQGWPAFVRDHYIECGDSMVFRYNGE  58



>ref|XP_007214051.1| hypothetical protein PRUPE_ppa017456mg, partial [Prunus persica]
 gb|EMJ15250.1| hypothetical protein PRUPE_ppa017456mg, partial [Prunus persica]
Length=198

 Score = 70.9 bits (172),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 43/67 (64%), Gaps = 0/67 (0%)
 Frame = +2

Query  335  KIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDGWTVFVKDHCLEYGDSL  514
            +IP KF K+ +       +L GPSG  W V + + + GLFF DGW  FVKDH LE GD L
Sbjct  1    RIPPKFVKNFNVRPLHKCALSGPSGIRWTVELEERENGLFFQDGWQGFVKDHHLEDGDFL  60

Query  515  VFRYDGD  535
            VF+YDG+
Sbjct  61   VFKYDGE  67



>gb|EMT00295.1| B3 domain-containing protein [Aegilops tauschii]
Length=774

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 37/83 (45%), Positives = 48/83 (58%), Gaps = 1/83 (1%)
 Frame = +2

Query  287  PHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDG  466
            P F      S S E+  IP    K+++  T G  SL GPSGN W V ++++ G L F  G
Sbjct  155  PQFFRSLMTSSSMEQETIPEDCHKYLEECT-GTVSLRGPSGNLWPVELAKISGELCFARG  213

Query  467  WTVFVKDHCLEYGDSLVFRYDGD  535
            W  F+ DHC+ YG  LVFRYDG+
Sbjct  214  WKEFLCDHCIVYGYLLVFRYDGN  236



>ref|XP_009389369.1| PREDICTED: B3 domain-containing protein Os01g0723500-like [Musa 
acuminata subsp. malaccensis]
Length=353

 Score = 72.4 bits (176),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 54/98 (55%), Gaps = 1/98 (1%)
 Frame = +2

Query  245  RTQAFGAEMSNGRKPHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYV  424
            ++Q    +    RKPHF        + ++L+IP KF KH+  V S  A L GPSG+ W+V
Sbjct  4    KSQKAKKKCLPTRKPHFFKVLLGDFA-QRLRIPPKFLKHISSVGSKKAILQGPSGSKWHV  62

Query  425  GVSQLDGGLFFHDGWTVFVKDHCLEYGDSLVFRYDGDL  538
             + +     F   GW  FVKDH L   + LVF+YDGD+
Sbjct  63   ELGKDMKDTFLTTGWPKFVKDHSLREYEFLVFQYDGDM  100



>ref|XP_006473400.1| PREDICTED: B3 domain-containing protein LOC_Os12g40080-like isoform 
X5 [Citrus sinensis]
Length=517

 Score = 73.2 bits (178),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = +2

Query  362  MDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDGWTVFVKDHCLEYGDSLVFRYDGDL  538
            M+G TSG  +L+GPS +TW++ + Q D  LFF  GW VF++D+ +E GD LVFRYDG+L
Sbjct  1    MEGRTSGSVTLIGPSWDTWHIDLIQQDDNLFFDKGWPVFLRDNFIECGDLLVFRYDGEL  59



>ref|XP_006840490.1| hypothetical protein AMTR_s00045p00193040 [Amborella trichopoda]
 gb|ERN02165.1| hypothetical protein AMTR_s00045p00193040 [Amborella trichopoda]
Length=530

 Score = 73.2 bits (178),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 45/68 (66%), Gaps = 0/68 (0%)
 Frame = +2

Query  335  KIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDGWTVFVKDHCLEYGDSL  514
            +IP  F KH+    +G+A L GPSGN W+V V+  +  + F +GW  FV DH L+ G+ L
Sbjct  8    QIPHAFLKHIKKAAAGLAILRGPSGNLWHVEVNITNDSVAFQEGWPQFVTDHSLQLGEFL  67

Query  515  VFRYDGDL  538
            VF++DGDL
Sbjct  68   VFKHDGDL  75



>ref|XP_006434878.1| hypothetical protein CICLE_v10000881mg [Citrus clementina]
 ref|XP_006434879.1| hypothetical protein CICLE_v10000881mg [Citrus clementina]
 ref|XP_006434880.1| hypothetical protein CICLE_v10000881mg [Citrus clementina]
 ref|XP_006434881.1| hypothetical protein CICLE_v10000881mg [Citrus clementina]
 gb|ESR48118.1| hypothetical protein CICLE_v10000881mg [Citrus clementina]
 gb|ESR48119.1| hypothetical protein CICLE_v10000881mg [Citrus clementina]
 gb|ESR48120.1| hypothetical protein CICLE_v10000881mg [Citrus clementina]
 gb|ESR48121.1| hypothetical protein CICLE_v10000881mg [Citrus clementina]
Length=517

 Score = 73.2 bits (178),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = +2

Query  362  MDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDGWTVFVKDHCLEYGDSLVFRYDGDL  538
            M+G TSG  +L+GPS +TW++ + Q D  LFF  GW VF++D+ +E GD LVFRYDG+L
Sbjct  1    MEGRTSGSVTLIGPSWDTWHIDLIQQDDNLFFDKGWPVFLRDNFIECGDLLVFRYDGEL  59



>ref|XP_008220725.1| PREDICTED: B3 domain-containing protein REM5-like [Prunus mume]
Length=261

 Score = 70.9 bits (172),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 42/70 (60%), Gaps = 0/70 (0%)
 Frame = +2

Query  323  SEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDGWTVFVKDHCLEY  502
            S+ L+IP  F K+  G   G  ++ GP+G  W V + Q   GLFFH GW  FVKDH +E 
Sbjct  24   SQHLRIPPAFIKNFSGRRLGKCTMRGPTGKCWAVELEQRRDGLFFHKGWPGFVKDHFIES  83

Query  503  GDSLVFRYDG  532
             D L+F YDG
Sbjct  84   EDFLIFDYDG  93



>ref|XP_006833221.1| hypothetical protein AMTR_s00072p00182810 [Amborella trichopoda]
 gb|ERM98499.1| hypothetical protein AMTR_s00072p00182810 [Amborella trichopoda]
Length=499

 Score = 72.8 bits (177),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 47/73 (64%), Gaps = 0/73 (0%)
 Frame = +2

Query  323  SEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDGWTVFVKDHCLEY  502
            SE+L IP  F +H++  +S  A L GP+G   +V + +  GG+ F DGW  FV+D CLE 
Sbjct  39   SERLWIPPAFQRHIEHESSENAILKGPNGKIRHVQLIKTIGGMLFDDGWKEFVRDCCLEM  98

Query  503  GDSLVFRYDGDLD  541
             D LVFRYDG++ 
Sbjct  99   EDFLVFRYDGNMQ  111



>ref|XP_010229963.1| PREDICTED: uncharacterized protein LOC104582255 [Brachypodium 
distachyon]
Length=812

 Score = 73.6 bits (179),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 36/81 (44%), Positives = 47/81 (58%), Gaps = 0/81 (0%)
 Frame = +2

Query  290  HFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDGW  469
            HF     P  S+++LKIP  F K+++  +SG+ SL   SGNTW VG+      L F  GW
Sbjct  168  HFFKVVMPGESTQQLKIPRAFKKYLENESSGVVSLRDASGNTWRVGLVANSMELSFVRGW  227

Query  470  TVFVKDHCLEYGDSLVFRYDG  532
              F  DH +  GD LVFRY+G
Sbjct  228  ERFFSDHRIHVGDFLVFRYNG  248



>gb|KDP38416.1| hypothetical protein JCGZ_04341 [Jatropha curcas]
Length=534

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = +2

Query  362  MDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDGWTVFVKDHCLEYGDSLVFRYDGDL  538
            M+G TSG  SL GPSGN W V + Q +  +F   GW  F+KDH +E GD LVFRYDG+L
Sbjct  1    MEGRTSGSVSLTGPSGNIWPVNLIQENDNIFLDHGWPTFLKDHFIECGDVLVFRYDGEL  59



>ref|XP_011030819.1| PREDICTED: B3 domain-containing protein Os01g0723500-like isoform 
X5 [Populus euphratica]
Length=589

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 31/59 (53%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = +2

Query  362  MDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDGWTVFVKDHCLEYGDSLVFRYDGDL  538
            M+G T G+ SL+GPSG+ W   ++Q +  L F +GW+ FV+DH LE GD LVFRY G+L
Sbjct  1    MEGKTPGLVSLLGPSGDVWTAELTQENDDLLFSNGWSEFVRDHFLECGDLLVFRYHGEL  59



>ref|XP_010924666.1| PREDICTED: B3 domain-containing protein Os01g0723500-like [Elaeis 
guineensis]
Length=352

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 49/86 (57%), Gaps = 1/86 (1%)
 Frame = +2

Query  281  RKPHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFH  460
            RKPHF        + ++LKIP  F KH+   TS    L GPSG+ WYV + +   G F  
Sbjct  14   RKPHFFKVLLGDFA-QRLKIPPNFMKHISMETSRKVILQGPSGSKWYVQLGKNIKGTFLT  72

Query  461  DGWTVFVKDHCLEYGDSLVFRYDGDL  538
             GW  FVKDH L+  + LVF+YDG +
Sbjct  73   AGWPKFVKDHSLKEHEFLVFQYDGCM  98



>emb|CAN82365.1| hypothetical protein VITISV_027616 [Vitis vinifera]
Length=844

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 38/93 (41%), Positives = 52/93 (56%), Gaps = 2/93 (2%)
 Frame = +2

Query  260  GAEMSNGRK--PHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVS  433
            G EMS+ ++  P F     P  SS+KL IP+ F +H +G     A L  P G  W V +S
Sbjct  461  GNEMSSPQEECPEFFKVCLPECSSDKLLIPTAFREHFNGFVPHKAILRDPVGRVWQVELS  520

Query  434  QLDGGLFFHDGWTVFVKDHCLEYGDSLVFRYDG  532
            ++   ++F  GW  FV D+ +E  D LVFRYDG
Sbjct  521  KIGKDVYFQKGWQKFVTDNFVEMEDFLVFRYDG  553


 Score = 63.9 bits (154),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 29/83 (35%), Positives = 47/83 (57%), Gaps = 0/83 (0%)
 Frame = +2

Query  287  PHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDG  466
            P F   + P +S ++L+IP+ F +H +G     A L    G  W+V V  +   ++F +G
Sbjct  103  PDFFTVYLPELSWDRLRIPTAFVEHFNGFMPEKAILRDFVGRVWHVEVGPIGKNVYFLNG  162

Query  467  WTVFVKDHCLEYGDSLVFRYDGD  535
            W  F+ ++ +E GD LVFRY G+
Sbjct  163  WQQFLTENSVEEGDFLVFRYAGN  185



>ref|XP_009613232.1| PREDICTED: B3 domain-containing protein At5g60140-like isoform 
X2 [Nicotiana tomentosiformis]
Length=328

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 48/80 (60%), Gaps = 0/80 (0%)
 Frame = +2

Query  293  FLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDGWT  472
            F   F P  SS+KLKIP+ F ++ +G      SL    GN W + +++    L+F DGW 
Sbjct  11   FFKFFYPENSSQKLKIPTAFTEYKNGKLPKRISLRDRFGNVWPIELAKKGRDLYFQDGWV  70

Query  473  VFVKDHCLEYGDSLVFRYDG  532
             F++D+ LE+GD L+F YDG
Sbjct  71   KFIEDNSLEFGDFLIFDYDG  90



>ref|XP_008440210.1| PREDICTED: uncharacterized protein LOC103484737 isoform X4 [Cucumis 
melo]
Length=927

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 32/80 (40%), Positives = 47/80 (59%), Gaps = 0/80 (0%)
 Frame = +2

Query  293  FLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDGWT  472
            F   F P   +  + IP  F KH++G     A++   +GN+W + + +LD  L+F +GW 
Sbjct  15   FFKVFLPDSCTLHMSIPPAFMKHLNGTFPEKATMQDHTGNSWGITLEKLDDLLYFKNGWK  74

Query  473  VFVKDHCLEYGDSLVFRYDG  532
             FV  H L+YGD LVF+YDG
Sbjct  75   AFVDYHSLKYGDFLVFQYDG  94



>ref|XP_008440215.1| PREDICTED: uncharacterized protein LOC103484737 isoform X9 [Cucumis 
melo]
Length=909

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 32/80 (40%), Positives = 47/80 (59%), Gaps = 0/80 (0%)
 Frame = +2

Query  293  FLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDGWT  472
            F   F P   +  + IP  F KH++G     A++   +GN+W + + +LD  L+F +GW 
Sbjct  15   FFKVFLPDSCTLHMSIPPAFMKHLNGTFPEKATMQDHTGNSWGITLEKLDDLLYFKNGWK  74

Query  473  VFVKDHCLEYGDSLVFRYDG  532
             FV  H L+YGD LVF+YDG
Sbjct  75   AFVDYHSLKYGDFLVFQYDG  94



>ref|XP_007202358.1| hypothetical protein PRUPE_ppa009186mg [Prunus persica]
 gb|EMJ03557.1| hypothetical protein PRUPE_ppa009186mg [Prunus persica]
Length=303

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 42/70 (60%), Gaps = 0/70 (0%)
 Frame = +2

Query  323  SEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDGWTVFVKDHCLEY  502
            S++L IP  F  H++G  S   +L  PSG+ W VG+       FFH+GW  FVKDH LE 
Sbjct  24   SQRLSIPPAFMYHVNGRLSPKCTLRDPSGDCWTVGLEVRGDRFFFHEGWQRFVKDHSLEI  83

Query  503  GDSLVFRYDG  532
             + LVF YDG
Sbjct  84   ANVLVFDYDG  93



>ref|XP_008440214.1| PREDICTED: uncharacterized protein LOC103484737 isoform X8 [Cucumis 
melo]
Length=909

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 32/80 (40%), Positives = 47/80 (59%), Gaps = 0/80 (0%)
 Frame = +2

Query  293  FLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDGWT  472
            F   F P   +  + IP  F KH++G     A++   +GN+W + + +LD  L+F +GW 
Sbjct  15   FFKVFLPDSCTLHMSIPPAFMKHLNGTFPEKATMQDHTGNSWGITLEKLDDLLYFKNGWK  74

Query  473  VFVKDHCLEYGDSLVFRYDG  532
             FV  H L+YGD LVF+YDG
Sbjct  75   AFVDYHSLKYGDFLVFQYDG  94



>ref|XP_008440211.1| PREDICTED: uncharacterized protein LOC103484737 isoform X5 [Cucumis 
melo]
Length=912

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 32/80 (40%), Positives = 47/80 (59%), Gaps = 0/80 (0%)
 Frame = +2

Query  293  FLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDGWT  472
            F   F P   +  + IP  F KH++G     A++   +GN+W + + +LD  L+F +GW 
Sbjct  15   FFKVFLPDSCTLHMSIPPAFMKHLNGTFPEKATMQDHTGNSWGITLEKLDDLLYFKNGWK  74

Query  473  VFVKDHCLEYGDSLVFRYDG  532
             FV  H L+YGD LVF+YDG
Sbjct  75   AFVDYHSLKYGDFLVFQYDG  94



>ref|XP_008440209.1| PREDICTED: uncharacterized protein LOC103484737 isoform X3 [Cucumis 
melo]
Length=927

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 32/80 (40%), Positives = 47/80 (59%), Gaps = 0/80 (0%)
 Frame = +2

Query  293  FLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDGWT  472
            F   F P   +  + IP  F KH++G     A++   +GN+W + + +LD  L+F +GW 
Sbjct  15   FFKVFLPDSCTLHMSIPPAFMKHLNGTFPEKATMQDHTGNSWGITLEKLDDLLYFKNGWK  74

Query  473  VFVKDHCLEYGDSLVFRYDG  532
             FV  H L+YGD LVF+YDG
Sbjct  75   AFVDYHSLKYGDFLVFQYDG  94



>ref|XP_008440208.1| PREDICTED: uncharacterized protein LOC103484737 isoform X2 [Cucumis 
melo]
Length=943

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 32/80 (40%), Positives = 47/80 (59%), Gaps = 0/80 (0%)
 Frame = +2

Query  293  FLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDGWT  472
            F   F P   +  + IP  F KH++G     A++   +GN+W + + +LD  L+F +GW 
Sbjct  15   FFKVFLPDSCTLHMSIPPAFMKHLNGTFPEKATMQDHTGNSWGITLEKLDDLLYFKNGWK  74

Query  473  VFVKDHCLEYGDSLVFRYDG  532
             FV  H L+YGD LVF+YDG
Sbjct  75   AFVDYHSLKYGDFLVFQYDG  94



>ref|XP_008440207.1| PREDICTED: uncharacterized protein LOC103484737 isoform X1 [Cucumis 
melo]
Length=945

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 32/80 (40%), Positives = 47/80 (59%), Gaps = 0/80 (0%)
 Frame = +2

Query  293  FLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDGWT  472
            F   F P   +  + IP  F KH++G     A++   +GN+W + + +LD  L+F +GW 
Sbjct  15   FFKVFLPDSCTLHMSIPPAFMKHLNGTFPEKATMQDHTGNSWGITLEKLDDLLYFKNGWK  74

Query  473  VFVKDHCLEYGDSLVFRYDG  532
             FV  H L+YGD LVF+YDG
Sbjct  75   AFVDYHSLKYGDFLVFQYDG  94



>ref|XP_008440213.1| PREDICTED: uncharacterized protein LOC103484737 isoform X7 [Cucumis 
melo]
Length=909

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 32/80 (40%), Positives = 47/80 (59%), Gaps = 0/80 (0%)
 Frame = +2

Query  293  FLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDGWT  472
            F   F P   +  + IP  F KH++G     A++   +GN+W + + +LD  L+F +GW 
Sbjct  15   FFKVFLPDSCTLHMSIPPAFMKHLNGTFPEKATMQDHTGNSWGITLEKLDDLLYFKNGWK  74

Query  473  VFVKDHCLEYGDSLVFRYDG  532
             FV  H L+YGD LVF+YDG
Sbjct  75   AFVDYHSLKYGDFLVFQYDG  94



>ref|XP_009769346.1| PREDICTED: B3 domain-containing protein Os11g0197600-like [Nicotiana 
sylvestris]
Length=310

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 51/87 (59%), Gaps = 1/87 (1%)
 Frame = +2

Query  281  RKPHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFH  460
            R+  F   FNP++ SE L+IP+ F +H+   +   A+L   SG  W V +   + GL  H
Sbjct  45   RRAIFFKIFNPTVKSE-LRIPAHFLRHISEDSPDKATLKCLSGGIWNVKLHIDEDGLLIH  103

Query  461  DGWTVFVKDHCLEYGDSLVFRYDGDLD  541
             GW  F KD+ +E G+ LVFRYDGDL 
Sbjct  104  QGWEKFHKDNHIEDGEFLVFRYDGDLQ  130



>ref|XP_002284808.2| PREDICTED: putative B3 domain-containing protein At5g66980 [Vitis 
vinifera]
Length=398

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 51/91 (56%), Gaps = 2/91 (2%)
 Frame = +2

Query  266  EMSNGRK--PHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQL  439
            EMS+ ++  P F     P  SS+KL IP+ F +H +G     A L  P G  W V +S++
Sbjct  17   EMSSPQEECPEFFKVCLPECSSDKLLIPTAFREHFNGFVPHKAILRDPVGRVWQVELSKI  76

Query  440  DGGLFFHDGWTVFVKDHCLEYGDSLVFRYDG  532
               ++F  GW  FV D+ +E  D LVFRYDG
Sbjct  77   GKDVYFQKGWQKFVTDNFVEMEDFLVFRYDG  107



>ref|XP_010647775.1| PREDICTED: B3 domain-containing protein REM20-like, partial [Vitis 
vinifera]
Length=161

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 48/83 (58%), Gaps = 0/83 (0%)
 Frame = +2

Query  287  PHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDG  466
            P F   + P  SS++L+IP+ F  H +G+    A L    G  W+V V Q+   + F +G
Sbjct  9    PEFFKVYLPEYSSDRLRIPTAFIGHFNGLVPEKAILRDFFGRVWHVEVGQIGKDVCFLNG  68

Query  467  WTVFVKDHCLEYGDSLVFRYDGD  535
            W  F+ D+ +E GD LVFRYDG+
Sbjct  69   WQRFLTDNSVEEGDFLVFRYDGN  91



>ref|XP_009613231.1| PREDICTED: B3 domain-containing protein At5g60140-like isoform 
X1 [Nicotiana tomentosiformis]
Length=375

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 48/80 (60%), Gaps = 0/80 (0%)
 Frame = +2

Query  293  FLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDGWT  472
            F   F P  SS+KLKIP+ F ++ +G      SL    GN W + +++    L+F DGW 
Sbjct  11   FFKFFYPENSSQKLKIPTAFTEYKNGKLPKRISLRDRFGNVWPIELAKKGRDLYFQDGWV  70

Query  473  VFVKDHCLEYGDSLVFRYDG  532
             F++D+ LE+GD L+F YDG
Sbjct  71   KFIEDNSLEFGDFLIFDYDG  90



>ref|XP_009341395.1| PREDICTED: putative B3 domain-containing protein Os04g0347400 
[Pyrus x bretschneideri]
Length=305

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 43/68 (63%), Gaps = 0/68 (0%)
 Frame = +2

Query  332  LKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDGWTVFVKDHCLEYGDS  511
            L+IP KF K+ +G +     L GPSG    V + +   GLFF+ GW  FVKDH LE GD 
Sbjct  27   LRIPPKFVKNFNGWSPCKCVLRGPSGLRRTVELEERKNGLFFNGGWQYFVKDHYLENGDL  86

Query  512  LVFRYDGD  535
            LVF+YDG+
Sbjct  87   LVFKYDGE  94



>ref|XP_010315502.1| PREDICTED: putative B3 domain-containing protein Os03g0621600 
[Solanum lycopersicum]
Length=705

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 31/82 (38%), Positives = 51/82 (62%), Gaps = 1/82 (1%)
 Frame = +2

Query  293  FLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDGWT  472
            F   FNP  S++++KIPS +A + +G             N W +GV++++G L+F +GW 
Sbjct  5    FFRIFNPESSAKRMKIPSSYATYKNGKLPRNVFFRDRFNNMWPMGVTKIEGALYFENGWK  64

Query  473  VFVKD-HCLEYGDSLVFRYDGD  535
             F++D + LEYGD ++F YDG+
Sbjct  65   KFIEDNNTLEYGDFMIFDYDGN  86


 Score = 61.6 bits (148),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 27/82 (33%), Positives = 49/82 (60%), Gaps = 1/82 (1%)
 Frame = +2

Query  293  FLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGN-TWYVGVSQLDGGLFFHDGW  469
            F   FNP  S++++KIP+ +  + +G       L     N +W V V +++  L+F +GW
Sbjct  363  FFKAFNPQTSAKRMKIPTAYTNYKNGKLPRKVFLRNQFSNMSWPVRVIKIEKDLYFLNGW  422

Query  470  TVFVKDHCLEYGDSLVFRYDGD  535
              F++D+ LE+G+ ++F YDG+
Sbjct  423  EKFIEDNNLEFGNIIIFDYDGN  444



>gb|KCW66218.1| hypothetical protein EUGRSUZ_F00044 [Eucalyptus grandis]
Length=378

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 41/70 (59%), Gaps = 0/70 (0%)
 Frame = +2

Query  326  EKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDGWTVFVKDHCLEYG  505
            ++L IP KFA+++         L GPSG TW VG    D  L F  GW  FVKDH LE  
Sbjct  35   QQLAIPKKFAENLRSKLPENVVLKGPSGATWKVGTVADDENLLFKHGWQDFVKDHALEKN  94

Query  506  DSLVFRYDGD  535
            D LVFRY+G+
Sbjct  95   DILVFRYNGE  104



>ref|XP_010059786.1| PREDICTED: B3 domain-containing protein REM16-like isoform X4 
[Eucalyptus grandis]
Length=381

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 41/70 (59%), Gaps = 0/70 (0%)
 Frame = +2

Query  326  EKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDGWTVFVKDHCLEYG  505
            ++L IP KFA+++         L GPSG TW VG    D  L F  GW  FVKDH LE  
Sbjct  35   QQLAIPKKFAENLRSKLPENVVLKGPSGATWKVGTVADDENLLFKHGWQDFVKDHALEKN  94

Query  506  DSLVFRYDGD  535
            D LVFRY+G+
Sbjct  95   DILVFRYNGE  104



>ref|XP_002510293.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF52480.1| DNA binding protein, putative [Ricinus communis]
Length=337

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 48/82 (59%), Gaps = 1/82 (1%)
 Frame = +2

Query  290  HFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDGW  469
            HF    +P     +L IP +F K++      + +L GPSG TW VG++  D  +FF+ GW
Sbjct  25   HFSQILHPGFD-RRLAIPEQFTKNLRRKLPKIITLRGPSGRTWEVGLAANDDTVFFNHGW  83

Query  470  TVFVKDHCLEYGDSLVFRYDGD  535
              FV DH L+  D L+F+Y+GD
Sbjct  84   EAFVIDHSLQEKDLLIFKYNGD  105



>ref|XP_008810645.1| PREDICTED: B3 domain-containing protein Os01g0723500-like isoform 
X1 [Phoenix dactylifera]
Length=353

 Score = 70.1 bits (170),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 49/86 (57%), Gaps = 1/86 (1%)
 Frame = +2

Query  281  RKPHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFH  460
            RKPHF          ++LKIP  F KH+    S   +L GPSG+ WYV +++   G F  
Sbjct  15   RKPHFFKVLLGDFG-QRLKIPPNFLKHISMEASRRVTLQGPSGSKWYVQLTKNIEGAFLT  73

Query  461  DGWTVFVKDHCLEYGDSLVFRYDGDL  538
             GW  FVKDH L+  + LVF+Y+G +
Sbjct  74   AGWPKFVKDHSLKEHEFLVFQYEGSM  99



>ref|XP_006840489.1| hypothetical protein AMTR_s00045p00192570 [Amborella trichopoda]
 gb|ERN02164.1| hypothetical protein AMTR_s00045p00192570 [Amborella trichopoda]
Length=363

 Score = 70.1 bits (170),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 46/73 (63%), Gaps = 1/73 (1%)
 Frame = +2

Query  323  SEKLKIPSKFAK-HMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDGWTVFVKDHCLE  499
            +EKL+IP +F + +   +++  A L GP G   YV +     GLFF DGW  FV D+ L+
Sbjct  19   TEKLRIPPEFVRRNRREISAENAVLKGPIGKLCYVKMKSTSKGLFFQDGWNEFVSDNSLQ  78

Query  500  YGDSLVFRYDGDL  538
             G+ LVFRYDGDL
Sbjct  79   TGEFLVFRYDGDL  91



>ref|XP_007224197.1| hypothetical protein PRUPE_ppa017317mg, partial [Prunus persica]
 gb|EMJ25396.1| hypothetical protein PRUPE_ppa017317mg, partial [Prunus persica]
Length=88

 Score = 66.2 bits (160),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 38/65 (58%), Gaps = 0/65 (0%)
 Frame = +2

Query  338  IPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDGWTVFVKDHCLEYGDSLV  517
            IP  F K+ +    G  ++ GPSG  W V + Q   GLFFH GW  FVKDH +E  D L+
Sbjct  7    IPPAFIKNFNRRRLGKCTMRGPSGKCWAVELEQRQDGLFFHKGWPGFVKDHFIELEDFLI  66

Query  518  FRYDG  532
            F YDG
Sbjct  67   FCYDG  71



>emb|CDP08404.1| unnamed protein product [Coffea canephora]
Length=288

 Score = 68.9 bits (167),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 44/84 (52%), Gaps = 0/84 (0%)
 Frame = +2

Query  284  KPHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHD  463
            +P F   F P +SS++L++P  F K   G+      L    G  W V V +   G+F  +
Sbjct  25   RPEFFKVFLPDVSSQQLRVPPLFVKKFSGLVCKRIKLRCIDGKIWDVDVEETQEGVFMKN  84

Query  464  GWTVFVKDHCLEYGDSLVFRYDGD  535
            GW  F   H L+ G+ LVFRYDG+
Sbjct  85   GWQAFADHHLLKLGEFLVFRYDGN  108



>ref|XP_010064142.1| PREDICTED: B3 domain-containing protein REM20-like [Eucalyptus 
grandis]
Length=190

 Score = 67.8 bits (164),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 43/67 (64%), Gaps = 0/67 (0%)
 Frame = +2

Query  335  KIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDGWTVFVKDHCLEYGDSL  514
            KIP  F  ++ G      SL GPSG++W VG+ + +G L+F  GW  FV+DH ++ GD L
Sbjct  56   KIPLAFQDYIKGRRPQAVSLTGPSGDSWMVGLMEEEGALYFGGGWPQFVEDHSVQIGDFL  115

Query  515  VFRYDGD  535
            VF YDG+
Sbjct  116  VFWYDGE  122



>ref|XP_004145348.1| PREDICTED: B3 domain-containing transcription factor VRN1-like 
[Cucumis sativus]
 ref|XP_004153258.1| PREDICTED: B3 domain-containing transcription factor VRN1-like 
[Cucumis sativus]
 gb|KGN61751.1| hypothetical protein Csa_2G237700 [Cucumis sativus]
Length=417

 Score = 70.1 bits (170),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 53/97 (55%), Gaps = 1/97 (1%)
 Frame = +2

Query  248  TQAFGAEMSNGRKPHFLHGFNPSI-SSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYV  424
             Q+F       R   F     PSI   +KLKIP+KFAK   G    + +LV P+G  W +
Sbjct  17   AQSFNQTSPARRAGLFYKLVVPSILQDKKLKIPNKFAKKFGGDILDLVTLVAPNGYRWVL  76

Query  425  GVSQLDGGLFFHDGWTVFVKDHCLEYGDSLVFRYDGD  535
             + +    ++F DGW  FVK HC++ G  LVFR++G+
Sbjct  77   ELKRHGRSMWFEDGWHEFVKHHCIQVGQLLVFRFEGN  113



>ref|XP_010647802.1| PREDICTED: B3 domain-containing protein Os01g0723500-like [Vitis 
vinifera]
Length=179

 Score = 67.8 bits (164),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 45/86 (52%), Gaps = 0/86 (0%)
 Frame = +2

Query  284  KPHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHD  463
            +PHF    +       L+IP  F KH+    S  A+L GPSG+ W V VS    G +   
Sbjct  12   RPHFFKIIHGEDVKRHLRIPPAFMKHLSQEMSNRATLTGPSGSQWRVTVSTDANGTYLQK  71

Query  464  GWTVFVKDHCLEYGDSLVFRYDGDLD  541
            GW  F+K++ L   + L FRYDG++ 
Sbjct  72   GWKQFMKENNLGDSEFLTFRYDGNMQ  97



>ref|XP_006423126.1| hypothetical protein CICLE_v10028843mg [Citrus clementina]
 ref|XP_006479376.1| PREDICTED: B3 domain-containing protein At5g60142-like [Citrus 
sinensis]
 gb|ESR36366.1| hypothetical protein CICLE_v10028843mg [Citrus clementina]
Length=321

 Score = 69.3 bits (168),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 44/83 (53%), Gaps = 0/83 (0%)
 Frame = +2

Query  287  PHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDG  466
            P F   + P  SS +L IP  F  H+         L+   G  W+V V+  D G+FF DG
Sbjct  6    PGFFKVYLPEKSSNRLHIPDAFIAHLSPSKPEKVMLINHIGEYWHVDVAYCDKGVFFLDG  65

Query  467  WTVFVKDHCLEYGDSLVFRYDGD  535
            W  FVKD+ LE  D LV +YDGD
Sbjct  66   WQKFVKDNSLETADILVLKYDGD  88



>ref|XP_004292711.1| PREDICTED: B3 domain-containing protein REM5-like [Fragaria vesca 
subsp. vesca]
Length=262

 Score = 68.2 bits (165),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 48/88 (55%), Gaps = 3/88 (3%)
 Frame = +2

Query  269  MSNGRKPHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGG  448
              + R+P F  G     S + L+IPS F K ++  TS    L GPSG  W V + +    
Sbjct  6    QRSARRPAFFKGLKDDFSRQ-LRIPSAFIKKLN--TSSPHRLRGPSGEYWDVELGKRGNQ  62

Query  449  LFFHDGWTVFVKDHCLEYGDSLVFRYDG  532
            +FFH GW  FV+ H +E GD L+F YDG
Sbjct  63   MFFHRGWEKFVQHHPVEVGDLLIFSYDG  90



>ref|XP_004308266.1| PREDICTED: putative B3 domain-containing protein Os03g0621600 
[Fragaria vesca subsp. vesca]
Length=240

 Score = 67.8 bits (164),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 48/89 (54%), Gaps = 2/89 (2%)
 Frame = +2

Query  269  MSNGRKPHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGG  448
            M+  RKP F        S ++L IP  F KH DG     + L  P+G TW+V V   +G 
Sbjct  1    MTRKRKPSFFKVLIGDFS-DQLSIPQAFHKHFDGRVPQQSHLQTPTG-TWFVDVKSDNGR  58

Query  449  LFFHDGWTVFVKDHCLEYGDSLVFRYDGD  535
            LF   GW  FV+D+ L  G+ LVFRY G+
Sbjct  59   LFLQKGWKQFVRDNGLRLGEFLVFRYAGN  87



>ref|XP_010064141.1| PREDICTED: B3 domain-containing protein Os03g0212300-like [Eucalyptus 
grandis]
Length=280

 Score = 68.2 bits (165),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 43/67 (64%), Gaps = 0/67 (0%)
 Frame = +2

Query  335  KIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDGWTVFVKDHCLEYGDSL  514
            KIP  F  ++ G       L GPSG++W VG+ + +G L+F  GW  FV+DH ++ GD L
Sbjct  56   KIPLAFQDYIKGRRPQAVLLTGPSGDSWMVGLIEEEGALYFGGGWPKFVEDHSVQTGDFL  115

Query  515  VFRYDGD  535
            VFRYDG+
Sbjct  116  VFRYDGE  122



>ref|XP_010277224.1| PREDICTED: B3 domain-containing protein LOC_Os12g40080-like [Nelumbo 
nucifera]
Length=362

 Score = 69.3 bits (168),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 38/59 (64%), Gaps = 0/59 (0%)
 Frame = +2

Query  362  MDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDGWTVFVKDHCLEYGDSLVFRYDGDL  538
            M G  SG   L GPSGN+W+  +     GLF  DGW  F+KDH ++ GD LVFRYDG+L
Sbjct  1    MKGQASGAVWLKGPSGNSWHANLISNPDGLFLEDGWKAFLKDHLIQVGDFLVFRYDGNL  59



>ref|XP_004152721.1| PREDICTED: B3 domain-containing protein REM16-like [Cucumis sativus]
 gb|KGN62556.1| hypothetical protein Csa_2G360730 [Cucumis sativus]
Length=395

 Score = 69.3 bits (168),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 43/70 (61%), Gaps = 0/70 (0%)
 Frame = +2

Query  323  SEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDGWTVFVKDHCLEY  502
             ++L IP+KF+ ++        +L GPSG TW VG++  D  L+F  GW  FVK H LE 
Sbjct  34   EQQLVIPNKFSNNLRNKLPDTVTLKGPSGATWDVGLTSSDDKLYFKRGWQEFVKAHSLEQ  93

Query  503  GDSLVFRYDG  532
             D LVFRY+G
Sbjct  94   NDLLVFRYNG  103



>emb|CBI32504.3| unnamed protein product [Vitis vinifera]
Length=1085

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 51/91 (56%), Gaps = 2/91 (2%)
 Frame = +2

Query  266  EMSNGRK--PHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQL  439
            EMS+ ++  P F     P  SS+KL IP+ F +H +G     A L  P G  W V +S++
Sbjct  655  EMSSPQEECPEFFKVCLPECSSDKLLIPTAFREHFNGFVPHKAILRDPVGRVWQVELSKI  714

Query  440  DGGLFFHDGWTVFVKDHCLEYGDSLVFRYDG  532
               ++F  GW  FV D+ +E  D LVFRYDG
Sbjct  715  GKDVYFQKGWQKFVTDNFVEMEDFLVFRYDG  745


 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 41/71 (58%), Gaps = 0/71 (0%)
 Frame = +2

Query  320  SSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDGWTVFVKDHCLE  499
            S ++L+IP+ F KH +G     A L    G  W+V V Q+   ++F  GW  F+ D+ +E
Sbjct  59   SWDRLQIPTAFVKHFNGFVPEKAILRDSVGRVWHVEVGQIGKNVYFLKGWQQFLTDNLVE  118

Query  500  YGDSLVFRYDG  532
             GD  VF+YDG
Sbjct  119  EGDLFVFQYDG  129


 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 38/68 (56%), Gaps = 0/68 (0%)
 Frame = +2

Query  335  KIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDGWTVFVKDHCLEYGDSL  514
            +IP+ F +H +G     A L    G  W+V V  +   ++F +GW  F+ ++ +E GD L
Sbjct  351  RIPTAFVEHFNGFMPEKAILRDFVGRVWHVEVGPIGKNVYFLNGWQQFLTENSVEEGDFL  410

Query  515  VFRYDGDL  538
            VFRY G+ 
Sbjct  411  VFRYAGNC  418



>ref|XP_011030831.1| PREDICTED: B3 domain-containing protein REM16-like [Populus euphratica]
 ref|XP_011030837.1| PREDICTED: B3 domain-containing protein REM16-like [Populus euphratica]
 ref|XP_011030846.1| PREDICTED: B3 domain-containing protein REM16-like [Populus euphratica]
 ref|XP_011030853.1| PREDICTED: B3 domain-containing protein REM16-like [Populus euphratica]
Length=361

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = +2

Query  329  KLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDGWTVFVKDHCLEYGD  508
            +L IP KF+ H+        +L GPSG+TW V ++  D  +FF  GW  FVKDH LE  D
Sbjct  37   QLPIPDKFSNHLKNKLLESVTLKGPSGSTWQVELTTDDNTMFFKHGWEEFVKDHFLEEKD  96

Query  509  SLVFRYDGD  535
             L+F+Y+G+
Sbjct  97   LLIFKYNGE  105



>ref|XP_004160048.1| PREDICTED: B3 domain-containing protein Os12g0591400-like [Cucumis 
sativus]
Length=479

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = +2

Query  326  EKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDGWTVFVKDHCLEYG  505
            ++L IP+KF+ ++        +L GPSG TW VG++  D  L+F  GW  FVK H LE  
Sbjct  104  QQLVIPNKFSNNLRNKLPDTVTLKGPSGATWDVGLTSSDDKLYFKRGWQEFVKAHSLEQN  163

Query  506  DSLVFRYDG  532
            D LVFRY+G
Sbjct  164  DLLVFRYNG  172



>ref|XP_009341402.1| PREDICTED: putative B3 domain-containing protein Os03g0621600 
[Pyrus x bretschneideri]
Length=318

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 42/70 (60%), Gaps = 0/70 (0%)
 Frame = +2

Query  323  SEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDGWTVFVKDHCLEY  502
            S  L+IP KF K+ +G +     L GP+G    V +     GLFF DGW  FVKDH LE 
Sbjct  24   SRHLRIPPKFVKNFNGRSLCKCVLRGPNGLRRTVELEGRKNGLFFDDGWQYFVKDHHLEK  83

Query  503  GDSLVFRYDG  532
            GD LVF+YDG
Sbjct  84   GDFLVFKYDG  93



>ref|XP_009769345.1| PREDICTED: B3 domain-containing protein Os01g0723500-like [Nicotiana 
sylvestris]
Length=113

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 49/79 (62%), Gaps = 3/79 (4%)
 Frame = +2

Query  305  FNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHD-GWTVFV  481
            FNP +  E+L+IPS+F K++    +    L GPSG  W + + + + GLFF+  GW  F 
Sbjct  23   FNPHV--EELRIPSEFVKYITKEATETTILKGPSGKYWNMKLREDEEGLFFNAGGWNKFA  80

Query  482  KDHCLEYGDSLVFRYDGDL  538
            ++  LE GD L+F+YDG +
Sbjct  81   REQQLEEGDFLLFQYDGKI  99



>ref|XP_006375018.1| transcriptional factor B3 family protein [Populus trichocarpa]
 gb|ERP52815.1| transcriptional factor B3 family protein [Populus trichocarpa]
Length=318

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = +2

Query  329  KLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDGWTVFVKDHCLEYGD  508
            +L IP KF+ H+        +L GPSG+TW V ++  D  +FF  GW  FVKDH LE  D
Sbjct  37   QLPIPEKFSNHLKNKLLENVTLKGPSGSTWQVELTTDDNTMFFKHGWEDFVKDHFLEEKD  96

Query  509  SLVFRYDGD  535
             L+F+Y+G+
Sbjct  97   LLIFKYNGE  105



>ref|XP_010263799.1| PREDICTED: B3 domain-containing transcription factor VRN1-like 
isoform X2 [Nelumbo nucifera]
Length=376

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 48/83 (58%), Gaps = 1/83 (1%)
 Frame = +2

Query  290  HFLHGFNPSI-SSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDG  466
            HF    + SI    +L IP KF + + G  S +A L  PSG  W +G+ +++G L+F  G
Sbjct  23   HFFKIIHSSILQQRQLVIPEKFVRKLRGNLSTVAVLTVPSGKVWRIGLKKVNGKLWFQKG  82

Query  467  WTVFVKDHCLEYGDSLVFRYDGD  535
            W  FV+ H L  G  LVFRY+G+
Sbjct  83   WQEFVEYHSLGEGHVLVFRYEGN  105



>ref|XP_010263798.1| PREDICTED: B3 domain-containing transcription factor VRN1-like 
isoform X1 [Nelumbo nucifera]
Length=382

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 48/83 (58%), Gaps = 1/83 (1%)
 Frame = +2

Query  290  HFLHGFNPSI-SSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDG  466
            HF    + SI    +L IP KF + + G  S +A L  PSG  W +G+ +++G L+F  G
Sbjct  23   HFFKIIHSSILQQRQLVIPEKFVRKLRGNLSTVAVLTVPSGKVWRIGLKKVNGKLWFQKG  82

Query  467  WTVFVKDHCLEYGDSLVFRYDGD  535
            W  FV+ H L  G  LVFRY+G+
Sbjct  83   WQEFVEYHSLGEGHVLVFRYEGN  105



>gb|KGN48479.1| hypothetical protein Csa_6G489950 [Cucumis sativus]
Length=960

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 31/80 (39%), Positives = 46/80 (58%), Gaps = 0/80 (0%)
 Frame = +2

Query  293  FLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDGWT  472
            F   F P   +  + IP  F KH++G     A++   +GN+W + + +LD  L+F +GW 
Sbjct  15   FFKVFLPGSCTLHMSIPPAFMKHLNGTFPEKATMQDHTGNSWCITLEKLDDLLYFKNGWK  74

Query  473  VFVKDHCLEYGDSLVFRYDG  532
             FV  H L+YGD LVF+Y G
Sbjct  75   AFVDYHSLKYGDFLVFQYHG  94



>ref|XP_008380674.1| PREDICTED: B3 domain-containing protein Os12g0591400-like [Malus 
domestica]
 ref|XP_008380675.1| PREDICTED: B3 domain-containing protein Os12g0591400-like [Malus 
domestica]
Length=276

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 44/72 (61%), Gaps = 1/72 (1%)
 Frame = +2

Query  323  SEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVS-QLDGGLFFHDGWTVFVKDHCLE  499
            S  L +P  F ++ +G      +L GPSG +W VG+  + DG  FF  GW  FV+DH LE
Sbjct  25   SRHLCLPPLFMENFNGRPPCKCTLRGPSGESWTVGLEGREDGKFFFRKGWQNFVEDHLLE  84

Query  500  YGDSLVFRYDGD  535
             G+ LVF+YDGD
Sbjct  85   IGNFLVFKYDGD  96



>ref|XP_009341411.1| PREDICTED: uncharacterized protein LOC103933435 [Pyrus x bretschneideri]
Length=404

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 53/100 (53%), Gaps = 1/100 (1%)
 Frame = +2

Query  236  KYGRTQAFGAEMSNGRKPHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNT  415
            + G  +   A  S+ +KP F        S + L+IP  F ++  G +    +L G SG  
Sbjct  139  RIGEKKVQMAGKSSPKKPSFFKVLLDDFS-QHLRIPHAFIENFSGQSLHKCALRGSSGQW  197

Query  416  WYVGVSQLDGGLFFHDGWTVFVKDHCLEYGDSLVFRYDGD  535
            W +   + + GLFFH GW  FVKDH LE G+ LVF YDGD
Sbjct  198  WAMKPEERENGLFFHGGWQGFVKDHSLEIGNFLVFDYDGD  237



>ref|XP_009340826.1| PREDICTED: B3 domain-containing protein At4g01580-like [Pyrus 
x bretschneideri]
Length=275

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 50/85 (59%), Gaps = 2/85 (2%)
 Frame = +2

Query  281  RKPHFLHGFNPSISSEKLKIPSKF-AKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFF  457
            +KP F+       +S+ L++P  F  K+ +G +     L GP+G    V + + + GLFF
Sbjct  6    KKPSFIKIL-AGDTSQSLRVPPAFITKNFNGRSLCKCDLKGPTGIRRTVELEERENGLFF  64

Query  458  HDGWTVFVKDHCLEYGDSLVFRYDG  532
            HDGW  FVKDH L+ GD LVF YDG
Sbjct  65   HDGWQGFVKDHLLKAGDFLVFSYDG  89



>ref|XP_009613235.1| PREDICTED: B3 domain-containing protein Os01g0723500-like [Nicotiana 
tomentosiformis]
Length=113

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 49/79 (62%), Gaps = 3/79 (4%)
 Frame = +2

Query  305  FNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHD-GWTVFV  481
            F+P +  E+L+IP +F KH+    +    L GPSG  W + + + + GLFF+  GW  F 
Sbjct  23   FDPRV--EELRIPPEFVKHITEEATETTILKGPSGKHWNMKLREDEEGLFFNAGGWNKFA  80

Query  482  KDHCLEYGDSLVFRYDGDL  538
            ++  LE GD L+F+YDG++
Sbjct  81   REQQLEEGDFLLFQYDGNI  99



>ref|XP_008386193.1| PREDICTED: putative B3 domain-containing protein Os03g0621600 
isoform X1 [Malus domestica]
 ref|XP_008366489.1| PREDICTED: putative B3 domain-containing protein Os03g0621600 
isoform X1 [Malus domestica]
Length=305

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 50/85 (59%), Gaps = 2/85 (2%)
 Frame = +2

Query  281  RKPHFLHGFNPSISSEKLKIPSKF-AKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFF  457
            +KP F+       +S+ L++P  F  K+ +G +     L GP+G    V + + + GLFF
Sbjct  6    KKPSFIKIL-AGDTSQGLRVPPAFIMKNFNGRSLCKCDLKGPTGIRRTVELEERENGLFF  64

Query  458  HDGWTVFVKDHCLEYGDSLVFRYDG  532
            HDGW  FVKDH LE GD LVF YDG
Sbjct  65   HDGWQGFVKDHLLEAGDFLVFXYDG  89



>ref|XP_008459236.1| PREDICTED: B3 domain-containing transcription factor VRN1-like 
[Cucumis melo]
Length=417

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 53/97 (55%), Gaps = 1/97 (1%)
 Frame = +2

Query  248  TQAFGAEMSNGRKPHFLHGFNPSI-SSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYV  424
             Q+F       R   F     PSI   +KLKIP+KFAK   G    + +LV P+G  W +
Sbjct  17   AQSFSESSPARRAGLFYKLVVPSILQDKKLKIPNKFAKKFGGDLLDLVTLVAPNGYRWVL  76

Query  425  GVSQLDGGLFFHDGWTVFVKDHCLEYGDSLVFRYDGD  535
             + +    ++F DGW  FV+ HC++ G  LVFR++G+
Sbjct  77   ELKRHGRSMWFEDGWHEFVEHHCIQVGQLLVFRFEGN  113



>ref|XP_008444660.1| PREDICTED: B3 domain-containing protein REM16-like [Cucumis melo]
Length=395

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 41/70 (59%), Gaps = 0/70 (0%)
 Frame = +2

Query  323  SEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDGWTVFVKDHCLEY  502
             ++L IP KF+ ++        +L GPSG TW VG+S  D  L F  GW  FVK H LE 
Sbjct  34   EQQLVIPDKFSNNLKNKLPATVTLKGPSGATWDVGLSTSDDKLCFKRGWQEFVKAHYLEQ  93

Query  503  GDSLVFRYDG  532
             D LVFRY+G
Sbjct  94   NDLLVFRYNG  103



>ref|XP_010059785.1| PREDICTED: B3 domain-containing protein REM16-like isoform X3 
[Eucalyptus grandis]
Length=384

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 38/66 (58%), Gaps = 0/66 (0%)
 Frame = +2

Query  338  IPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDGWTVFVKDHCLEYGDSLV  517
            IP KFA+++         L GPSG TW VG    D  L F  GW  FVKDH LE  D LV
Sbjct  45   IPKKFAENLRSKLPENVVLKGPSGATWKVGTVADDENLLFKHGWQDFVKDHALEKNDILV  104

Query  518  FRYDGD  535
            FRY+G+
Sbjct  105  FRYNGE  110



>ref|XP_010059782.1| PREDICTED: B3 domain-containing protein REM16-like isoform X1 
[Eucalyptus grandis]
Length=387

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 38/66 (58%), Gaps = 0/66 (0%)
 Frame = +2

Query  338  IPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDGWTVFVKDHCLEYGDSLV  517
            IP KFA+++         L GPSG TW VG    D  L F  GW  FVKDH LE  D LV
Sbjct  45   IPKKFAENLRSKLPENVVLKGPSGATWKVGTVADDENLLFKHGWQDFVKDHALEKNDILV  104

Query  518  FRYDGD  535
            FRY+G+
Sbjct  105  FRYNGE  110



>ref|XP_004145349.1| PREDICTED: B3 domain-containing transcription factor VRN1-like 
[Cucumis sativus]
Length=415

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 54/101 (53%), Gaps = 7/101 (7%)
 Frame = +2

Query  245  RTQAFGAEMSNGRKPHF----LHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGN  412
            RT  F  +M    +PHF    L     +I + KL+IP  F + +    S +A+L  P G+
Sbjct  8    RTGGFKRKMP---RPHFHKLVLTSTTSTIQARKLRIPETFVRMIRDELSAVATLTVPDGH  64

Query  413  TWYVGVSQLDGGLFFHDGWTVFVKDHCLEYGDSLVFRYDGD  535
             W VG+ + D   +F DGW  F++ + +  G  LVFRY+G+
Sbjct  65   VWRVGLRKADNKFWFEDGWQGFLEHYSIRVGYLLVFRYEGN  105



>ref|XP_010059783.1| PREDICTED: B3 domain-containing protein REM16-like isoform X2 
[Eucalyptus grandis]
Length=386

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 38/66 (58%), Gaps = 0/66 (0%)
 Frame = +2

Query  338  IPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDGWTVFVKDHCLEYGDSLV  517
            IP KFA+++         L GPSG TW VG    D  L F  GW  FVKDH LE  D LV
Sbjct  45   IPKKFAENLRSKLPENVVLKGPSGATWKVGTVADDENLLFKHGWQDFVKDHALEKNDILV  104

Query  518  FRYDGD  535
            FRY+G+
Sbjct  105  FRYNGE  110



>gb|KJB48489.1| hypothetical protein B456_008G071300 [Gossypium raimondii]
Length=732

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 34/96 (35%), Positives = 52/96 (54%), Gaps = 1/96 (1%)
 Frame = +2

Query  251  QAFGAEMSNGRKPHFLHG-FNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVG  427
            +A    M   + PHF       +I  +KL IP KF +      S    L  PSG+TW+  
Sbjct  6    KANNGSMFASKTPHFFKIILEATIRDKKLGIPRKFVRKYGKGLSSSVLLTVPSGDTWHAQ  65

Query  428  VSQLDGGLFFHDGWTVFVKDHCLEYGDSLVFRYDGD  535
            +++ DG ++F +GW  F + + L+YG  LVFRY+G+
Sbjct  66   LTKSDGVVWFQNGWQAFAEYYSLQYGHFLVFRYEGN  101



>ref|XP_011461326.1| PREDICTED: putative B3 domain-containing protein Os03g0621600 
isoform X2 [Fragaria vesca subsp. vesca]
Length=292

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 43/68 (63%), Gaps = 2/68 (3%)
 Frame = +2

Query  338  IPSKFAKHM--DGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDGWTVFVKDHCLEYGDS  511
            IP +F K++  +G+     +L GPSG      V   + G+FFH+GW  FVKDH LE GD 
Sbjct  6    IPPEFTKNLVWNGIFPHKCALRGPSGLLCAAEVESTENGMFFHNGWECFVKDHHLELGDF  65

Query  512  LVFRYDGD  535
            L+FRYDG+
Sbjct  66   LIFRYDGE  73



>gb|EMT01422.1| B3 domain-containing protein [Aegilops tauschii]
Length=714

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 35/82 (43%), Positives = 46/82 (56%), Gaps = 1/82 (1%)
 Frame = +2

Query  287  PHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDG  466
            PHF          E + IP  F K+++  T  M SL GPSGN W V ++++ G L F  G
Sbjct  149  PHFFRALISYSFKEHVTIPVGFHKYLEDCTR-MVSLRGPSGNKWPVELAKISGELRFARG  207

Query  467  WTVFVKDHCLEYGDSLVFRYDG  532
            W  F+ D+ + YG  LVFRYDG
Sbjct  208  WKEFLSDNRIGYGYLLVFRYDG  229



>ref|XP_010266788.1| PREDICTED: B3 domain-containing protein Os01g0723500-like isoform 
X4 [Nelumbo nucifera]
Length=206

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 48/86 (56%), Gaps = 0/86 (0%)
 Frame = +2

Query  281  RKPHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFH  460
            RK +F     P + +++L+IP  F +H+    +G A L    G  W+V + Q   G++  
Sbjct  13   RKHYFFKIMLPGLPTQQLRIPPNFTRHISKRAAGRAILEDRKGYRWFVKLKQTSSGIYLG  72

Query  461  DGWTVFVKDHCLEYGDSLVFRYDGDL  538
            +GW  F+ DH +   + L+FRYDG+L
Sbjct  73   EGWQDFLVDHSILDNEFLLFRYDGNL  98



>ref|XP_010266787.1| PREDICTED: B3 domain-containing protein Os01g0723500-like isoform 
X3 [Nelumbo nucifera]
Length=215

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 48/86 (56%), Gaps = 0/86 (0%)
 Frame = +2

Query  281  RKPHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFH  460
            RK +F     P + +++L+IP  F +H+    +G A L    G  W+V + Q   G++  
Sbjct  13   RKHYFFKIMLPGLPTQQLRIPPNFTRHISKRAAGRAILEDRKGYRWFVKLKQTSSGIYLG  72

Query  461  DGWTVFVKDHCLEYGDSLVFRYDGDL  538
            +GW  F+ DH +   + L+FRYDG+L
Sbjct  73   EGWQDFLVDHSILDNEFLLFRYDGNL  98



>ref|XP_004230835.1| PREDICTED: B3 domain-containing protein Os11g0197600-like isoform 
X1 [Solanum lycopersicum]
Length=286

 Score = 66.6 bits (161),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 50/87 (57%), Gaps = 1/87 (1%)
 Frame = +2

Query  281  RKPHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFH  460
            ++  F   F PSI++E L+IP+ F +H+   +   A+L   SG TW V +   + GL   
Sbjct  11   KRAIFYKVFCPSITNE-LRIPAHFLRHVSEESPDKATLKCLSGGTWNVKLQCDEDGLLIQ  69

Query  461  DGWTVFVKDHCLEYGDSLVFRYDGDLD  541
             GW  F K++ LE G+ LVFRYDG L 
Sbjct  70   KGWKKFQKNNQLENGEYLVFRYDGALQ  96



>ref|XP_010315280.1| PREDICTED: B3 domain-containing protein Os11g0197600-like isoform 
X2 [Solanum lycopersicum]
Length=278

 Score = 66.6 bits (161),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 50/87 (57%), Gaps = 1/87 (1%)
 Frame = +2

Query  281  RKPHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFH  460
            ++  F   F PSI++E L+IP+ F +H+   +   A+L   SG TW V +   + GL   
Sbjct  11   KRAIFYKVFCPSITNE-LRIPAHFLRHVSEESPDKATLKCLSGGTWNVKLQCDEDGLLIQ  69

Query  461  DGWTVFVKDHCLEYGDSLVFRYDGDLD  541
             GW  F K++ LE G+ LVFRYDG L 
Sbjct  70   KGWKKFQKNNQLENGEYLVFRYDGALQ  96



>gb|KJB48488.1| hypothetical protein B456_008G071300 [Gossypium raimondii]
Length=721

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 33/90 (37%), Positives = 50/90 (56%), Gaps = 1/90 (1%)
 Frame = +2

Query  269  MSNGRKPHFLHG-FNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDG  445
            M   + PHF       +I  +KL IP KF +      S    L  PSG+TW+  +++ DG
Sbjct  1    MFASKTPHFFKIILEATIRDKKLGIPRKFVRKYGKGLSSSVLLTVPSGDTWHAQLTKSDG  60

Query  446  GLFFHDGWTVFVKDHCLEYGDSLVFRYDGD  535
             ++F +GW  F + + L+YG  LVFRY+G+
Sbjct  61   VVWFQNGWQAFAEYYSLQYGHFLVFRYEGN  90



>ref|NP_001144632.1| uncharacterized protein LOC100277651 [Zea mays]
 gb|ACG41906.1| hypothetical protein [Zea mays]
Length=498

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 46/86 (53%), Gaps = 4/86 (5%)
 Frame = +2

Query  287  PHFLHGFNPSISSEKLKIPSKFAKHM-DGVTSGMASLVGPSGNTWYVGV---SQLDGGLF  454
            P F   F P  S+E+L+IP+ F +H+ +   +G  SL GPSGN W   +   S+ +    
Sbjct  98   PQFFKVFFPEQSTERLRIPTMFNQHLKEQQPTGAVSLRGPSGNRWQAALASESESEAAWC  157

Query  455  FHDGWTVFVKDHCLEYGDSLVFRYDG  532
            F  GW  FV DH L  G  LVF  DG
Sbjct  158  FEQGWKEFVTDHSLRLGHFLVFTRDG  183



>gb|KDO52155.1| hypothetical protein CISIN_1g020807mg [Citrus sinensis]
Length=321

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 44/83 (53%), Gaps = 0/83 (0%)
 Frame = +2

Query  287  PHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDG  466
            P F   + P  SS +L IP  F  ++  +      L+   G  W+V V+  D G+FF DG
Sbjct  6    PGFFKVYLPEKSSNRLHIPDAFIAYLSPLKPEKVMLINHIGEYWHVNVAYCDKGVFFLDG  65

Query  467  WTVFVKDHCLEYGDSLVFRYDGD  535
            W  FV D+ LE  D LV +YDGD
Sbjct  66   WQKFVNDNSLETADILVLKYDGD  88



>ref|XP_010039406.1| PREDICTED: B3 domain-containing protein At3g06220-like [Eucalyptus 
grandis]
Length=191

 Score = 65.5 bits (158),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 42/67 (63%), Gaps = 0/67 (0%)
 Frame = +2

Query  335  KIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDGWTVFVKDHCLEYGDSL  514
            +IP  F  ++   +     L GPSGN+W V + + +G L+F  GW  FV D+C++ GD L
Sbjct  7    EIPPAFQDYIKDQSPQAILLTGPSGNSWTVALIKEEGALYFGGGWPKFVGDNCVQTGDFL  66

Query  515  VFRYDGD  535
            +FRYDG+
Sbjct  67   IFRYDGE  73



>ref|XP_008440206.1| PREDICTED: putative B3 domain-containing protein At5g66980 isoform 
X3 [Cucumis melo]
Length=215

 Score = 65.5 bits (158),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 46/81 (57%), Gaps = 0/81 (0%)
 Frame = +2

Query  290  HFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDGW  469
             F   F P+ SS+++ IP  F K+ +G     A +   SG +W+V + +L   +FF DGW
Sbjct  20   EFFKVFLPNSSSQRMSIPPAFVKYFNGRIPSEAIIRDQSGKSWHVTLEELKNIVFFKDGW  79

Query  470  TVFVKDHCLEYGDSLVFRYDG  532
              FV  H L+ G  LVF+YDG
Sbjct  80   QEFVDSHHLKRGYFLVFQYDG  100



>ref|XP_006361103.1| PREDICTED: putative B3 domain-containing protein Os03g0621600-like 
[Solanum tuberosum]
Length=253

 Score = 65.9 bits (159),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 43/83 (52%), Gaps = 0/83 (0%)
 Frame = +2

Query  287  PHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDG  466
            P F   F+P I   +L+IP  F K  +G    +  L   +  TW V V + DG  FF + 
Sbjct  15   PEFFKIFHPEICYPQLRIPPAFIKFFNGDIPSICVLEDLAARTWKVVVKRNDGDFFFMES  74

Query  467  WTVFVKDHCLEYGDSLVFRYDGD  535
            W  FV D+ LEYGD L F Y G+
Sbjct  75   WPDFVLDNNLEYGDFLTFSYTGN  97



>ref|XP_010647820.1| PREDICTED: B3 domain-containing protein REM20-like isoform X3 
[Vitis vinifera]
Length=319

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +2

Query  287  PHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDG  466
            P F   + P +S ++++IP+ F KH +G     A L    G  W+V V Q+   ++F  G
Sbjct  9    PEFFKVYLPELSWDRMQIPTAFVKHFNGFVPEKAILRDSVGRVWHVEVGQIGKNVYFLKG  68

Query  467  WTVFVKDHCLEYGDSLVFRYDG  532
            W  F+ D+ +E GD  VF+YDG
Sbjct  69   WQQFLTDNLVEEGDLFVFQYDG  90



>ref|XP_008786201.1| PREDICTED: putative B3 domain-containing protein Os03g0621600 
[Phoenix dactylifera]
Length=622

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 34/83 (41%), Positives = 47/83 (57%), Gaps = 1/83 (1%)
 Frame = +2

Query  290  HFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDGW  469
            HFL   +   S  ++ IP KF K+     S    L GPSGN W+V +S     + F DGW
Sbjct  301  HFLKVMDGDFS-HRMTIPKKFVKNFKEELSQNIQLKGPSGNLWHVRLSNDAEDMIFDDGW  359

Query  470  TVFVKDHCLEYGDSLVFRYDGDL  538
              FV+DH ++  D LVF+Y+G+L
Sbjct  360  KQFVEDHYIKEDDHLVFKYNGNL  382


 Score = 56.6 bits (135),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 29/89 (33%), Positives = 47/89 (53%), Gaps = 9/89 (10%)
 Frame = +2

Query  278  GRKPHF----LHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDG  445
             +KP F    +HGF      E+L+IP  F K++  +    A+L+ P G +W V +   + 
Sbjct  15   AQKPEFFKVLMHGF-----EEELRIPPAFIKYIIDLRGKRATLISPLGKSWSVRIHGHNR  69

Query  446  GLFFHDGWTVFVKDHCLEYGDSLVFRYDG  532
             + F +GW  F + H L+ G  +VF Y+G
Sbjct  70   NMCFREGWPEFARAHDLKMGFFMVFSYEG  98



>ref|XP_009613237.1| PREDICTED: B3 domain-containing protein Os11g0197600-like [Nicotiana 
tomentosiformis]
Length=283

 Score = 65.9 bits (159),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 51/87 (59%), Gaps = 1/87 (1%)
 Frame = +2

Query  281  RKPHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFH  460
            R+  F   FNP++ SE L+IP+ F +H+   +   A+L   SG TW V +   + GL  +
Sbjct  11   RRAVFFKIFNPTVKSE-LRIPAHFLRHISEDSPDKATLKCLSGGTWNVKLHIDENGLLIN  69

Query  461  DGWTVFVKDHCLEYGDSLVFRYDGDLD  541
             GW  F KD+ +E G+ L+FRYDG L 
Sbjct  70   QGWEKFHKDNHIEGGEFLLFRYDGALQ  96



>ref|XP_010266786.1| PREDICTED: putative B3 domain-containing protein Os03g0621600 
isoform X2 [Nelumbo nucifera]
Length=268

 Score = 65.9 bits (159),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 48/86 (56%), Gaps = 0/86 (0%)
 Frame = +2

Query  281  RKPHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFH  460
            RK +F     P + +++L+IP  F +H+    +G A L    G  W+V + Q   G++  
Sbjct  13   RKHYFFKIMLPGLPTQQLRIPPNFTRHISKRAAGRAILEDRKGYRWFVKLKQTSSGIYLG  72

Query  461  DGWTVFVKDHCLEYGDSLVFRYDGDL  538
            +GW  F+ DH +   + L+FRYDG+L
Sbjct  73   EGWQDFLVDHSILDNEFLLFRYDGNL  98



>ref|XP_010263796.1| PREDICTED: B3 domain-containing protein REM16-like [Nelumbo nucifera]
Length=420

 Score = 67.0 bits (162),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 41/68 (60%), Gaps = 0/68 (0%)
 Frame = +2

Query  329  KLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDGWTVFVKDHCLEYGD  508
            KL IP+KF K++    S   +L GP+G  W VG+ +    LFF  GW  FV+DH LE  D
Sbjct  36   KLVIPAKFVKNLKEDLSSPVTLRGPTGKVWKVGLVKAGDSLFFQYGWDEFVEDHNLEEED  95

Query  509  SLVFRYDG  532
             LVFRY G
Sbjct  96   LLVFRYSG  103



>gb|KDP38417.1| hypothetical protein JCGZ_04342 [Jatropha curcas]
Length=336

 Score = 66.6 bits (161),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 46/83 (55%), Gaps = 6/83 (7%)
 Frame = +2

Query  290  HFLH-GFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDG  466
             FLH GF      ++L IP KFA+++        +L  P G  W V ++  +  LFF  G
Sbjct  28   QFLHAGF-----EQRLAIPEKFARNLKSKLPDTVNLKSPCGALWEVSLTANENTLFFDQG  82

Query  467  WTVFVKDHCLEYGDSLVFRYDGD  535
            W  FVKDH L+  D LVF+Y+G+
Sbjct  83   WQEFVKDHSLQENDILVFKYNGE  105



>ref|XP_004969798.1| PREDICTED: B3 domain-containing protein Os01g0723500-like [Setaria 
italica]
Length=408

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 47/95 (49%), Gaps = 11/95 (12%)
 Frame = +2

Query  281  RKPHFLHGFNPSISSEKLKIPSKFAKHMD----------GVTSGMASLVGPSGNTWYVGV  430
            R+PHF          ++LKIP  F KH+              S  A+L GPSG TW V +
Sbjct  15   RRPHFFKVLMGDFK-KRLKIPPDFCKHIPWEASRKARTLKEASMAATLEGPSGQTWLVVI  73

Query  431  SQLDGGLFFHDGWTVFVKDHCLEYGDSLVFRYDGD  535
             +   G FF  GW  FV+D  L   + LVFRYDGD
Sbjct  74   RRSAEGTFFTSGWPKFVRDQALRELEFLVFRYDGD  108



>ref|XP_004153259.1| PREDICTED: B3 domain-containing transcription factor VRN1-like 
[Cucumis sativus]
 ref|XP_004161627.1| PREDICTED: B3 domain-containing transcription factor VRN1-like 
[Cucumis sativus]
 gb|KGN61750.1| hypothetical protein Csa_2G237690 [Cucumis sativus]
Length=412

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 34/98 (35%), Positives = 53/98 (54%), Gaps = 4/98 (4%)
 Frame = +2

Query  245  RTQAFGAEMSNGRKPHFLH-GFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWY  421
            RT  F  +M    +PHF       +I + KL+IP  F + +    S +A+L  P G+ W 
Sbjct  8    RTGGFKRKMP---RPHFHKLVLTSTIQARKLRIPETFVRMIRDELSAVATLTVPDGHVWR  64

Query  422  VGVSQLDGGLFFHDGWTVFVKDHCLEYGDSLVFRYDGD  535
            VG+ + D   +F DGW  F++ + +  G  LVFRY+G+
Sbjct  65   VGLRKADNKFWFEDGWQGFLEHYSIRVGYLLVFRYEGN  102



>ref|XP_010070479.1| PREDICTED: putative B3 domain-containing protein At5g66980 [Eucalyptus 
grandis]
Length=310

 Score = 66.2 bits (160),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 50/93 (54%), Gaps = 1/93 (1%)
 Frame = +2

Query  260  GAEMSNGRKP-HFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQ  436
             A+ S+  +P  F   + PS SS +L IP  F ++  GV    A L   +G +W +G++ 
Sbjct  6    AAKTSSSDEPIEFFKVYLPSFSSHQLLIPPDFVENFKGVVPKKAVLKNTTGRSWPIGIAG  65

Query  437  LDGGLFFHDGWTVFVKDHCLEYGDSLVFRYDGD  535
            +   LF   GW  FV DH L++ D L+FRY  D
Sbjct  66   VGNTLFIKSGWRDFVIDHPLDFADFLIFRYIRD  98



>ref|XP_008440203.1| PREDICTED: putative B3 domain-containing protein At5g66980 isoform 
X1 [Cucumis melo]
Length=305

 Score = 65.9 bits (159),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 46/81 (57%), Gaps = 0/81 (0%)
 Frame = +2

Query  290  HFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDGW  469
             F   F P+ SS+++ IP  F K+ +G     A +   SG +W+V + +L   +FF DGW
Sbjct  20   EFFKVFLPNSSSQRMSIPPAFVKYFNGRIPSEAIIRDQSGKSWHVTLEELKNIVFFKDGW  79

Query  470  TVFVKDHCLEYGDSLVFRYDG  532
              FV  H L+ G  LVF+YDG
Sbjct  80   QEFVDSHHLKRGYFLVFQYDG  100



>emb|CDY40646.1| BnaA03g53170D [Brassica napus]
Length=211

 Score = 64.7 bits (156),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 45/83 (54%), Gaps = 1/83 (1%)
 Frame = +2

Query  287  PHFLHGFNPSISSEKLKIPSKFAKHM-DGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHD  463
            P F   F P  +SE + IP  F +H+ D +    A L G  G  W V   ++ GG +F  
Sbjct  12   PRFFKVFLPETASESMAIPKSFNEHLQDPLPHETAKLQGIGGGVWTVSFKKIRGGAYFTS  71

Query  464  GWTVFVKDHCLEYGDSLVFRYDG  532
            GW+ F +DH L++G+ L F YDG
Sbjct  72   GWSKFAEDHELKHGEFLTFVYDG  94



>ref|XP_010266779.1| PREDICTED: B3 domain-containing protein Os01g0723500-like isoform 
X1 [Nelumbo nucifera]
 ref|XP_010266780.1| PREDICTED: B3 domain-containing protein Os01g0723500-like isoform 
X1 [Nelumbo nucifera]
 ref|XP_010266781.1| PREDICTED: B3 domain-containing protein Os01g0723500-like isoform 
X1 [Nelumbo nucifera]
 ref|XP_010266782.1| PREDICTED: B3 domain-containing protein Os01g0723500-like isoform 
X1 [Nelumbo nucifera]
 ref|XP_010266783.1| PREDICTED: B3 domain-containing protein Os01g0723500-like isoform 
X1 [Nelumbo nucifera]
 ref|XP_010266784.1| PREDICTED: B3 domain-containing protein Os01g0723500-like isoform 
X1 [Nelumbo nucifera]
Length=297

 Score = 65.5 bits (158),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 48/86 (56%), Gaps = 0/86 (0%)
 Frame = +2

Query  281  RKPHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFH  460
            RK +F     P + +++L+IP  F +H+    +G A L    G  W+V + Q   G++  
Sbjct  13   RKHYFFKIMLPGLPTQQLRIPPNFTRHISKRAAGRAILEDRKGYRWFVKLKQTSSGIYLG  72

Query  461  DGWTVFVKDHCLEYGDSLVFRYDGDL  538
            +GW  F+ DH +   + L+FRYDG+L
Sbjct  73   EGWQDFLVDHSILDNEFLLFRYDGNL  98



>ref|XP_004233644.1| PREDICTED: B3 domain-containing protein REM16-like [Solanum lycopersicum]
Length=366

 Score = 66.2 bits (160),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 39/70 (56%), Gaps = 2/70 (3%)
 Frame = +2

Query  329  KLKIPSKFAKHMDGVTS--GMASLVGPSGNTWYVGVSQLDGGLFFHDGWTVFVKDHCLEY  502
            +L+IP KF           G   L GPSGNTW V V + +    F +GW VFVKDH LE 
Sbjct  37   RLRIPQKFVTCFKNSHKLLGQKILTGPSGNTWLVEVIRTEKDYVFCNGWEVFVKDHSLEI  96

Query  503  GDSLVFRYDG  532
             D LVF+ DG
Sbjct  97   ADMLVFKMDG  106



>ref|XP_004231373.1| PREDICTED: B3 domain-containing protein At5g60140-like [Solanum 
lycopersicum]
 ref|XP_004230633.2| PREDICTED: B3 domain-containing protein At5g60140-like [Solanum 
lycopersicum]
Length=336

 Score = 65.9 bits (159),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 49/81 (60%), Gaps = 0/81 (0%)
 Frame = +2

Query  293  FLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDGWT  472
            F+  F+P  S ++LKIP+ F  + +       +L    GN W VGV+++ G L+F  GW 
Sbjct  5    FVKIFSPENSGKRLKIPTSFTYYKNRKLPMKINLRDRFGNMWPVGVNKIGGNLYFQYGWE  64

Query  473  VFVKDHCLEYGDSLVFRYDGD  535
             F++D+ +E GD LVF YDG+
Sbjct  65   KFIEDNSVEVGDFLVFDYDGN  85



>gb|ABF70122.1| transcriptional factor B3 family protein / AT hook motif-containing 
protein [Musa balbisiana]
Length=331

 Score = 65.9 bits (159),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 48/82 (59%), Gaps = 1/82 (1%)
 Frame = +2

Query  293  FLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDGWT  472
             L+G   +I S K +IP KF KH+  V S  A L GPSG+ W+V + +     F   GW 
Sbjct  7    LLYGCFTTIVSWK-RIPPKFLKHISSVGSKKAILQGPSGSKWHVELGKDMKDTFLTTGWP  65

Query  473  VFVKDHCLEYGDSLVFRYDGDL  538
             FVKDH L   + LVF+YDGD+
Sbjct  66   KFVKDHSLREYEFLVFQYDGDM  87



>dbj|BAK05045.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=372

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 44/74 (59%), Gaps = 2/74 (3%)
 Frame = +2

Query  320  SSEKLKIPSKFAKHMDGVTSGMA--SLVGPSGNTWYVGVSQLDGGLFFHDGWTVFVKDHC  493
            S E+++IP KFA    G T       L  PSG TW+VGV+++  GLFF  GW  FVK H 
Sbjct  30   SQERIRIPDKFASSFIGQTQSSRGFRLKAPSGETWHVGVTKVADGLFFSSGWGDFVKAHE  89

Query  494  LEYGDSLVFRYDGD  535
            L+  D LVF + G+
Sbjct  90   LQENDLLVFTFSGN  103



>ref|XP_007017397.1| AP2/B3-like transcriptional factor family protein, putative isoform 
2 [Theobroma cacao]
 gb|EOY14622.1| AP2/B3-like transcriptional factor family protein, putative isoform 
2 [Theobroma cacao]
Length=381

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 42/69 (61%), Gaps = 0/69 (0%)
 Frame = +2

Query  326  EKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDGWTVFVKDHCLEYG  505
            ++L++P KFAK+M        +L GPSG  W VG+      LFF  GW +FVKDH L   
Sbjct  35   QRLEVPEKFAKNMKQKLPETVTLKGPSGIIWDVGLKADGDTLFFDCGWKIFVKDHSLVEN  94

Query  506  DSLVFRYDG  532
            D L+F+Y+G
Sbjct  95   DLLIFKYNG  103



>ref|XP_008386195.1| PREDICTED: B3 domain-containing protein REM16-like [Malus domestica]
Length=288

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 44/72 (61%), Gaps = 1/72 (1%)
 Frame = +2

Query  323  SEKLKIPSKF-AKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDGWTVFVKDHCLE  499
            S+ L+IP  F  K+ +G +     L GPSG    VG+ + + GLFF +GW  FVKDH LE
Sbjct  19   SQGLRIPPAFIRKNFNGRSLCKCDLKGPSGIRRTVGLEERENGLFFRNGWQGFVKDHRLE  78

Query  500  YGDSLVFRYDGD  535
              D LVF YDG+
Sbjct  79   AADVLVFDYDGE  90



>ref|XP_007017396.1| AP2/B3-like transcriptional factor family protein, putative isoform 
1 [Theobroma cacao]
 gb|EOY14621.1| AP2/B3-like transcriptional factor family protein, putative isoform 
1 [Theobroma cacao]
Length=409

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 42/69 (61%), Gaps = 0/69 (0%)
 Frame = +2

Query  326  EKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDGWTVFVKDHCLEYG  505
            ++L++P KFAK+M        +L GPSG  W VG+      LFF  GW +FVKDH L   
Sbjct  63   QRLEVPEKFAKNMKQKLPETVTLKGPSGIIWDVGLKADGDTLFFDCGWKIFVKDHSLVEN  122

Query  506  DSLVFRYDG  532
            D L+F+Y+G
Sbjct  123  DLLIFKYNG  131



>gb|EMT25326.1| B3 domain-containing protein [Aegilops tauschii]
Length=296

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 48/97 (49%), Gaps = 11/97 (11%)
 Frame = +2

Query  272  SNGRKPHFLHGFNPSISSEKLKIPSKFAKHMD----------GVTSGMASLVGPSGNTWY  421
            S  R+PHF          ++LKIP KF KH+              S  A+L GPSG TW 
Sbjct  12   SAERRPHFFKVLIGDFK-KRLKIPPKFCKHIPWEASRKAKGLKEASMAATLEGPSGRTWQ  70

Query  422  VGVSQLDGGLFFHDGWTVFVKDHCLEYGDSLVFRYDG  532
            V + +   G FF  GW  FV+D  L   + LVFR+DG
Sbjct  71   VVIRRTAEGTFFTAGWAKFVQDQALRELEFLVFRHDG  107



>dbj|BAK07954.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=664

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 34/82 (41%), Positives = 46/82 (56%), Gaps = 1/82 (1%)
 Frame = +2

Query  287  PHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDG  466
            P F        S E+  IP    K+++  T G+  L GPSGN W V ++++ G L F  G
Sbjct  192  PQFFRSLITRSSMEQETIPEDCHKYLEECT-GVVYLRGPSGNKWPVELAKISGELCFARG  250

Query  467  WTVFVKDHCLEYGDSLVFRYDG  532
            W  F++DH + YG  LVFRYDG
Sbjct  251  WKEFLRDHRVMYGYLLVFRYDG  272



>ref|XP_010245897.1| PREDICTED: putative B3 domain-containing protein Os03g0621600 
isoform X1 [Nelumbo nucifera]
Length=318

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/104 (34%), Positives = 51/104 (49%), Gaps = 2/104 (2%)
 Frame = +2

Query  230  ILKYGRTQAFG--AEMSNGRKPHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGP  403
            + KY  +   G   + S  ++P F     PS  S+ L+IP  F KH +      + +  P
Sbjct  2    MTKYRCSTQLGNTTKCSRRKRPSFFKVLLPSHYSKLLQIPPPFIKHFNRSVPRRSIIRSP  61

Query  404  SGNTWYVGVSQLDGGLFFHDGWTVFVKDHCLEYGDSLVFRYDGD  535
            +G  W V V +++   +F  GW  FVK H L  GD LVF Y G+
Sbjct  62   TGKCWPVTVKKIEKRFYFQKGWQSFVKHHDLVVGDLLVFSYHGN  105



>ref|XP_003567062.1| PREDICTED: B3 domain-containing protein Os01g0723500-like [Brachypodium 
distachyon]
Length=381

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/101 (39%), Positives = 51/101 (50%), Gaps = 15/101 (15%)
 Frame = +2

Query  272  SNGRKPHFLHGFNPSISSEKLKIPSKFAKHM-------------DGVTSGMASLVGPSGN  412
            + GR+PHF          ++LKIP  F KH+             +  +S  A+L GPSG 
Sbjct  12   TGGRRPHFFKVLIGDFQ-KRLKIPPNFCKHIPWEASTKAKKSLKEASSSMAATLEGPSGR  70

Query  413  TWYVGVSQLDG-GLFFHDGWTVFVKDHCLEYGDSLVFRYDG  532
            TW V + +    G FF  GWT FV+D  L   D LVFR+DG
Sbjct  71   TWPVVIRRTAAEGTFFASGWTKFVQDQALRELDFLVFRHDG  111



>emb|CAN82372.1| hypothetical protein VITISV_027623 [Vitis vinifera]
Length=492

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 45/86 (52%), Gaps = 0/86 (0%)
 Frame = +2

Query  284  KPHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHD  463
            +PHF    +       L+IP  F +H+    S  A+L GPSG+ W V VS    G +   
Sbjct  257  RPHFFKIIHGEDVKRHLRIPPAFMEHLSQEMSNRATLTGPSGSQWRVTVSTDANGTYLQK  316

Query  464  GWTVFVKDHCLEYGDSLVFRYDGDLD  541
            GW  F+K++ L   + L FRYDG++ 
Sbjct  317  GWKQFMKENNLGDSEFLTFRYDGNMQ  342



>ref|XP_006842132.1| hypothetical protein AMTR_s00078p00115450 [Amborella trichopoda]
 gb|ERN03807.1| hypothetical protein AMTR_s00078p00115450 [Amborella trichopoda]
Length=404

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 46/85 (54%), Gaps = 1/85 (1%)
 Frame = +2

Query  284  KPHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHD  463
            +PHFL     + S+  L +P +   H+    S  A LV PSG  W VG+++     F   
Sbjct  26   RPHFLVALVGNFSN-VLALPLELNAHIKEEISENAILVSPSGKIWLVGLNKTKDCAFLQK  84

Query  464  GWTVFVKDHCLEYGDSLVFRYDGDL  538
            GW+ FVK H LE G+ LV RYDG L
Sbjct  85   GWSDFVKGHSLEKGEHLVLRYDGGL  109



>gb|KJB58376.1| hypothetical protein B456_009G207400 [Gossypium raimondii]
Length=240

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 43/68 (63%), Gaps = 0/68 (0%)
 Frame = +2

Query  329  KLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDGWTVFVKDHCLEYGD  508
            +L+IP KFAK++        ++ GPSG  W +G++     LFF+DGW  FV DH LE  D
Sbjct  36   QLEIPEKFAKNIRKKLPETVTVKGPSGIIWDLGLTADGDTLFFNDGWRNFVLDHSLEEND  95

Query  509  SLVFRYDG  532
             L+F+Y+G
Sbjct  96   LLIFKYNG  103



>gb|AFW60660.1| hypothetical protein ZEAMMB73_443682 [Zea mays]
Length=411

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 45/86 (52%), Gaps = 4/86 (5%)
 Frame = +2

Query  287  PHFLHGFNPSISSEKLKIPSKFAKHM-DGVTSGMASLVGPSGNTWYVGV---SQLDGGLF  454
            P F   F P  S+E+L+IP  F +H+ +   +G  SL GPSGN W   +   S+ +    
Sbjct  98   PQFFKVFFPEQSTERLRIPPMFNQHLKEQQPTGAVSLRGPSGNRWQAALASESESEAAWC  157

Query  455  FHDGWTVFVKDHCLEYGDSLVFRYDG  532
            F  GW  FV DH L  G  LVF  DG
Sbjct  158  FDQGWKEFVTDHSLRLGHFLVFTRDG  183



>ref|XP_004167398.1| PREDICTED: putative B3 domain-containing protein At5g66980-like 
[Cucumis sativus]
Length=309

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 45/81 (56%), Gaps = 0/81 (0%)
 Frame = +2

Query  290  HFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDGW  469
             F   F P+ SS+ + IP  F K+ +G     A +   SGN+W+V + +L   + F DGW
Sbjct  20   EFFKVFLPNSSSQSMSIPPAFVKYFNGRIPSEAIIRDQSGNSWHVTLEELKNIVLFKDGW  79

Query  470  TVFVKDHCLEYGDSLVFRYDG  532
              FV  H L+ G  LVF+YDG
Sbjct  80   QEFVDSHHLKRGYFLVFQYDG  100



>gb|KJB17862.1| hypothetical protein B456_003G020000 [Gossypium raimondii]
Length=575

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 32/84 (38%), Positives = 47/84 (56%), Gaps = 1/84 (1%)
 Frame = +2

Query  287  PHFLHG-FNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHD  463
            PHF       +I + KL +P KF K+     S  A L  PSG  W V +++ +G ++F +
Sbjct  20   PHFFKIILQDTIQNGKLGVPRKFVKNQGNSMSSPAMLSVPSGEVWKVELTKCNGKIWFEN  79

Query  464  GWTVFVKDHCLEYGDSLVFRYDGD  535
            GW  F   + L++G  LVFRYDG+
Sbjct  80   GWLEFSNHYSLDFGHLLVFRYDGN  103



>gb|KDP38418.1| hypothetical protein JCGZ_04343 [Jatropha curcas]
Length=361

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 47/83 (57%), Gaps = 6/83 (7%)
 Frame = +2

Query  290  HFLH-GFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDG  466
             FLH GF+      KL IP +F K++        +L GPSGNTW VG+      ++F  G
Sbjct  28   QFLHAGFD-----RKLAIPEQFTKNLRKKLPKTITLKGPSGNTWQVGLMTFHDIVYFIYG  82

Query  467  WTVFVKDHCLEYGDSLVFRYDGD  535
            W  FV DH L+  D L+F+Y+GD
Sbjct  83   WQEFVNDHFLQEKDLLIFKYNGD  105



>ref|NP_001130957.1| hypothetical protein [Zea mays]
 gb|ACF79361.1| unknown [Zea mays]
 gb|ACN26168.1| unknown [Zea mays]
 gb|AFT82639.1| ABI36 ABI3VP1 type transcription factor, partial [Zea mays subsp. 
mays]
 gb|AFW60661.1| hypothetical protein ZEAMMB73_443682 [Zea mays]
Length=503

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 45/86 (52%), Gaps = 4/86 (5%)
 Frame = +2

Query  287  PHFLHGFNPSISSEKLKIPSKFAKHM-DGVTSGMASLVGPSGNTWYVGV---SQLDGGLF  454
            P F   F P  S+E+L+IP  F +H+ +   +G  SL GPSGN W   +   S+ +    
Sbjct  98   PQFFKVFFPEQSTERLRIPPMFNQHLKEQQPTGAVSLRGPSGNRWQAALASESESEAAWC  157

Query  455  FHDGWTVFVKDHCLEYGDSLVFRYDG  532
            F  GW  FV DH L  G  LVF  DG
Sbjct  158  FDQGWKEFVTDHSLRLGHFLVFTRDG  183



>ref|XP_006851101.1| hypothetical protein AMTR_s00025p00247140 [Amborella trichopoda]
 gb|ERN12682.1| hypothetical protein AMTR_s00025p00247140 [Amborella trichopoda]
Length=226

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 41/71 (58%), Gaps = 1/71 (1%)
 Frame = +2

Query  323  SEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDGWTVFVKDHCLEY  502
            S++L IP  F  +   +    A L GPSGN W V V ++ G L F  GW  FVKDH L  
Sbjct  28   SKQLFIPPAFRHNFKKIFHE-AVLEGPSGNNWNVEVEEVRGALCFSRGWKKFVKDHSLND  86

Query  503  GDSLVFRYDGD  535
            GD LVF YDGD
Sbjct  87   GDFLVFYYDGD  97



>ref|XP_008240883.1| PREDICTED: putative B3 domain-containing protein At5g66980 [Prunus 
mume]
Length=292

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 39/70 (56%), Gaps = 0/70 (0%)
 Frame = +2

Query  323  SEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDGWTVFVKDHCLEY  502
            S++L IP  F  H++G      +L  P G+ W V +       FFH+GW  FVKDH LE 
Sbjct  24   SQRLCIPPAFMDHVNGRLPPKCTLRDPRGDCWTVCLEVRGDRFFFHEGWQRFVKDHSLEI  83

Query  503  GDSLVFRYDG  532
             + LVF YDG
Sbjct  84   ANVLVFDYDG  93



>ref|XP_003589270.1| B3 domain-containing protein [Medicago truncatula]
Length=923

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 30/83 (36%), Positives = 48/83 (58%), Gaps = 1/83 (1%)
 Frame = +2

Query  290  HFLHGFNPSIS-SEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDG  466
            HF+     +    ++L +P  F+ ++     G  +L GPSG  W VG++  D  ++F +G
Sbjct  24   HFIQFLQTTTDFQQQLALPKTFSDNLKKKLPGNVTLKGPSGVVWNVGLTARDDTIYFTNG  83

Query  467  WTVFVKDHCLEYGDSLVFRYDGD  535
            W  FVKDH L+  D LVF+Y+G+
Sbjct  84   WQRFVKDHSLKENDFLVFKYNGE  106


 Score = 56.2 bits (134),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 25/75 (33%), Positives = 41/75 (55%), Gaps = 0/75 (0%)
 Frame = +2

Query  311  PSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDGWTVFVKDH  490
            P    ++L +P  F+ +++       +L GP G  W +G+   D  ++F +GW  FV DH
Sbjct  189  PEDFKQQLALPKTFSDNLNKKLPENVTLKGPGGVAWKIGLITRDDTVYFLNGWQRFVNDH  248

Query  491  CLEYGDSLVFRYDGD  535
             L+  D LVF Y+G+
Sbjct  249  SLKDNDFLVFNYNGE  263



>ref|XP_010255064.1| PREDICTED: B3 domain-containing protein REM16-like isoform X2 
[Nelumbo nucifera]
Length=394

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 41/71 (58%), Gaps = 1/71 (1%)
 Frame = +2

Query  326  EKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVG-VSQLDGGLFFHDGWTVFVKDHCLEY  502
            +KL IP KF  H+    S   SL GPSG TW V  V   DG  FF  GW  FV+++ L+ 
Sbjct  35   QKLNIPPKFMHHVKKEISSSVSLRGPSGKTWKVEIVMDEDGRCFFQHGWNTFVQENSLKE  94

Query  503  GDSLVFRYDGD  535
             + LVFRY G+
Sbjct  95   KNVLVFRYTGN  105



>ref|XP_008226603.1| PREDICTED: B3 domain-containing protein Os01g0723500-like, partial 
[Prunus mume]
Length=277

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 40/67 (60%), Gaps = 0/67 (0%)
 Frame = +2

Query  335  KIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDGWTVFVKDHCLEYGDSL  514
            +IP  F K+  G +    SL GPSG    V + + + GLFF  GW  FVK H LE G+ L
Sbjct  4    RIPPAFIKNFSGGSLRKCSLRGPSGKVRAVELEERENGLFFSKGWQGFVKGHHLEVGNFL  63

Query  515  VFRYDGD  535
            VFRYDG+
Sbjct  64   VFRYDGE  70



>ref|XP_006338757.1| PREDICTED: B3 domain-containing protein REM16-like [Solanum tuberosum]
Length=367

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 41/71 (58%), Gaps = 3/71 (4%)
 Frame = +2

Query  329  KLKIPSKFAKHMDGVTS--GMASLVGPSGNTWYVGVSQLDGGLF-FHDGWTVFVKDHCLE  499
            +L+IP KF           G   L GPSGNTW V V + +   + F +GW VFVKDHCLE
Sbjct  37   RLRIPQKFVTCFKNSHKLLGQKILTGPSGNTWLVEVVRTEEDDYVFCNGWEVFVKDHCLE  96

Query  500  YGDSLVFRYDG  532
              D LVF+ DG
Sbjct  97   DADMLVFKMDG  107



>ref|NP_001172546.1| Os01g0723500 [Oryza sativa Japonica Group]
 sp|Q8S2E6.1|Y1235_ORYSJ RecName: Full=B3 domain-containing protein Os01g0723500 [Oryza 
sativa Japonica Group]
 dbj|BAB89497.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAH91276.1| Os01g0723500 [Oryza sativa Japonica Group]
Length=402

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/98 (38%), Positives = 48/98 (49%), Gaps = 11/98 (11%)
 Frame = +2

Query  272  SNGRKPHFLHGFNPSISSEKLKIPSKFAKHMD----------GVTSGMASLVGPSGNTWY  421
            S  R+PHF          ++LKIP  F KH+              S  A+L GPSG TW 
Sbjct  14   SGERRPHFFKVLVGDFK-QRLKIPPNFCKHIPWEESRKAKGLKEASMAATLEGPSGRTWL  72

Query  422  VGVSQLDGGLFFHDGWTVFVKDHCLEYGDSLVFRYDGD  535
            V + +   G FF  GW  FV+D  L   + +VFRYDG+
Sbjct  73   VVIRRTAEGTFFTSGWPKFVQDQALRELEFVVFRYDGN  110



>ref|XP_008459235.1| PREDICTED: B3 domain-containing transcription factor VRN1-like 
[Cucumis melo]
Length=412

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/98 (34%), Positives = 54/98 (55%), Gaps = 4/98 (4%)
 Frame = +2

Query  245  RTQAFGAEMSNGRKPHFLH-GFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWY  421
            RT  F  +M    +PHF     + +I + KL++P  F + +    S +A+L  P G+ W 
Sbjct  8    RTGGFKRKMP---RPHFHKLVLSSTIQARKLRLPETFVRLIRDELSAVATLTVPDGHVWR  64

Query  422  VGVSQLDGGLFFHDGWTVFVKDHCLEYGDSLVFRYDGD  535
            VG+ + D   +F DGW  F++ + +  G  LVFRY+G+
Sbjct  65   VGLRKADNKFWFEDGWQGFLEHYSIRVGYLLVFRYEGN  102



>ref|XP_010255062.1| PREDICTED: B3 domain-containing protein REM16-like isoform X1 
[Nelumbo nucifera]
Length=397

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 41/71 (58%), Gaps = 1/71 (1%)
 Frame = +2

Query  326  EKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVG-VSQLDGGLFFHDGWTVFVKDHCLEY  502
            +KL IP KF  H+    S   SL GPSG TW V  V   DG  FF  GW  FV+++ L+ 
Sbjct  35   QKLNIPPKFMHHVKKEISSSVSLRGPSGKTWKVEIVMDEDGRCFFQHGWNTFVQENSLKE  94

Query  503  GDSLVFRYDGD  535
             + LVFRY G+
Sbjct  95   KNVLVFRYTGN  105



>gb|AES59521.2| plant-specific B3-DNA-binding domain protein [Medicago truncatula]
Length=842

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 30/83 (36%), Positives = 48/83 (58%), Gaps = 1/83 (1%)
 Frame = +2

Query  290  HFLHGFNPSIS-SEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDG  466
            HF+     +    ++L +P  F+ ++     G  +L GPSG  W VG++  D  ++F +G
Sbjct  24   HFIQFLQTTTDFQQQLALPKTFSDNLKKKLPGNVTLKGPSGVVWNVGLTARDDTIYFTNG  83

Query  467  WTVFVKDHCLEYGDSLVFRYDGD  535
            W  FVKDH L+  D LVF+Y+G+
Sbjct  84   WQRFVKDHSLKENDFLVFKYNGE  106


 Score = 56.2 bits (134),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 25/75 (33%), Positives = 41/75 (55%), Gaps = 0/75 (0%)
 Frame = +2

Query  311  PSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDGWTVFVKDH  490
            P    ++L +P  F+ +++       +L GP G  W +G+   D  ++F +GW  FV DH
Sbjct  189  PEDFKQQLALPKTFSDNLNKKLPENVTLKGPGGVAWKIGLITRDDTVYFLNGWQRFVNDH  248

Query  491  CLEYGDSLVFRYDGD  535
             L+  D LVF Y+G+
Sbjct  249  SLKDNDFLVFNYNGE  263



>gb|EEC71407.1| hypothetical protein OsI_03573 [Oryza sativa Indica Group]
Length=401

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/98 (38%), Positives = 48/98 (49%), Gaps = 11/98 (11%)
 Frame = +2

Query  272  SNGRKPHFLHGFNPSISSEKLKIPSKFAKHMD----------GVTSGMASLVGPSGNTWY  421
            S  R+PHF          ++LKIP  F KH+              S  A+L GPSG TW 
Sbjct  13   SGERRPHFFKVLVGDFK-QRLKIPPNFCKHIPWEESRKAKGLKEASMAATLEGPSGRTWL  71

Query  422  VGVSQLDGGLFFHDGWTVFVKDHCLEYGDSLVFRYDGD  535
            V + +   G FF  GW  FV+D  L   + +VFRYDG+
Sbjct  72   VVIRRTAEGTFFTSGWPKFVQDQALRELEFVVFRYDGN  109



>ref|XP_009356789.1| PREDICTED: putative B3 domain-containing protein Os03g0621600 
[Pyrus x bretschneideri]
Length=307

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 46/72 (64%), Gaps = 1/72 (1%)
 Frame = +2

Query  323  SEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFH-DGWTVFVKDHCLE  499
            S+ L+IP  F K++ G++ G  +L GPSG    V + + + GLFF+  GW  FVKDH L+
Sbjct  21   SKHLRIPHAFLKNLSGLSLGKCALKGPSGKRLIVELEERENGLFFYAAGWQDFVKDHLLQ  80

Query  500  YGDSLVFRYDGD  535
             GD LVF Y G+
Sbjct  81   VGDFLVFYYYGE  92



>ref|XP_007047113.1| AP2/B3-like transcriptional factor family protein, putative [Theobroma 
cacao]
 gb|EOX91270.1| AP2/B3-like transcriptional factor family protein, putative [Theobroma 
cacao]
Length=567

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 33/84 (39%), Positives = 47/84 (56%), Gaps = 1/84 (1%)
 Frame = +2

Query  287  PHFLHGFNP-SISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHD  463
            PHF     P ++   KL IP+KF K      S  A L  P+G  W V +++ DG ++  +
Sbjct  19   PHFFKIILPETLRDGKLGIPTKFVKKYGNGMSSPALLKVPNGEVWKVELTKSDGKVWLKN  78

Query  464  GWTVFVKDHCLEYGDSLVFRYDGD  535
            GW  F+  + LEYG  LVFRY+G+
Sbjct  79   GWQEFLNHYSLEYGHFLVFRYEGN  102



>ref|XP_004160514.1| PREDICTED: uncharacterized LOC101221625 [Cucumis sativus]
Length=1043

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 28/65 (43%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +2

Query  338  IPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDGWTVFVKDHCLEYGDSLV  517
            IP  F KH++G     A++   +GN+W + + +LD  L+F +GW  FV  H L+YGD LV
Sbjct  607  IPPAFMKHLNGTFPEKATMQDHTGNSWCITLEKLDDLLYFKNGWKAFVDYHSLKYGDFLV  666

Query  518  FRYDG  532
            F+Y G
Sbjct  667  FQYHG  671


 Score = 48.5 bits (114),  Expect = 0.001, Method: Composition-based stats.
 Identities = 25/71 (35%), Positives = 36/71 (51%), Gaps = 1/71 (1%)
 Frame = +2

Query  314  SISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLD-GGLFFHDGWTVFVKDH  490
            ++   KL IP  F K    + S    L  P G  W +G++  D G ++   GW  F + +
Sbjct  15   NVEDPKLMIPRMFIKSYGKLLSSSVILKLPDGREWKIGLTTSDNGAVWLEKGWDKFSEHY  74

Query  491  CLEYGDSLVFR  523
            CLEYG  LVF+
Sbjct  75   CLEYGFLLVFK  85



>gb|ADN97106.1| reduced vernalization response 1 [Gossypium hirsutum]
Length=375

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 44/74 (59%), Gaps = 0/74 (0%)
 Frame = +2

Query  314  SISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDGWTVFVKDHC  493
            ++  EKL+IP  F K      S  A+L  P G+ W VG+ + D  ++FH+GW  FV+ + 
Sbjct  14   TLQHEKLRIPDNFVKKFGDELSVAAALTVPDGHVWRVGIRRADNKVWFHEGWQEFVERYH  73

Query  494  LEYGDSLVFRYDGD  535
            +  G  LVFRY+G+
Sbjct  74   IRVGYLLVFRYEGN  87



>gb|KJB58378.1| hypothetical protein B456_009G207400 [Gossypium raimondii]
Length=288

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 43/68 (63%), Gaps = 0/68 (0%)
 Frame = +2

Query  329  KLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDGWTVFVKDHCLEYGD  508
            +L+IP KFAK++        ++ GPSG  W +G++     LFF+DGW  FV DH LE  D
Sbjct  36   QLEIPEKFAKNIRKKLPETVTVKGPSGIIWDLGLTADGDTLFFNDGWRNFVLDHSLEEND  95

Query  509  SLVFRYDG  532
             L+F+Y+G
Sbjct  96   LLIFKYNG  103



>ref|XP_004304357.1| PREDICTED: putative B3 domain-containing protein Os03g0621600 
[Fragaria vesca subsp. vesca]
Length=363

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 38/71 (54%), Gaps = 0/71 (0%)
 Frame = +2

Query  323  SEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDGWTVFVKDHCLEY  502
            S++L IP  F K+ +G       L GP GN W V +  +   L FHDGW  F K H LE 
Sbjct  18   SQQLCIPRAFVKNFNGHVPRFCGLRGPCGNLWAVNLKVIRNRLVFHDGWQSFAKHHFLEI  77

Query  503  GDSLVFRYDGD  535
            GD L F  DG+
Sbjct  78   GDFLTFTLDGE  88



>ref|XP_006644645.1| PREDICTED: B3 domain-containing protein Os01g0723500-like [Oryza 
brachyantha]
Length=401

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 37/98 (38%), Positives = 48/98 (49%), Gaps = 11/98 (11%)
 Frame = +2

Query  272  SNGRKPHFLHGFNPSISSEKLKIPSKFAKHMD----------GVTSGMASLVGPSGNTWY  421
            S  R+PHF          ++LKIP  F KH+              S  A+L GPSG TW 
Sbjct  14   SAERRPHFFKVLVGDFK-QRLKIPPNFCKHIPWEESSKAKSLKEASMAATLEGPSGRTWL  72

Query  422  VGVSQLDGGLFFHDGWTVFVKDHCLEYGDSLVFRYDGD  535
            V + +   G FF  GW  FV+D  L   + +VFRYDG+
Sbjct  73   VVIHRTTEGTFFTSGWPKFVQDQALRDLEFVVFRYDGN  110



>gb|KJB58374.1| hypothetical protein B456_009G207400 [Gossypium raimondii]
Length=313

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 43/68 (63%), Gaps = 0/68 (0%)
 Frame = +2

Query  329  KLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDGWTVFVKDHCLEYGD  508
            +L+IP KFAK++        ++ GPSG  W +G++     LFF+DGW  FV DH LE  D
Sbjct  36   QLEIPEKFAKNIRKKLPETVTVKGPSGIIWDLGLTADGDTLFFNDGWRNFVLDHSLEEND  95

Query  509  SLVFRYDG  532
             L+F+Y+G
Sbjct  96   LLIFKYNG  103



>gb|KJB58377.1| hypothetical protein B456_009G207400 [Gossypium raimondii]
Length=310

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 43/68 (63%), Gaps = 0/68 (0%)
 Frame = +2

Query  329  KLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDGWTVFVKDHCLEYGD  508
            +L+IP KFAK++        ++ GPSG  W +G++     LFF+DGW  FV DH LE  D
Sbjct  36   QLEIPEKFAKNIRKKLPETVTVKGPSGIIWDLGLTADGDTLFFNDGWRNFVLDHSLEEND  95

Query  509  SLVFRYDG  532
             L+F+Y+G
Sbjct  96   LLIFKYNG  103



>emb|CDM84156.1| unnamed protein product [Triticum aestivum]
Length=388

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 47/94 (50%), Gaps = 11/94 (12%)
 Frame = +2

Query  281  RKPHFLHGFNPSISSEKLKIPSKFAKHMD----------GVTSGMASLVGPSGNTWYVGV  430
            R+PHF          ++LKIP KF KH+              S  A+L GPSG TW V +
Sbjct  15   RRPHFFKVLIGDFK-KRLKIPPKFCKHIPWEASRKAKGLKEASMAATLEGPSGRTWQVVI  73

Query  431  SQLDGGLFFHDGWTVFVKDHCLEYGDSLVFRYDG  532
             +   G FF  GW  FV+D  L   + LVFR+DG
Sbjct  74   RRTAEGTFFTAGWAKFVQDQALRELEFLVFRHDG  107



>gb|KJB48485.1| hypothetical protein B456_008G071200 [Gossypium raimondii]
Length=621

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 32/90 (36%), Positives = 51/90 (57%), Gaps = 1/90 (1%)
 Frame = +2

Query  269  MSNGRKPHFLHG-FNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDG  445
            M   + PHF     + +I  +KL+IP KF +      S    L  PSG+TW+V +++ DG
Sbjct  12   MFTPKTPHFFKIILDANIRDKKLEIPGKFVRKYGNGLSNSVLLTVPSGDTWHVELTKSDG  71

Query  446  GLFFHDGWTVFVKDHCLEYGDSLVFRYDGD  535
             ++  +GW  F +   L+YG  LVF+Y+G+
Sbjct  72   IVWLQNGWQEFSEYFSLKYGHLLVFKYEGN  101



>ref|XP_011086144.1| PREDICTED: putative B3 domain-containing protein At5g66980 [Sesamum 
indicum]
Length=141

 Score = 61.6 bits (148),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 49/100 (49%), Gaps = 3/100 (3%)
 Frame = +2

Query  236  KYGRTQAFGAEMSNGRKPHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNT  415
            + GR  +     SNG +  F   F P+++S  L IP  F K    +     +L   +G  
Sbjct  13   RRGRPNSKETFSSNGAE--FFKVFLPNVTSHHLMIPPDFVKKCHRIIKERVTLKDTNGKK  70

Query  416  WYVGVSQL-DGGLFFHDGWTVFVKDHCLEYGDSLVFRYDG  532
            W+V V +   G +F  +GW  FV  HCL  GD L+F YDG
Sbjct  71   WHVDVEKTPKGSVFLKNGWQSFVAHHCLTPGDFLLFHYDG  110



>ref|XP_006403705.1| hypothetical protein EUTSA_v10010633mg [Eutrema salsugineum]
 gb|ESQ45158.1| hypothetical protein EUTSA_v10010633mg [Eutrema salsugineum]
Length=270

 Score = 63.5 bits (153),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 44/82 (54%), Gaps = 0/82 (0%)
 Frame = +2

Query  287  PHFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDG  466
            P F   F    SSE ++IP  F +H++      A L G  G  W VG ++    ++F DG
Sbjct  11   PRFFKVFLSETSSESMRIPVSFNEHLEDPLPRTAKLHGTGGGIWTVGFTKRRKRVYFTDG  70

Query  467  WTVFVKDHCLEYGDSLVFRYDG  532
            W+ F +DH L+ G+ L F YDG
Sbjct  71   WSKFAEDHDLKDGEFLTFVYDG  92



>gb|KJB48487.1| hypothetical protein B456_008G071200 [Gossypium raimondii]
Length=719

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 32/90 (36%), Positives = 51/90 (57%), Gaps = 1/90 (1%)
 Frame = +2

Query  269  MSNGRKPHFLHG-FNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDG  445
            M   + PHF     + +I  +KL+IP KF +      S    L  PSG+TW+V +++ DG
Sbjct  1    MFTPKTPHFFKIILDANIRDKKLEIPGKFVRKYGNGLSNSVLLTVPSGDTWHVELTKSDG  60

Query  446  GLFFHDGWTVFVKDHCLEYGDSLVFRYDGD  535
             ++  +GW  F +   L+YG  LVF+Y+G+
Sbjct  61   IVWLQNGWQEFSEYFSLKYGHLLVFKYEGN  90



>gb|KJB48484.1| hypothetical protein B456_008G071200 [Gossypium raimondii]
Length=730

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 32/90 (36%), Positives = 51/90 (57%), Gaps = 1/90 (1%)
 Frame = +2

Query  269  MSNGRKPHFLHG-FNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDG  445
            M   + PHF     + +I  +KL+IP KF +      S    L  PSG+TW+V +++ DG
Sbjct  12   MFTPKTPHFFKIILDANIRDKKLEIPGKFVRKYGNGLSNSVLLTVPSGDTWHVELTKSDG  71

Query  446  GLFFHDGWTVFVKDHCLEYGDSLVFRYDGD  535
             ++  +GW  F +   L+YG  LVF+Y+G+
Sbjct  72   IVWLQNGWQEFSEYFSLKYGHLLVFKYEGN  101



>gb|KJB48486.1| hypothetical protein B456_008G071200 [Gossypium raimondii]
Length=732

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 32/90 (36%), Positives = 51/90 (57%), Gaps = 1/90 (1%)
 Frame = +2

Query  269  MSNGRKPHFLHG-FNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDG  445
            M   + PHF     + +I  +KL+IP KF +      S    L  PSG+TW+V +++ DG
Sbjct  14   MFTPKTPHFFKIILDANIRDKKLEIPGKFVRKYGNGLSNSVLLTVPSGDTWHVELTKSDG  73

Query  446  GLFFHDGWTVFVKDHCLEYGDSLVFRYDGD  535
             ++  +GW  F +   L+YG  LVF+Y+G+
Sbjct  74   IVWLQNGWQEFSEYFSLKYGHLLVFKYEGN  103



>ref|XP_004142021.1| PREDICTED: uncharacterized protein LOC101221625 [Cucumis sativus]
Length=1322

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 28/65 (43%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +2

Query  338  IPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDGWTVFVKDHCLEYGDSLV  517
            IP  F KH++G     A++   +GN+W + + +LD  L+F +GW  FV  H L+YGD LV
Sbjct  720  IPPAFMKHLNGTFPEKATMQDHTGNSWCITLEKLDDLLYFKNGWKAFVDYHSLKYGDFLV  779

Query  518  FRYDG  532
            F+Y G
Sbjct  780  FQYHG  784



>gb|KCW63848.1| hypothetical protein EUGRSUZ_G01517 [Eucalyptus grandis]
Length=321

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 50/84 (60%), Gaps = 1/84 (1%)
 Frame = +2

Query  284  KPHFLH-GFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFH  460
            +P+F     + +I  ++L+IP  F K      S +A+L  P G+ W+VG+ + +  L+FH
Sbjct  3    RPYFYKLVLSSTIQDKRLRIPENFVKKFRDELSSVATLNVPDGHVWHVGIRKSESKLWFH  62

Query  461  DGWTVFVKDHCLEYGDSLVFRYDG  532
            +GW  FV+ + +  G  LVFRY+G
Sbjct  63   EGWQEFVQHYSIGIGYFLVFRYEG  86



>gb|KDP46179.1| hypothetical protein JCGZ_10019 [Jatropha curcas]
Length=402

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 44/73 (60%), Gaps = 0/73 (0%)
 Frame = +2

Query  317  ISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDGWTVFVKDHCL  496
            +  +KLKIP KF K      S +A+L  P+G  W V + + DG L+FH+GW  FV+ + +
Sbjct  29   LKDKKLKIPEKFVKKYGDELSSIATLTVPNGRIWLVELEKKDGKLWFHNGWHEFVEYYSV  88

Query  497  EYGDSLVFRYDGD  535
              G  LVF+Y GD
Sbjct  89   RLGYFLVFKYGGD  101



>ref|XP_008380676.1| PREDICTED: B3 domain-containing protein REM10-like [Malus domestica]
Length=275

 Score = 63.2 bits (152),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 43/74 (58%), Gaps = 1/74 (1%)
 Frame = +2

Query  323  SEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVS-QLDGGLFFHDGWTVFVKDHCLE  499
            S  L +P  F ++ +G      +L GPSG +W VG+  + DG  FF  GW  FV DH LE
Sbjct  25   SRHLCLPPLFMENFNGRPPCKCTLRGPSGESWTVGLEGRKDGKFFFRKGWRHFVGDHLLE  84

Query  500  YGDSLVFRYDGDLD  541
             G+ LVF YDG+ +
Sbjct  85   IGNFLVFEYDGNTN  98



>ref|XP_010279604.1| PREDICTED: B3 domain-containing transcription factor VRN1-like 
[Nelumbo nucifera]
Length=441

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 42/70 (60%), Gaps = 0/70 (0%)
 Frame = +2

Query  329  KLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDGWTVFVKDHCLEYGD  508
            K++IP  F KH+   +S   +L  P G+ W+  +S+   G+F  DGW  F++D  L   +
Sbjct  174  KMRIPPAFVKHVSEKSSERVTLECPGGDIWHAKLSRRADGMFIEDGWEKFLRDQSLGDEE  233

Query  509  SLVFRYDGDL  538
             LVFRY+GDL
Sbjct  234  FLVFRYNGDL  243


 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 44/72 (61%), Gaps = 1/72 (1%)
 Frame = +2

Query  326  EKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQ-LDGGLFFHDGWTVFVKDHCLEY  502
            ++L+IP  F KH+   +SG   L GP+   W+V +++ ++G LF  DGW  F  D  L  
Sbjct  25   QRLRIPHAFVKHISEESSGRVILEGPNHGIWHVKLNKTMNGILFLEDGWEKFSTDSSLRL  84

Query  503  GDSLVFRYDGDL  538
            G+ L+F+Y GD+
Sbjct  85   GEFLIFKYKGDI  96



>gb|KJB58381.1| hypothetical protein B456_009G207400 [Gossypium raimondii]
Length=347

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 43/68 (63%), Gaps = 0/68 (0%)
 Frame = +2

Query  329  KLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDGWTVFVKDHCLEYGD  508
            +L+IP KFAK++        ++ GPSG  W +G++     LFF+DGW  FV DH LE  D
Sbjct  36   QLEIPEKFAKNIRKKLPETVTVKGPSGIIWDLGLTADGDTLFFNDGWRNFVLDHSLEEND  95

Query  509  SLVFRYDG  532
             L+F+Y+G
Sbjct  96   LLIFKYNG  103



>emb|CDP07597.1| unnamed protein product [Coffea canephora]
Length=345

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 40/68 (59%), Gaps = 0/68 (0%)
 Frame = +2

Query  329  KLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDGGLFFHDGWTVFVKDHCLEYGD  508
            +L IP KFA ++     G  SL GPSG  W  G++ +D  L+  +GW  FV DH L+  D
Sbjct  37   QLAIPQKFANNLKEKLVGAVSLKGPSGLEWKAGLTMIDDTLYLKEGWKKFVVDHSLKEND  96

Query  509  SLVFRYDG  532
             L+F+Y G
Sbjct  97   VLIFKYVG  104



>ref|XP_007147158.1| hypothetical protein PHAVU_006G100700g [Phaseolus vulgaris]
 gb|ESW19152.1| hypothetical protein PHAVU_006G100700g [Phaseolus vulgaris]
Length=297

 Score = 63.5 bits (153),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 32/89 (36%), Positives = 49/89 (55%), Gaps = 1/89 (1%)
 Frame = +2

Query  269  MSNGRKP-HFLHGFNPSISSEKLKIPSKFAKHMDGVTSGMASLVGPSGNTWYVGVSQLDG  445
            M + R+   F   F  + +S +L+IP+ F K  +G+      L+   G  W V + +++G
Sbjct  1    MESARQALEFFKVFLLNKASTQLQIPTSFTKFFNGIAPCKIILIDHDGKCWDVKLEKIEG  60

Query  446  GLFFHDGWTVFVKDHCLEYGDSLVFRYDG  532
             L F +GW  F K+  LE GD LVF+YDG
Sbjct  61   RLVFKNGWQQFAKEKNLEEGDFLVFQYDG  89



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 579015689490