BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002B12

Length=422
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009602752.1|  PREDICTED: aldo-keto reductase family 4 memb...    163   4e-46   Nicotiana tomentosiformis
ref|XP_009791583.1|  PREDICTED: aldo-keto reductase family 4 memb...    163   4e-46   Nicotiana sylvestris
ref|XP_009621148.1|  PREDICTED: aldo-keto reductase family 4 memb...    157   5e-44   
gb|EYU41765.1|  hypothetical protein MIMGU_mgv1a010335mg                157   1e-43   Erythranthe guttata [common monkey flower]
ref|XP_002529872.1|  aldo-keto reductase, putative                      156   2e-43   
gb|AFK48248.1|  unknown                                                 156   2e-43   Lotus japonicus
ref|XP_010509278.1|  PREDICTED: aldo-keto reductase family 4 memb...    155   3e-43   Camelina sativa [gold-of-pleasure]
ref|XP_011094913.1|  PREDICTED: aldo-keto reductase family 4 memb...    155   5e-43   Sesamum indicum [beniseed]
emb|CAC32834.1|  aldose reductase                                       155   5e-43   Digitalis purpurea
emb|CAC32835.1|  aldose reductase                                       155   5e-43   Digitalis purpurea
ref|XP_010505375.1|  PREDICTED: aldo-keto reductase family 4 memb...    154   8e-43   
ref|XP_004509601.1|  PREDICTED: aldo-keto reductase family 4 memb...    153   2e-42   Cicer arietinum [garbanzo]
gb|EYU41764.1|  hypothetical protein MIMGU_mgv1a010256mg                153   3e-42   Erythranthe guttata [common monkey flower]
dbj|BAG97587.1|  unnamed protein product                                153   3e-42   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011094911.1|  PREDICTED: aldo-keto reductase family 4 memb...    152   4e-42   Sesamum indicum [beniseed]
ref|XP_010509276.1|  PREDICTED: aldo-keto reductase family 4 memb...    152   6e-42   
ref|XP_002529871.1|  aldo-keto reductase, putative                      152   6e-42   
ref|XP_009143448.1|  PREDICTED: aldo-keto reductase family 4 memb...    152   6e-42   Brassica rapa
emb|CDX74934.1|  BnaA05g06800D                                          152   7e-42   
emb|CDY57141.1|  BnaC04g53480D                                          152   1e-41   Brassica napus [oilseed rape]
ref|XP_006294573.1|  hypothetical protein CARUB_v10023609mg             152   1e-41   
ref|NP_001055731.2|  Os05g0456300                                       150   2e-41   
gb|EPS58903.1|  hypothetical protein M569_15909                         150   3e-41   Genlisea aurea
ref|XP_010937542.1|  PREDICTED: aldo-keto reductase family 4 memb...    150   4e-41   Elaeis guineensis
ref|XP_008785508.1|  PREDICTED: aldo-keto reductase family 4 memb...    144   4e-41   Phoenix dactylifera
gb|KJB76789.1|  hypothetical protein B456_012G107300                    147   5e-41   Gossypium raimondii
gb|KDP24556.1|  hypothetical protein JCGZ_25120                         150   6e-41   Jatropha curcas
emb|CDY64988.1|  BnaA05g34870D                                          149   6e-41   Brassica napus [oilseed rape]
dbj|BAJ94780.1|  predicted protein                                      149   6e-41   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ33839.1|  unnamed protein product                                149   6e-41   Eutrema halophilum
ref|XP_006410968.1|  hypothetical protein EUTSA_v10016962mg             149   8e-41   Eutrema salsugineum [saltwater cress]
ref|XP_003516897.1|  PREDICTED: aldo-keto reductase family 4 memb...    149   9e-41   Glycine max [soybeans]
ref|XP_011094910.1|  PREDICTED: aldo-keto reductase family 4 memb...    149   9e-41   Sesamum indicum [beniseed]
ref|XP_006645007.1|  PREDICTED: aldo-keto reductase family 4 memb...    149   1e-40   Oryza brachyantha
ref|XP_006294635.1|  hypothetical protein CARUB_v10023673mg             149   1e-40   Capsella rubella
ref|XP_009143450.1|  PREDICTED: aldo-keto reductase family 4 memb...    149   1e-40   Brassica rapa
gb|ACG28331.1|  aldose reductase                                        148   1e-40   Zea mays [maize]
ref|XP_002273035.1|  PREDICTED: aldo-keto reductase family 4 memb...    149   1e-40   Vitis vinifera
ref|XP_007205595.1|  hypothetical protein PRUPE_ppa008899mg             149   1e-40   
emb|CDP17857.1|  unnamed protein product                                149   1e-40   Coffea canephora [robusta coffee]
ref|NP_181313.3|  aldo-keto reductase family 4 member C9                148   1e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008785509.1|  PREDICTED: aldo-keto reductase family 4 memb...    143   1e-40   
ref|XP_008387820.1|  PREDICTED: aldo-keto reductase family 4 memb...    148   2e-40   
ref|XP_002456633.1|  hypothetical protein SORBIDRAFT_03g039770          148   2e-40   Sorghum bicolor [broomcorn]
gb|AAC23647.1|  putative alcohol dehydrogenase                          147   2e-40   Arabidopsis thaliana [mouse-ear cress]
gb|EYU41763.1|  hypothetical protein MIMGU_mgv1a010332mg                148   2e-40   Erythranthe guttata [common monkey flower]
ref|XP_010256789.1|  PREDICTED: aldo-keto reductase family 4 memb...    148   2e-40   Nelumbo nucifera [Indian lotus]
ref|XP_003520905.1|  PREDICTED: aldo-keto reductase family 4 memb...    148   3e-40   
ref|XP_004302710.1|  PREDICTED: aldo-keto reductase family 4 memb...    148   3e-40   Fragaria vesca subsp. vesca
ref|XP_010044002.1|  PREDICTED: aldo-keto reductase family 4 memb...    148   3e-40   Eucalyptus grandis [rose gum]
emb|CDY59481.1|  BnaC03g72040D                                          148   3e-40   Brassica napus [oilseed rape]
emb|CDM85016.1|  unnamed protein product                                148   3e-40   Triticum aestivum [Canadian hard winter wheat]
gb|ACG39768.1|  aldose reductase                                        148   3e-40   Zea mays [maize]
ref|NP_001240076.1|  uncharacterized protein LOC100781137               148   3e-40   Glycine max [soybeans]
ref|NP_001105982.1|  aldo-keto reductase family 1, member B1            147   3e-40   Zea mays [maize]
ref|XP_008350456.1|  PREDICTED: aldo-keto reductase family 4 memb...    148   3e-40   
ref|XP_004970568.1|  PREDICTED: aldo-keto reductase family 4 memb...    147   3e-40   Setaria italica
ref|XP_009133204.1|  PREDICTED: aldo-keto reductase family 4 memb...    147   3e-40   Brassica rapa
dbj|BAB64275.1|  putative aldose reductase                              147   3e-40   Oryza sativa Japonica Group [Japonica rice]
emb|CDY07771.1|  BnaA03g17400D                                          147   3e-40   Brassica napus [oilseed rape]
gb|KHN22181.1|  Aldo-keto reductase family 4 member C9                  147   3e-40   Glycine soja [wild soybean]
ref|XP_010038915.1|  PREDICTED: aldo-keto reductase family 4 memb...    147   3e-40   
gb|EMS47119.1|  Aldo-keto reductase family 4 member C10                 147   4e-40   Triticum urartu
ref|XP_009358771.1|  PREDICTED: aldo-keto reductase family 4 memb...    147   4e-40   Pyrus x bretschneideri [bai li]
ref|NP_001031505.1|  aldo-keto reductase family 4 member C9             147   4e-40   Arabidopsis thaliana [mouse-ear cress]
emb|CDM80750.1|  unnamed protein product                                147   5e-40   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009402310.1|  PREDICTED: aldo-keto reductase family 4 memb...    147   5e-40   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008350454.1|  PREDICTED: aldo-keto reductase family 4 memb...    147   6e-40   
ref|NP_001044799.1|  Os01g0847700                                       147   6e-40   
pdb|3H7U|A  Chain A, Crystal Structure Of The Plant Stress-Respon...    147   7e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002879708.1|  oxidoreductase                                     147   7e-40   
ref|XP_003520967.1|  PREDICTED: aldo-keto reductase family 4 memb...    147   7e-40   Glycine max [soybeans]
ref|XP_003604914.1|  Aldose reductase                                   146   8e-40   
gb|KJB76787.1|  hypothetical protein B456_012G107300                    147   9e-40   Gossypium raimondii
ref|XP_006340994.1|  PREDICTED: aldo-keto reductase family 4 memb...    146   1e-39   Solanum tuberosum [potatoes]
gb|KJB76793.1|  hypothetical protein B456_012G107500                    144   1e-39   Gossypium raimondii
gb|KHG06616.1|  Aldo-keto reductase family 4 member C9                  145   1e-39   Gossypium arboreum [tree cotton]
gb|KJB76786.1|  hypothetical protein B456_012G107200                    144   1e-39   Gossypium raimondii
ref|XP_007205596.1|  hypothetical protein PRUPE_ppa008905mg             146   1e-39   Prunus persica
gb|EMS66725.1|  Aldo-keto reductase family 4 member C10                 146   1e-39   Triticum urartu
ref|XP_004506627.1|  PREDICTED: aldo-keto reductase family 4 memb...    145   1e-39   
ref|XP_002529870.1|  aldo-keto reductase, putative                      146   1e-39   Ricinus communis
gb|KCW84681.1|  hypothetical protein EUGRSUZ_B01498                     145   1e-39   Eucalyptus grandis [rose gum]
dbj|BAJ90871.1|  predicted protein                                      146   1e-39   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KHN43834.1|  Aldo-keto reductase family 4 member C9                  146   1e-39   Glycine soja [wild soybean]
ref|XP_010517055.1|  PREDICTED: aldo-keto reductase family 4 memb...    146   1e-39   Camelina sativa [gold-of-pleasure]
ref|XP_003516896.1|  PREDICTED: aldo-keto reductase family 4 memb...    146   1e-39   Glycine max [soybeans]
ref|XP_003604913.1|  Aldose reductase                                   146   2e-39   Medicago truncatula
gb|ACJ84681.1|  unknown                                                 145   2e-39   Medicago truncatula
gb|KFK36670.1|  hypothetical protein AALP_AA4G154600                    145   2e-39   Arabis alpina [alpine rockcress]
ref|XP_010038908.1|  PREDICTED: aldo-keto reductase family 4 memb...    145   2e-39   Eucalyptus grandis [rose gum]
ref|XP_007134071.1|  hypothetical protein PHAVU_010G017100g             145   2e-39   Phaseolus vulgaris [French bean]
ref|XP_004506626.1|  PREDICTED: aldo-keto reductase family 4 memb...    145   2e-39   Cicer arietinum [garbanzo]
gb|EEC71799.1|  hypothetical protein OsI_04428                          145   3e-39   Oryza sativa Indica Group [Indian rice]
ref|XP_008674825.1|  PREDICTED: aldo-keto reductase family 4 memb...    145   3e-39   
ref|XP_006654504.1|  PREDICTED: aldo-keto reductase family 4 memb...    145   4e-39   Oryza brachyantha
ref|XP_007134074.1|  hypothetical protein PHAVU_010G017400g             145   4e-39   Phaseolus vulgaris [French bean]
ref|XP_010517053.1|  PREDICTED: aldo-keto reductase family 4 memb...    145   4e-39   Camelina sativa [gold-of-pleasure]
ref|XP_010038899.1|  PREDICTED: aldo-keto reductase family 4 memb...    145   4e-39   Eucalyptus grandis [rose gum]
ref|XP_007134066.1|  hypothetical protein PHAVU_010G016600g             144   5e-39   Phaseolus vulgaris [French bean]
gb|KFK36672.1|  hypothetical protein AALP_AA4G154800                    144   6e-39   Arabis alpina [alpine rockcress]
gb|KDO48136.1|  hypothetical protein CISIN_1g021241mg                   144   7e-39   Citrus sinensis [apfelsine]
ref|XP_009358775.1|  PREDICTED: aldo-keto reductase family 4 memb...    144   7e-39   Pyrus x bretschneideri [bai li]
ref|XP_009133205.1|  PREDICTED: aldo-keto reductase family 4 memb...    144   7e-39   Brassica rapa
ref|XP_006429181.1|  hypothetical protein CICLE_v10012243mg             144   7e-39   Citrus clementina [clementine]
ref|XP_010088583.1|  Aldo-keto reductase family 4 member C9             143   8e-39   
ref|XP_008448277.1|  PREDICTED: aldo-keto reductase family 4 memb...    144   8e-39   Cucumis melo [Oriental melon]
gb|KJB76792.1|  hypothetical protein B456_012G107500                    144   8e-39   Gossypium raimondii
ref|XP_010529794.1|  PREDICTED: aldo-keto reductase family 4 memb...    145   9e-39   Tarenaya hassleriana [spider flower]
ref|XP_004166957.1|  PREDICTED: aldo-keto reductase family 4 memb...    144   1e-38   
gb|KGN54282.1|  hypothetical protein Csa_4G296840                       143   1e-38   Cucumis sativus [cucumbers]
ref|XP_006410969.1|  hypothetical protein EUTSA_v10017980mg             144   1e-38   Eutrema salsugineum [saltwater cress]
ref|XP_002272909.1|  PREDICTED: aldo-keto reductase family 4 memb...    144   1e-38   Vitis vinifera
ref|XP_007026920.1|  NAD(P)-linked oxidoreductase superfamily pro...    150   1e-38   
ref|XP_007026919.1|  NAD(P)-linked oxidoreductase superfamily pro...    150   1e-38   
emb|CDY57148.1|  BnaC04g53540D                                          147   1e-38   Brassica napus [oilseed rape]
gb|KJB76791.1|  hypothetical protein B456_012G107500                    143   1e-38   Gossypium raimondii
gb|KCW84679.1|  hypothetical protein EUGRSUZ_B01497                     143   1e-38   Eucalyptus grandis [rose gum]
ref|XP_004253294.1|  PREDICTED: aldo-keto reductase family 4 memb...    140   2e-38   
ref|XP_002862967.1|  hypothetical protein ARALYDRAFT_333154             144   2e-38   
ref|XP_010232559.1|  PREDICTED: aldo-keto reductase family 4 memb...    143   2e-38   Brachypodium distachyon [annual false brome]
ref|XP_004166956.1|  PREDICTED: aldo-keto reductase family 4 memb...    143   2e-38   
ref|XP_004142054.1|  PREDICTED: aldo-keto reductase family 4 memb...    143   2e-38   
ref|XP_009358774.1|  PREDICTED: aldo-keto reductase family 4 memb...    143   2e-38   Pyrus x bretschneideri [bai li]
ref|XP_006410971.1|  hypothetical protein EUTSA_v10016967mg             142   3e-38   Eutrema salsugineum [saltwater cress]
gb|EMT22693.1|  Alcohol dehydrogenase (NADP+) A                         142   3e-38   
gb|EEC71798.1|  hypothetical protein OsI_04426                          141   3e-38   Oryza sativa Indica Group [Indian rice]
emb|CDY07770.1|  BnaA03g17410D                                          142   3e-38   Brassica napus [oilseed rape]
gb|KJB76785.1|  hypothetical protein B456_012G107200                    142   3e-38   Gossypium raimondii
ref|XP_004246435.1|  PREDICTED: aldo-keto reductase family 4 memb...    142   3e-38   
emb|CAA66205.1|  orf                                                    142   4e-38   Medicago sativa [alfalfa]
gb|KHG05402.1|  Aldo-keto reductase family 4 member C9                  142   4e-38   Gossypium arboreum [tree cotton]
ref|XP_008387824.1|  PREDICTED: aldo-keto reductase family 4 memb...    142   4e-38   
ref|XP_010505374.1|  PREDICTED: aldo-keto reductase family 4 memb...    142   6e-38   Camelina sativa [gold-of-pleasure]
gb|KCW86006.1|  hypothetical protein EUGRSUZ_B02711                     139   6e-38   Eucalyptus grandis [rose gum]
ref|XP_006340995.1|  PREDICTED: aldo-keto reductase family 4 memb...    142   6e-38   Solanum tuberosum [potatoes]
ref|XP_011466525.1|  PREDICTED: aldo-keto reductase family 4 memb...    141   7e-38   Fragaria vesca subsp. vesca
gb|KEH20249.1|  aldo/keto reductase family oxidoreductase               142   8e-38   Medicago truncatula
dbj|BAB64273.1|  putative aldose reductase                              141   1e-37   Oryza sativa Japonica Group [Japonica rice]
gb|KDP24551.1|  hypothetical protein JCGZ_25115                         141   1e-37   Jatropha curcas
ref|XP_006846375.1|  hypothetical protein AMTR_s00012p00262860          141   1e-37   Amborella trichopoda
ref|XP_008448265.1|  PREDICTED: LOW QUALITY PROTEIN: aldo-keto re...    141   1e-37   Cucumis melo [Oriental melon]
ref|XP_002529867.1|  aldo-keto reductase, putative                      140   2e-37   Ricinus communis
ref|XP_007134069.1|  hypothetical protein PHAVU_010G016900g             140   2e-37   Phaseolus vulgaris [French bean]
ref|XP_011466526.1|  PREDICTED: aldo-keto reductase family 4 memb...    140   2e-37   Fragaria vesca subsp. vesca
ref|XP_004302708.2|  PREDICTED: aldo-keto reductase family 4 memb...    140   2e-37   Fragaria vesca subsp. vesca
ref|XP_006429178.1|  hypothetical protein CICLE_v10012242mg             140   2e-37   Citrus clementina [clementine]
gb|ACJ84357.1|  unknown                                                 138   2e-37   Medicago truncatula
ref|XP_009346418.1|  PREDICTED: aldo-keto reductase family 4 memb...    140   2e-37   Pyrus x bretschneideri [bai li]
ref|NP_181315.2|  aldo-keto reductase family 4 member C10               140   2e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010235188.1|  PREDICTED: aldo-keto reductase family 4 memb...    140   2e-37   Brachypodium distachyon [annual false brome]
gb|KDO48137.1|  hypothetical protein CISIN_1g021264mg                   140   2e-37   Citrus sinensis [apfelsine]
ref|XP_008240395.1|  PREDICTED: aldo-keto reductase family 4 memb...    140   2e-37   Prunus mume [ume]
ref|XP_006493578.1|  PREDICTED: aldo-keto reductase family 4 memb...    140   2e-37   Citrus sinensis [apfelsine]
gb|ACN37066.1|  unknown                                                 137   3e-37   Zea mays [maize]
ref|XP_010509274.1|  PREDICTED: aldo-keto reductase family 4 memb...    139   4e-37   Camelina sativa [gold-of-pleasure]
ref|XP_010043997.1|  PREDICTED: aldo-keto reductase family 4 memb...    139   5e-37   Eucalyptus grandis [rose gum]
gb|EMT09403.1|  Aldose reductase                                        139   5e-37   
ref|XP_004302706.1|  PREDICTED: aldo-keto reductase family 4 memb...    139   6e-37   Fragaria vesca subsp. vesca
gb|ACN27137.1|  unknown                                                 137   6e-37   Zea mays [maize]
ref|XP_007134073.1|  hypothetical protein PHAVU_010G017300g             139   6e-37   Phaseolus vulgaris [French bean]
ref|XP_004302704.1|  PREDICTED: aldo-keto reductase family 4 memb...    139   7e-37   Fragaria vesca subsp. vesca
ref|XP_002441210.1|  hypothetical protein SORBIDRAFT_09g022370          140   7e-37   
gb|EMT09404.1|  Aldose reductase                                        139   7e-37   
ref|XP_006576246.1|  PREDICTED: uncharacterized protein LOC100809...    139   8e-37   
ref|XP_010231310.1|  PREDICTED: aldo-keto reductase family 4 memb...    138   1e-36   Brachypodium distachyon [annual false brome]
ref|XP_002863483.1|  predicted protein                                  140   1e-36   
gb|EMS64417.1|  Aldo-keto reductase family 4 member C10                 139   1e-36   Triticum urartu
ref|XP_010262633.1|  PREDICTED: aldo-keto reductase family 4 memb...    138   1e-36   Nelumbo nucifera [Indian lotus]
gb|AFK44784.1|  unknown                                                 138   1e-36   Medicago truncatula
gb|AFW78248.1|  putative oxidoreductase, aldo/keto reductase fami...    137   2e-36   
ref|XP_006846379.1|  hypothetical protein AMTR_s00012p00263360          138   2e-36   Amborella trichopoda
ref|XP_010529793.1|  PREDICTED: aldo-keto reductase family 4 memb...    137   2e-36   Tarenaya hassleriana [spider flower]
gb|AFW78251.1|  putative oxidoreductase, aldo/keto reductase fami...    137   3e-36   
ref|XP_007134072.1|  hypothetical protein PHAVU_010G017200g             137   3e-36   Phaseolus vulgaris [French bean]
ref|XP_004172647.1|  PREDICTED: aldo-keto reductase family 4 memb...    137   3e-36   
ref|XP_004172864.1|  PREDICTED: aldo-keto reductase family 4 memb...    135   5e-36   
ref|XP_008350448.1|  PREDICTED: aldo-keto reductase family 4 memb...    137   5e-36   
ref|XP_008387819.1|  PREDICTED: aldo-keto reductase family 4 memb...    137   5e-36   
ref|XP_007134068.1|  hypothetical protein PHAVU_010G016800g             136   5e-36   Phaseolus vulgaris [French bean]
ref|NP_001145887.1|  uncharacterized protein LOC100279403               136   6e-36   Zea mays [maize]
gb|KDO36593.1|  hypothetical protein CISIN_1g032577mg                   132   6e-36   Citrus sinensis [apfelsine]
gb|EMS64418.1|  Aldo-keto reductase family 4 member C9                  136   7e-36   Triticum urartu
ref|XP_010517051.1|  PREDICTED: aldo-keto reductase family 4 memb...    136   8e-36   Camelina sativa [gold-of-pleasure]
gb|KGN54280.1|  hypothetical protein Csa_4G296820                       136   8e-36   Cucumis sativus [cucumbers]
gb|AFK39472.1|  unknown                                                 134   8e-36   Lotus japonicus
gb|AAO42123.1|  putative aldo/keto reductase                            136   8e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007026918.1|  NAD(P)-linked oxidoreductase superfamily pro...    136   8e-36   
ref|XP_010517052.1|  PREDICTED: aldo-keto reductase family 4 memb...    136   8e-36   Camelina sativa [gold-of-pleasure]
gb|AFK37060.1|  unknown                                                 135   1e-35   Lotus japonicus
gb|AFK33934.1|  unknown                                                 132   1e-35   Medicago truncatula
ref|XP_003604924.1|  Alcohol dehydrogenase                              135   1e-35   Medicago truncatula
ref|XP_009358772.1|  PREDICTED: aldo-keto reductase family 4 memb...    135   1e-35   Pyrus x bretschneideri [bai li]
gb|EMS64419.1|  Aldo-keto reductase family 4 member C9                  139   1e-35   Triticum urartu
ref|XP_010529798.1|  PREDICTED: aldo-keto reductase family 4 memb...    135   2e-35   Tarenaya hassleriana [spider flower]
ref|XP_004142056.1|  PREDICTED: LOW QUALITY PROTEIN: aldo-keto re...    135   2e-35   
gb|AFW78250.1|  putative oxidoreductase, aldo/keto reductase fami...    136   2e-35   
ref|XP_008387821.1|  PREDICTED: aldo-keto reductase family 4 memb...    136   2e-35   
gb|EMS58684.1|  Aldo-keto reductase family 4 member C9                  134   2e-35   Triticum urartu
ref|XP_002456632.1|  hypothetical protein SORBIDRAFT_03g039760          135   2e-35   Sorghum bicolor [broomcorn]
ref|XP_008387823.1|  PREDICTED: aldo-keto reductase family 4 memb...    135   3e-35   
ref|XP_010529797.1|  PREDICTED: aldo-keto reductase family 4 memb...    135   3e-35   Tarenaya hassleriana [spider flower]
gb|KDP24554.1|  hypothetical protein JCGZ_25118                         135   3e-35   Jatropha curcas
ref|XP_007134070.1|  hypothetical protein PHAVU_010G017000g             134   4e-35   Phaseolus vulgaris [French bean]
ref|XP_006373911.1|  hypothetical protein POPTR_0016s10390g             134   4e-35   
ref|XP_010038893.1|  PREDICTED: aldo-keto reductase family 4 memb...    134   5e-35   Eucalyptus grandis [rose gum]
ref|XP_010088585.1|  Aldo-keto reductase family 4 member C9             134   5e-35   Morus notabilis
ref|XP_004142055.1|  PREDICTED: aldo-keto reductase family 4 memb...    134   6e-35   
ref|XP_006429176.1|  hypothetical protein CICLE_v10012267mg             133   6e-35   Citrus clementina [clementine]
ref|XP_004166958.1|  PREDICTED: aldo-keto reductase family 4 memb...    134   6e-35   
ref|XP_009345431.1|  PREDICTED: aldo-keto reductase family 4 memb...    134   7e-35   Pyrus x bretschneideri [bai li]
ref|XP_008448252.1|  PREDICTED: aldo-keto reductase family 4 memb...    134   7e-35   Cucumis melo [Oriental melon]
ref|XP_004970567.1|  PREDICTED: aldo-keto reductase family 4 memb...    134   7e-35   Setaria italica
gb|KGN54281.1|  hypothetical protein Csa_4G296830                       133   8e-35   Cucumis sativus [cucumbers]
ref|XP_008369943.1|  PREDICTED: aldo-keto reductase family 4 memb...    134   8e-35   
ref|XP_011012443.1|  PREDICTED: aldo-keto reductase family 4 memb...    134   8e-35   Populus euphratica
ref|XP_008240406.1|  PREDICTED: aldo-keto reductase family 4 memb...    133   9e-35   Prunus mume [ume]
ref|XP_004970569.1|  PREDICTED: aldo-keto reductase family 4 memb...    133   9e-35   Setaria italica
ref|XP_004305184.1|  PREDICTED: aldo-keto reductase family 4 memb...    133   1e-34   Fragaria vesca subsp. vesca
ref|XP_006403644.1|  hypothetical protein EUTSA_v10010554mg             133   1e-34   Eutrema salsugineum [saltwater cress]
emb|CBI30495.3|  unnamed protein product                                132   1e-34   Vitis vinifera
gb|KHN04060.1|  Aldo-keto reductase family 4 member C9                  133   1e-34   Glycine soja [wild soybean]
ref|XP_006429175.1|  hypothetical protein CICLE_v10012267mg             133   1e-34   Citrus clementina [clementine]
ref|XP_004961878.1|  PREDICTED: aldo-keto reductase family 4 memb...    132   2e-34   Setaria italica
gb|ABL61257.1|  aldo-keto reductase                                     132   2e-34   Aloe arborescens
gb|EMT21856.1|  Alcohol dehydrogenase (NADP+) A                         132   2e-34   
ref|XP_003604919.1|  Aldose reductase                                   132   2e-34   Medicago truncatula
ref|XP_009358773.1|  PREDICTED: aldo-keto reductase family 4 memb...    132   3e-34   Pyrus x bretschneideri [bai li]
gb|KJB36674.1|  hypothetical protein B456_006G170300                    132   3e-34   Gossypium raimondii
ref|XP_002273139.1|  PREDICTED: aldo-keto reductase family 4 memb...    132   4e-34   Vitis vinifera
ref|NP_001242750.1|  uncharacterized protein LOC100788951               131   5e-34   
gb|EMS64420.1|  Aldo-keto reductase family 4 member C9                  131   5e-34   Triticum urartu
ref|XP_006493577.1|  PREDICTED: aldo-keto reductase family 4 memb...    131   5e-34   Citrus sinensis [apfelsine]
ref|XP_010088587.1|  Aldo-keto reductase family 4 member C10            130   8e-34   Morus notabilis
ref|XP_006493576.1|  PREDICTED: aldo-keto reductase family 4 memb...    130   8e-34   Citrus sinensis [apfelsine]
ref|NP_001241957.1|  uncharacterized protein LOC100809492               131   9e-34   
ref|XP_008673076.1|  PREDICTED: uncharacterized protein LOC100381...    130   1e-33   Zea mays [maize]
ref|XP_007205574.1|  hypothetical protein PRUPE_ppa008802mg             130   1e-33   Prunus persica
ref|XP_008240372.1|  PREDICTED: aldo-keto reductase family 4 memb...    130   1e-33   Prunus mume [ume]
ref|XP_006493575.1|  PREDICTED: aldo-keto reductase family 4 memb...    130   1e-33   Citrus sinensis [apfelsine]
gb|ACG36524.1|  aldose reductase                                        130   2e-33   Zea mays [maize]
ref|XP_008673074.1|  PREDICTED: uncharacterized protein LOC100381...    130   2e-33   Zea mays [maize]
ref|XP_008369939.1|  PREDICTED: aldo-keto reductase family 4 memb...    130   2e-33   Malus domestica [apple tree]
ref|XP_008673075.1|  PREDICTED: uncharacterized protein LOC100381...    129   2e-33   Zea mays [maize]
ref|XP_002272736.1|  PREDICTED: aldo-keto reductase family 4 memb...    130   2e-33   Vitis vinifera
ref|XP_009346417.1|  PREDICTED: aldo-keto reductase family 4 memb...    129   2e-33   Pyrus x bretschneideri [bai li]
gb|EMT09402.1|  Alcohol dehydrogenase (NADP+) A                         129   2e-33   
ref|XP_010037792.1|  PREDICTED: aldo-keto reductase family 4 memb...    129   3e-33   Eucalyptus grandis [rose gum]
emb|CBI30497.3|  unnamed protein product                                130   3e-33   Vitis vinifera
gb|EEC79337.1|  hypothetical protein OsI_20196                          129   4e-33   Oryza sativa Indica Group [Indian rice]
ref|XP_004142053.1|  PREDICTED: aldo-keto reductase family 4 memb...    129   4e-33   Cucumis sativus [cucumbers]
ref|XP_003552198.1|  PREDICTED: aldo-keto reductase family 4 memb...    129   4e-33   Glycine max [soybeans]
ref|XP_008649709.1|  PREDICTED: aldo-keto reductase family 4 memb...    129   4e-33   Zea mays [maize]
ref|XP_008240418.1|  PREDICTED: aldo-keto reductase family 4 memb...    129   4e-33   Prunus mume [ume]
ref|XP_002962356.1|  hypothetical protein SELMODRAFT_78063              129   5e-33   Selaginella moellendorffii
gb|KHN04058.1|  Aldo-keto reductase family 4 member C9                  129   5e-33   Glycine soja [wild soybean]
ref|XP_002962921.1|  hypothetical protein SELMODRAFT_141212             129   6e-33   Selaginella moellendorffii
gb|EMT09399.1|  Alcohol dehydrogenase (NADP+)                           127   7e-33   
gb|EMT18107.1|  Alcohol dehydrogenase (NADP+)                           128   8e-33   
ref|XP_010528536.1|  PREDICTED: aldo-keto reductase family 4 memb...    128   8e-33   Tarenaya hassleriana [spider flower]
ref|XP_006429183.1|  hypothetical protein CICLE_v10013858mg             128   9e-33   Citrus clementina [clementine]
ref|XP_004515026.1|  PREDICTED: aldo-keto reductase family 4 memb...    128   9e-33   Cicer arietinum [garbanzo]
ref|XP_006493583.1|  PREDICTED: aldo-keto reductase family 4 memb...    128   9e-33   Citrus sinensis [apfelsine]
ref|XP_008448286.1|  PREDICTED: aldo-keto reductase family 4 memb...    128   1e-32   Cucumis melo [Oriental melon]
emb|CDM85015.1|  unnamed protein product                                127   1e-32   Triticum aestivum [Canadian hard winter wheat]
ref|XP_007205608.1|  hypothetical protein PRUPE_ppa009057mg             127   1e-32   Prunus persica
ref|XP_002323523.1|  hypothetical protein POPTR_0016s10400g             127   1e-32   
gb|KHG02299.1|  Aldo-keto reductase family 4 member C9                  127   1e-32   Gossypium arboreum [tree cotton]
ref|XP_011466527.1|  PREDICTED: aldo-keto reductase family 4 memb...    127   1e-32   Fragaria vesca subsp. vesca
ref|XP_002441209.1|  hypothetical protein SORBIDRAFT_09g022360          127   2e-32   Sorghum bicolor [broomcorn]
ref|XP_004302707.1|  PREDICTED: aldo-keto reductase family 4 memb...    127   2e-32   Fragaria vesca subsp. vesca
emb|CBI30496.3|  unnamed protein product                                127   2e-32   Vitis vinifera
ref|XP_010262638.1|  PREDICTED: aldo-keto reductase family 4 memb...    127   2e-32   Nelumbo nucifera [Indian lotus]
gb|KDO48134.1|  hypothetical protein CISIN_1g041263mg                   127   3e-32   Citrus sinensis [apfelsine]
ref|XP_002308181.2|  aldo/keto reductase family protein                 127   3e-32   
emb|CAN73300.1|  hypothetical protein VITISV_029324                     126   3e-32   Vitis vinifera
ref|XP_010088579.1|  Aldo-keto reductase family 4 member C9             127   3e-32   Morus notabilis
ref|XP_006429180.1|  hypothetical protein CICLE_v10012214mg             127   3e-32   Citrus clementina [clementine]
ref|XP_010923220.1|  PREDICTED: aldo-keto reductase family 4 memb...    126   4e-32   Elaeis guineensis
ref|NP_001132855.1|  uncharacterized protein LOC100194348               126   4e-32   
ref|XP_008803139.1|  PREDICTED: aldo-keto reductase family 4 memb...    126   4e-32   
ref|XP_010672422.1|  PREDICTED: aldo-keto reductase family 4 memb...    126   5e-32   
gb|EMS61074.1|  Aldo-keto reductase family 4 member C10                 126   6e-32   
gb|KDQ20256.1|  hypothetical protein BOTBODRAFT_142790                  126   7e-32   
ref|XP_003564605.1|  PREDICTED: aldo-keto reductase family 4 memb...    125   7e-32   
ref|XP_006493579.1|  PREDICTED: aldo-keto reductase family 4 memb...    125   1e-31   
ref|XP_006294644.1|  hypothetical protein CARUB_v10023681mg             125   1e-31   
gb|KHG23083.1|  Aldo-keto reductase family 4 member C9                  125   1e-31   
gb|KHG23082.1|  Aldo-keto reductase family 4 member C8                  125   1e-31   
ref|XP_002441207.1|  hypothetical protein SORBIDRAFT_09g022350          124   1e-31   
ref|XP_011006382.1|  PREDICTED: aldo-keto reductase family 4 memb...    125   1e-31   
gb|EMT22694.1|  Aldose reductase                                        126   2e-31   
gb|EMS47118.1|  Aldo-keto reductase family 4 member C9                  127   2e-31   
gb|KJB46605.1|  hypothetical protein B456_007G377100                    122   2e-31   
gb|ABK23442.1|  unknown                                                 124   2e-31   
ref|XP_004961879.1|  PREDICTED: aldo-keto reductase family 4 memb...    124   3e-31   
ref|XP_010937782.1|  PREDICTED: aldo-keto reductase family 4 memb...    125   3e-31   
ref|NP_001118465.1|  aldo-keto reductase family 4 member C8             123   3e-31   
ref|XP_006410967.1|  hypothetical protein EUTSA_v10016976mg             124   3e-31   
ref|NP_973627.1|  aldo-keto reductase family 4 member C8                123   4e-31   
ref|XP_001771685.1|  predicted protein                                  124   4e-31   
emb|CDY57149.1|  BnaC04g53550D                                          124   4e-31   
gb|KGN57595.1|  hypothetical protein Csa_3G221780                       117   4e-31   
ref|XP_009143449.1|  PREDICTED: aldo-keto reductase family 4 memb...    123   6e-31   
ref|XP_006645006.1|  PREDICTED: aldo-keto reductase family 4 memb...    123   7e-31   
ref|NP_565871.1|  aldo-keto reductase family 4 member C8                123   8e-31   
ref|XP_007026917.1|  NAD(P)-linked oxidoreductase superfamily pro...    123   9e-31   
ref|XP_011012439.1|  PREDICTED: aldo-keto reductase family 4 memb...    123   9e-31   
gb|KIJ51265.1|  hypothetical protein M422DRAFT_223741                   123   1e-30   
ref|XP_009621149.1|  PREDICTED: aldo-keto reductase family 4 memb...    122   1e-30   
pdb|3H7R|A  Chain A, Crystal Structure Of The Plant Stress-Respon...    122   1e-30   
ref|XP_009143451.1|  PREDICTED: aldo-keto reductase family 4 memb...    121   3e-30   
emb|CDY69395.1|  BnaAnng30320D                                          121   3e-30   
gb|KJB46604.1|  hypothetical protein B456_007G377100                    121   3e-30   
emb|CDY64989.1|  BnaA05g34880D                                          121   3e-30   
ref|XP_010509279.1|  PREDICTED: aldo-keto reductase family 4 memb...    121   3e-30   
ref|XP_006429179.1|  hypothetical protein CICLE_v10012214mg             121   3e-30   
ref|XP_002322921.1|  hypothetical protein POPTR_0016s10370g             121   4e-30   
ref|XP_010505373.1|  PREDICTED: aldo-keto reductase family 4 memb...    120   5e-30   
dbj|BAD90688.1|  erythrose reductase 2                                  120   6e-30   
ref|XP_007134067.1|  hypothetical protein PHAVU_010G016700g             120   6e-30   
dbj|BAD90687.1|  erythrose reductase 1                                  120   6e-30   
gb|KJB36675.1|  hypothetical protein B456_006G170400                    120   7e-30   
gb|KJB36677.1|  hypothetical protein B456_006G170400                    121   8e-30   
gb|KJB36676.1|  hypothetical protein B456_006G170400                    120   8e-30   
ref|XP_008803159.1|  PREDICTED: aldo-keto reductase family 4 memb...    120   8e-30   
ref|XP_002879707.1|  aldo/keto reductase family protein                 120   1e-29   
ref|XP_006493580.1|  PREDICTED: aldo-keto reductase family 4 memb...    120   1e-29   
emb|CDY57151.1|  BnaC04g53560D                                          119   1e-29   
emb|CDY54027.1|  BnaA09g54910D                                          119   2e-29   
ref|XP_009116084.1|  PREDICTED: aldo-keto reductase family 4 memb...    119   2e-29   
ref|XP_001778870.1|  predicted protein                                  119   2e-29   
gb|EMT29335.1|  Alcohol dehydrogenase (NADP+)                           119   3e-29   
emb|CDX73517.1|  BnaC08g24860D                                          119   3e-29   
ref|XP_010677556.1|  PREDICTED: aldo-keto reductase family 4 memb...    118   6e-29   
ref|XP_010529795.1|  PREDICTED: aldo-keto reductase family 4 memb...    118   6e-29   
ref|XP_010677557.1|  PREDICTED: aldo-keto reductase family 4 memb...    117   9e-29   
gb|KJB76788.1|  hypothetical protein B456_012G107300                    115   1e-28   
gb|AGB07593.1|  erythrose reductase 3                                   117   1e-28   
ref|XP_010517056.1|  PREDICTED: aldo-keto reductase family 4 memb...    116   2e-28   
ref|XP_007700235.1|  hypothetical protein COCSADRAFT_89350              116   2e-28   
ref|XP_007715339.1|  hypothetical protein COCCADRAFT_104160             116   3e-28   
ref|XP_007684948.1|  hypothetical protein COCMIDRAFT_86997              116   3e-28   
ref|XP_004516040.1|  PREDICTED: aldo-keto reductase family 4 memb...    114   3e-28   
dbj|BAD90689.1|  erythrose reductase 3                                  116   3e-28   
ref|XP_002456634.1|  hypothetical protein SORBIDRAFT_03g039780          115   3e-28   
ref|XP_002876230.1|  aldo/keto reductase family protein                 115   6e-28   
gb|EMD88656.1|  hypothetical protein COCHEDRAFT_1142462                 115   7e-28   
ref|NP_190956.1|  aldo-keto reductase family 4 member C11               115   8e-28   
ref|XP_006645009.1|  PREDICTED: aldo-keto reductase family 4 memb...    114   1e-27   
ref|XP_008024200.1|  hypothetical protein SETTUDRAFT_168549             114   1e-27   
ref|XP_006291519.1|  hypothetical protein CARUB_v10017668mg             114   1e-27   
ref|WP_044207365.1|  aldehyde oxidoreductase                            114   2e-27   
ref|WP_035245404.1|  aldehyde oxidoreductase                            114   2e-27   
ref|XP_004504536.1|  PREDICTED: aldo-keto reductase family 4 memb...    113   3e-27   
ref|XP_002991432.1|  hypothetical protein SELMODRAFT_429709             113   3e-27   
gb|EYB32718.1|  hypothetical protein FG05_12483                         113   3e-27   
ref|XP_009257346.1|  hypothetical protein FPSE_05953                    113   4e-27   
ref|XP_010427047.1|  PREDICTED: aldo-keto reductase family 4 memb...    113   4e-27   
ref|XP_001936893.1|  aldehyde reductase 1                               113   4e-27   
gb|ACS94043.1|  aldo-keto reductase                                     112   4e-27   
ref|XP_003301695.1|  hypothetical protein PTT_13265                     113   5e-27   
ref|XP_003843901.1|  similar to aldehyde reductase                      113   5e-27   
gb|EXM19140.1|  alcohol dehydrogenase (NADP+)                           112   7e-27   
gb|EXK35840.1|  alcohol dehydrogenase (NADP+)                           112   7e-27   
gb|ENH70176.1|  Aldehyde reductase 1                                    112   7e-27   
gb|EGU86885.1|  hypothetical protein FOXB_02595                         112   8e-27   
gb|EMT72080.1|  Aldehyde reductase 1                                    112   8e-27   
ref|WP_002695791.1|  aldehyde oxidoreductase                            112   9e-27   
ref|XP_010515893.1|  PREDICTED: aldo-keto reductase family 4 memb...    112   1e-26   
gb|KFK34635.1|  hypothetical protein AALP_AA5G171600                    111   1e-26   
ref|XP_009033997.1|  hypothetical protein AURANDRAFT_59872              112   1e-26   
ref|XP_002741123.1|  PREDICTED: aldose reductase-like                   107   1e-26   
ref|XP_005706925.1|  aldo/keto reductase                                111   2e-26   
ref|XP_001792803.1|  hypothetical protein SNOG_02188                    111   2e-26   
ref|XP_003384280.1|  PREDICTED: aldo-keto reductase family 4 memb...    110   3e-26   
gb|EWZ85327.1|  alcohol dehydrogenase (NADP+)                           111   3e-26   
ref|WP_044227051.1|  aldehyde oxidoreductase                            110   3e-26   
ref|XP_007677637.1|  hypothetical protein BAUCODRAFT_518265             110   4e-26   
gb|EMT10823.1|  Aldose reductase                                        110   4e-26   
emb|CCT72907.1|  related to members of the aldo/keto reductase fa...    110   4e-26   
gb|KIL93748.1|  alcohol dehydrogenase (nadp+)                           110   4e-26   
ref|WP_015109522.1|  aldo/keto reductase, diketogulonate reductase      110   5e-26   
gb|EWG55489.1|  alcohol dehydrogenase (NADP+)                           110   5e-26   
ref|WP_028947934.1|  aldehyde oxidoreductase                            110   7e-26   
gb|KIH94370.1|  hypothetical protein SPBR_06022                         109   8e-26   
ref|XP_001914456.1|  alcohol dehydrogenase                              106   8e-26   
gb|KHN44003.1|  Aldo-keto reductase family 4 member C9                  109   8e-26   
ref|XP_969601.1|  PREDICTED: aldose reductase                           109   8e-26   
ref|XP_007877898.1|  hypothetical protein PFL1_02194                    109   9e-26   
gb|EHK46691.1|  hypothetical protein TRIATDRAFT_256549                  109   9e-26   
emb|CAN73301.1|  hypothetical protein VITISV_029327                     110   9e-26   
ref|XP_008835848.1|  PREDICTED: alcohol dehydrogenase [NADP(+)]-like    105   9e-26   
emb|CBQ68613.1|  related to GCY1-galactose-induced protein of ald...    109   1e-25   
gb|KEQ79148.1|  Aldo/keto reductase                                     109   1e-25   
gb|ERS99301.1|  hypothetical protein HMPREF1624_04500                   109   1e-25   
gb|EKV09479.1|  Glycerol dehydrogenase, putative                        109   1e-25   
gb|AAH78366.1|  Si:dkey-180p18.9 protein                                109   1e-25   
gb|KGL74239.1|  Alcohol dehydrogenase [NADP(+)]                         108   1e-25   
gb|AAH95647.1|  Si:dkey-180p18.9 protein                                109   1e-25   
gb|AIE74584.1|  Aldo-keto reductase family 1 member B10                 108   1e-25   
emb|CDI54720.1|  related to GCY1-galactose-induced protein of ald...    109   1e-25   
ref|WP_019600044.1|  hypothetical protein                               108   1e-25   
gb|KDQ09649.1|  hypothetical protein BOTBODRAFT_69040                   108   2e-25   
ref|XP_002185454.1|  predicted protein                                  108   2e-25   
ref|XP_006963643.1|  predicted protein                                  108   2e-25   
ref|XP_001914269.1|  alcohol dehydrogenase                              106   2e-25   
ref|XP_010226425.1|  PREDICTED: alcohol dehydrogenase [NADP(+)]         108   2e-25   
gb|KFV84448.1|  Alcohol dehydrogenase [NADP(+)]                         108   2e-25   
gb|EEC71800.1|  hypothetical protein OsI_04429                          108   2e-25   
gb|EPS28840.1|  hypothetical protein PDE_03786                          108   2e-25   
ref|XP_003382567.1|  PREDICTED: aldose reductase-like                   108   2e-25   
ref|XP_007673564.1|  hypothetical protein BAUCODRAFT_31372              108   3e-25   
ref|XP_009679249.1|  PREDICTED: alcohol dehydrogenase [NADP(+)]         108   3e-25   
ref|XP_001648462.1|  AAEL004088-PD                                      108   3e-25   
gb|KFY54645.1|  hypothetical protein V496_07225                         108   3e-25   
ref|WP_007148509.1|  aldehyde oxidoreductase                            108   3e-25   
gb|KFK36668.1|  hypothetical protein AALP_AA4G154400                    107   3e-25   
gb|KEQ60473.1|  aldehyde reductase-like protein                         108   3e-25   
gb|KDN46461.1|  erythrose reductase 3                                   108   3e-25   
gb|EHK20576.1|  hypothetical protein TRIVIDRAFT_90260                   108   3e-25   
ref|XP_001648461.1|  AAEL004088-PA                                      107   4e-25   
gb|KEQ69670.1|  aldehyde reductase-like protein                         107   4e-25   
emb|CCE27492.1|  related to members of the aldo/keto reductase fa...    107   4e-25   
ref|XP_005645934.1|  putative aldose reductase                          107   4e-25   
gb|EOB00363.1|  Alcohol dehydrogenase [NADP+]                           107   5e-25   
ref|XP_002565934.1|  Pc22g20340                                         107   5e-25   
ref|WP_037981021.1|  aldehyde oxidoreductase                            107   5e-25   
ref|XP_005705628.1|  aldo/keto reductase                                107   5e-25   
gb|KJB76794.1|  hypothetical protein B456_012G107600                    107   6e-25   
ref|XP_001213633.1|  hypothetical protein ATEG_04455                    107   6e-25   
ref|XP_007876655.1|  hypothetical protein PFL1_00964                    107   6e-25   
gb|KDB12548.1|  NADP-dependent glycerol dehydrogenase                   107   6e-25   
ref|XP_004341974.1|  oxidoreductase, aldo/keto reductase, putative      107   6e-25   
gb|EHK23280.1|  hypothetical protein TRIVIDRAFT_64267                   107   7e-25   
ref|XP_005537159.1|  aldehyde reductase                                 107   7e-25   
ref|XP_008597160.1|  NADP-dependent glycerol dehydrogenase              107   7e-25   
ref|XP_005020890.1|  PREDICTED: alcohol dehydrogenase [NADP(+)] i...    107   7e-25   
gb|KEH23000.1|  aldo/keto reductase family oxidoreductase               107   7e-25   
ref|XP_002988328.1|  hypothetical protein SELMODRAFT_159380             106   8e-25   
ref|XP_005020889.1|  PREDICTED: alcohol dehydrogenase [NADP(+)] i...    107   8e-25   
ref|XP_008291084.1|  PREDICTED: alcohol dehydrogenase [NADP(+)] i...    107   8e-25   
ref|WP_010873023.1|  aldehyde oxidoreductase                            107   8e-25   
ref|XP_006986628.1|  PREDICTED: alcohol dehydrogenase [NADP(+)] i...    107   9e-25   
gb|EME44402.1|  hypothetical protein DOTSEDRAFT_72031                   107   9e-25   
gb|KHN40264.1|  Aldo-keto reductase family 4 member C9                  105   9e-25   
gb|EFB27516.1|  hypothetical protein PANDA_008132                       106   9e-25   
ref|XP_007924944.1|  hypothetical protein MYCFIDRAFT_152559             107   9e-25   
ref|XP_003039406.1|  hypothetical protein NECHADRAFT_56237              107   1e-24   
ref|XP_004491996.1|  PREDICTED: aldo-keto reductase family 4 memb...    106   1e-24   
ref|XP_006986627.1|  PREDICTED: alcohol dehydrogenase [NADP(+)] i...    107   1e-24   
ref|XP_003389202.1|  PREDICTED: alcohol dehydrogenase [NADP(+)]-like    106   1e-24   
ref|XP_001826222.1|  protein GCY                                        106   1e-24   
ref|WP_007311851.1|  aldehyde oxidoreductase                            106   1e-24   
ref|XP_006899050.1|  PREDICTED: alcohol dehydrogenase [NADP(+)]         106   1e-24   
dbj|GAD99583.1|  aldehyde reductase (AKR1), putative                    106   1e-24   
gb|ACN10195.1|  Alcohol dehydrogenase                                   106   1e-24   
ref|XP_006986629.1|  PREDICTED: alcohol dehydrogenase [NADP(+)] i...    106   1e-24   
emb|CDQ60852.1|  unnamed protein product                                106   1e-24   
ref|XP_004639243.1|  PREDICTED: alcohol dehydrogenase [NADP(+)]         106   1e-24   
ref|XP_008697503.1|  PREDICTED: alcohol dehydrogenase [NADP(+)] i...    106   1e-24   
ref|XP_653766.1|  aldose reductase                                      106   1e-24   
ref|XP_308086.3|  AGAP011050-PA                                         106   1e-24   
gb|ACI33815.1|  Alcohol dehydrogenase                                   106   1e-24   
ref|XP_011390578.1|  hypothetical protein UMAG_11741                    106   1e-24   
dbj|BAN37950.1|  aldose reductase, putative                             106   1e-24   
dbj|BAM54879.1|  aldehyde reductase                                     106   1e-24   
ref|XP_002919499.1|  PREDICTED: alcohol dehydrogenase [NADP(+)] i...    106   1e-24   
ref|XP_002715183.1|  PREDICTED: alcohol dehydrogenase [NADP(+)]         106   2e-24   
ref|XP_648383.1|  aldose reductase                                      105   2e-24   
emb|CDQ74329.1|  unnamed protein product                                106   2e-24   
emb|CEJ91822.1|  Putative NADP-dependent glycerol dehydrogenase         106   2e-24   
ref|XP_007164613.1|  PREDICTED: alcohol dehydrogenase [NADP(+)]         106   2e-24   
ref|XP_010862467.1|  PREDICTED: alcohol dehydrogenase [NADP(+)] i...    106   2e-24   
ref|XP_010186260.1|  PREDICTED: alcohol dehydrogenase [NADP(+)]         106   2e-24   
ref|WP_026235816.1|  aldehyde oxidoreductase                            105   2e-24   
ref|XP_006633906.1|  PREDICTED: aldose reductase-like                   105   2e-24   
ref|XP_008263557.1|  PREDICTED: alcohol dehydrogenase [NADP(+)]-like    106   2e-24   
ref|XP_005151147.1|  PREDICTED: alcohol dehydrogenase [NADP(+)]         105   2e-24   
ref|XP_011055123.1|  PREDICTED: aldose reductase-like                   105   2e-24   
ref|XP_003389200.1|  PREDICTED: alcohol dehydrogenase [NADP(+)]-like    105   2e-24   
gb|KGO41407.1|  Aldo/keto reductase                                     105   2e-24   
dbj|GAC74919.1|  aldo/keto reductase family proteins                    105   2e-24   
ref|WP_008628876.1|  aldo/keto reductase family protein                 105   2e-24   
gb|EST04584.1|  aldehyde reductase 1                                    105   2e-24   
gb|KGL92998.1|  Alcohol dehydrogenase [NADP(+)]                         105   2e-24   
ref|XP_003040537.1|  hypothetical protein NECHADRAFT_55099              105   2e-24   
emb|CEJ01152.1|  Putative Alcohol dehydrogenase                         103   2e-24   
emb|CEG70680.1|  Putative Alcohol dehydrogenase                         105   2e-24   
gb|EYE92053.1|  putative aldehyde reductase                             105   2e-24   
dbj|GAK68044.1|  aldo/keto reductase                                    105   2e-24   
ref|XP_002587374.1|  hypothetical protein BRAFLDRAFT_282999             102   2e-24   
emb|CCF48978.1|  related to GCY1-galactose-induced protein of ald...    105   2e-24   
ref|XP_007341171.1|  Aldo/keto reductase                                105   2e-24   
gb|ELK06104.1|  Alcohol dehydrogenase [NADP+]                           105   3e-24   
emb|CBY14032.1|  unnamed protein product                                105   3e-24   
ref|XP_001258146.1|  aldehyde reductase (AKR1), putative                105   3e-24   
ref|XP_006839767.1|  PREDICTED: alcohol dehydrogenase [NADP(+)]         105   3e-24   
ref|XP_007248231.1|  PREDICTED: alcohol dehydrogenase [NADP(+)] B...    105   3e-24   
ref|XP_750915.1|  aldehyde reductase (AKR1)                             105   3e-24   



>ref|XP_009602752.1| PREDICTED: aldo-keto reductase family 4 member C10-like [Nicotiana 
tomentosiformis]
Length=315

 Score =   163 bits (412),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 75/97 (77%), Positives = 86/97 (89%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA A++ F LNTGAK+PSVGLGTWQ++PGVVGQAVE AIKVGYRHID AR Y  EKEIGE
Sbjct  1    MAAAIRYFELNTGAKMPSVGLGTWQSDPGVVGQAVEFAIKVGYRHIDCARIYKNEKEIGE  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            +LK+LF DGV+KRE+LF+TSKLW  DH+PEDVPVALN
Sbjct  61   ILKRLFKDGVIKREELFVTSKLWNTDHSPEDVPVALN  97



>ref|XP_009791583.1| PREDICTED: aldo-keto reductase family 4 member C10-like [Nicotiana 
sylvestris]
Length=315

 Score =   163 bits (412),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 77/97 (79%), Positives = 85/97 (88%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA A++ F LNTGAK+PSVGLGTWQ++PGVVG AVE AIKVGYRHID AR Y  EKEIGE
Sbjct  1    MAAAIRYFELNTGAKMPSVGLGTWQSDPGVVGHAVEIAIKVGYRHIDCARIYKNEKEIGE  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            VLKKLF DGVVKRE+LF+TSKLW  DHAPEDVP+ALN
Sbjct  61   VLKKLFKDGVVKREELFVTSKLWNTDHAPEDVPLALN  97



>ref|XP_009621148.1| PREDICTED: aldo-keto reductase family 4 member C9-like isoform 
X1 [Nicotiana tomentosiformis]
Length=309

 Score =   157 bits (398),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 74/96 (77%), Positives = 83/96 (86%), Gaps = 0/96 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA A++ F LNTGAKIPSVGLGTWQ++PG+VGQA+E AIKVGYRHID A+ Y  EKEIG+
Sbjct  1    MAEAIQYFELNTGAKIPSVGLGTWQSDPGIVGQAIETAIKVGYRHIDCAQVYGNEKEIGQ  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVAL  417
            VLK+LF DGVVKREDLFITSKLW  DHAPEDVP A 
Sbjct  61   VLKRLFKDGVVKREDLFITSKLWCTDHAPEDVPAAF  96



>gb|EYU41765.1| hypothetical protein MIMGU_mgv1a010335mg [Erythranthe guttata]
Length=315

 Score =   157 bits (396),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 78/97 (80%), Positives = 83/97 (86%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA  +  F LNTGAKIPSVGLGTWQ+EPG+VGQAVEAAIK GYRHID ARAYN EKEIG 
Sbjct  1    MANEILYFELNTGAKIPSVGLGTWQSEPGLVGQAVEAAIKSGYRHIDCARAYNNEKEIGL  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            VLKKLF DGVVKRE+LFITSKLW  DHAPEDV  AL+
Sbjct  61   VLKKLFDDGVVKREELFITSKLWCNDHAPEDVLAALD  97



>ref|XP_002529872.1| aldo-keto reductase, putative [Ricinus communis]
 gb|EEF32522.1| aldo-keto reductase, putative [Ricinus communis]
Length=301

 Score =   156 bits (394),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/97 (78%), Positives = 81/97 (84%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA A++ F LNTGAKIPSVGLGTWQAEPGVVGQAV  AIK GYRHID A  Y  EKEIG 
Sbjct  1    MAKAIRFFELNTGAKIPSVGLGTWQAEPGVVGQAVSTAIKAGYRHIDCASVYGNEKEIGS  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
             LKKLFADGVVKREDL++TSKLW  DHAPEDVP AL+
Sbjct  61   SLKKLFADGVVKREDLWVTSKLWCTDHAPEDVPQALD  97



>gb|AFK48248.1| unknown [Lotus japonicus]
Length=315

 Score =   156 bits (395),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/97 (76%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            M+  ++ F LNTGAKIPSVGLGTWQ++PGVVGQAV AAIK+GYRHID A+ Y  EKEIG 
Sbjct  1    MSNEIQFFQLNTGAKIPSVGLGTWQSDPGVVGQAVAAAIKIGYRHIDCAQIYGNEKEIGS  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            VLKKLF DGVVKREDL+ITSKLW  DHAPEDVP+AL+
Sbjct  61   VLKKLFEDGVVKREDLWITSKLWNTDHAPEDVPLALD  97



>ref|XP_010509278.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Camelina 
sativa]
Length=315

 Score =   155 bits (393),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 73/97 (75%), Positives = 82/97 (85%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA A+KCF LNTGAKIPSVGLGTWQ+ PG+VG AV AA+K+GYRHID A+ Y+ EKEIG 
Sbjct  1    MANAIKCFELNTGAKIPSVGLGTWQSSPGLVGDAVAAAVKIGYRHIDCAKLYDNEKEIGA  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            VLKKLF D VVKRE+LFITSKLW  DH P+DVP ALN
Sbjct  61   VLKKLFEDNVVKREELFITSKLWCNDHDPQDVPEALN  97



>ref|XP_011094913.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Sesamum 
indicum]
Length=315

 Score =   155 bits (392),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 78/97 (80%), Positives = 81/97 (84%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            M   +  F LNTGAKIPSVGLGTWQAEPGVVGQAVE AIK GYRHID ARAY  EKEIG 
Sbjct  1    MVQEIGYFELNTGAKIPSVGLGTWQAEPGVVGQAVEVAIKSGYRHIDCARAYGNEKEIGV  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            VLKKLF DG+VKRE+LFITSKL   DHAPEDVPVALN
Sbjct  61   VLKKLFDDGIVKREELFITSKLRNNDHAPEDVPVALN  97



>emb|CAC32834.1| aldose reductase [Digitalis purpurea]
Length=315

 Score =   155 bits (392),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 76/97 (78%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA  ++ F LNTGAKIPSVGLGTWQ+ PG   QAVE AIK GYRHIDGAR Y  EKEIG 
Sbjct  1    MAEEIRFFKLNTGAKIPSVGLGTWQSSPGDAAQAVEVAIKCGYRHIDGARLYENEKEIGV  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            VLKKLF DGVVKREDLFITSKLW  DHAPEDVPVAL+
Sbjct  61   VLKKLFDDGVVKREDLFITSKLWSTDHAPEDVPVALD  97



>emb|CAC32835.1| aldose reductase [Digitalis purpurea]
Length=315

 Score =   155 bits (391),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 76/97 (78%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA  ++ F LNTGAKIPSVGLGTWQ+ PG   QAVE AIK GYRHIDGAR Y  EKEIG 
Sbjct  1    MAEEIRFFELNTGAKIPSVGLGTWQSSPGDAAQAVEVAIKCGYRHIDGARLYENEKEIGV  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            VLKKLF DGVVKREDLFITSKLW  DHAPEDVPVAL+
Sbjct  61   VLKKLFDDGVVKREDLFITSKLWSTDHAPEDVPVALD  97



>ref|XP_010505375.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Camelina 
sativa]
Length=316

 Score =   154 bits (390),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 75/97 (77%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA  VKCF LNTGAKIPSVGLGTWQA PG+VG AV AA+K+GYRHID A+ Y  EKEIG 
Sbjct  1    MANEVKCFELNTGAKIPSVGLGTWQASPGLVGDAVAAAVKIGYRHIDCAKLYGNEKEIGA  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            VLKKLF D VVKRE+LFITSKLW  DH PEDVP ALN
Sbjct  61   VLKKLFEDNVVKREELFITSKLWCTDHDPEDVPEALN  97



>ref|XP_004509601.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Cicer 
arietinum]
Length=315

 Score =   153 bits (387),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 72/97 (74%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            M+  ++ F+LNTGAKIPSVGLGTWQ++PG+VGQAV AAIK GYRHID A+ Y  EKEIG 
Sbjct  1    MSNDIQFFILNTGAKIPSVGLGTWQSDPGLVGQAVAAAIKAGYRHIDCAQVYGNEKEIGS  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            VLKKLF +GVVKREDL+ITSKLW  DHAPEDVP+AL+
Sbjct  61   VLKKLFDEGVVKREDLWITSKLWNTDHAPEDVPLALD  97



>gb|EYU41764.1| hypothetical protein MIMGU_mgv1a010256mg [Erythranthe guttata]
Length=318

 Score =   153 bits (386),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 77/97 (79%), Positives = 82/97 (85%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA  +  F LNTGAKIPSVGLGTWQ+EPG+VGQAVEAAIK GYRHID ARAY  EKEIG 
Sbjct  1    MAHEILYFELNTGAKIPSVGLGTWQSEPGLVGQAVEAAIKNGYRHIDCARAYVNEKEIGS  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            VLKKLF DGVVKR+DLFITSKLW  DHAPEDV  AL+
Sbjct  61   VLKKLFDDGVVKRDDLFITSKLWCADHAPEDVLAALD  97



>dbj|BAG97587.1| unnamed protein product [Oryza sativa Japonica Group]
Length=326

 Score =   153 bits (387),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 73/100 (73%), Positives = 83/100 (83%), Gaps = 0/100 (0%)
 Frame = +1

Query  121  CVAMAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKE  300
            C+      +CFVLNTGAKIPSVGLGTWQAEPGVVG AV AA+K GYRHID A+AY  EKE
Sbjct  9    CLQQNTMARCFVLNTGAKIPSVGLGTWQAEPGVVGNAVYAAVKAGYRHIDCAQAYFNEKE  68

Query  301  IGEVLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            IG  LKK+F +G+VKRED+FITSKLW  +HAPEDVPVAL+
Sbjct  69   IGVALKKVFDEGIVKREDIFITSKLWCTNHAPEDVPVALD  108



>ref|XP_011094911.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Sesamum 
indicum]
 ref|XP_011094912.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Sesamum 
indicum]
Length=315

 Score =   152 bits (385),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 76/96 (79%), Positives = 81/96 (84%), Gaps = 0/96 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA  +K F LNTGAKIPSVGLGTWQAEPGVVGQ++EAA+K GYRHID A  Y  EKEIG 
Sbjct  1    MAKEIKYFELNTGAKIPSVGLGTWQAEPGVVGQSIEAAVKNGYRHIDCAPVYGNEKEIGV  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVAL  417
            VLKKLF + VVKREDLFITSKLW  DHAPEDVPVAL
Sbjct  61   VLKKLFDEKVVKREDLFITSKLWCTDHAPEDVPVAL  96



>ref|XP_010509276.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Camelina 
sativa]
 ref|XP_010509277.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Camelina 
sativa]
Length=316

 Score =   152 bits (384),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 73/97 (75%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA  VKCF LNTGAKIPSVGLGTWQA PG+VG AV AA+K+GYRHID A+ Y  EKEIG 
Sbjct  1    MANEVKCFELNTGAKIPSVGLGTWQASPGLVGDAVAAAVKIGYRHIDCAKLYGNEKEIGA  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            VLK+LF D VVKRE+LFITSKLW  DH P+DVP ALN
Sbjct  61   VLKQLFEDNVVKREELFITSKLWCTDHDPQDVPEALN  97



>ref|XP_002529871.1| aldo-keto reductase, putative [Ricinus communis]
 gb|EEF32521.1| aldo-keto reductase, putative [Ricinus communis]
Length=326

 Score =   152 bits (385),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 74/96 (77%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA  ++ F LNTGAK+PSVGLGTWQAEPG+VG AV+AAIK+GYRHID A+AYN EKEIG 
Sbjct  1    MANEIRFFELNTGAKMPSVGLGTWQAEPGLVGAAVDAAIKIGYRHIDCAQAYNNEKEIGS  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVAL  417
            VLKKLF DGVVKREDLFITSKLW  +H PEDV  AL
Sbjct  61   VLKKLFEDGVVKREDLFITSKLWCSNHDPEDVVKAL  96



>ref|XP_009143448.1| PREDICTED: aldo-keto reductase family 4 member C10 [Brassica 
rapa]
Length=314

 Score =   152 bits (384),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 72/97 (74%), Positives = 83/97 (86%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA  ++ F LNTGAKIPSVGLGTWQ++PG+VG AVEAA+K+GYRHID A+ Y  EKEIG 
Sbjct  1    MAEEIRFFELNTGAKIPSVGLGTWQSDPGLVGNAVEAAVKIGYRHIDCAQIYGNEKEIGL  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            VLKKLF DGVVKRE++FITSKLW  DH P+DVPVALN
Sbjct  61   VLKKLFDDGVVKREEIFITSKLWCTDHDPQDVPVALN  97



>emb|CDX74934.1| BnaA05g06800D [Brassica napus]
Length=315

 Score =   152 bits (384),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 72/97 (74%), Positives = 83/97 (86%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA  ++ F LNTGAKIPSVGLGTWQ++PG+VG AVEAA+K+GYRHID A+ Y  EKEIG 
Sbjct  1    MAEEIRFFELNTGAKIPSVGLGTWQSDPGLVGNAVEAAVKIGYRHIDCAQIYGNEKEIGL  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            VLKKLF DGVVKRE++FITSKLW  DH P+DVPVALN
Sbjct  61   VLKKLFDDGVVKREEIFITSKLWCTDHDPQDVPVALN  97



>emb|CDY57141.1| BnaC04g53480D [Brassica napus]
Length=322

 Score =   152 bits (383),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 72/97 (74%), Positives = 83/97 (86%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA  ++ F LNTGAKIPSVGLGTWQ++PG+VG AVEAA+K+GYRHID A+ Y  EKEIG 
Sbjct  1    MAEEIRFFELNTGAKIPSVGLGTWQSDPGLVGNAVEAAVKIGYRHIDCAQIYGNEKEIGL  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            VLKKLF DGVVKRE++FITSKLW  DH P+DVPVALN
Sbjct  61   VLKKLFDDGVVKREEIFITSKLWCTDHDPQDVPVALN  97



>ref|XP_006294573.1| hypothetical protein CARUB_v10023609mg [Capsella rubella]
 gb|EOA27471.1| hypothetical protein CARUB_v10023609mg [Capsella rubella]
Length=328

 Score =   152 bits (384),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 72/97 (74%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA  +KCF LNTGAKIPSVGLGTWQ+ PG+VG AV AA+K+GYRHID A+ Y  EKEIG 
Sbjct  16   MASPIKCFELNTGAKIPSVGLGTWQSSPGLVGDAVAAAVKIGYRHIDCAQLYANEKEIGA  75

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            VLKKLF D VVKRE+LFITSKLW  DH P+DVP ALN
Sbjct  76   VLKKLFEDNVVKREELFITSKLWCTDHDPQDVPEALN  112



>ref|NP_001055731.2| Os05g0456300 [Oryza sativa Japonica Group]
 gb|AAU90220.1| putative aldose reductase [Oryza sativa Japonica Group]
 gb|EEC79338.1| hypothetical protein OsI_20197 [Oryza sativa Indica Group]
 gb|EEE63961.1| hypothetical protein OsJ_18786 [Oryza sativa Japonica Group]
 dbj|BAF17645.2| Os05g0456300 [Oryza sativa Japonica Group]
Length=312

 Score =   150 bits (380),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 72/92 (78%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = +1

Query  145  KCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGEVLKKL  324
            +CFVLNTGAKIPSVGLGTWQAEPGVVG AV AA+K GYRHID A+AY  EKEIG  LKK+
Sbjct  3    RCFVLNTGAKIPSVGLGTWQAEPGVVGNAVYAAVKAGYRHIDCAQAYFNEKEIGVALKKV  62

Query  325  FADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            F +G+VKRED+FITSKLW  +HAPEDVPVAL+
Sbjct  63   FDEGIVKREDIFITSKLWCTNHAPEDVPVALD  94



>gb|EPS58903.1| hypothetical protein M569_15909, partial [Genlisea aurea]
Length=320

 Score =   150 bits (379),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = +1

Query  142  VKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGEVLKK  321
            ++ FVLNTGAK+PS+GLGTWQ+EPG+VG+AV+ AI+ GYRHID AR Y  EKEIG  L+K
Sbjct  1    IRFFVLNTGAKMPSIGLGTWQSEPGLVGKAVQVAIQSGYRHIDCARVYRNEKEIGLALRK  60

Query  322  LFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            LF DGVVKREDLFITSKLW  DH+PEDVPVAL 
Sbjct  61   LFEDGVVKREDLFITSKLWNDDHSPEDVPVALQ  93



>ref|XP_010937542.1| PREDICTED: aldo-keto reductase family 4 member C9-like isoform 
X1 [Elaeis guineensis]
Length=311

 Score =   150 bits (379),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 71/92 (77%), Positives = 80/92 (87%), Gaps = 0/92 (0%)
 Frame = +1

Query  145  KCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGEVLKKL  324
            + F LNTGA+IPSVGLGTWQAEPGVVG AV AA+K GYRHID ARAY+ E+E+G  LKKL
Sbjct  3    RFFTLNTGAQIPSVGLGTWQAEPGVVGDAVIAAVKAGYRHIDCARAYSNEEEVGLALKKL  62

Query  325  FADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            F +GVVKREDLFITSKLW  DHAPEDVPVA++
Sbjct  63   FDEGVVKREDLFITSKLWSSDHAPEDVPVAMD  94



>ref|XP_008785508.1| PREDICTED: aldo-keto reductase family 4 member C9-like isoform 
X1 [Phoenix dactylifera]
Length=129

 Score =   144 bits (364),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 67/92 (73%), Positives = 78/92 (85%), Gaps = 0/92 (0%)
 Frame = +1

Query  145  KCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGEVLKKL  324
            + F L+TGAKIPSVGLGTW+AEPGVVG AV  A+KVGYRHID AR Y+ EKE+G  LKKL
Sbjct  3    RFFPLSTGAKIPSVGLGTWKAEPGVVGDAVVTAVKVGYRHIDCARVYDNEKEVGFSLKKL  62

Query  325  FADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            F +GVVKR+DLFITSKLW  DHAPEDVP +++
Sbjct  63   FDEGVVKRQDLFITSKLWNSDHAPEDVPASMD  94



>gb|KJB76789.1| hypothetical protein B456_012G107300 [Gossypium raimondii]
Length=217

 Score =   147 bits (371),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 80/99 (81%), Gaps = 0/99 (0%)
 Frame = +1

Query  124  VAMAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEI  303
            V MA A++ F LNTGAKIPSVGLGTWQA PGVVG AV  AIK GYRHID A+ Y  EKEI
Sbjct  7    VKMAAAIRYFDLNTGAKIPSVGLGTWQAAPGVVGNAVATAIKHGYRHIDCAQVYGNEKEI  66

Query  304  GEVLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            G VLKKL  DGVVKRE+L+ITSKLW  +HAPEDVP ALN
Sbjct  67   GLVLKKLSEDGVVKREELWITSKLWNTNHAPEDVPEALN  105



>gb|KDP24556.1| hypothetical protein JCGZ_25120 [Jatropha curcas]
Length=315

 Score =   150 bits (378),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 73/97 (75%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA A++ F LNTGAKIPSVGLGTWQ+EP VVG AV AAIK GYRHID A  Y  EKE+G 
Sbjct  1    MANAIRFFTLNTGAKIPSVGLGTWQSEPSVVGDAVTAAIKAGYRHIDCASVYGNEKEVGL  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
             LKKLF DGVVKRE+L+ITSKLW  DH PEDVPVALN
Sbjct  61   ALKKLFDDGVVKREELWITSKLWCTDHDPEDVPVALN  97



>emb|CDY64988.1| BnaA05g34870D [Brassica napus]
Length=315

 Score =   149 bits (377),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 72/97 (74%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA A++ F LNTGAKIPSVGLGTWQA PG+VG AV AA+K+GYRHID A+ Y  EKEIG 
Sbjct  1    MANAIRYFELNTGAKIPSVGLGTWQASPGLVGDAVAAAVKIGYRHIDCAQIYGNEKEIGT  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            VLKKLF D VVKRE+LFITSKLW  DH P+DVP ALN
Sbjct  61   VLKKLFEDNVVKREELFITSKLWCTDHDPQDVPEALN  97



>dbj|BAJ94780.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ95659.1| predicted protein, partial [Hordeum vulgare subsp. vulgare]
 dbj|BAJ89077.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=313

 Score =   149 bits (377),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 74/95 (78%), Positives = 80/95 (84%), Gaps = 0/95 (0%)
 Frame = +1

Query  133  AGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGEV  312
            AG    FVLNTGAKIPSVGLGTWQ++PGVVG+AV AA+K GYRHID ARAYN EKE+G  
Sbjct  1    AGMATHFVLNTGAKIPSVGLGTWQSDPGVVGEAVYAAVKAGYRHIDCARAYNNEKEVGLA  60

Query  313  LKKLFADGVVKREDLFITSKLWGRDHAPEDVPVAL  417
            LKKLF +GVVKREDLFITSKLW   HAPEDVP AL
Sbjct  61   LKKLFDEGVVKREDLFITSKLWCGHHAPEDVPEAL  95



>dbj|BAJ33839.1| unnamed protein product [Thellungiella halophila]
Length=315

 Score =   149 bits (377),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 72/97 (74%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA A++ F LNTGAKIPSVGLGTWQA PG+VG AV AA+K+GYRHID A+ Y  EKEIG 
Sbjct  1    MANAIRFFELNTGAKIPSVGLGTWQASPGLVGDAVAAAVKLGYRHIDCAQIYGNEKEIGT  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            VLKKLF D VVKRE+LFITSKLW  DH P+DVP ALN
Sbjct  61   VLKKLFEDSVVKREELFITSKLWCTDHDPQDVPEALN  97



>ref|XP_006410968.1| hypothetical protein EUTSA_v10016962mg [Eutrema salsugineum]
 gb|ESQ52421.1| hypothetical protein EUTSA_v10016962mg [Eutrema salsugineum]
Length=315

 Score =   149 bits (376),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 72/97 (74%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA A++ F LNTGAKIPSVGLGTWQA PG+VG AV AA+K+GYRHID A+ Y  EKEIG 
Sbjct  1    MANAIRFFELNTGAKIPSVGLGTWQASPGLVGDAVAAAVKLGYRHIDCAQIYGNEKEIGT  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            VLKKLF D VVKRE+LFITSKLW  DH P+DVP ALN
Sbjct  61   VLKKLFEDSVVKREELFITSKLWCTDHDPQDVPEALN  97



>ref|XP_003516897.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Glycine 
max]
Length=315

 Score =   149 bits (376),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 71/97 (73%), Positives = 82/97 (85%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            M+  +  F LNTGAKIPSVGLGTWQ++PG+V QAV AAIKVGYRHID A+ Y  EKEIG 
Sbjct  1    MSNDIGFFDLNTGAKIPSVGLGTWQSDPGLVAQAVAAAIKVGYRHIDCAQIYGNEKEIGS  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            +LKKLF +GVVKREDL+ITSKLW  DHAPEDVP+AL+
Sbjct  61   MLKKLFEEGVVKREDLWITSKLWNTDHAPEDVPLALD  97



>ref|XP_011094910.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Sesamum 
indicum]
Length=315

 Score =   149 bits (376),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 82/97 (85%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            M+ A++ F LN GA+IPSVGLGTW+AEPGVVG A+ AAIK GYRHID A+ Y  EKEIG+
Sbjct  1    MSKAIRFFELNNGARIPSVGLGTWKAEPGVVGDAITAAIKAGYRHIDCAQKYANEKEIGD  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
             LKKLF +G+VKREDL+ITSKLW  DHAPEDVP+ALN
Sbjct  61   ALKKLFENGIVKREDLWITSKLWCSDHAPEDVPLALN  97



>ref|XP_006645007.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Oryza 
brachyantha]
Length=310

 Score =   149 bits (376),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 73/92 (79%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = +1

Query  145  KCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGEVLKKL  324
            K FVLNTGAKIPSVGLGTWQA+PGVVG AV AA+K GYRHID A+AYN EKE+G  LKKL
Sbjct  3    KHFVLNTGAKIPSVGLGTWQADPGVVGNAVYAAVKAGYRHIDCAKAYNNEKEVGLALKKL  62

Query  325  FADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            F +GVVKREDLFITSKLW   HAPEDVP AL+
Sbjct  63   FEEGVVKREDLFITSKLWCDRHAPEDVPEALD  94



>ref|XP_006294635.1| hypothetical protein CARUB_v10023673mg [Capsella rubella]
 gb|EOA27533.1| hypothetical protein CARUB_v10023673mg [Capsella rubella]
Length=314

 Score =   149 bits (376),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 71/96 (74%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA  ++ F LNTGAKIPSVGLGTWQA+PG+VG  VEAA+K+GYRHID A+ Y  EKEIG 
Sbjct  1    MADEIRYFELNTGAKIPSVGLGTWQADPGLVGNTVEAAVKIGYRHIDCAQIYGNEKEIGL  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVAL  417
            VLKKLF DGVVKRED+FITSKLW  DH P+DVP AL
Sbjct  61   VLKKLFDDGVVKREDMFITSKLWCTDHDPQDVPEAL  96



>ref|XP_009143450.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Brassica 
rapa]
Length=310

 Score =   149 bits (375),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 71/97 (73%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA A++ F LNTGAKIPSVGLGTWQA PG+VG AV AA+K+GYRHID A+ Y  EKEIG 
Sbjct  1    MANAIRYFELNTGAKIPSVGLGTWQASPGLVGDAVAAAVKIGYRHIDCAQIYGNEKEIGT  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            VLKKLF D VVKRE+LFITSKLW  DH P+DVP  LN
Sbjct  61   VLKKLFEDNVVKREELFITSKLWCTDHDPQDVPETLN  97



>gb|ACG28331.1| aldose reductase [Zea mays]
Length=278

 Score =   148 bits (373),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 72/92 (78%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +1

Query  145  KCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGEVLKKL  324
            + FVLNTGAKIPSVGLGTWQ++PGVVG AV AA+K GYRHID AR Y  EKEIG  LKKL
Sbjct  3    RHFVLNTGAKIPSVGLGTWQSDPGVVGNAVYAAVKAGYRHIDCARVYGNEKEIGLALKKL  62

Query  325  FADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            F +GVVKREDLFITSKLW   HAPEDVP ALN
Sbjct  63   FEEGVVKREDLFITSKLWNDHHAPEDVPEALN  94



>ref|XP_002273035.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Vitis 
vinifera]
Length=315

 Score =   149 bits (376),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 72/97 (74%), Positives = 82/97 (85%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            M+  ++ F LNTGAK+PSVGLGTWQ++PG+VGQAV  AIKVGYRHID A+ Y  E+EIG 
Sbjct  1    MSDDIRFFQLNTGAKMPSVGLGTWQSDPGLVGQAVAIAIKVGYRHIDCAQVYGNEEEIGI  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            VLKKLF DGVVKREDL+ITSKLW  DHAPEDVP ALN
Sbjct  61   VLKKLFDDGVVKREDLWITSKLWCTDHAPEDVPEALN  97



>ref|XP_007205595.1| hypothetical protein PRUPE_ppa008899mg [Prunus persica]
 gb|EMJ06794.1| hypothetical protein PRUPE_ppa008899mg [Prunus persica]
Length=315

 Score =   149 bits (375),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 73/97 (75%), Positives = 81/97 (84%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA  ++ F LNTGAKIPSVGLGTWQ+ PG+VG AV+AAIK GYRHID A+ Y  EKEIG 
Sbjct  1    MAYDIRFFELNTGAKIPSVGLGTWQSSPGLVGDAVDAAIKAGYRHIDCAQLYANEKEIGS  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            VLKKLF DGVVKREDL+ITSKLW  DHAPEDVP AL+
Sbjct  61   VLKKLFEDGVVKREDLWITSKLWCTDHAPEDVPEALD  97



>emb|CDP17857.1| unnamed protein product [Coffea canephora]
Length=315

 Score =   149 bits (375),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 73/97 (75%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA  +  F LNTGAKIP++GLGTWQA+PGVVGQAVE AIKVGYRHID ARAY  EKEIG 
Sbjct  1    MAKDIHFFELNTGAKIPAIGLGTWQADPGVVGQAVEIAIKVGYRHIDCARAYENEKEIGS  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            VLKK+  DG VKRE+LFITSKL   DHAPEDVP AL+
Sbjct  61   VLKKILEDGAVKREELFITSKLRSSDHAPEDVPAALD  97



>ref|NP_181313.3| aldo-keto reductase family 4 member C9 [Arabidopsis thaliana]
 gb|AEC09448.1| aldo-keto reductase family 4 member C9 [Arabidopsis thaliana]
Length=283

 Score =   148 bits (373),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 72/97 (74%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA A+  F LNTGAK PSVGLGTWQA PG+VG AV AA+K+GYRHID A+ Y  EKEIG 
Sbjct  1    MANAITFFKLNTGAKFPSVGLGTWQASPGLVGDAVAAAVKIGYRHIDCAQIYGNEKEIGA  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            VLKKLF D VVKREDLFITSKLW  DH P+DVP ALN
Sbjct  61   VLKKLFEDRVVKREDLFITSKLWCTDHDPQDVPEALN  97



>ref|XP_008785509.1| PREDICTED: aldo-keto reductase family 4 member C9-like isoform 
X2 [Phoenix dactylifera]
Length=114

 Score =   143 bits (360),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 67/92 (73%), Positives = 78/92 (85%), Gaps = 0/92 (0%)
 Frame = +1

Query  145  KCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGEVLKKL  324
            + F L+TGAKIPSVGLGTW+AEPGVVG AV  A+KVGYRHID AR Y+ EKE+G  LKKL
Sbjct  3    RFFPLSTGAKIPSVGLGTWKAEPGVVGDAVVTAVKVGYRHIDCARVYDNEKEVGFSLKKL  62

Query  325  FADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            F +GVVKR+DLFITSKLW  DHAPEDVP +++
Sbjct  63   FDEGVVKRQDLFITSKLWNSDHAPEDVPASMD  94



>ref|XP_008387820.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Malus 
domestica]
 ref|XP_008387826.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Malus 
domestica]
Length=315

 Score =   148 bits (374),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/97 (74%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA  +  F LNTGAKIPS+GLGTWQA PG+VG++V AAIK GYRHID A+ Y  EKEIG 
Sbjct  1    MADDIXFFELNTGAKIPSIGLGTWQASPGLVGESVHAAIKAGYRHIDCAQIYGNEKEIGL  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            VLKKLF DGVVKREDL+ITSKLW  DHAPEDVP AL+
Sbjct  61   VLKKLFEDGVVKREDLWITSKLWNTDHAPEDVPEALD  97



>ref|XP_002456633.1| hypothetical protein SORBIDRAFT_03g039770 [Sorghum bicolor]
 gb|EES01753.1| hypothetical protein SORBIDRAFT_03g039770 [Sorghum bicolor]
Length=310

 Score =   148 bits (374),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/92 (78%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +1

Query  145  KCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGEVLKKL  324
            + FVLNTGAKIPSVGLGTWQ++PGVVG AV AA+K GYRHID AR Y  EKEIG  LKKL
Sbjct  3    RHFVLNTGAKIPSVGLGTWQSDPGVVGNAVYAAVKAGYRHIDCARVYGNEKEIGVALKKL  62

Query  325  FADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            F +GVVKREDLFITSKLW   HAPEDVP ALN
Sbjct  63   FEEGVVKREDLFITSKLWNDHHAPEDVPEALN  94



>gb|AAC23647.1| putative alcohol dehydrogenase [Arabidopsis thaliana]
Length=290

 Score =   147 bits (372),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/97 (74%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA A+  F LNTGAK PSVGLGTWQA PG+VG AV AA+K+GYRHID A+ Y  EKEIG 
Sbjct  1    MANAITFFKLNTGAKFPSVGLGTWQASPGLVGDAVAAAVKIGYRHIDCAQIYGNEKEIGA  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            VLKKLF D VVKREDLFITSKLW  DH P+DVP ALN
Sbjct  61   VLKKLFEDRVVKREDLFITSKLWCTDHDPQDVPEALN  97



>gb|EYU41763.1| hypothetical protein MIMGU_mgv1a010332mg [Erythranthe guttata]
Length=315

 Score =   148 bits (374),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/97 (74%), Positives = 81/97 (84%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA A++ F LN GAKIPSVGLGTW+A PGVVG A+ AAIK GYRHID A+ Y  EKEIG+
Sbjct  1    MARAIRSFELNPGAKIPSVGLGTWKAAPGVVGDAITAAIKAGYRHIDCAQRYGNEKEIGD  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            VLKKL  +GVVKREDL+ITSKLW  DHAPEDVP+ALN
Sbjct  61   VLKKLLEEGVVKREDLWITSKLWCTDHAPEDVPLALN  97



>ref|XP_010256789.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Nelumbo 
nucifera]
 ref|XP_010256790.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Nelumbo 
nucifera]
Length=315

 Score =   148 bits (373),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/97 (74%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA  ++ F LNTGAKIPSVGLGTWQ+EPG+VG AV AAIK GYRHID AR Y  EKEIG 
Sbjct  1    MATEIRYFELNTGAKIPSVGLGTWQSEPGLVGDAVAAAIKAGYRHIDCARVYANEKEIGL  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            VLKKLF DG+V+REDL+ITSKLW  DH PEDVP AL+
Sbjct  61   VLKKLFGDGLVRREDLWITSKLWCTDHVPEDVPEALD  97



>ref|XP_003520905.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Glycine 
max]
Length=313

 Score =   148 bits (373),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 71/97 (73%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA ++K F LNTGAKIPS+GLGTWQAEPGVV +A+  AI+VGYRHID A AY  + EIG 
Sbjct  1    MAKSIKFFELNTGAKIPSLGLGTWQAEPGVVAEALTTAIQVGYRHIDCASAYKNQAEIGS  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
             LKKLF DGVVKREDL+ITSKLW  DHAPEDVP AL+
Sbjct  61   ALKKLFDDGVVKREDLWITSKLWCSDHAPEDVPKALD  97



>ref|XP_004302710.1| PREDICTED: aldo-keto reductase family 4 member C10-like [Fragaria 
vesca subsp. vesca]
Length=315

 Score =   148 bits (373),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 74/97 (76%), Positives = 81/97 (84%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA A++ F LNTGAKIP+VGLGTWQAEPGVVG AV AAIKVGYRHID A+ Y  EKEIG 
Sbjct  1    MAKAIRFFELNTGAKIPAVGLGTWQAEPGVVGDAVTAAIKVGYRHIDCAQIYGNEKEIGC  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
             LKKL+ DGVVKREDL+ITSKLW   HAPEDVP AL+
Sbjct  61   ALKKLYDDGVVKREDLWITSKLWCSKHAPEDVPKALD  97



>ref|XP_010044002.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Eucalyptus 
grandis]
Length=310

 Score =   148 bits (373),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 72/97 (74%), Positives = 77/97 (79%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            M   ++ F LNTGAKIPSVGLGTWQA+PG+VG AVE AIK GYRHID AR Y  E EIG 
Sbjct  1    MGKDIRYFELNTGAKIPSVGLGTWQADPGLVGNAVEIAIKHGYRHIDCARLYGNEAEIGV  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
             LKKLF DGVVKREDLFITSKLW  DHAPEDVP+A  
Sbjct  61   ALKKLFEDGVVKREDLFITSKLWNSDHAPEDVPLAFE  97



>emb|CDY59481.1| BnaC03g72040D [Brassica napus]
Length=315

 Score =   148 bits (373),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 71/96 (74%), Positives = 79/96 (82%), Gaps = 0/96 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA A++ F LNTGAKIPSVGLGTWQA PG+VG AV AA+K+GYRHID A+ Y  EKEIG 
Sbjct  1    MANAIRFFELNTGAKIPSVGLGTWQASPGLVGDAVAAAVKIGYRHIDCAQIYGNEKEIGS  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVAL  417
            VLKKLF D VVKRE+LFITSKLW  DH P+DVP AL
Sbjct  61   VLKKLFEDNVVKREELFITSKLWCTDHDPQDVPEAL  96



>emb|CDM85016.1| unnamed protein product [Triticum aestivum]
Length=311

 Score =   148 bits (373),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 72/89 (81%), Positives = 78/89 (88%), Gaps = 0/89 (0%)
 Frame = +1

Query  151  FVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGEVLKKLFA  330
            FVLNTGAKIPSVGLGTWQ++PGVVG+AV AA+K GYRHID ARAYN EKE+G  LKKLF 
Sbjct  5    FVLNTGAKIPSVGLGTWQSDPGVVGEAVYAAVKAGYRHIDCARAYNNEKEVGLALKKLFE  64

Query  331  DGVVKREDLFITSKLWGRDHAPEDVPVAL  417
            +GVVKREDLFITSKLW   HAPEDVP AL
Sbjct  65   EGVVKREDLFITSKLWCGHHAPEDVPEAL  93



>gb|ACG39768.1| aldose reductase [Zea mays]
Length=310

 Score =   148 bits (373),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 72/92 (78%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +1

Query  145  KCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGEVLKKL  324
            + FVLNTGAKIPSVGLGTWQ++PGVVG AV AA+K GYRHID AR Y  EKEIG  LKKL
Sbjct  3    RHFVLNTGAKIPSVGLGTWQSDPGVVGNAVYAAVKAGYRHIDCARVYGNEKEIGLALKKL  62

Query  325  FADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            F +GVVKREDLFITSKLW   HAPEDVP ALN
Sbjct  63   FEEGVVKREDLFITSKLWNDHHAPEDVPEALN  94



>ref|NP_001240076.1| uncharacterized protein LOC100781137 [Glycine max]
 gb|ACU18305.1| unknown [Glycine max]
 gb|KHN17833.1| Aldo-keto reductase family 4 member C9 [Glycine soja]
Length=315

 Score =   148 bits (373),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 82/97 (85%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA  ++ F LNTGAKIPSVGLGTWQ++PG+V +AV AAIKVGYRHID A+ Y  EKEIG 
Sbjct  1    MAKDIRFFDLNTGAKIPSVGLGTWQSDPGLVAEAVAAAIKVGYRHIDCAQIYGNEKEIGS  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            +LK LF +GVVKREDL+ITSKLW  DHAPEDVP+AL+
Sbjct  61   LLKNLFEEGVVKREDLWITSKLWNTDHAPEDVPLALD  97



>ref|NP_001105982.1| aldo-keto reductase family 1, member B1 [Zea mays]
 gb|ABF61890.1| aldose reductase [Zea mays]
 gb|ACF78216.1| unknown [Zea mays]
 gb|ACF85314.1| unknown [Zea mays]
 gb|ACG32378.1| aldose reductase [Zea mays]
Length=310

 Score =   147 bits (372),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 72/92 (78%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +1

Query  145  KCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGEVLKKL  324
            + FVLNTGAKIPSVGLGTWQ++PGVVG AV AA+K GYRHID AR Y  EKEIG  LKKL
Sbjct  3    RHFVLNTGAKIPSVGLGTWQSDPGVVGNAVYAAVKAGYRHIDCARVYGNEKEIGLALKKL  62

Query  325  FADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            F +GVVKREDLFITSKLW   HAPEDVP ALN
Sbjct  63   FEEGVVKREDLFITSKLWNDHHAPEDVPEALN  94



>ref|XP_008350456.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Malus 
domestica]
Length=347

 Score =   148 bits (374),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 72/97 (74%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA  +  F LNTGAKIPS+GLGTWQA PG+VG++V AAIK GYRHID A+ Y  EKEIG 
Sbjct  33   MADDIXFFELNTGAKIPSIGLGTWQASPGLVGESVHAAIKAGYRHIDCAQIYGNEKEIGL  92

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            VLKKLF DGVVKREDL+ITSKLW  DHAPEDVP AL+
Sbjct  93   VLKKLFEDGVVKREDLWITSKLWNTDHAPEDVPEALD  129



>ref|XP_004970568.1| PREDICTED: aldo-keto reductase family 4 member C10-like [Setaria 
italica]
Length=310

 Score =   147 bits (372),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 72/92 (78%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +1

Query  145  KCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGEVLKKL  324
            + FVLNTGAKIPSVGLGTWQ++PGVVG AV AA+K GYRHID AR Y  EKEIG  LKKL
Sbjct  3    RHFVLNTGAKIPSVGLGTWQSDPGVVGNAVYAAVKAGYRHIDCARVYGNEKEIGLALKKL  62

Query  325  FADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            F +GVVKREDLFITSKLW   HAPEDVP ALN
Sbjct  63   FEEGVVKREDLFITSKLWNDHHAPEDVPEALN  94



>ref|XP_009133204.1| PREDICTED: aldo-keto reductase family 4 member C9 [Brassica rapa]
Length=315

 Score =   147 bits (372),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 71/96 (74%), Positives = 79/96 (82%), Gaps = 0/96 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA A++ F LNTGAKIPSVGLGTWQA PG+VG AV AA+K+GYRHID A+ Y  EKEIG 
Sbjct  1    MANAIRFFELNTGAKIPSVGLGTWQASPGLVGDAVAAAVKIGYRHIDCAQIYGNEKEIGS  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVAL  417
            VLKKLF D VVKRE+LFITSKLW  DH P+DVP AL
Sbjct  61   VLKKLFEDNVVKREELFITSKLWCTDHDPQDVPEAL  96



>dbj|BAB64275.1| putative aldose reductase [Oryza sativa Japonica Group]
 gb|EAZ41983.1| hypothetical protein OsJ_26532 [Oryza sativa Japonica Group]
 dbj|BAG96231.1| unnamed protein product [Oryza sativa Japonica Group]
Length=311

 Score =   147 bits (372),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 72/92 (78%), Positives = 78/92 (85%), Gaps = 0/92 (0%)
 Frame = +1

Query  145  KCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGEVLKKL  324
            K FVLNTGAKIPSVGLGTWQ++PGVVG AV AA+K GYRHID A AYN EKE+G  LKKL
Sbjct  3    KHFVLNTGAKIPSVGLGTWQSDPGVVGNAVYAAVKAGYRHIDCASAYNNEKEVGLALKKL  62

Query  325  FADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            F +GVVKREDLFITSKLW   HAPEDVP AL+
Sbjct  63   FEEGVVKREDLFITSKLWCDHHAPEDVPEALD  94



>emb|CDY07771.1| BnaA03g17400D [Brassica napus]
Length=315

 Score =   147 bits (372),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 71/96 (74%), Positives = 79/96 (82%), Gaps = 0/96 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA A++ F LNTGAKIPSVGLGTWQA PG+VG AV AA+K+GYRHID A+ Y  EKEIG 
Sbjct  1    MANAIRFFELNTGAKIPSVGLGTWQASPGLVGDAVAAAVKIGYRHIDCAQIYGNEKEIGS  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVAL  417
            VLKKLF D VVKRE+LFITSKLW  DH P+DVP AL
Sbjct  61   VLKKLFEDNVVKREELFITSKLWCTDHDPQDVPEAL  96



>gb|KHN22181.1| Aldo-keto reductase family 4 member C9 [Glycine soja]
Length=315

 Score =   147 bits (372),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 82/97 (85%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            M+  +  F LNTGAKIPSVGLGTWQ++PG+V +AV AAIKVGYRHID A+ Y  EKEIG 
Sbjct  1    MSNDIGFFDLNTGAKIPSVGLGTWQSDPGLVAEAVAAAIKVGYRHIDCAQIYGNEKEIGS  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            +LKKLF +GVVKREDL+ITSKLW  DHAPEDVP+AL+
Sbjct  61   MLKKLFEEGVVKREDLWITSKLWNTDHAPEDVPLALD  97



>ref|XP_010038915.1| PREDICTED: aldo-keto reductase family 4 member C9-like isoform 
X2 [Eucalyptus grandis]
Length=281

 Score =   147 bits (370),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 69/97 (71%), Positives = 81/97 (84%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA A++ F LNTGAKIPS+GLGTWQA+PGVV +AV  A K GYRHID A+AY  EKEIG 
Sbjct  1    MAKAIRFFELNTGAKIPSIGLGTWQADPGVVAEAVTTATKAGYRHIDCAQAYYNEKEIGT  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
             L+KLF++GVVKREDL+ITSKLW  DHAPEDVP A++
Sbjct  61   ALQKLFSEGVVKREDLWITSKLWCTDHAPEDVPKAID  97



>gb|EMS47119.1| Aldo-keto reductase family 4 member C10 [Triticum urartu]
Length=311

 Score =   147 bits (372),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 72/89 (81%), Positives = 78/89 (88%), Gaps = 0/89 (0%)
 Frame = +1

Query  151  FVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGEVLKKLFA  330
            FVLNTGAKIPSVGLGTWQ++PGVVG+AV AA+K GYRHID ARAYN EKE+G  LKKLF 
Sbjct  5    FVLNTGAKIPSVGLGTWQSDPGVVGEAVYAAVKAGYRHIDCARAYNNEKEVGLALKKLFE  64

Query  331  DGVVKREDLFITSKLWGRDHAPEDVPVAL  417
            +GVVKREDLFITSKLW   HAPEDVP AL
Sbjct  65   EGVVKREDLFITSKLWCGHHAPEDVPEAL  93



>ref|XP_009358771.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Pyrus 
x bretschneideri]
Length=316

 Score =   147 bits (372),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 71/97 (73%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA  ++ F LNTGAKIPS+GLGTWQ+ PGVVG AV AA+K GYRHID A+ Y  EKEIG 
Sbjct  1    MADDIRFFELNTGAKIPSIGLGTWQSSPGVVGDAVHAAVKAGYRHIDCAQIYGNEKEIGL  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            VLKKLF +GVVKREDL+ITSKLW  DHAPEDVP AL+
Sbjct  61   VLKKLFEEGVVKREDLWITSKLWNTDHAPEDVPEALD  97



>ref|NP_001031505.1| aldo-keto reductase family 4 member C9 [Arabidopsis thaliana]
 ref|XP_004253292.1| PREDICTED: aldo-keto reductase family 4 member C9 [Solanum lycopersicum]
 sp|Q0PGJ6.1|AKRC9_ARATH RecName: Full=Aldo-keto reductase family 4 member C9 [Arabidopsis 
thaliana]
 gb|ABH07515.1| aldo-keto reductase [Arabidopsis thaliana]
 gb|AEC09449.1| aldo-keto reductase family 4 member C9 [Arabidopsis thaliana]
Length=315

 Score =   147 bits (372),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 72/97 (74%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA A+  F LNTGAK PSVGLGTWQA PG+VG AV AA+K+GYRHID A+ Y  EKEIG 
Sbjct  1    MANAITFFKLNTGAKFPSVGLGTWQASPGLVGDAVAAAVKIGYRHIDCAQIYGNEKEIGA  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            VLKKLF D VVKREDLFITSKLW  DH P+DVP ALN
Sbjct  61   VLKKLFEDRVVKREDLFITSKLWCTDHDPQDVPEALN  97



>emb|CDM80750.1| unnamed protein product [Triticum aestivum]
Length=310

 Score =   147 bits (371),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 72/92 (78%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +1

Query  145  KCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGEVLKKL  324
            + F+LNTGAKIPSVGLGTWQA+PGVVG AV AA+K GYRHID AR Y  EKEIG  LKKL
Sbjct  3    RHFLLNTGAKIPSVGLGTWQADPGVVGDAVYAAVKAGYRHIDCARVYGNEKEIGLALKKL  62

Query  325  FADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            F +GVVKREDLFITSKLW   HAPEDVP ALN
Sbjct  63   FEEGVVKREDLFITSKLWNDHHAPEDVPEALN  94



>ref|XP_009402310.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Musa 
acuminata subsp. malaccensis]
Length=311

 Score =   147 bits (371),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 70/92 (76%), Positives = 78/92 (85%), Gaps = 0/92 (0%)
 Frame = +1

Query  145  KCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGEVLKKL  324
            K F LNTGAKIPSVGLGTWQ+ PG+VG AV AA+K GYRHID AR YN EKE+G  LKKL
Sbjct  3    KFFTLNTGAKIPSVGLGTWQSAPGLVGAAVIAAVKAGYRHIDCARVYNNEKEVGSALKKL  62

Query  325  FADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            F +GVVKRE+LFITSKLW  DHAPEDVPVA++
Sbjct  63   FDEGVVKREELFITSKLWCSDHAPEDVPVAID  94



>ref|XP_008350454.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Malus 
domestica]
Length=316

 Score =   147 bits (371),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 71/97 (73%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA  ++ F LNTGAKIPS+GLGTWQ+ PGVVG AV AA+K GYRHID A+ Y  EKEIG 
Sbjct  1    MADDIRFFELNTGAKIPSIGLGTWQSSPGVVGDAVHAAVKAGYRHIDCAQIYGNEKEIGL  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            VLKKLF DGVVKREDL+ITS LW  DHAPEDVP AL+
Sbjct  61   VLKKLFEDGVVKREDLWITSXLWNTDHAPEDVPEALD  97



>ref|NP_001044799.1| Os01g0847700 [Oryza sativa Japonica Group]
 dbj|BAF06713.1| Os01g0847700, partial [Oryza sativa Japonica Group]
Length=324

 Score =   147 bits (371),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 73/96 (76%), Positives = 79/96 (82%), Gaps = 0/96 (0%)
 Frame = +1

Query  133  AGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGEV  312
            A   K FVLNTGAKIPSVGLGTWQ++PGVVG AV AA+K GYRHID A AYN EKE+G  
Sbjct  12   AEMAKHFVLNTGAKIPSVGLGTWQSDPGVVGNAVYAAVKAGYRHIDCASAYNNEKEVGLA  71

Query  313  LKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            LKKLF +GVVKREDLFITSKLW   HAPEDVP AL+
Sbjct  72   LKKLFEEGVVKREDLFITSKLWCDHHAPEDVPEALD  107



>pdb|3H7U|A Chain A, Crystal Structure Of The Plant Stress-Response Enzyme 
Akr4c9
Length=335

 Score =   147 bits (372),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 72/97 (74%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA A+  F LNTGAK PSVGLGTWQA PG+VG AV AA+K+GYRHID A+ Y  EKEIG 
Sbjct  21   MANAITFFKLNTGAKFPSVGLGTWQASPGLVGDAVAAAVKIGYRHIDCAQIYGNEKEIGA  80

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            VLKKLF D VVKREDLFITSKLW  DH P+DVP ALN
Sbjct  81   VLKKLFEDRVVKREDLFITSKLWCTDHDPQDVPEALN  117



>ref|XP_002879708.1| oxidoreductase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55967.1| oxidoreductase [Arabidopsis lyrata subsp. lyrata]
Length=315

 Score =   147 bits (370),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 72/97 (74%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA A+  F LNTGAK PSVGLGTWQA PG+VG AV AAIK+GYRHID A+ Y  EKEIG 
Sbjct  1    MANAITFFELNTGAKFPSVGLGTWQASPGLVGDAVAAAIKIGYRHIDCAQIYGNEKEIGA  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            VLKKLF D VVKR+DLFITSKLW  DH P+DVP ALN
Sbjct  61   VLKKLFEDRVVKRDDLFITSKLWCTDHDPQDVPEALN  97



>ref|XP_003520967.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Glycine 
max]
Length=313

 Score =   147 bits (370),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 72/97 (74%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA  +K F LNTGAKIPSVGLGTWQAEPGVV +AV  AI+VGYRHID A+AYN + EIG 
Sbjct  1    MAKLIKFFELNTGAKIPSVGLGTWQAEPGVVAKAVTIAIQVGYRHIDCAQAYNNQAEIGS  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
             LKKLF +GVVKREDL+ITSKLW  DH PEDVP AL+
Sbjct  61   ALKKLFDEGVVKREDLWITSKLWCSDHVPEDVPKALD  97



>ref|XP_003604914.1| Aldose reductase [Medicago truncatula]
 gb|AES87111.1| aldo/keto reductase family oxidoreductase [Medicago truncatula]
Length=288

 Score =   146 bits (368),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA A+K F LNTGAKIPSVGLGTWQAEPGVV +AV  A++VGYRHID A AY  + EIG 
Sbjct  1    MATAIKFFQLNTGAKIPSVGLGTWQAEPGVVAKAVTTAVQVGYRHIDCAEAYKNQSEIGS  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
             LKKLF DGV+KRE+L+ITSKLW  DH PEDVP AL+
Sbjct  61   ALKKLFEDGVIKREELWITSKLWCSDHHPEDVPKALD  97



>gb|KJB76787.1| hypothetical protein B456_012G107300 [Gossypium raimondii]
Length=323

 Score =   147 bits (370),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 80/99 (81%), Gaps = 0/99 (0%)
 Frame = +1

Query  124  VAMAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEI  303
            V MA A++ F LNTGAKIPSVGLGTWQA PGVVG AV  AIK GYRHID A+ Y  EKEI
Sbjct  7    VKMAAAIRYFDLNTGAKIPSVGLGTWQAAPGVVGNAVATAIKHGYRHIDCAQVYGNEKEI  66

Query  304  GEVLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            G VLKKL  DGVVKRE+L+ITSKLW  +HAPEDVP ALN
Sbjct  67   GLVLKKLSEDGVVKREELWITSKLWNTNHAPEDVPEALN  105



>ref|XP_006340994.1| PREDICTED: aldo-keto reductase family 4 member C10-like [Solanum 
tuberosum]
Length=317

 Score =   146 bits (369),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 81/99 (82%), Gaps = 0/99 (0%)
 Frame = +1

Query  124  VAMAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEI  303
            +A A  +  F LNTG  IP+VGLGTWQ++PGVVG+AVE AIK+GYRHID A+ Y  EKEI
Sbjct  1    MAEATEMPYFKLNTGFSIPAVGLGTWQSDPGVVGKAVETAIKMGYRHIDCAQIYKNEKEI  60

Query  304  GEVLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            GEVL +LF DGVVKR+DLFITSKLW  +HAPEDVPV L+
Sbjct  61   GEVLSRLFKDGVVKRQDLFITSKLWNTNHAPEDVPVTLD  99



>gb|KJB76793.1| hypothetical protein B456_012G107500 [Gossypium raimondii]
Length=221

 Score =   144 bits (363),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 73/97 (75%), Positives = 81/97 (84%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA A+K F LNTGAKIPSVGLGTWQ+EPG+VG AV AA+K+GYRHID A+ Y  EKEIG 
Sbjct  1    MANAIKFFELNTGAKIPSVGLGTWQSEPGLVGAAVAAAVKIGYRHIDCAQVYGNEKEIGV  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            V KKLF DGVVKRE+LFITSKLW  DH+PEDVP AL 
Sbjct  61   VFKKLFEDGVVKREELFITSKLWCTDHSPEDVPAALE  97



>gb|KHG06616.1| Aldo-keto reductase family 4 member C9 [Gossypium arboreum]
Length=288

 Score =   145 bits (367),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 73/97 (75%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA A++ F LNTGAKIPSVGLGTWQA PGVVG AV  AIK GYRHID A+ Y  EKEIG 
Sbjct  1    MAAAIRYFDLNTGAKIPSVGLGTWQAAPGVVGNAVATAIKHGYRHIDCAQVYGNEKEIGL  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            VLKKL  DGVVKRE+L+ITSKLW  +HAPEDVP ALN
Sbjct  61   VLKKLSEDGVVKREELWITSKLWNTNHAPEDVPEALN  97



>gb|KJB76786.1| hypothetical protein B456_012G107200 [Gossypium raimondii]
Length=230

 Score =   144 bits (363),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 77/97 (79%), Positives = 85/97 (88%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA A++ F LNTGAKIPSVGLGTWQA PGVVG AV AAIK+GYRHID A+AY+ EKEIG 
Sbjct  4    MAQAIRYFELNTGAKIPSVGLGTWQASPGVVGAAVAAAIKIGYRHIDCAQAYDNEKEIGS  63

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            VLKKLF DGVV+REDL+ITSKLW  +HAPEDVPVALN
Sbjct  64   VLKKLFQDGVVRREDLWITSKLWCTNHAPEDVPVALN  100



>ref|XP_007205596.1| hypothetical protein PRUPE_ppa008905mg [Prunus persica]
 gb|EMJ06795.1| hypothetical protein PRUPE_ppa008905mg [Prunus persica]
Length=315

 Score =   146 bits (369),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 72/97 (74%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA A++ F LNTGAKIPS+GLGTWQAEPGVV  AV  AIKVGYRHID A+AY  EKEIG 
Sbjct  1    MAKAIRFFELNTGAKIPSLGLGTWQAEPGVVAAAVTTAIKVGYRHIDCAQAYGNEKEIGF  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
             LKKL+ DGVVKREDL+ITSKLW  +H PEDVP AL+
Sbjct  61   ALKKLYDDGVVKREDLWITSKLWCNNHEPEDVPKALD  97



>gb|EMS66725.1| Aldo-keto reductase family 4 member C10 [Triticum urartu]
Length=310

 Score =   146 bits (368),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 71/90 (79%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = +1

Query  151  FVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGEVLKKLFA  330
            F+LNTGA++PSVGLGTWQAEPGVVG AV AA+K GYRHID AR Y+ EKEIG  LKKLF 
Sbjct  5    FLLNTGARMPSVGLGTWQAEPGVVGDAVYAAVKAGYRHIDCAREYHNEKEIGLALKKLFE  64

Query  331  DGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            +GVVKREDLFITSKLW   HAPEDVP ALN
Sbjct  65   EGVVKREDLFITSKLWNDCHAPEDVPEALN  94



>ref|XP_004506627.1| PREDICTED: aldo-keto reductase family 4 member C9-like isoform 
X2 [Cicer arietinum]
Length=287

 Score =   145 bits (367),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 71/97 (73%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            M  A+K F LNTGAKIPSVGLGTWQAEPGVV +AV  AI+VGYRHID A AY  + EIG 
Sbjct  1    MGTAIKFFQLNTGAKIPSVGLGTWQAEPGVVAEAVNTAIQVGYRHIDCAEAYRNQAEIGS  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
             LKKLF DGVVKRE+L+ITSKLW  DH PEDVP AL+
Sbjct  61   ALKKLFEDGVVKREELWITSKLWCSDHHPEDVPKALD  97



>ref|XP_002529870.1| aldo-keto reductase, putative [Ricinus communis]
 gb|EEF32520.1| aldo-keto reductase, putative [Ricinus communis]
Length=315

 Score =   146 bits (369),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 73/96 (76%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA  ++CF LNTGAK+PSVGLGTWQAEPG+VG AVEAAIK+GYRHID A+AYN EKEIG 
Sbjct  1    MANEIRCFELNTGAKMPSVGLGTWQAEPGLVGAAVEAAIKIGYRHIDCAQAYNNEKEIGS  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVAL  417
            VLKKL  DGVVKR DLFITSKL   +H PEDV  AL
Sbjct  61   VLKKLLEDGVVKRGDLFITSKLGCSNHDPEDVVKAL  96



>gb|KCW84681.1| hypothetical protein EUGRSUZ_B01498 [Eucalyptus grandis]
Length=289

 Score =   145 bits (367),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 72/97 (74%), Positives = 81/97 (84%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA A++ F LNTGAKIPSVGLGTWQA+PGVV  AV  AIKVGYRHID A+AY  EKEIG 
Sbjct  1    MAKAIRFFELNTGAKIPSVGLGTWQADPGVVADAVTTAIKVGYRHIDCAQAYQNEKEIGT  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
             L+KLF++GVVKREDL+ITSKL   DHAPEDVP AL+
Sbjct  61   ALQKLFSEGVVKREDLWITSKLACTDHAPEDVPKALD  97



>dbj|BAJ90871.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=310

 Score =   146 bits (368),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 71/92 (77%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +1

Query  145  KCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGEVLKKL  324
            + F+LNTGAKIPSVGLGTWQA+PGVVG AV AA+K GYRHID AR Y  EKEIG  LKKL
Sbjct  3    RHFLLNTGAKIPSVGLGTWQADPGVVGDAVYAAVKAGYRHIDCARVYGNEKEIGLALKKL  62

Query  325  FADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            F +GVVKR+DLFITSKLW   HAPEDVP ALN
Sbjct  63   FEEGVVKRDDLFITSKLWNDHHAPEDVPEALN  94



>gb|KHN43834.1| Aldo-keto reductase family 4 member C9 [Glycine soja]
Length=312

 Score =   146 bits (368),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 73/97 (75%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA  +K F LNTGAKIPSVGLGTWQAEPGVV +AV  AI VGYRHID A+AYN + EIG 
Sbjct  1    MAKLIKFFELNTGAKIPSVGLGTWQAEPGVVAKAVTTAILVGYRHIDCAQAYNNQAEIGS  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
             LKKLF DGVVKREDL+ITSKLW  DHA EDVP AL+
Sbjct  61   ALKKLFDDGVVKREDLWITSKLWCSDHASEDVPKALD  97



>ref|XP_010517055.1| PREDICTED: aldo-keto reductase family 4 member C9-like isoform 
X1 [Camelina sativa]
Length=316

 Score =   146 bits (368),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 71/97 (73%), Positives = 77/97 (79%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA  VKCF LNTGAKIPSVGLGTWQA PG+VG AV AA+K+GYRH D A+ Y  EK IG 
Sbjct  1    MANEVKCFELNTGAKIPSVGLGTWQASPGLVGNAVAAAVKIGYRHTDCAKLYGNEKVIGA  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            VLKKLF D VVK E+LFITSKLW  DH P+DVP ALN
Sbjct  61   VLKKLFEDNVVKHEELFITSKLWCTDHDPKDVPEALN  97



>ref|XP_003516896.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Glycine 
max]
Length=313

 Score =   146 bits (368),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 73/97 (75%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA  +K F LNTGAKIPSVGLGTWQAEPGVV +AV  AI VGYRHID A+AYN + EIG 
Sbjct  1    MAKLIKFFELNTGAKIPSVGLGTWQAEPGVVAKAVTTAILVGYRHIDCAQAYNNQAEIGS  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
             LKKLF DGVVKREDL+ITSKLW  DHA EDVP AL+
Sbjct  61   ALKKLFDDGVVKREDLWITSKLWCSDHASEDVPKALD  97



>ref|XP_003604913.1| Aldose reductase [Medicago truncatula]
 gb|AES87110.1| aldo/keto reductase family oxidoreductase [Medicago truncatula]
 gb|AFK38211.1| unknown [Medicago truncatula]
Length=313

 Score =   146 bits (368),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA A+K F LNTGAKIPSVGLGTWQAEPGVV +AV  A++VGYRHID A AY  + EIG 
Sbjct  1    MATAIKFFQLNTGAKIPSVGLGTWQAEPGVVAKAVTTAVQVGYRHIDCAEAYKNQSEIGS  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
             LKKLF DGV+KRE+L+ITSKLW  DH PEDVP AL+
Sbjct  61   ALKKLFEDGVIKREELWITSKLWCSDHHPEDVPKALD  97



>gb|ACJ84681.1| unknown [Medicago truncatula]
Length=313

 Score =   145 bits (367),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA A+K F LNTGAKIPSVGLGTWQAEPGVV +AV  A++VGYRHID A AY  + EIG 
Sbjct  1    MATAIKFFQLNTGAKIPSVGLGTWQAEPGVVAKAVTTAVQVGYRHIDCAEAYKNQSEIGS  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
             LKKLF DGV+KRE+L+ITSKLW  DH PEDVP AL+
Sbjct  61   ALKKLFEDGVIKREELWITSKLWCSDHHPEDVPKALD  97



>gb|KFK36670.1| hypothetical protein AALP_AA4G154600 [Arabis alpina]
Length=315

 Score =   145 bits (367),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/96 (73%), Positives = 78/96 (81%), Gaps = 0/96 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA A+K F LNTGAKIPSVGLGTWQ+ PG+VG AV  A+K+GYRHID A+ Y  EKEIG 
Sbjct  1    MANAIKFFELNTGAKIPSVGLGTWQSSPGLVGDAVATAVKIGYRHIDCAQIYGNEKEIGA  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVAL  417
            VLKKLF D VVKRE+LFITSKLW  DH P+DVP AL
Sbjct  61   VLKKLFEDSVVKREELFITSKLWCTDHDPQDVPEAL  96



>ref|XP_010038908.1| PREDICTED: aldo-keto reductase family 4 member C9-like isoform 
X1 [Eucalyptus grandis]
 gb|KCW84684.1| hypothetical protein EUGRSUZ_B01501 [Eucalyptus grandis]
Length=315

 Score =   145 bits (367),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/97 (71%), Positives = 81/97 (84%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA A++ F LNTGAKIPS+GLGTWQA+PGVV +AV  A K GYRHID A+AY  EKEIG 
Sbjct  1    MAKAIRFFELNTGAKIPSIGLGTWQADPGVVAEAVTTATKAGYRHIDCAQAYYNEKEIGT  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
             L+KLF++GVVKREDL+ITSKLW  DHAPEDVP A++
Sbjct  61   ALQKLFSEGVVKREDLWITSKLWCTDHAPEDVPKAID  97



>ref|XP_007134071.1| hypothetical protein PHAVU_010G017100g [Phaseolus vulgaris]
 gb|ESW06065.1| hypothetical protein PHAVU_010G017100g [Phaseolus vulgaris]
Length=313

 Score =   145 bits (366),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA  ++ F L TGAKIPSVGLGTWQAEPGVV +A+  AI+VGYRHID A+AYN + EIG 
Sbjct  1    MAKLIQFFELKTGAKIPSVGLGTWQAEPGVVAKAITTAIQVGYRHIDCAQAYNNQAEIGS  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
             LKK+F DGVVKREDL+ITSKLW  DHAPEDVP AL+
Sbjct  61   ALKKVFDDGVVKREDLWITSKLWCTDHAPEDVPKALD  97



>ref|XP_004506626.1| PREDICTED: aldo-keto reductase family 4 member C9-like isoform 
X1 [Cicer arietinum]
Length=313

 Score =   145 bits (366),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 71/97 (73%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            M  A+K F LNTGAKIPSVGLGTWQAEPGVV +AV  AI+VGYRHID A AY  + EIG 
Sbjct  1    MGTAIKFFQLNTGAKIPSVGLGTWQAEPGVVAEAVNTAIQVGYRHIDCAEAYRNQAEIGS  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
             LKKLF DGVVKRE+L+ITSKLW  DH PEDVP AL+
Sbjct  61   ALKKLFEDGVVKREELWITSKLWCSDHHPEDVPKALD  97



>gb|EEC71799.1| hypothetical protein OsI_04428 [Oryza sativa Indica Group]
 gb|ACS92968.1| aldo-keto reductase [Oryza sativa Indica Group]
Length=311

 Score =   145 bits (366),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 71/92 (77%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +1

Query  145  KCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGEVLKKL  324
            K  VLNTGAKIPSVGLGTWQ++PGVVG AV AA+K GYRHID A AYN EKE+G  LKKL
Sbjct  3    KHLVLNTGAKIPSVGLGTWQSDPGVVGNAVYAAVKAGYRHIDCASAYNNEKEVGLALKKL  62

Query  325  FADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            F +GVVKREDLFITSKLW   HAPEDVP AL+
Sbjct  63   FEEGVVKREDLFITSKLWCDHHAPEDVPEALD  94



>ref|XP_008674825.1| PREDICTED: aldo-keto reductase family 4 member C10 [Zea mays]
Length=310

 Score =   145 bits (365),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 69/92 (75%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +1

Query  145  KCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGEVLKKL  324
            + FVLNTGAK+PSVGLGTWQ++PG+VG AV AA+K G+RHID AR Y  EKEIG  LKKL
Sbjct  3    RHFVLNTGAKVPSVGLGTWQSDPGIVGNAVYAAVKAGFRHIDCARVYGNEKEIGLALKKL  62

Query  325  FADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            F +GVVKREDLFITSKLW   HAPEDVP ALN
Sbjct  63   FEEGVVKREDLFITSKLWNDHHAPEDVPEALN  94



>ref|XP_006654504.1| PREDICTED: aldo-keto reductase family 4 member C10-like [Oryza 
brachyantha]
Length=312

 Score =   145 bits (365),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = +1

Query  145  KCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGEVLKKL  324
            +CFVLNTGAKIPSVGLGTWQ+EPG VG AV AA+K GYRHID A+AY  +KEIG  LKK+
Sbjct  3    RCFVLNTGAKIPSVGLGTWQSEPGAVGDAVYAAVKAGYRHIDCAQAYANQKEIGVALKKV  62

Query  325  FADGVVKREDLFITSKLWGRDHAPEDVPVAL  417
            F +G++KREDLFITSKLW  +H PEDVPVAL
Sbjct  63   FDEGIIKREDLFITSKLWCTNHDPEDVPVAL  93



>ref|XP_007134074.1| hypothetical protein PHAVU_010G017400g [Phaseolus vulgaris]
 gb|ESW06068.1| hypothetical protein PHAVU_010G017400g [Phaseolus vulgaris]
Length=315

 Score =   145 bits (365),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 68/96 (71%), Positives = 78/96 (81%), Gaps = 0/96 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            M+  +  F LNTGAKIPS+ LGTWQ++PG+V QAV AAIK GYRHID A+ Y  EKEIG 
Sbjct  1    MSNDIPFFELNTGAKIPSIALGTWQSDPGLVSQAVAAAIKTGYRHIDCAQIYENEKEIGS  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVAL  417
            +LKKLF +GVVKREDL+ITSKLW  DHAPEDVP AL
Sbjct  61   MLKKLFEEGVVKREDLWITSKLWNTDHAPEDVPQAL  96



>ref|XP_010517053.1| PREDICTED: aldo-keto reductase family 4 member C10 isoform X3 
[Camelina sativa]
 ref|XP_010517054.1| PREDICTED: aldo-keto reductase family 4 member C10 isoform X4 
[Camelina sativa]
Length=314

 Score =   145 bits (365),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 81/97 (84%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA  ++ F LNTGAKIPSVGLGTWQA+PG+VG AVEAA+K+GYRHID A+ Y  EKEIG 
Sbjct  1    MADEIRYFELNTGAKIPSVGLGTWQADPGLVGNAVEAAVKIGYRHIDCAQIYGNEKEIGL  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            VLKKLF DGVVKRE++FITSKLW   H P++VP ALN
Sbjct  61   VLKKLFDDGVVKREEMFITSKLWCTCHDPQEVPEALN  97



>ref|XP_010038899.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Eucalyptus 
grandis]
 gb|KCW84680.1| hypothetical protein EUGRSUZ_B01498 [Eucalyptus grandis]
Length=315

 Score =   145 bits (365),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 72/97 (74%), Positives = 81/97 (84%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA A++ F LNTGAKIPSVGLGTWQA+PGVV  AV  AIKVGYRHID A+AY  EKEIG 
Sbjct  1    MAKAIRFFELNTGAKIPSVGLGTWQADPGVVADAVTTAIKVGYRHIDCAQAYQNEKEIGT  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
             L+KLF++GVVKREDL+ITSKL   DHAPEDVP AL+
Sbjct  61   ALQKLFSEGVVKREDLWITSKLACTDHAPEDVPKALD  97



>ref|XP_007134066.1| hypothetical protein PHAVU_010G016600g [Phaseolus vulgaris]
 gb|ESW06060.1| hypothetical protein PHAVU_010G016600g [Phaseolus vulgaris]
Length=311

 Score =   144 bits (364),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 68/97 (70%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            M   ++ F L TGAKIPS+GLGTWQAEPGVV +AV  AI+VGYRHID A+AY+ + EIG 
Sbjct  1    MTNLIQSFELKTGAKIPSIGLGTWQAEPGVVAKAVTTAIQVGYRHIDCAQAYDNQAEIGS  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
             LKK+F DGVVKREDL+ITSKLW  DHAPEDVP AL+
Sbjct  61   ALKKVFEDGVVKREDLWITSKLWCSDHAPEDVPKALD  97



>gb|KFK36672.1| hypothetical protein AALP_AA4G154800 [Arabis alpina]
Length=314

 Score =   144 bits (364),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 71/97 (73%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA  +K F LNTGAKIPSVGLGTWQ++PG+VG AVEAAIK+GYRHID A+ Y  EKEIG 
Sbjct  1    MADEIKFFELNTGAKIPSVGLGTWQSDPGLVGNAVEAAIKIGYRHIDCAQIYGNEKEIGL  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            VLKKLF DGVVKRE++FITSKLW   H P+DV  ALN
Sbjct  61   VLKKLFDDGVVKREEMFITSKLWCTYHDPQDVAEALN  97



>gb|KDO48136.1| hypothetical protein CISIN_1g021241mg [Citrus sinensis]
Length=315

 Score =   144 bits (363),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 71/97 (73%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA  ++ FVLNTGAKIPSVGLGTWQ++PGVVG AV AAIK GYRHID A+ Y  EKEIG 
Sbjct  1    MANEIRQFVLNTGAKIPSVGLGTWQSDPGVVGNAVAAAIKAGYRHIDCAQIYGNEKEIGL  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            VLKK F D VVKREDL+ITSKLW   H PEDVP AL+
Sbjct  61   VLKKFFEDAVVKREDLWITSKLWNAYHEPEDVPEALD  97



>ref|XP_009358775.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Pyrus 
x bretschneideri]
Length=315

 Score =   144 bits (363),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 71/97 (73%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA  ++ F LNTG+KIPSVGLGTWQ+ PG+VG AV AAIK GYRHID A+ Y  EKEIG 
Sbjct  1    MADDMRFFQLNTGSKIPSVGLGTWQSSPGLVGDAVAAAIKAGYRHIDCAQRYGNEKEIGL  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            VLKKLF DGVVKREDLFITSKLW  DHAPEDV  A++
Sbjct  61   VLKKLFEDGVVKREDLFITSKLWCTDHAPEDVLAAMD  97



>ref|XP_009133205.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Brassica 
rapa]
Length=315

 Score =   144 bits (363),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 69/97 (71%), Positives = 77/97 (79%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA  +K F LNTGAKIPSVGLGTWQA PGVVG AV  A+K+GYRHID A+ Y+ EKEIG 
Sbjct  1    MANPIKVFELNTGAKIPSVGLGTWQASPGVVGDAVTTAVKIGYRHIDCAQMYDNEKEIGA  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
             LKKLF + VVKRE+LFITSKLW  DH P+DVP AL 
Sbjct  61   ALKKLFEEDVVKREELFITSKLWCTDHDPQDVPEALT  97



>ref|XP_006429181.1| hypothetical protein CICLE_v10012243mg [Citrus clementina]
 ref|XP_006493581.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Citrus 
sinensis]
 gb|ESR42421.1| hypothetical protein CICLE_v10012243mg [Citrus clementina]
Length=315

 Score =   144 bits (363),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 71/97 (73%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA  ++ FVLNTGAKIPSVGLGTWQ++PGVVG AV AAIK GYRHID A+ Y  EKEIG 
Sbjct  1    MANEIRHFVLNTGAKIPSVGLGTWQSDPGVVGNAVAAAIKAGYRHIDCAQIYGNEKEIGL  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            VLKK F D VVKREDL+ITSKLW   H PEDVP AL+
Sbjct  61   VLKKFFEDAVVKREDLWITSKLWNAYHEPEDVPEALD  97



>ref|XP_010088583.1| Aldo-keto reductase family 4 member C9 [Morus notabilis]
 gb|EXB36724.1| Aldo-keto reductase family 4 member C9 [Morus notabilis]
Length=280

 Score =   143 bits (361),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 70/96 (73%), Positives = 75/96 (78%), Gaps = 0/96 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            M   +  F LNTGAKIPS+GLGTWQ+ PG+V  AV AAI VGYRHID A+ Y  EKEIG 
Sbjct  1    MGDDILYFELNTGAKIPSMGLGTWQSSPGLVADAVTAAITVGYRHIDCAQVYGNEKEIGS  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVAL  417
             LKKLF DGVVKREDLFITSKLW  DHAPEDVP AL
Sbjct  61   ALKKLFEDGVVKREDLFITSKLWNTDHAPEDVPKAL  96



>ref|XP_008448277.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Cucumis 
melo]
Length=317

 Score =   144 bits (363),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 78/99 (79%), Gaps = 0/99 (0%)
 Frame = +1

Query  124  VAMAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEI  303
            +A    +  F LNTGA IPS+GLGTWQA  G+VG AV AAIK+GYRHID AR Y  EKEI
Sbjct  1    MASESQISFFSLNTGANIPSIGLGTWQATEGLVGNAVAAAIKIGYRHIDCARDYGNEKEI  60

Query  304  GEVLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            G VLK+LF +GVVKREDLFITSKLW  DHAPEDVP AL+
Sbjct  61   GSVLKQLFEEGVVKREDLFITSKLWCTDHAPEDVPAALD  99



>gb|KJB76792.1| hypothetical protein B456_012G107500 [Gossypium raimondii]
Length=310

 Score =   144 bits (363),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 73/96 (76%), Positives = 81/96 (84%), Gaps = 0/96 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA A+K F LNTGAKIPSVGLGTWQ+EPG+VG AV AA+K+GYRHID A+ Y  EKEIG 
Sbjct  1    MANAIKFFELNTGAKIPSVGLGTWQSEPGLVGAAVAAAVKIGYRHIDCAQVYGNEKEIGV  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVAL  417
            V KKLF DGVVKRE+LFITSKLW  DH+PEDVP AL
Sbjct  61   VFKKLFEDGVVKREELFITSKLWCTDHSPEDVPAAL  96



>ref|XP_010529794.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Tarenaya 
hassleriana]
Length=363

 Score =   145 bits (365),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 76/97 (78%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA  ++ F LNTG KIPSVGLGTWQA PG+VG AV AA+K+GYRHID AR Y  EKEIG 
Sbjct  49   MAKDIRFFELNTGTKIPSVGLGTWQAAPGLVGDAVTAAVKIGYRHIDCARIYGNEKEIGT  108

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
             LKKLF DGVVKRE+LFITSKLW  DH P DVP A N
Sbjct  109  ALKKLFEDGVVKREELFITSKLWCTDHDPRDVPEAFN  145



>ref|XP_004166957.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Cucumis 
sativus]
Length=315

 Score =   144 bits (362),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 71/97 (73%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA  +  F LNTGAKIPSVGLGTWQA  G+VG AV AA+K GYRHID A+ Y  EKEIG 
Sbjct  1    MASPISFFQLNTGAKIPSVGLGTWQAAEGLVGNAVAAAVKFGYRHIDCAQIYGNEKEIGS  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            VLKKLF DGVVKREDL+ITSKLW  DHAPE+VP AL+
Sbjct  61   VLKKLFEDGVVKREDLWITSKLWCTDHAPEEVPAALD  97



>gb|KGN54282.1| hypothetical protein Csa_4G296840 [Cucumis sativus]
Length=291

 Score =   143 bits (360),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 78/99 (79%), Gaps = 0/99 (0%)
 Frame = +1

Query  124  VAMAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEI  303
            +A    +  F LNT AKIPSVGLGTWQA  G+VG AV AAIK+GYRHID AR Y  EKEI
Sbjct  1    MASESQISFFTLNTAAKIPSVGLGTWQAAEGLVGNAVAAAIKIGYRHIDCARDYGNEKEI  60

Query  304  GEVLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            G VLK+LF +GVVKREDL+ITSKLW  DHAPEDVP AL+
Sbjct  61   GSVLKQLFEEGVVKREDLWITSKLWCSDHAPEDVPAALD  99



>ref|XP_006410969.1| hypothetical protein EUTSA_v10017980mg [Eutrema salsugineum]
 gb|ESQ52422.1| hypothetical protein EUTSA_v10017980mg [Eutrema salsugineum]
Length=315

 Score =   144 bits (362),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/97 (71%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA A++ F LNTGAKIPSVGLGTWQA PG+VG AV  A+K+GYRHID A+ Y  E EIG 
Sbjct  1    MANAMRFFELNTGAKIPSVGLGTWQASPGLVGDAVATAVKIGYRHIDCAQMYGNENEIGA  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            VLKKLF D VVKRE+LFITSKLW  DH P+DVP AL+
Sbjct  61   VLKKLFEDSVVKREELFITSKLWCADHDPQDVPEALD  97



>ref|XP_002272909.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Vitis 
vinifera]
Length=315

 Score =   144 bits (362),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 68/97 (70%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            M+  ++ F LNTGAK+P VGLGTWQ++PG+VG+AV  AIKVGYRHID A+ Y  EKEIG 
Sbjct  1    MSDDIRFFELNTGAKMPYVGLGTWQSDPGLVGEAVAIAIKVGYRHIDCAQVYGNEKEIGI  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            VLKK+F DG+VKREDL+ITSKLW  DH PEDVP ALN
Sbjct  61   VLKKMFEDGIVKREDLWITSKLWCTDHGPEDVPEALN  97



>ref|XP_007026920.1| NAD(P)-linked oxidoreductase superfamily protein, putative isoform 
2 [Theobroma cacao]
 gb|EOY07422.1| NAD(P)-linked oxidoreductase superfamily protein, putative isoform 
2 [Theobroma cacao]
Length=1231

 Score =   150 bits (378),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 74/97 (76%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = +1

Query  130   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
             MA A++ F LNTGAKIPSVGLGTWQA PGVVG AV  AIK+GYRHID A+ Y  EKEIG 
Sbjct  1026  MAQAIRYFELNTGAKIPSVGLGTWQAAPGVVGDAVATAIKLGYRHIDCAQVYGNEKEIGS  1085

Query  310   VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
             VLKKLF DGVVKREDL+ITSKLW  +HAPEDV  ALN
Sbjct  1086  VLKKLFEDGVVKREDLWITSKLWNTNHAPEDVQEALN  1122


 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 75/97 (77%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA A++ F LNTGAKIPSVGLGTWQA PGVVG AV AAIK+GYRHID A AY  +KEIG 
Sbjct  647  MAEAIRYFELNTGAKIPSVGLGTWQAAPGVVGNAVAAAIKLGYRHIDCAEAYENQKEIGS  706

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            VLKKLF DGVVKREDL+ITSKLW   HAPE VP ALN
Sbjct  707  VLKKLFDDGVVKREDLWITSKLWCNSHAPEVVPEALN  743


 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 65/98 (66%), Positives = 74/98 (76%), Gaps = 1/98 (1%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQA-EPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIG  306
            MA  ++ F LNTGAKIPSVGLGT+ A + GV+   V  AIKVGYRHID A  Y  EKEIG
Sbjct  1    MADDIRFFELNTGAKIPSVGLGTYGAKQHGVIQNTVTTAIKVGYRHIDCASLYGNEKEIG  60

Query  307  EVLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
              LKKLF +G+V+REDL+ITSKLW  DH PEDVP ALN
Sbjct  61   SALKKLFNEGIVRREDLWITSKLWCSDHLPEDVPKALN  98


 Score =   114 bits (286),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 66/88 (75%), Gaps = 0/88 (0%)
 Frame = +1

Query  157  LNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGEVLKKLFADG  336
            L  GAKIPSVGLGT+ A+ GV+   V  AIKVGYRHID A  Y  EKEIG  LKKLF +G
Sbjct  311  LWDGAKIPSVGLGTYGAKHGVIQNTVITAIKVGYRHIDCASLYGNEKEIGSALKKLFNEG  370

Query  337  VVKREDLFITSKLWGRDHAPEDVPVALN  420
            +V+REDL+ITSKLW  DH PEDV  ALN
Sbjct  371  IVRREDLWITSKLWCSDHLPEDVSKALN  398



>ref|XP_007026919.1| NAD(P)-linked oxidoreductase superfamily protein, putative isoform 
1 [Theobroma cacao]
 gb|EOY07421.1| NAD(P)-linked oxidoreductase superfamily protein, putative isoform 
1 [Theobroma cacao]
Length=1340

 Score =   150 bits (379),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 74/97 (76%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = +1

Query  130   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
             MA A++ F LNTGAKIPSVGLGTWQA PGVVG AV  AIK+GYRHID A+ Y  EKEIG 
Sbjct  1026  MAQAIRYFELNTGAKIPSVGLGTWQAAPGVVGDAVATAIKLGYRHIDCAQVYGNEKEIGS  1085

Query  310   VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
             VLKKLF DGVVKREDL+ITSKLW  +HAPEDV  ALN
Sbjct  1086  VLKKLFEDGVVKREDLWITSKLWNTNHAPEDVQEALN  1122


 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 75/97 (77%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA A++ F LNTGAKIPSVGLGTWQA PGVVG AV AAIK+GYRHID A AY  +KEIG 
Sbjct  647  MAEAIRYFELNTGAKIPSVGLGTWQAAPGVVGNAVAAAIKLGYRHIDCAEAYENQKEIGS  706

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            VLKKLF DGVVKREDL+ITSKLW   HAPE VP ALN
Sbjct  707  VLKKLFDDGVVKREDLWITSKLWCNSHAPEVVPEALN  743


 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 65/98 (66%), Positives = 74/98 (76%), Gaps = 1/98 (1%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQA-EPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIG  306
            MA  ++ F LNTGAKIPSVGLGT+ A + GV+   V  AIKVGYRHID A  Y  EKEIG
Sbjct  1    MADDIRFFELNTGAKIPSVGLGTYGAKQHGVIQNTVTTAIKVGYRHIDCASLYGNEKEIG  60

Query  307  EVLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
              LKKLF +G+V+REDL+ITSKLW  DH PEDVP ALN
Sbjct  61   SALKKLFNEGIVRREDLWITSKLWCSDHLPEDVPKALN  98


 Score =   114 bits (286),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 65/85 (76%), Gaps = 0/85 (0%)
 Frame = +1

Query  166  GAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGEVLKKLFADGVVK  345
            GAKIPSVGLGT+ A+ GV+   V  AIKVGYRHID A  Y  EKEIG  LKKLF +G+V+
Sbjct  314  GAKIPSVGLGTYGAKHGVIQNTVITAIKVGYRHIDCASLYGNEKEIGSALKKLFNEGIVR  373

Query  346  REDLFITSKLWGRDHAPEDVPVALN  420
            REDL+ITSKLW  DH PEDV  ALN
Sbjct  374  REDLWITSKLWCSDHLPEDVSKALN  398



>emb|CDY57148.1| BnaC04g53540D [Brassica napus]
Length=600

 Score =   147 bits (370),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 71/96 (74%), Positives = 79/96 (82%), Gaps = 0/96 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA A++ F LNTGAKIPSVGLGTWQA PG+VG AV AA+K+GYRHID A+ Y  EKEIG 
Sbjct  1    MANALRYFELNTGAKIPSVGLGTWQASPGLVGDAVAAAVKIGYRHIDCAQIYGNEKEIGT  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVAL  417
            VLKKLF D VVKRE+LFITSKLW  DH P+DVP AL
Sbjct  61   VLKKLFEDNVVKREELFITSKLWCTDHDPQDVPEAL  96


 Score = 87.4 bits (215),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = +1

Query  250  VGYRHIDGARAYNXEKEIGEVLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVAL  417
            +GYRHID A+ Y  EKEIG VLKKLF D VVKRE+LFITSKLW  DH P+DVP AL
Sbjct  326  IGYRHIDCAQIYGNEKEIGTVLKKLFEDNVVKREELFITSKLWCTDHDPQDVPEAL  381



>gb|KJB76791.1| hypothetical protein B456_012G107500 [Gossypium raimondii]
Length=315

 Score =   143 bits (361),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 73/96 (76%), Positives = 81/96 (84%), Gaps = 0/96 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA A+K F LNTGAKIPSVGLGTWQ+EPG+VG AV AA+K+GYRHID A+ Y  EKEIG 
Sbjct  1    MANAIKFFELNTGAKIPSVGLGTWQSEPGLVGAAVAAAVKIGYRHIDCAQVYGNEKEIGV  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVAL  417
            V KKLF DGVVKRE+LFITSKLW  DH+PEDVP AL
Sbjct  61   VFKKLFEDGVVKREELFITSKLWCTDHSPEDVPAAL  96



>gb|KCW84679.1| hypothetical protein EUGRSUZ_B01497 [Eucalyptus grandis]
Length=315

 Score =   143 bits (361),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 68/97 (70%), Positives = 81/97 (84%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA A+  F LNTGAKIPSVGLGTWQ++PGVV  AV  A+KVGYRH+D A+ YN EKE+G 
Sbjct  1    MAKAICFFELNTGAKIPSVGLGTWQSDPGVVADAVITAVKVGYRHVDCAQIYNNEKEVGT  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
             L+KLF++GVVKREDL+ITSKLW  DHAPEDVP A++
Sbjct  61   ALQKLFSEGVVKREDLWITSKLWCNDHAPEDVPKAID  97



>ref|XP_004253294.1| PREDICTED: aldo-keto reductase family 4 member C10, partial [Solanum 
lycopersicum]
Length=204

 Score =   140 bits (353),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/97 (70%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA  ++ F LNTGAKIPSVGLGTWQA+PG+VG AV+AA+K+GYRHID A+ Y  EKEIG 
Sbjct  1    MAEEIRFFELNTGAKIPSVGLGTWQADPGLVGNAVDAAVKIGYRHIDCAQIYGNEKEIGL  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            VLKKLF  GVVKRE++FITSKLW   H P++VP ALN
Sbjct  61   VLKKLFDGGVVKREEMFITSKLWCTYHDPQEVPEALN  97



>ref|XP_002862967.1| hypothetical protein ARALYDRAFT_333154 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39226.1| hypothetical protein ARALYDRAFT_333154 [Arabidopsis lyrata subsp. 
lyrata]
Length=350

 Score =   144 bits (363),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/97 (71%), Positives = 81/97 (84%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA  ++ F LNTGAKIPSVGLGTWQA+PG+VG AV+AA+K+GYRHID A+ Y  EKEIG 
Sbjct  1    MAEEIRFFELNTGAKIPSVGLGTWQADPGLVGNAVDAAVKIGYRHIDCAQIYGNEKEIGL  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            VLKKLF DGVVKRE++FITSKLW   H P++VP ALN
Sbjct  61   VLKKLFDDGVVKREEMFITSKLWCTYHDPQEVPEALN  97



>ref|XP_010232559.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Brachypodium 
distachyon]
Length=311

 Score =   143 bits (360),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 77/89 (87%), Gaps = 0/89 (0%)
 Frame = +1

Query  151  FVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGEVLKKLFA  330
            FVLNTGAK+P+VGLGTWQ++PGVVG+AV AA+K GYRHID ARAYN EKE+G  LKKLF 
Sbjct  5    FVLNTGAKMPAVGLGTWQSDPGVVGEAVYAAVKAGYRHIDCARAYNNEKEVGLALKKLFE  64

Query  331  DGVVKREDLFITSKLWGRDHAPEDVPVAL  417
            +G VKREDLFITSKLW   HAPEDVP A+
Sbjct  65   EGTVKREDLFITSKLWCGHHAPEDVPEAI  93



>ref|XP_004166956.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Cucumis 
sativus]
Length=317

 Score =   143 bits (360),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 78/99 (79%), Gaps = 0/99 (0%)
 Frame = +1

Query  124  VAMAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEI  303
            +A    +  F LNT AKIPSVGLGTWQA  G+VG AV AAIK+GYRHID AR Y  EKEI
Sbjct  1    MASESQISFFTLNTAAKIPSVGLGTWQAAEGLVGNAVAAAIKIGYRHIDCARDYGNEKEI  60

Query  304  GEVLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            G VLK+LF +GVVKREDL+ITSKLW  DHAPEDVP AL+
Sbjct  61   GSVLKQLFEEGVVKREDLWITSKLWCSDHAPEDVPAALD  99



>ref|XP_004142054.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Cucumis 
sativus]
Length=317

 Score =   143 bits (360),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 78/99 (79%), Gaps = 0/99 (0%)
 Frame = +1

Query  124  VAMAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEI  303
            +A    +  F LNT AKIPSVGLGTWQA  G+VG AV AAIK+GYRHID AR Y  EKEI
Sbjct  1    MASESQISFFTLNTAAKIPSVGLGTWQAAEGLVGNAVAAAIKIGYRHIDCARDYGNEKEI  60

Query  304  GEVLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            G VLK+LF +GVVKREDL+ITSKLW  DHAPEDVP AL+
Sbjct  61   GSVLKQLFEEGVVKREDLWITSKLWCSDHAPEDVPAALD  99



>ref|XP_009358774.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Pyrus 
x bretschneideri]
Length=315

 Score =   143 bits (360),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA  ++ F LNTGAKIPS+GLGTWQA PG+VG AV  AIK GYRHID A+ Y  E+EIG 
Sbjct  1    MADDIRFFELNTGAKIPSIGLGTWQASPGLVGDAVHTAIKAGYRHIDCAQIYGNEEEIGL  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            VLKKLF DGVVKREDL+ITSKLW  DHAPEDV  AL+
Sbjct  61   VLKKLFEDGVVKREDLWITSKLWNTDHAPEDVLEALD  97



>ref|XP_006410971.1| hypothetical protein EUTSA_v10016967mg [Eutrema salsugineum]
 gb|ESQ52424.1| hypothetical protein EUTSA_v10016967mg [Eutrema salsugineum]
Length=314

 Score =   142 bits (359),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 70/96 (73%), Positives = 79/96 (82%), Gaps = 0/96 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA  +  F LNTGAKIPSVGLGTWQA+PG+VG AVEAA+K+GYRHID A+ Y  EKEIG 
Sbjct  1    MAEEIGLFELNTGAKIPSVGLGTWQADPGLVGNAVEAAVKIGYRHIDCAQIYGNEKEIGL  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVAL  417
            VLKKLF DGVVKRE++FITSKLW   H P+DVP AL
Sbjct  61   VLKKLFDDGVVKREEIFITSKLWCTYHDPQDVPEAL  96



>gb|EMT22693.1| Alcohol dehydrogenase (NADP+) A [Aegilops tauschii]
Length=311

 Score =   142 bits (359),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 69/88 (78%), Positives = 75/88 (85%), Gaps = 0/88 (0%)
 Frame = +1

Query  151  FVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGEVLKKLFA  330
            FVLNTGAKIPSVGLGTWQ+ PG+VG+AV AA+K GYRHID ARAYN EKE+G  LKKLF 
Sbjct  5    FVLNTGAKIPSVGLGTWQSAPGIVGEAVYAAVKAGYRHIDCARAYNNEKEVGLALKKLFE  64

Query  331  DGVVKREDLFITSKLWGRDHAPEDVPVA  414
            + VVKREDLFITSKLW   HAPEDVP A
Sbjct  65   ESVVKREDLFITSKLWCGHHAPEDVPEA  92



>gb|EEC71798.1| hypothetical protein OsI_04426 [Oryza sativa Indica Group]
Length=263

 Score =   141 bits (356),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 69/92 (75%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +1

Query  145  KCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGEVLKKL  324
            K FVLNTGAKIPSVGLGTWQ++PGVVG AV AA+K GYRHID AR Y  E E+G  LKKL
Sbjct  3    KHFVLNTGAKIPSVGLGTWQSDPGVVGDAVYAAVKAGYRHIDCARMYKNENEVGIALKKL  62

Query  325  FADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            F +GVVKREDLFITSKLW   HAPEDVP +L+
Sbjct  63   FEEGVVKREDLFITSKLWCDCHAPEDVPESLD  94



>emb|CDY07770.1| BnaA03g17410D [Brassica napus]
Length=306

 Score =   142 bits (358),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 68/96 (71%), Positives = 76/96 (79%), Gaps = 0/96 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA  +  F LNTGAKIPSVGLGTWQA PGVVG AV  A+K+GYRHID A+ Y+ EKEIG 
Sbjct  1    MANPITVFELNTGAKIPSVGLGTWQASPGVVGDAVTTAVKIGYRHIDCAQMYDNEKEIGA  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVAL  417
             LKKLF + VVKRE+LFITSKLW  DH P+DVP AL
Sbjct  61   ALKKLFEEDVVKREELFITSKLWCTDHDPQDVPEAL  96



>gb|KJB76785.1| hypothetical protein B456_012G107200 [Gossypium raimondii]
Length=318

 Score =   142 bits (359),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 77/97 (79%), Positives = 85/97 (88%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA A++ F LNTGAKIPSVGLGTWQA PGVVG AV AAIK+GYRHID A+AY+ EKEIG 
Sbjct  4    MAQAIRYFELNTGAKIPSVGLGTWQASPGVVGAAVAAAIKIGYRHIDCAQAYDNEKEIGS  63

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            VLKKLF DGVV+REDL+ITSKLW  +HAPEDVPVALN
Sbjct  64   VLKKLFQDGVVRREDLWITSKLWCTNHAPEDVPVALN  100



>ref|XP_004246435.1| PREDICTED: aldo-keto reductase family 4 member C10-like [Solanum 
lycopersicum]
Length=317

 Score =   142 bits (359),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 80/99 (81%), Gaps = 0/99 (0%)
 Frame = +1

Query  124  VAMAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEI  303
            +A A  +    LNTG  IP+VGLGTWQ++PGVVG+AVE AIK+GYRHID A+ Y  EKEI
Sbjct  1    MAEATEMPYIELNTGFSIPAVGLGTWQSDPGVVGKAVETAIKMGYRHIDCAQIYKNEKEI  60

Query  304  GEVLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            GEVL +LF DGVVKR +LFITSKLW  +HAPEDVPVAL+
Sbjct  61   GEVLSRLFKDGVVKRRELFITSKLWNTNHAPEDVPVALD  99



>emb|CAA66205.1| orf [Medicago sativa]
Length=313

 Score =   142 bits (358),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA A+K F LNTGAKIPSVGLGTWQAEPGVV +AV  A++VGYRHID A AY  + EIG 
Sbjct  1    MATAIKFFQLNTGAKIPSVGLGTWQAEPGVVAKAVTTAVQVGYRHIDCAEAYKNQSEIGS  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
             LKKL  DGVVKRE+L+ITSKLW  DH PEDVP AL+
Sbjct  61   ALKKLCEDGVVKREELWITSKLWCSDHHPEDVPKALD  97



>gb|KHG05402.1| Aldo-keto reductase family 4 member C9 [Gossypium arboreum]
Length=318

 Score =   142 bits (358),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 77/97 (79%), Positives = 85/97 (88%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA A++ F LNTGAKIPSVGLGTWQA PGVVG AV AAIK+GYRHID A+AY+ EKEIG 
Sbjct  4    MAQAIRYFELNTGAKIPSVGLGTWQASPGVVGAAVAAAIKIGYRHIDCAQAYDNEKEIGS  63

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            VLKKLF DGVV+REDL+ITSKLW  +HAPEDVPVALN
Sbjct  64   VLKKLFEDGVVRREDLWITSKLWCTNHAPEDVPVALN  100



>ref|XP_008387824.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Malus 
domestica]
Length=315

 Score =   142 bits (358),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA  ++ F LNTG+KIPSVGLGTWQ+  G+VG AV AAIK GYRHID A+ Y  EKEIG 
Sbjct  1    MADDIRFFRLNTGSKIPSVGLGTWQSSXGLVGDAVAAAIKAGYRHIDCAQRYGNEKEIGL  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            VLKKLF DG VKREDLFITSKLW  DHAPEDV VA++
Sbjct  61   VLKKLFEDGXVKREDLFITSKLWSTDHAPEDVLVAMD  97



>ref|XP_010505374.1| PREDICTED: aldo-keto reductase family 4 member C10-like [Camelina 
sativa]
Length=314

 Score =   142 bits (357),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 68/96 (71%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA  ++ F LNTGAKIPS+GLGTWQA+PG+VG AVEAA+K+GYRHID A+ Y  EKEIG 
Sbjct  1    MADEIRYFELNTGAKIPSIGLGTWQADPGLVGNAVEAAVKIGYRHIDCAQIYGNEKEIGL  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVAL  417
            VLKKLF DGVVKRE++FITSKLW   H P++VP AL
Sbjct  61   VLKKLFDDGVVKREEMFITSKLWCTCHDPQEVPEAL  96



>gb|KCW86006.1| hypothetical protein EUGRSUZ_B02711 [Eucalyptus grandis]
Length=225

 Score =   139 bits (351),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 76/96 (79%), Gaps = 0/96 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA A++ F LNTGAKIPSVGLGTWQ++PG+VG+AV  AI+ GYRHID A+ Y  E EIG 
Sbjct  1    MANAIRYFELNTGAKIPSVGLGTWQSDPGLVGKAVNIAIRHGYRHIDCAQVYANEAEIGA  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVAL  417
            V K L  + VVKREDLFITSKLW  DH PEDVPVAL
Sbjct  61   VFKNLIKERVVKREDLFITSKLWNTDHLPEDVPVAL  96



>ref|XP_006340995.1| PREDICTED: aldo-keto reductase family 4 member C10-like [Solanum 
tuberosum]
Length=317

 Score =   142 bits (357),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 80/99 (81%), Gaps = 0/99 (0%)
 Frame = +1

Query  124  VAMAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEI  303
            +A A  +  F LNTG  IP+VGLGTWQ++PGVVG+AVE AIK+GYRHID A+ Y  EKEI
Sbjct  1    MAEATEMPYFKLNTGFSIPAVGLGTWQSDPGVVGKAVETAIKMGYRHIDCAQVYKNEKEI  60

Query  304  GEVLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            GEVL +LF DGVVKR DLFITSKL   +HAPEDVPVAL+
Sbjct  61   GEVLSRLFKDGVVKRRDLFITSKLSNTNHAPEDVPVALD  99



>ref|XP_011466525.1| PREDICTED: aldo-keto reductase family 4 member C9-like isoform 
X2 [Fragaria vesca subsp. vesca]
Length=315

 Score =   141 bits (356),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 71/96 (74%), Positives = 78/96 (81%), Gaps = 0/96 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA  ++ F LNTGAKIPS+GLGTWQA PG+VG AV AAIK GYRHID A+ Y  EKEIG 
Sbjct  1    MADEIRFFELNTGAKIPSLGLGTWQASPGLVGDAVAAAIKAGYRHIDCAQRYGNEKEIGL  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVAL  417
            VLKKLF  GVVKRE+L+ITSKLW  DHAPEDV VAL
Sbjct  61   VLKKLFEHGVVKREELWITSKLWCTDHAPEDVTVAL  96



>gb|KEH20249.1| aldo/keto reductase family oxidoreductase [Medicago truncatula]
Length=319

 Score =   142 bits (357),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 71/98 (72%), Positives = 81/98 (83%), Gaps = 2/98 (2%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAE--PGVVGQAVEAAIKVGYRHIDGARAYNXEKEI  303
            M+ A++ F LNTGAKIPSVGLGTWQAE  PG+V +AV  AIK GYRHID A+ Y  +KEI
Sbjct  1    MSKAIQFFDLNTGAKIPSVGLGTWQAEDDPGLVAEAVATAIKAGYRHIDCAQLYGNQKEI  60

Query  304  GEVLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVAL  417
            G VLKKLF +GVVKREDL+ITSKLW  DHAPEDVP+AL
Sbjct  61   GLVLKKLFDEGVVKREDLWITSKLWNTDHAPEDVPLAL  98



>dbj|BAB64273.1| putative aldose reductase [Oryza sativa Japonica Group]
 gb|EAZ41984.1| hypothetical protein OsJ_26534 [Oryza sativa Japonica Group]
 dbj|BAH01375.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|ACS92967.1| aldo-keto reductase [Oryza sativa Indica Group]
Length=311

 Score =   141 bits (355),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 69/92 (75%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +1

Query  145  KCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGEVLKKL  324
            K FVLNTGAKIPSVGLGTWQ++PGVVG AV AA+K GYRHID AR Y  E E+G  LKKL
Sbjct  3    KHFVLNTGAKIPSVGLGTWQSDPGVVGDAVYAAVKAGYRHIDCARMYKNENEVGIALKKL  62

Query  325  FADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            F +GVVKREDLFITSKLW   HAPEDVP +L+
Sbjct  63   FEEGVVKREDLFITSKLWCDCHAPEDVPESLD  94



>gb|KDP24551.1| hypothetical protein JCGZ_25115 [Jatropha curcas]
Length=318

 Score =   141 bits (356),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/90 (76%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = +1

Query  151  FVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGEVLKKLFA  330
            F LNTGAKIPSVGLGTW+AEPG+VG AV+AA+K GYRHID A+ YN EKEIGE LK+LF+
Sbjct  12   FDLNTGAKIPSVGLGTWKAEPGIVGDAVKAAVKAGYRHIDCAKVYNNEKEIGEALKELFS  71

Query  331  DGVVKREDLFITSKLWGRDHAPEDVPVALN  420
             GVVKR +LFITSKLW  DHAPEDV  AL+
Sbjct  72   SGVVKRNELFITSKLWCCDHAPEDVSKALS  101



>ref|XP_006846375.1| hypothetical protein AMTR_s00012p00262860 [Amborella trichopoda]
 gb|ERN08050.1| hypothetical protein AMTR_s00012p00262860 [Amborella trichopoda]
Length=319

 Score =   141 bits (355),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/90 (76%), Positives = 75/90 (83%), Gaps = 0/90 (0%)
 Frame = +1

Query  151  FVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGEVLKKLFA  330
            F   TGAKIPSVGLGTWQA PGVVG AV AA+K GYRHID ARAY+ E EIG  LKKLF 
Sbjct  12   FERKTGAKIPSVGLGTWQAPPGVVGDAVTAAVKAGYRHIDCARAYDNEAEIGRALKKLFE  71

Query  331  DGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            DGVVKRE+++ITSKLW  DHAPEDVP+AL+
Sbjct  72   DGVVKREEMWITSKLWCSDHAPEDVPLALD  101



>ref|XP_008448265.1| PREDICTED: LOW QUALITY PROTEIN: aldo-keto reductase family 4 
member C9-like [Cucumis melo]
Length=315

 Score =   141 bits (355),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 69/97 (71%), Positives = 77/97 (79%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            M   +  F LNTGAKIPSVGLGTWQA  G+VG AV AA+K GYRHID A+ Y  EKEIG 
Sbjct  1    MDSPISFFQLNTGAKIPSVGLGTWQAAEGLVGNAVAAAVKFGYRHIDCAQIYGNEKEIGS  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            VLKKLF DGVVKRED++ITSKLW  DHAPE+VP AL+
Sbjct  61   VLKKLFEDGVVKREDMWITSKLWCTDHAPEEVPAALD  97



>ref|XP_002529867.1| aldo-keto reductase, putative [Ricinus communis]
 gb|EEF32517.1| aldo-keto reductase, putative [Ricinus communis]
Length=315

 Score =   140 bits (354),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +1

Query  151  FVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGEVLKKLFA  330
            F LNTGAKIPSVGLGTW+AEPGVVG AV+AAIK GYRHID A+ YN E+EIGE  K+LF+
Sbjct  9    FDLNTGAKIPSVGLGTWKAEPGVVGDAVKAAIKAGYRHIDCAKVYNNEREIGEAFKELFS  68

Query  331  DGVVKREDLFITSKLWGRDHAPEDVPVAL  417
             GVVKR +LFITSKLW  DHAPEDV  AL
Sbjct  69   SGVVKRSELFITSKLWCSDHAPEDVSKAL  97



>ref|XP_007134069.1| hypothetical protein PHAVU_010G016900g [Phaseolus vulgaris]
 gb|ESW06063.1| hypothetical protein PHAVU_010G016900g [Phaseolus vulgaris]
Length=313

 Score =   140 bits (354),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/97 (69%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            M   ++ F LNTGAKIPS+GLGTWQAEPGVV +A+  AI+VGYRHID A+ Y+ + EIG 
Sbjct  1    MGKLIQFFELNTGAKIPSIGLGTWQAEPGVVVKAITTAIQVGYRHIDCAQFYDNQAEIGS  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
             LKK+F DGVVKREDL+ITSKLW  DHAPEDVP AL+
Sbjct  61   ALKKVFDDGVVKREDLWITSKLWCTDHAPEDVPKALD  97



>ref|XP_011466526.1| PREDICTED: aldo-keto reductase family 4 member C9-like isoform 
X3 [Fragaria vesca subsp. vesca]
Length=315

 Score =   140 bits (354),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/96 (74%), Positives = 77/96 (80%), Gaps = 0/96 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA  ++ F LNTGAKIPS+GLGTWQA PG+VG AV AAIK GYRHID A  Y  EKEIG 
Sbjct  1    MADEIRFFELNTGAKIPSLGLGTWQASPGLVGDAVAAAIKAGYRHIDCAPVYGNEKEIGL  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVAL  417
            VLKKLF  GVVKRE+L+ITSKLW  DHAPEDV VAL
Sbjct  61   VLKKLFEHGVVKREELWITSKLWCTDHAPEDVTVAL  96



>ref|XP_004302708.2| PREDICTED: aldo-keto reductase family 4 member C9-like isoform 
X2 [Fragaria vesca subsp. vesca]
Length=315

 Score =   140 bits (354),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/97 (70%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA  ++ F LNTGAK+PS+GLGTWQ+ PG+VG+AV  AIK GYRHID A+AY  EKEIG 
Sbjct  1    MANDIRFFELNTGAKMPSLGLGTWQSSPGLVGEAVATAIKAGYRHIDCAQAYGNEKEIGL  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            VL+KLF DGVVKRE+L+ITSKLW  DHAPEDV  AL+
Sbjct  61   VLRKLFEDGVVKREELWITSKLWCTDHAPEDVLEALD  97



>ref|XP_006429178.1| hypothetical protein CICLE_v10012242mg [Citrus clementina]
 gb|ESR42418.1| hypothetical protein CICLE_v10012242mg [Citrus clementina]
Length=315

 Score =   140 bits (354),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/97 (74%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA     F LNTGAK+PSVGLGTWQA+PGVVG AV+ AIK GYRHID AR Y  EKEIG 
Sbjct  1    MANENGYFELNTGAKMPSVGLGTWQADPGVVGNAVDVAIKAGYRHIDCARLYLNEKEIGF  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            VLKKLF DGVVKREDL+ITSKLW  D AP+DVP AL+
Sbjct  61   VLKKLFEDGVVKREDLWITSKLWCTDLAPKDVPEALD  97



>gb|ACJ84357.1| unknown [Medicago truncatula]
 gb|AFK33435.1| unknown [Medicago truncatula]
Length=219

 Score =   138 bits (347),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/97 (73%), Positives = 83/97 (86%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            M+  ++ F LNTGAKIPSVGLGTWQ++PG+V QAV AAIK GYRHID A+ Y  EKEIG 
Sbjct  1    MSNEIRFFSLNTGAKIPSVGLGTWQSDPGLVAQAVAAAIKAGYRHIDCAQVYGNEKEIGS  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            +LKKLFA+GVVKREDL+ITSKLW  DHAPEDVP+AL+
Sbjct  61   ILKKLFAEGVVKREDLWITSKLWNTDHAPEDVPLALD  97



>ref|XP_009346418.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Pyrus 
x bretschneideri]
Length=315

 Score =   140 bits (354),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/97 (71%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA  ++ F LNTGAKIPSVGLGTWQ+ PG+VG AV AA+K G RHID A+ Y  EKE+G 
Sbjct  1    MADDIRFFELNTGAKIPSVGLGTWQSSPGLVGDAVHAAVKAGCRHIDCAQFYGNEKEVGL  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            VLKKLF +GVVKREDL+ITSKLW  DHAPEDVP AL+
Sbjct  61   VLKKLFENGVVKREDLWITSKLWCTDHAPEDVPEALD  97



>ref|NP_181315.2| aldo-keto reductase family 4 member C10 [Arabidopsis thaliana]
 sp|Q84TF0.1|AKRCA_ARATH RecName: Full=Aldo-keto reductase family 4 member C10 [Arabidopsis 
thaliana]
 gb|AAO64797.1| At2g37790 [Arabidopsis thaliana]
 dbj|BAE99364.1| putative alcohol dehydrogenase [Arabidopsis thaliana]
 gb|ABH07516.1| aldo-keto reductase [Arabidopsis thaliana]
 gb|AEC09451.1| aldo-keto reductase family 4 member C10 [Arabidopsis thaliana]
Length=314

 Score =   140 bits (354),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/97 (70%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA  ++ F LNTGAKIPSVGLGTWQA+PG+VG AV+AA+K+GYRHID A+ Y  EKEIG 
Sbjct  1    MAEEIRFFELNTGAKIPSVGLGTWQADPGLVGNAVDAAVKIGYRHIDCAQIYGNEKEIGL  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            VLKKLF  GVVKRE++FITSKLW   H P++VP ALN
Sbjct  61   VLKKLFDGGVVKREEMFITSKLWCTYHDPQEVPEALN  97



>ref|XP_010235188.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Brachypodium 
distachyon]
Length=324

 Score =   140 bits (354),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +1

Query  151  FVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGEVLKKLFA  330
            FVLNTGAKIPSVGLGTWQ++P VVG+AV AA+K GYRHID A AY+ EKE+G  LKKLF 
Sbjct  18   FVLNTGAKIPSVGLGTWQSDPSVVGEAVYAAVKAGYRHIDCASAYDNEKEVGLALKKLFE  77

Query  331  DGVVKREDLFITSKLWGRDHAPEDVPVAL  417
            +GVVKREDLFITS+LW   HAPEDVP AL
Sbjct  78   EGVVKREDLFITSQLWCGHHAPEDVPEAL  106



>gb|KDO48137.1| hypothetical protein CISIN_1g021264mg [Citrus sinensis]
Length=315

 Score =   140 bits (353),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/97 (73%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA     F LNTGAK+PSVGLGTWQA+PG+VG AV+ AIK GYRHID AR Y  EKEIG 
Sbjct  1    MANENGYFELNTGAKMPSVGLGTWQADPGIVGNAVDVAIKAGYRHIDCARLYLNEKEIGF  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            VLKKLF DGVVKREDL+ITSKLW  D AP+DVP AL+
Sbjct  61   VLKKLFEDGVVKREDLWITSKLWCTDLAPKDVPEALD  97



>ref|XP_008240395.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Prunus 
mume]
Length=315

 Score =   140 bits (353),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/97 (71%), Positives = 76/97 (78%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA  ++ F LNTGAKIPSVGLGTWQ+ PG+VG AV      GYRHID A+ Y  EKEIG 
Sbjct  1    MADDIRFFELNTGAKIPSVGLGTWQSSPGLVGDAVGXXXXAGYRHIDCAQLYANEKEIGS  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            VLKKLF DGVVKREDL+ITSKLW  DHAPEDVP AL+
Sbjct  61   VLKKLFEDGVVKREDLWITSKLWCTDHAPEDVPEALD  97



>ref|XP_006493578.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Citrus 
sinensis]
Length=315

 Score =   140 bits (353),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/97 (73%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA     F LNTGAK+PSVGLGTWQA+PG+VG AV+ AIK GYRHID AR Y  EKEIG 
Sbjct  1    MANENGYFELNTGAKMPSVGLGTWQADPGIVGNAVDVAIKAGYRHIDCARLYLNEKEIGF  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            VLKKLF DGVVKREDL+ITSKLW  D AP+DVP AL+
Sbjct  61   VLKKLFEDGVVKREDLWITSKLWCTDLAPKDVPEALD  97



>gb|ACN37066.1| unknown [Zea mays]
Length=205

 Score =   137 bits (345),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = +1

Query  151  FVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGEVLKKLFA  330
            FVLNTGAKIPSVGLGTWQA+ G+VG AV AA+K GYRHID A+AYN EKE+G  L+++  
Sbjct  5    FVLNTGAKIPSVGLGTWQADNGLVGDAVYAAVKAGYRHIDCAQAYNNEKEVGFGLRRVLD  64

Query  331  DGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            +G+VKREDLFITSKLW  +HA EDVPVALN
Sbjct  65   EGIVKREDLFITSKLWDINHAAEDVPVALN  94



>ref|XP_010509274.1| PREDICTED: aldo-keto reductase family 4 member C10-like [Camelina 
sativa]
Length=314

 Score =   139 bits (351),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 69/97 (71%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA  +  F LNTGAKIPSVGLGTWQA+PG+VG AVEAA+K+GYRHID A+ Y  EKEIG 
Sbjct  1    MADEIGYFELNTGAKIPSVGLGTWQADPGLVGNAVEAAVKIGYRHIDCAQIYGNEKEIGL  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            VLKKLF D VVKRE++FITSKLW   H P++VP ALN
Sbjct  61   VLKKLFDDVVVKREEMFITSKLWCTCHDPQEVPNALN  97



>ref|XP_010043997.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Eucalyptus 
grandis]
 gb|KCW86005.1| hypothetical protein EUGRSUZ_B02711 [Eucalyptus grandis]
Length=315

 Score =   139 bits (351),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 76/96 (79%), Gaps = 0/96 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA A++ F LNTGAKIPSVGLGTWQ++PG+VG+AV  AI+ GYRHID A+ Y  E EIG 
Sbjct  1    MANAIRYFELNTGAKIPSVGLGTWQSDPGLVGKAVNIAIRHGYRHIDCAQVYANEAEIGA  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVAL  417
            V K L  + VVKREDLFITSKLW  DH PEDVPVAL
Sbjct  61   VFKNLIKERVVKREDLFITSKLWNTDHLPEDVPVAL  96



>gb|EMT09403.1| Aldose reductase [Aegilops tauschii]
Length=313

 Score =   139 bits (350),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 67/97 (69%), Positives = 79/97 (81%), Gaps = 3/97 (3%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MAG+   FVLNTGA+IPS+GLGTWQ EP VVG A+ AA+K GYRHID A AY+ +K++G 
Sbjct  1    MAGS---FVLNTGARIPSIGLGTWQIEPDVVGDAIYAAVKAGYRHIDCAPAYHNQKQVGL  57

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
             LK LF DGVVKREDLF+TSKLW  DHAPEDVP A++
Sbjct  58   ALKTLFEDGVVKREDLFVTSKLWFGDHAPEDVPEAID  94



>ref|XP_004302706.1| PREDICTED: aldo-keto reductase family 4 member C9-like isoform 
X1 [Fragaria vesca subsp. vesca]
Length=315

 Score =   139 bits (350),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 69/96 (72%), Positives = 77/96 (80%), Gaps = 0/96 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA  ++ F LNTGAKIPS+GLGTWQ+ PGVVG AV  A+K GYRHID A+ Y  EKEIG 
Sbjct  1    MAHEIQFFELNTGAKIPSLGLGTWQSSPGVVGDAVATAVKAGYRHIDCAQRYGNEKEIGL  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVAL  417
            VLKKLF  GVVKRE+L+ITSKLW  DHAPEDV VAL
Sbjct  61   VLKKLFEHGVVKREELWITSKLWCTDHAPEDVTVAL  96



>gb|ACN27137.1| unknown [Zea mays]
Length=215

 Score =   137 bits (344),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = +1

Query  151  FVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGEVLKKLFA  330
            FVLNTGAKIPSVGLGTWQA+ G+VG AV AA+K GYRHID A+AYN EKE+G  L+++  
Sbjct  5    FVLNTGAKIPSVGLGTWQADNGLVGDAVYAAVKAGYRHIDCAQAYNNEKEVGFGLRRVLD  64

Query  331  DGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            +G+VKREDLFITSKLW  +HA EDVPVALN
Sbjct  65   EGIVKREDLFITSKLWDINHAAEDVPVALN  94



>ref|XP_007134073.1| hypothetical protein PHAVU_010G017300g [Phaseolus vulgaris]
 gb|ESW06067.1| hypothetical protein PHAVU_010G017300g [Phaseolus vulgaris]
Length=306

 Score =   139 bits (349),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 67/90 (74%), Positives = 72/90 (80%), Gaps = 0/90 (0%)
 Frame = +1

Query  151  FVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGEVLKKLFA  330
            F LNTGAKIPSVGLGTW AEPGVV  A+  A  VGYRHID A+ Y  EKEIG+ LKKLFA
Sbjct  10   FELNTGAKIPSVGLGTWLAEPGVVAHALTTATNVGYRHIDCAQIYGNEKEIGDALKKLFA  69

Query  331  DGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            DGVVKRED+FITSKLW  DH PEDVP A +
Sbjct  70   DGVVKREDMFITSKLWCNDHLPEDVPKAFD  99



>ref|XP_004302704.1| PREDICTED: aldo-keto reductase family 4 member C9-like isoform 
X1 [Fragaria vesca subsp. vesca]
Length=315

 Score =   139 bits (350),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 67/97 (69%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA  ++ F LNTGAK+PS+GLGTWQ+ PG+VG+AV  AIK GYRHID A+ Y  EKEIG 
Sbjct  1    MANDIRFFELNTGAKMPSLGLGTWQSSPGLVGEAVATAIKAGYRHIDCAQVYGNEKEIGL  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            VL+KLF DGVVKRE+L+ITSKLW  DHAPEDV  AL+
Sbjct  61   VLRKLFEDGVVKREELWITSKLWCTDHAPEDVLEALD  97



>ref|XP_002441210.1| hypothetical protein SORBIDRAFT_09g022370 [Sorghum bicolor]
 gb|EES19640.1| hypothetical protein SORBIDRAFT_09g022370 [Sorghum bicolor]
Length=385

 Score =   140 bits (353),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 67/90 (74%), Positives = 78/90 (87%), Gaps = 0/90 (0%)
 Frame = +1

Query  151  FVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGEVLKKLFA  330
            FVLNTGAKIPSVGLGTWQ++ G+VG AV AA+K GYRHID A+AYN EKE+G  LKK+  
Sbjct  64   FVLNTGAKIPSVGLGTWQSDNGLVGDAVYAAVKAGYRHIDCAQAYNNEKEVGFGLKKVLD  123

Query  331  DGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            +G+VKREDLFITSKLW  +HAPEDVPVAL+
Sbjct  124  EGIVKREDLFITSKLWNTNHAPEDVPVALD  153



>gb|EMT09404.1| Aldose reductase [Aegilops tauschii]
Length=309

 Score =   139 bits (349),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = +1

Query  151  FVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGEVLKKLFA  330
            FVL+TGAKIPSVGLGTWQ+EPGVVG AV AA+K GYRHID A+ Y  EKEIG  LKK+F 
Sbjct  5    FVLSTGAKIPSVGLGTWQSEPGVVGDAVYAAVKAGYRHIDCAQVYGNEKEIGFALKKVFD  64

Query  331  DGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            +G+  R+DLFITSKLW  +HAPEDVPVAL+
Sbjct  65   EGITSRQDLFITSKLWCTNHAPEDVPVALD  94



>ref|XP_006576246.1| PREDICTED: uncharacterized protein LOC100809492 isoform X1 [Glycine 
max]
Length=304

 Score =   139 bits (349),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 75/93 (81%), Gaps = 0/93 (0%)
 Frame = +1

Query  142  VKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGEVLKK  321
            ++ F LNTGAKIPSVGLGTW AEPGVV +A+  AI VGYRHID A+ Y  EKEIG  LKK
Sbjct  6    LRFFELNTGAKIPSVGLGTWLAEPGVVARALATAINVGYRHIDCAQIYGNEKEIGAALKK  65

Query  322  LFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            LFADGVVKRED+FITSKLW  DH PE+VP A +
Sbjct  66   LFADGVVKREDMFITSKLWCNDHLPENVPEAFD  98



>ref|XP_010231310.1| PREDICTED: aldo-keto reductase family 4 member C10-like [Brachypodium 
distachyon]
Length=311

 Score =   138 bits (348),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 73/92 (79%), Gaps = 0/92 (0%)
 Frame = +1

Query  145  KCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGEVLKKL  324
            + FVLNTGA+IPS+G GTWQ EP VVG  + AA+K GYRHID A  Y  EKE+G  LKKL
Sbjct  3    ESFVLNTGARIPSIGFGTWQIEPAVVGHTIYAAVKAGYRHIDCAPIYRNEKEVGLALKKL  62

Query  325  FADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            F DGVVKRED+FITSKLW  DHAPEDVP A++
Sbjct  63   FEDGVVKREDMFITSKLWAGDHAPEDVPEAID  94



>ref|XP_002863483.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH39742.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=384

 Score =   140 bits (352),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 79/98 (81%), Gaps = 0/98 (0%)
 Frame = +1

Query  127  AMAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIG  306
             +A  ++ F LNTGA IPSVGLGTWQA+PG+VG AVEAA+K+GYRHID A+ Y  EKEIG
Sbjct  56   TLADEIRFFKLNTGAMIPSVGLGTWQADPGLVGNAVEAAVKIGYRHIDCAQIYGNEKEIG  115

Query  307  EVLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
             VLKKLF DGVVKRE++FITSKL    H P+DVP ALN
Sbjct  116  LVLKKLFDDGVVKREEIFITSKLCCTSHNPQDVPDALN  153



>gb|EMS64417.1| Aldo-keto reductase family 4 member C10 [Triticum urartu]
Length=328

 Score =   139 bits (349),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = +1

Query  151  FVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGEVLKKLFA  330
            FVL+TGAKIPSVGLGTWQ+EPGVVG AV AA+K GYRHID A+ Y  EKEIG  LKK+F 
Sbjct  5    FVLSTGAKIPSVGLGTWQSEPGVVGDAVYAAVKAGYRHIDCAQVYGNEKEIGFALKKVFD  64

Query  331  DGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            +G+  R+DLFITSKLW  +HAPEDVPVAL+
Sbjct  65   EGITSRQDLFITSKLWCTNHAPEDVPVALD  94



>ref|XP_010262633.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Nelumbo 
nucifera]
Length=315

 Score =   138 bits (348),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 69/97 (71%), Positives = 77/97 (79%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            M   ++ F LNTGAKIPS+GLGTWQAEPG+VG AV AAIK GY HID A+ Y  EKEIG 
Sbjct  1    MVTEIRYFELNTGAKIPSLGLGTWQAEPGLVGDAVAAAIKAGYGHIDCAQIYGNEKEIGL  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            VL KLF DG+VKREDL+ITSKLW  DHAPEDV  AL+
Sbjct  61   VLTKLFKDGIVKREDLWITSKLWCTDHAPEDVLKALD  97



>gb|AFK44784.1| unknown [Medicago truncatula]
 gb|KEH20251.1| aldo/keto reductase family oxidoreductase [Medicago truncatula]
Length=315

 Score =   138 bits (348),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 71/97 (73%), Positives = 83/97 (86%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            M+  ++ F LNTGAKIPSVGLGTWQ++PG+V QAV AAIK GYRHID A+ Y  EKEIG 
Sbjct  1    MSNEIRFFSLNTGAKIPSVGLGTWQSDPGLVAQAVAAAIKAGYRHIDCAQVYGNEKEIGS  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            +LKKLFA+GVVKREDL+ITSKLW  DHAPEDVP+AL+
Sbjct  61   ILKKLFAEGVVKREDLWITSKLWNTDHAPEDVPLALD  97



>gb|AFW78248.1| putative oxidoreductase, aldo/keto reductase family protein isoform 
1 [Zea mays]
 gb|AFW78249.1| putative oxidoreductase, aldo/keto reductase family protein isoform 
2 [Zea mays]
Length=274

 Score =   137 bits (345),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = +1

Query  151  FVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGEVLKKLFA  330
            FVLNTGAKIPSVGLGTWQA+ G+VG AV AA+K GYRHID A+AYN EKE+G  L+++  
Sbjct  74   FVLNTGAKIPSVGLGTWQADNGLVGDAVYAAVKAGYRHIDCAQAYNNEKEVGFGLRRVLD  133

Query  331  DGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            +G+VKREDLFITSKLW  +HA EDVPVALN
Sbjct  134  EGIVKREDLFITSKLWDINHAAEDVPVALN  163



>ref|XP_006846379.1| hypothetical protein AMTR_s00012p00263360 [Amborella trichopoda]
 gb|ERN08054.1| hypothetical protein AMTR_s00012p00263360 [Amborella trichopoda]
Length=325

 Score =   138 bits (347),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 80/106 (75%), Gaps = 0/106 (0%)
 Frame = +1

Query  103  SSLFRLCVAMAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARA  282
            S++ + C  +      F LNTGA+IPSVGLGTW+A PG VG A+ AA+K GYRHID AR 
Sbjct  3    SAVKKQCRNVDEVAMYFELNTGARIPSVGLGTWKAPPGAVGDAIIAAVKAGYRHIDCARV  62

Query  283  YNXEKEIGEVLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            Y+ EKE G  LK LF++G+VKREDL+ITSKLW  DHAPEDVP ALN
Sbjct  63   YDNEKEAGIALKHLFSEGIVKREDLWITSKLWNCDHAPEDVPKALN  108



>ref|XP_010529793.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Tarenaya 
hassleriana]
Length=315

 Score =   137 bits (346),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 73/96 (76%), Gaps = 0/96 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA  ++ F LN G KIPSVGLGTWQA PGV+G AV AA+K+GYRHID A+ Y  EKEIG 
Sbjct  1    MADEIRFFELNNGEKIPSVGLGTWQASPGVIGDAVAAAVKIGYRHIDCAQRYGNEKEIGS  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVAL  417
            VLKKLF DG  KR DLFITSKLW  D  P+DVP AL
Sbjct  61   VLKKLFEDGTAKRGDLFITSKLWLTDQDPQDVPEAL  96



>gb|AFW78251.1| putative oxidoreductase, aldo/keto reductase family protein [Zea 
mays]
Length=284

 Score =   137 bits (344),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = +1

Query  151  FVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGEVLKKLFA  330
            FVLNTGAKIPSVGLGTWQA+ G+VG AV AA+K GYRHID A+AYN EKE+G  L+++  
Sbjct  74   FVLNTGAKIPSVGLGTWQADNGLVGDAVYAAVKAGYRHIDCAQAYNNEKEVGFGLRRVLD  133

Query  331  DGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            +G+VKREDLFITSKLW  +HA EDVPVALN
Sbjct  134  EGIVKREDLFITSKLWDINHAAEDVPVALN  163



>ref|XP_007134072.1| hypothetical protein PHAVU_010G017200g [Phaseolus vulgaris]
 gb|ESW06066.1| hypothetical protein PHAVU_010G017200g [Phaseolus vulgaris]
Length=305

 Score =   137 bits (345),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 70/89 (79%), Gaps = 0/89 (0%)
 Frame = +1

Query  151  FVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGEVLKKLFA  330
            F LNTGAKIPSVGLGTW AEPGVV  A+  A  VGYRHID A+ Y  EKEIG+ L KLFA
Sbjct  9    FELNTGAKIPSVGLGTWLAEPGVVAHALTTATNVGYRHIDCAQIYGNEKEIGDALNKLFA  68

Query  331  DGVVKREDLFITSKLWGRDHAPEDVPVAL  417
            DGVVKRED+FITSKLW  DH PEDVP A 
Sbjct  69   DGVVKREDMFITSKLWCNDHLPEDVPKAF  97



>ref|XP_004172647.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Cucumis 
sativus]
Length=316

 Score =   137 bits (345),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 65/97 (67%), Positives = 76/97 (78%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA  +  F LNTGA IPS+GLGTWQA  G++  A+ AA+K+GYRHID +  Y  EKEIG 
Sbjct  1    MASQISSFPLNTGANIPSLGLGTWQATEGLLTNAISAALKIGYRHIDCSPVYGNEKEIGS  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            VLKKLF +GVVKREDL+ITSKLW  DHAPEDVP AL+
Sbjct  61   VLKKLFEEGVVKREDLWITSKLWCTDHAPEDVPKALD  97



>ref|XP_004172864.1| PREDICTED: aldo-keto reductase family 4 member C9-like, partial 
[Cucumis sativus]
Length=255

 Score =   135 bits (340),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 65/97 (67%), Positives = 76/97 (78%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA  +  F LNTGA IPS+GLGTWQA  G++  A+ AA+K+GYRHID +  Y  EKEIG 
Sbjct  1    MAYQISSFPLNTGANIPSLGLGTWQATEGLLTNAIPAALKIGYRHIDCSPVYGNEKEIGS  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            VLKKLF +GVVKREDL+ITSKLW  DHAPEDVP AL+
Sbjct  61   VLKKLFEEGVVKREDLWITSKLWCTDHAPEDVPKALD  97



>ref|XP_008350448.1| PREDICTED: aldo-keto reductase family 4 member C10-like [Malus 
domestica]
Length=315

 Score =   137 bits (344),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 73/97 (75%), Positives = 82/97 (85%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA A++ F L+TGAKIPSVGLGTWQAEPGVV  AV AAIK+GYRHID A+AY  EKEIG 
Sbjct  1    MAKAIRFFELSTGAKIPSVGLGTWQAEPGVVAAAVTAAIKIGYRHIDCAQAYGNEKEIGF  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
             LKKL+ DGVVKREDL+ITSKLW  +HAPEDVP AL+
Sbjct  61   ALKKLYDDGVVKREDLWITSKLWCSNHAPEDVPKALD  97



>ref|XP_008387819.1| PREDICTED: aldo-keto reductase family 4 member C10-like [Malus 
domestica]
Length=328

 Score =   137 bits (344),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 73/97 (75%), Positives = 82/97 (85%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA A++ F L+TGAKIPSVGLGTWQAEPGVV  AV AAIK+GYRHID A+AY  EKEIG 
Sbjct  1    MAKAIRFFELSTGAKIPSVGLGTWQAEPGVVAAAVTAAIKIGYRHIDCAQAYGNEKEIGF  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
             LKKL+ DGVVKREDL+ITSKLW  +HAPEDVP AL+
Sbjct  61   ALKKLYDDGVVKREDLWITSKLWCSNHAPEDVPKALD  97



>ref|XP_007134068.1| hypothetical protein PHAVU_010G016800g [Phaseolus vulgaris]
 gb|ESW06062.1| hypothetical protein PHAVU_010G016800g [Phaseolus vulgaris]
Length=311

 Score =   136 bits (343),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 65/97 (67%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            M   ++ F LNTGAKIPS+GLGT QAEPG+V +A+  AI+VGYRHID A+AY+ + EIG 
Sbjct  1    MGKLIQFFELNTGAKIPSIGLGTGQAEPGIVAKAITTAIQVGYRHIDCAQAYDNQAEIGS  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
             LKK+F DGVVKREDL+ITSKLW  DH PEDVP AL+
Sbjct  61   ALKKVFDDGVVKREDLWITSKLWCTDHGPEDVPKALD  97



>ref|NP_001145887.1| uncharacterized protein LOC100279403 [Zea mays]
 gb|ACL52791.1| unknown [Zea mays]
 gb|ADU32867.1| aldose reductase [Zea mays]
Length=311

 Score =   136 bits (343),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = +1

Query  151  FVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGEVLKKLFA  330
            FVLNTGAKIPSVGLGTWQA+ G+VG AV AA+K GYRHID A+AYN EKE+G  L+++  
Sbjct  5    FVLNTGAKIPSVGLGTWQADNGLVGDAVYAAVKAGYRHIDCAQAYNNEKEVGFGLRRVLD  64

Query  331  DGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            +G+VKREDLFITSKLW  +HA EDVPVALN
Sbjct  65   EGIVKREDLFITSKLWDINHAAEDVPVALN  94



>gb|KDO36593.1| hypothetical protein CISIN_1g032577mg [Citrus sinensis]
Length=137

 Score =   132 bits (331),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 65/97 (67%), Positives = 73/97 (75%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            M    + F LN GAKIPS+GLGTW A P VVG A+ AA+KVGYRHID A+ Y  EK IG 
Sbjct  1    MEEGFRFFKLNAGAKIPSLGLGTWAAAPDVVGDAIAAAVKVGYRHIDCAQIYGNEKGIGS  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
             LKKLF DGVVKREDL+ITSKLW  +H PEDVP AL+
Sbjct  61   ALKKLFDDGVVKREDLWITSKLWCNNHLPEDVPKALD  97



>gb|EMS64418.1| Aldo-keto reductase family 4 member C9 [Triticum urartu]
Length=305

 Score =   136 bits (342),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 68/97 (70%), Positives = 78/97 (80%), Gaps = 3/97 (3%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MAG+   FVLNTGA IPSVGLGTWQ +P VVG  + AA+K GYRHID A AY+ EKE+G 
Sbjct  1    MAGS---FVLNTGAGIPSVGLGTWQIKPEVVGDTIYAAVKAGYRHIDCAPAYSNEKEVGL  57

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
             LKKLF DGVVKRE+LFITSKLW  +HAPEDVP A++
Sbjct  58   ALKKLFEDGVVKREELFITSKLWSGNHAPEDVPEAID  94



>ref|XP_010517051.1| PREDICTED: aldo-keto reductase family 4 member C9 isoform X1 
[Camelina sativa]
Length=315

 Score =   136 bits (343),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 74/97 (76%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA A+KCF LNTGAKIPSVGLGTWQ+ PGVVG AV AA+K GYRHID A+ Y  EKEIG 
Sbjct  1    MANAIKCFELNTGAKIPSVGLGTWQSSPGVVGDAVAAAVKNGYRHIDCAKLYGNEKEIGA  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            VLKKLF D VVKRE+LFITSKLW  DH P+DVP ALN
Sbjct  61   VLKKLFEDNVVKREELFITSKLWCTDHDPQDVPEALN  97



>gb|KGN54280.1| hypothetical protein Csa_4G296820 [Cucumis sativus]
Length=305

 Score =   136 bits (342),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 65/97 (67%), Positives = 76/97 (78%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA  +  F LNTGA IPS+GLGTWQA  G++  A+ AA+K+GYRHID +  Y  EKEIG 
Sbjct  1    MAYQISSFPLNTGANIPSLGLGTWQATEGLLTNAISAALKIGYRHIDCSPVYGNEKEIGS  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            VLKKLF +GVVKREDL+ITSKLW  DHAPEDVP AL+
Sbjct  61   VLKKLFEEGVVKREDLWITSKLWCTDHAPEDVPKALD  97



>gb|AFK39472.1| unknown [Lotus japonicus]
Length=212

 Score =   134 bits (336),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 65/99 (66%), Positives = 76/99 (77%), Gaps = 0/99 (0%)
 Frame = +1

Query  124  VAMAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEI  303
            +A    ++ F L+TGAKIPSVGLGTW A PGVV  A+  A+ VGYRH+D A+ Y  EKEI
Sbjct  1    MASDDDLRFFELSTGAKIPSVGLGTWLAAPGVVANAIATAVDVGYRHLDCAQIYRNEKEI  60

Query  304  GEVLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            G+ LKKLFADGVVKRED+FITSKLW  DH PEDVP A +
Sbjct  61   GDGLKKLFADGVVKREDMFITSKLWCTDHLPEDVPKAFD  99



>gb|AAO42123.1| putative aldo/keto reductase [Arabidopsis thaliana]
Length=304

 Score =   136 bits (342),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 66/86 (77%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = +1

Query  163  TGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGEVLKKLFADGVV  342
            TGAK PSVGLGTWQA PG+VG AV AA+K+GYRHID A+ Y  EKEIG VLKKLF D VV
Sbjct  1    TGAKFPSVGLGTWQASPGLVGDAVAAAVKIGYRHIDCAQIYGNEKEIGAVLKKLFEDRVV  60

Query  343  KREDLFITSKLWGRDHAPEDVPVALN  420
            KREDLFITSKLW  DH P+DVP ALN
Sbjct  61   KREDLFITSKLWCTDHDPQDVPEALN  86



>ref|XP_007026918.1| NAD(P)-linked oxidoreductase superfamily protein [Theobroma cacao]
 gb|EOY07420.1| NAD(P)-linked oxidoreductase superfamily protein [Theobroma cacao]
Length=315

 Score =   136 bits (342),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 72/97 (74%), Positives = 82/97 (85%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA  ++ F LNTGAKIPSVGLGTWQ+EPG++G AV AA+K+GYRHID A+ Y  EKEIG 
Sbjct  1    MASEIRFFELNTGAKIPSVGLGTWQSEPGLLGAAVAAAVKIGYRHIDCAQIYGNEKEIGL  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            VLKKLF DGVVKRE+LFITSKLW  DHAPEDVP AL+
Sbjct  61   VLKKLFEDGVVKREELFITSKLWCTDHAPEDVPAALD  97



>ref|XP_010517052.1| PREDICTED: aldo-keto reductase family 4 member C9 isoform X2 
[Camelina sativa]
Length=314

 Score =   136 bits (342),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 74/97 (76%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA A+KCF LNTGAKIPSVGLGTWQ+ PGVVG AV AA+K GYRHID A+ Y  EKEIG 
Sbjct  1    MANAIKCFELNTGAKIPSVGLGTWQSSPGVVGDAVAAAVKNGYRHIDCAKLYGNEKEIGA  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            VLKKLF D VVKRE+LFITSKLW  DH P+DVP ALN
Sbjct  61   VLKKLFEDNVVKREELFITSKLWCTDHDPQDVPEALN  97



>gb|AFK37060.1| unknown [Lotus japonicus]
Length=305

 Score =   135 bits (341),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 76/99 (77%), Gaps = 0/99 (0%)
 Frame = +1

Query  124  VAMAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEI  303
            +A    ++ F LNTGAKIPSVGLGTW A PGVV  A+  A+ VGYRH+D A+ Y  EKEI
Sbjct  1    MASDDDLRFFELNTGAKIPSVGLGTWLAAPGVVANAIATAVDVGYRHLDCAQIYRNEKEI  60

Query  304  GEVLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            G+ LKKLFADGVVKRED+FITSKLW  DH PEDVP A +
Sbjct  61   GDGLKKLFADGVVKREDMFITSKLWCTDHLPEDVPKAFD  99



>gb|AFK33934.1| unknown [Medicago truncatula]
Length=172

 Score =   132 bits (332),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 74/93 (80%), Gaps = 0/93 (0%)
 Frame = +1

Query  142  VKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGEVLKK  321
            ++ F LNTGAKIPSVGLGTW A PGVV  A+  A+ VGYRHID A+ Y  EKEIG+ LKK
Sbjct  6    LRLFELNTGAKIPSVGLGTWLAAPGVVYDAISTAVNVGYRHIDCAQIYGNEKEIGDALKK  65

Query  322  LFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            LFA+GVVKRE+++ITSKLW  DH PEDVP A +
Sbjct  66   LFANGVVKREEMWITSKLWCTDHLPEDVPKAFD  98



>ref|XP_003604924.1| Alcohol dehydrogenase [Medicago truncatula]
 gb|AES87121.1| aldo/keto reductase family oxidoreductase [Medicago truncatula]
Length=304

 Score =   135 bits (341),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 74/92 (80%), Gaps = 0/92 (0%)
 Frame = +1

Query  142  VKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGEVLKK  321
            ++ F LNTGAKIPSVGLGTW AEPGVV  A+  A+ VGYRHID A+ Y  EKEIG+ LKK
Sbjct  6    LRFFELNTGAKIPSVGLGTWLAEPGVVYDAISTAVNVGYRHIDCAQYYGNEKEIGDALKK  65

Query  322  LFADGVVKREDLFITSKLWGRDHAPEDVPVAL  417
            LFA+GVVKRE+++ITSKLW  DH PEDVP A 
Sbjct  66   LFANGVVKREEMWITSKLWNTDHLPEDVPKAF  97



>ref|XP_009358772.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Pyrus 
x bretschneideri]
Length=307

 Score =   135 bits (341),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/97 (68%), Positives = 77/97 (79%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA A++ F LNTGAKIPSVGLGT++A+  VV   + AAIK+GYRHID AR Y  EKEIG 
Sbjct  1    MANAIRVFELNTGAKIPSVGLGTYRADTHVVSDVITAAIKIGYRHIDCARLYGNEKEIGG  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
             LKKLF DGVVKRED++ITSKLW  DH PEDVP A++
Sbjct  61   ALKKLFNDGVVKREDIWITSKLWCSDHEPEDVPKAID  97



>gb|EMS64419.1| Aldo-keto reductase family 4 member C9 [Triticum urartu]
Length=676

 Score =   139 bits (351),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 68/109 (62%), Positives = 86/109 (79%), Gaps = 5/109 (5%)
 Frame = +1

Query  100  TSSLFRLCVA--MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDG  273
            +S +F  C+A  MAG+   F+LNTGA+IP +GLGTWQ EP VVG A+ AA+K GYRHID 
Sbjct  352  SSIVFLSCLAPKMAGS---FILNTGARIPPIGLGTWQIEPDVVGDAIYAAVKAGYRHIDC  408

Query  274  ARAYNXEKEIGEVLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            A AY+ +K++G  LKKLF DGV++REDLF+TSKLW  DHAPEDVP A++
Sbjct  409  APAYHNQKQVGLALKKLFEDGVIEREDLFVTSKLWFGDHAPEDVPEAID  457


 Score =   137 bits (345),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 76/96 (79%), Gaps = 3/96 (3%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MAG+   FVLNTGA+IP +GLGTWQ EP VVG A+ AA+K GYRHID A  Y  EK++G 
Sbjct  1    MAGS---FVLNTGARIPLIGLGTWQIEPDVVGDAIYAAVKAGYRHIDCAPVYRNEKQVGL  57

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVAL  417
             LKKLF DGVV+REDLFITSKLW  DHAPEDVP A+
Sbjct  58   ALKKLFEDGVVRREDLFITSKLWSGDHAPEDVPEAI  93



>ref|XP_010529798.1| PREDICTED: aldo-keto reductase family 4 member C11-like isoform 
X2 [Tarenaya hassleriana]
Length=303

 Score =   135 bits (339),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/97 (67%), Positives = 76/97 (78%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA A+  F LNTGA IPSVGLGTWQA PGVVG +V  A+K+GYRHID A+ Y  EKE+G 
Sbjct  1    MANALVSFRLNTGAMIPSVGLGTWQAPPGVVGDSVVTAVKIGYRHIDCAQLYGNEKEVGN  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
             LKKLF +GVVKR++L+ITSKLW   HAPEDV  A+N
Sbjct  61   ALKKLFDEGVVKRDELWITSKLWNTHHAPEDVHEAMN  97



>ref|XP_004142056.1| PREDICTED: LOW QUALITY PROTEIN: aldo-keto reductase family 4 
member C9-like [Cucumis sativus]
Length=315

 Score =   135 bits (340),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/97 (66%), Positives = 75/97 (77%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA  +  F LNTGA IPS+GLGTWQA  G++  A+ AA+K+GYRHID +  Y  EKEIG 
Sbjct  1    MASQISSFPLNTGANIPSLGLGTWQATEGLLTNAISAALKIGYRHIDCSPVYGNEKEIGS  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            VLKKLF +GVVKREDL+IT KLW  DHAPEDVP AL+
Sbjct  61   VLKKLFEEGVVKREDLWITXKLWCTDHAPEDVPKALD  97



>gb|AFW78250.1| putative oxidoreductase, aldo/keto reductase family protein [Zea 
mays]
Length=380

 Score =   136 bits (343),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = +1

Query  151  FVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGEVLKKLFA  330
            FVLNTGAKIPSVGLGTWQA+ G+VG AV AA+K GYRHID A+AYN EKE+G  L+++  
Sbjct  74   FVLNTGAKIPSVGLGTWQADNGLVGDAVYAAVKAGYRHIDCAQAYNNEKEVGFGLRRVLD  133

Query  331  DGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            +G+VKREDLFITSKLW  +HA EDVPVALN
Sbjct  134  EGIVKREDLFITSKLWDINHAAEDVPVALN  163



>ref|XP_008387821.1| PREDICTED: aldo-keto reductase family 4 member C9-like isoform 
X1 [Malus domestica]
Length=352

 Score =   136 bits (342),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/102 (65%), Positives = 79/102 (77%), Gaps = 0/102 (0%)
 Frame = +1

Query  115  RLCVAMAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXE  294
            R  + MA A++ F LNTGAKIPSVGLGT++A+  VV   + AAIK+GYRHID A+ Y  E
Sbjct  41   REKLKMANAIRFFELNTGAKIPSVGLGTYRADTHVVSDVIAAAIKIGYRHIDCAQMYGNE  100

Query  295  KEIGEVLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            KEIG+ LKKLF DGVVKRED++ITSKLW  DH PEDVP A +
Sbjct  101  KEIGDALKKLFNDGVVKREDIWITSKLWCSDHEPEDVPKAFD  142



>gb|EMS58684.1| Aldo-keto reductase family 4 member C9 [Triticum urartu]
Length=285

 Score =   134 bits (338),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/92 (72%), Positives = 74/92 (80%), Gaps = 0/92 (0%)
 Frame = +1

Query  145  KCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGEVLKKL  324
            + FVLNTGA+IPSVGLGT + EPG VG+AV AAIK GYRHID A AY  EKEIG  LKKL
Sbjct  3    ESFVLNTGARIPSVGLGTAKTEPGTVGEAVYAAIKAGYRHIDCAPAYRNEKEIGLALKKL  62

Query  325  FADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            F D VVKREDLFI+SKLW  +HAPEDVP  ++
Sbjct  63   FEDYVVKREDLFISSKLWSGNHAPEDVPEGID  94



>ref|XP_002456632.1| hypothetical protein SORBIDRAFT_03g039760 [Sorghum bicolor]
 gb|EES01752.1| hypothetical protein SORBIDRAFT_03g039760 [Sorghum bicolor]
Length=311

 Score =   135 bits (339),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 75/90 (83%), Gaps = 0/90 (0%)
 Frame = +1

Query  151  FVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGEVLKKLFA  330
            FVLNTGA+IPSVG GTWQ++P VVG +V AA+K GYRHID ARAY  EKEIG  L++LF 
Sbjct  5    FVLNTGAEIPSVGYGTWQSKPDVVGDSVYAAVKAGYRHIDCARAYRNEKEIGLALQRLFE  64

Query  331  DGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            +GVVKRE+LFITSKLW   HAPEDVP +L+
Sbjct  65   EGVVKREELFITSKLWHDHHAPEDVPESLD  94



>ref|XP_008387823.1| PREDICTED: aldo-keto reductase family 4 member C9-like isoform 
X2 [Malus domestica]
Length=307

 Score =   135 bits (339),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 65/97 (67%), Positives = 77/97 (79%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA A++ F LNTGAKIPSVGLGT++A+  VV   + AAIK+GYRHID A+ Y  EKEIG+
Sbjct  1    MANAIRFFELNTGAKIPSVGLGTYRADTHVVSDVIAAAIKIGYRHIDCAQMYGNEKEIGD  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
             LKKLF DGVVKRED++ITSKLW  DH PEDVP A +
Sbjct  61   ALKKLFNDGVVKREDIWITSKLWCSDHEPEDVPKAFD  97



>ref|XP_010529797.1| PREDICTED: aldo-keto reductase family 4 member C10-like isoform 
X1 [Tarenaya hassleriana]
Length=315

 Score =   135 bits (339),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 65/97 (67%), Positives = 76/97 (78%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA A+  F LNTGA IPSVGLGTWQA PGVVG +V  A+K+GYRHID A+ Y  EKE+G 
Sbjct  1    MANALVSFRLNTGAMIPSVGLGTWQAPPGVVGDSVVTAVKIGYRHIDCAQLYGNEKEVGN  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
             LKKLF +GVVKR++L+ITSKLW   HAPEDV  A+N
Sbjct  61   ALKKLFDEGVVKRDELWITSKLWNTHHAPEDVHEAMN  97



>gb|KDP24554.1| hypothetical protein JCGZ_25118 [Jatropha curcas]
Length=315

 Score =   135 bits (339),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 69/96 (72%), Positives = 79/96 (82%), Gaps = 0/96 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            M   ++ F LNTGAK+PSVGLGTWQAEPG+VG AV AA+K+GYRHID A+AY+ EKEIG 
Sbjct  1    MVNEIRFFELNTGAKMPSVGLGTWQAEPGLVGAAVAAAVKIGYRHIDCAQAYSNEKEIGA  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVAL  417
            VL KLF DGVVKRE+LFITSKLW  +H PEDV  AL
Sbjct  61   VLNKLFEDGVVKREELFITSKLWCNNHEPEDVVKAL  96



>ref|XP_007134070.1| hypothetical protein PHAVU_010G017000g [Phaseolus vulgaris]
 gb|ESW06064.1| hypothetical protein PHAVU_010G017000g [Phaseolus vulgaris]
Length=313

 Score =   134 bits (338),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 66/97 (68%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            M   ++ F LNTGAKIPS+GLGT +AEPGVV +AV  AI+VGYRHID A+ Y+ + EIG 
Sbjct  1    MGKLIQFFELNTGAKIPSIGLGTAKAEPGVVPKAVTTAIQVGYRHIDCAQFYDNQAEIGS  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
             LKK+F DGVVKREDL+ITSKLW  DHAPEDVP AL+
Sbjct  61   ALKKVFDDGVVKREDLWITSKLWCTDHAPEDVPKALD  97



>ref|XP_006373911.1| hypothetical protein POPTR_0016s10390g [Populus trichocarpa]
 gb|ERP51708.1| hypothetical protein POPTR_0016s10390g [Populus trichocarpa]
Length=331

 Score =   134 bits (338),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 76/96 (79%), Gaps = 0/96 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA A+  F LNTGAKIPSVGLGTW+A+PG V  AV AAIK GYRHID AR Y  EKE+G 
Sbjct  1    MAKAIPFFELNTGAKIPSVGLGTWRADPGAVADAVTAAIKAGYRHIDCARLYCNEKEVGC  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVAL  417
             LKKLF +GVVKR +++ITSKLW  DHAPEDVP +L
Sbjct  61   ALKKLFDNGVVKRGEVWITSKLWCNDHAPEDVPESL  96



>ref|XP_010038893.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Eucalyptus 
grandis]
 gb|KCW84682.1| hypothetical protein EUGRSUZ_B01499 [Eucalyptus grandis]
Length=313

 Score =   134 bits (337),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 70/96 (73%), Positives = 76/96 (79%), Gaps = 2/96 (2%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA A++ F LNTGAKIPSVGLGTWQ   GV   AV  AIKVGYRHID A+AY  EKEIG 
Sbjct  1    MAKAIRFFELNTGAKIPSVGLGTWQTGDGV--DAVTTAIKVGYRHIDCAQAYQNEKEIGT  58

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVAL  417
             L KLF++GVVKREDL+ITSKLW  DHAPEDVP AL
Sbjct  59   ALLKLFSEGVVKREDLWITSKLWCADHAPEDVPKAL  94



>ref|XP_010088585.1| Aldo-keto reductase family 4 member C9 [Morus notabilis]
 gb|EXB36726.1| Aldo-keto reductase family 4 member C9 [Morus notabilis]
Length=315

 Score =   134 bits (337),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 67/97 (69%), Positives = 74/97 (76%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA  +  F LNTGAK+PSVGLGTWQ+ PG+V  AV AAIK+GYRHID AR Y  E EIG 
Sbjct  1    MADDILYFELNTGAKMPSVGLGTWQSSPGLVADAVTAAIKIGYRHIDCARLYRNEAEIGS  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
             LKKLF DGVVKREDL+ITSKLW  D APE V  AL+
Sbjct  61   ALKKLFEDGVVKREDLWITSKLWSTDFAPEYVQEALD  97



>ref|XP_004142055.1| PREDICTED: aldo-keto reductase family 4 member C10-like [Cucumis 
sativus]
Length=318

 Score =   134 bits (337),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 64/97 (66%), Positives = 76/97 (78%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA  +  F LNTGA IPS+GLGTWQA   ++  A+ AA+K+GYRHID A+ Y  EKEIG 
Sbjct  1    MASQISFFPLNTGANIPSLGLGTWQATGDLLTNAIAAALKIGYRHIDCAQLYGNEKEIGS  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            VLKKLF +G+VKREDL+ITSKLW  DHAPEDVP AL+
Sbjct  61   VLKKLFEEGIVKREDLWITSKLWCTDHAPEDVPKALD  97



>ref|XP_006429176.1| hypothetical protein CICLE_v10012267mg [Citrus clementina]
 gb|ESR42416.1| hypothetical protein CICLE_v10012267mg [Citrus clementina]
Length=287

 Score =   133 bits (335),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 66/97 (68%), Positives = 74/97 (76%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            M    + F LNTGAKIPS+GLGTW A P VVG A+ AA+KVGYRHID A+ Y  EK IG 
Sbjct  1    MEEGFRFFKLNTGAKIPSLGLGTWAAAPDVVGDAIAAAVKVGYRHIDCAQIYGNEKGIGS  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
             LKKLF DGVVKREDL+ITSKLW  +H PEDVP AL+
Sbjct  61   ALKKLFDDGVVKREDLWITSKLWCNNHLPEDVPKALD  97



>ref|XP_004166958.1| PREDICTED: aldo-keto reductase family 4 member C10-like [Cucumis 
sativus]
Length=316

 Score =   134 bits (336),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 64/97 (66%), Positives = 76/97 (78%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA  +  F LNTGA IPS+GLGTWQA   ++  A+ AA+K+GYRHID A+ Y  EKEIG 
Sbjct  1    MASQISFFPLNTGANIPSLGLGTWQATGDLLTNAIAAALKIGYRHIDCAQLYGNEKEIGS  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            VLKKLF +G+VKREDL+ITSKLW  DHAPEDVP AL+
Sbjct  61   VLKKLFEEGIVKREDLWITSKLWCTDHAPEDVPKALD  97



>ref|XP_009345431.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Pyrus 
x bretschneideri]
 ref|XP_009345432.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Pyrus 
x bretschneideri]
Length=317

 Score =   134 bits (336),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = +1

Query  151  FVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGEVLKKLFA  330
            F LNTGAKIPSVGLGTW+AEPGVVGQAV AA+K GYRHID A  Y  EKE+G  LK+LF+
Sbjct  11   FDLNTGAKIPSVGLGTWKAEPGVVGQAVIAAVKNGYRHIDCASVYGNEKEVGVALKELFS  70

Query  331  DGVVKREDLFITSKLWGRDHAPEDVPVALN  420
             GVV+R +LFITSKLW  DHAPEDV  AL+
Sbjct  71   TGVVQRSELFITSKLWCSDHAPEDVSKALS  100



>ref|XP_008448252.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Cucumis 
melo]
Length=316

 Score =   134 bits (336),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 64/97 (66%), Positives = 75/97 (77%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA  +  F LNTGA IPS+GLGTWQA   ++  A+  A+K+GYRHID A+ Y  EKEIG 
Sbjct  1    MASHISFFPLNTGANIPSLGLGTWQATDALLINAIATALKIGYRHIDCAQFYGNEKEIGS  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            VLK+LF +GVVKREDLFITSKLW  DHAPEDVP AL+
Sbjct  61   VLKQLFEEGVVKREDLFITSKLWCSDHAPEDVPKALD  97



>ref|XP_004970567.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Setaria 
italica]
Length=311

 Score =   134 bits (336),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 75/90 (83%), Gaps = 0/90 (0%)
 Frame = +1

Query  151  FVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGEVLKKLFA  330
            FVLNTGA+IPSVGLGTWQ++P VVG +V AA+K GYRHID ARAY  E+EIG  L+KLF 
Sbjct  5    FVLNTGAEIPSVGLGTWQSKPDVVGDSVYAAVKAGYRHIDCARAYRNEEEIGLALQKLFE  64

Query  331  DGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            +G+VKREDLFITSKLW   HAPEDV  +L+
Sbjct  65   EGIVKREDLFITSKLWHDHHAPEDVRESLD  94



>gb|KGN54281.1| hypothetical protein Csa_4G296830 [Cucumis sativus]
Length=296

 Score =   133 bits (335),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 63/97 (65%), Positives = 76/97 (78%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA  +  F LNTGA IPS+GLGTWQA   ++  A+ AA+K+GYRHID A+ Y  EKEIG 
Sbjct  1    MASQISFFPLNTGANIPSLGLGTWQATGDLLTNAIAAALKIGYRHIDCAQLYGNEKEIGS  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            VLKKLF +G+VKREDL+ITSKLW  DHAPE+VP AL+
Sbjct  61   VLKKLFEEGIVKREDLWITSKLWCTDHAPEEVPAALD  97



>ref|XP_008369943.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Malus 
domestica]
 ref|XP_008369945.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Malus 
domestica]
Length=317

 Score =   134 bits (336),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = +1

Query  151  FVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGEVLKKLFA  330
            F LNTGAKIPSVGLGTW+AEPGVVGQAV AA+K GYRHID A  Y  EKE+G  LK+LF+
Sbjct  11   FDLNTGAKIPSVGLGTWKAEPGVVGQAVIAAVKNGYRHIDCASVYGNEKEVGVALKELFS  70

Query  331  DGVVKREDLFITSKLWGRDHAPEDVPVALN  420
             GVV+R +LFITSKLW  DHAPEDV  AL+
Sbjct  71   TGVVQRSELFITSKLWCSDHAPEDVSKALS  100



>ref|XP_011012443.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Populus 
euphratica]
 ref|XP_011012444.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Populus 
euphratica]
Length=318

 Score =   134 bits (336),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 75/96 (78%), Gaps = 0/96 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA A+  F LNTGAKIPSVGLGTW+A+PG V  AV AAIK GYRHID AR Y  EKE+G 
Sbjct  1    MAKAIPFFELNTGAKIPSVGLGTWRADPGAVADAVTAAIKAGYRHIDCARLYRNEKEVGC  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVAL  417
             LK LF +GVVKR +++ITSKLW  DHAPEDVP +L
Sbjct  61   ALKNLFDNGVVKRGEVWITSKLWCTDHAPEDVPESL  96



>ref|XP_008240406.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Prunus 
mume]
Length=315

 Score =   133 bits (335),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 64/97 (66%), Positives = 75/97 (77%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA  +  F LNTGA+IPS+GLGTWQ+ PG+VG AV  A+K GYRHID A+ Y  EKEIG 
Sbjct  1    MADDIHSFELNTGARIPSLGLGTWQSSPGLVGDAVATAVKAGYRHIDCAQRYGNEKEIGL  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            VLKKLF DGV  REDL++TSKLW  +HAPEDV  AL+
Sbjct  61   VLKKLFEDGVANREDLWVTSKLWCTNHAPEDVLEALD  97



>ref|XP_004970569.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Setaria 
italica]
Length=304

 Score =   133 bits (334),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 75/90 (83%), Gaps = 0/90 (0%)
 Frame = +1

Query  151  FVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGEVLKKLFA  330
            F LNTGA+IPSVGLGT++A PGVVG A+ AA+K GYRHID A  YN EKEIG  LKK+FA
Sbjct  5    FTLNTGARIPSVGLGTYKAGPGVVGDAIAAAVKAGYRHIDCASLYNNEKEIGVALKKVFA  64

Query  331  DGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            DGVVKREDLF+TSK+W  D APEDV +A++
Sbjct  65   DGVVKREDLFVTSKIWCSDLAPEDVSLAID  94



>ref|XP_004305184.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Fragaria 
vesca subsp. vesca]
Length=318

 Score =   133 bits (335),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 72/90 (80%), Gaps = 0/90 (0%)
 Frame = +1

Query  151  FVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGEVLKKLFA  330
            F LNTGAKIPSVGLGTW AEPGVVGQAV AA+K GYRHID A  Y  EKEIG  LK+LF+
Sbjct  12   FDLNTGAKIPSVGLGTWHAEPGVVGQAVIAAVKNGYRHIDCASVYGNEKEIGVALKELFS  71

Query  331  DGVVKREDLFITSKLWGRDHAPEDVPVALN  420
             GVV R ++FITSKLW  DHAPEDV  AL+
Sbjct  72   TGVVHRSEIFITSKLWCSDHAPEDVSTALS  101



>ref|XP_006403644.1| hypothetical protein EUTSA_v10010554mg [Eutrema salsugineum]
 gb|ESQ45097.1| hypothetical protein EUTSA_v10010554mg [Eutrema salsugineum]
Length=315

 Score =   133 bits (334),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 67/97 (69%), Positives = 74/97 (76%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA  +  F LNTGAKIPSVGLGTWQA PG+VG AV AA+K+GY+HID A  Y  E EIG+
Sbjct  1    MANEIGYFELNTGAKIPSVGLGTWQAAPGIVGDAVAAAVKIGYQHIDCASRYGNEMEIGK  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            VLKKLF DGVVKRE LFITSK+W  D  P DV  ALN
Sbjct  61   VLKKLFEDGVVKREKLFITSKIWLTDLDPPDVQEALN  97



>emb|CBI30495.3| unnamed protein product [Vitis vinifera]
Length=275

 Score =   132 bits (332),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = +1

Query  175  IPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGEVLKKLFADGVVKRED  354
            +PSVGLGTWQ++PG+VGQAV  AIKVGYRHID A+ Y  E+EIG VLKKLF DGVVKRED
Sbjct  1    MPSVGLGTWQSDPGLVGQAVAIAIKVGYRHIDCAQVYGNEEEIGIVLKKLFDDGVVKRED  60

Query  355  LFITSKLWGRDHAPEDVPVALN  420
            L+ITSKLW  DHAPEDVP ALN
Sbjct  61   LWITSKLWCTDHAPEDVPEALN  82



>gb|KHN04060.1| Aldo-keto reductase family 4 member C9 [Glycine soja]
Length=312

 Score =   133 bits (334),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/97 (65%), Positives = 77/97 (79%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            M+  ++ F LNTGA IPS+GLGTW A+PGVVG  +  A++VGYRHID A+ Y  ++EIG 
Sbjct  1    MSNEIRFFELNTGANIPSLGLGTWLADPGVVGDVIAHAVEVGYRHIDCAQIYGNQEEIGL  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
             LKKLF +GVVKREDL+ITSKLW  DHAPEDVP AL+
Sbjct  61   ALKKLFEEGVVKREDLWITSKLWCTDHAPEDVPEALD  97



>ref|XP_006429175.1| hypothetical protein CICLE_v10012267mg [Citrus clementina]
 gb|ESR42415.1| hypothetical protein CICLE_v10012267mg [Citrus clementina]
Length=311

 Score =   133 bits (334),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/97 (68%), Positives = 74/97 (76%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            M    + F LNTGAKIPS+GLGTW A P VVG A+ AA+KVGYRHID A+ Y  EK IG 
Sbjct  1    MEEGFRFFKLNTGAKIPSLGLGTWAAAPDVVGDAIAAAVKVGYRHIDCAQIYGNEKGIGS  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
             LKKLF DGVVKREDL+ITSKLW  +H PEDVP AL+
Sbjct  61   ALKKLFDDGVVKREDLWITSKLWCNNHLPEDVPKALD  97



>ref|XP_004961878.1| PREDICTED: aldo-keto reductase family 4 member C10-like [Setaria 
italica]
Length=311

 Score =   132 bits (333),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/91 (70%), Positives = 72/91 (79%), Gaps = 0/91 (0%)
 Frame = +1

Query  145  KCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGEVLKKL  324
            + FVLNTGA IPSVGLG WQ +P  VG A+ AA+K GYRHID A AY+ EKE+G  LKKL
Sbjct  3    ESFVLNTGATIPSVGLGVWQIKPEAVGDAIYAAVKAGYRHIDCAAAYSNEKEVGLALKKL  62

Query  325  FADGVVKREDLFITSKLWGRDHAPEDVPVAL  417
            F DGVVKRED+FITSKLW   HAPEDVP A+
Sbjct  63   FEDGVVKREDMFITSKLWSAYHAPEDVPEAI  93



>gb|ABL61257.1| aldo-keto reductase [Aloe arborescens]
Length=307

 Score =   132 bits (333),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 71/91 (78%), Gaps = 0/91 (0%)
 Frame = +1

Query  145  KCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGEVLKKL  324
            K F LNTGAKIPS+GLGTW+AEPGVV  AV AAIK GYRHID A  Y  EKEIG  LKKL
Sbjct  3    KFFTLNTGAKIPSIGLGTWRAEPGVVENAVTAAIKAGYRHIDCAAMYGNEKEIGFSLKKL  62

Query  325  FADGVVKREDLFITSKLWGRDHAPEDVPVAL  417
              D VVKREDLFITSKLW  + A EDVP+AL
Sbjct  63   LEDAVVKREDLFITSKLWLTEQAREDVPLAL  93



>gb|EMT21856.1| Alcohol dehydrogenase (NADP+) A [Aegilops tauschii]
Length=311

 Score =   132 bits (332),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 74/92 (80%), Gaps = 0/92 (0%)
 Frame = +1

Query  145  KCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGEVLKKL  324
            + F LNTG +IPSVG GTWQ++P  VG++V AA+K GYRHID ARAY  EKE+G  L+KL
Sbjct  3    RHFTLNTGTEIPSVGYGTWQSKPDGVGRSVYAAVKAGYRHIDCARAYRNEKEVGLALQKL  62

Query  325  FADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            F +GVVKREDLFITSKLW   HAPEDVP +L+
Sbjct  63   FEEGVVKREDLFITSKLWHDHHAPEDVPESLH  94



>ref|XP_003604919.1| Aldose reductase [Medicago truncatula]
 gb|ACJ84246.1| unknown [Medicago truncatula]
 gb|AES87116.1| aldo/keto reductase family oxidoreductase [Medicago truncatula]
 gb|AFK40685.1| unknown [Medicago truncatula]
Length=304

 Score =   132 bits (332),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 74/93 (80%), Gaps = 0/93 (0%)
 Frame = +1

Query  142  VKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGEVLKK  321
            ++ F LNTGAKIPSVGLGTW A PGVV  A+  A+ VGYRHID A+ Y  EKEIG+ LKK
Sbjct  6    LRLFELNTGAKIPSVGLGTWLAAPGVVYDAISTAVNVGYRHIDCAQIYGNEKEIGDALKK  65

Query  322  LFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            LFA+GVVKRE+++ITSKLW  DH PEDVP A +
Sbjct  66   LFANGVVKREEMWITSKLWCTDHLPEDVPKAFD  98



>ref|XP_009358773.1| PREDICTED: aldo-keto reductase family 4 member C10-like [Pyrus 
x bretschneideri]
Length=315

 Score =   132 bits (332),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 72/97 (74%), Positives = 81/97 (84%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA A++ F L+TGAKIPSVGLGTWQAE GVV  AV AAIK+GYRHID A+AY  EKEIG 
Sbjct  1    MAKAIRFFELSTGAKIPSVGLGTWQAEHGVVAAAVTAAIKLGYRHIDCAQAYGNEKEIGF  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
             LKKL+ DGVVKREDL+ITSKLW  +HAPEDVP AL+
Sbjct  61   ALKKLYDDGVVKREDLWITSKLWCSNHAPEDVPKALD  97



>gb|KJB36674.1| hypothetical protein B456_006G170300 [Gossypium raimondii]
Length=318

 Score =   132 bits (331),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 64/89 (72%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = +1

Query  151  FVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGEVLKKLFA  330
            F LNTGAK+PSVGLGTW+A PGVVG+AV  A+K GYRHID A  Y+ EKEIG  LK LF+
Sbjct  12   FELNTGAKMPSVGLGTWKASPGVVGEAVVTAVKAGYRHIDCAHVYDNEKEIGLALKGLFS  71

Query  331  DGVVKREDLFITSKLWGRDHAPEDVPVAL  417
             GVVKR++LFITSKLW  DHAPEDVP A+
Sbjct  72   SGVVKRKELFITSKLWCCDHAPEDVPKAM  100



>ref|XP_002273139.1| PREDICTED: aldo-keto reductase family 4 member C9 isoform X1 
[Vitis vinifera]
 ref|XP_010654238.1| PREDICTED: aldo-keto reductase family 4 member C9 isoform X1 
[Vitis vinifera]
 emb|CBI30494.3| unnamed protein product [Vitis vinifera]
Length=315

 Score =   132 bits (331),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 62/90 (69%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = +1

Query  151  FVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGEVLKKLFA  330
            F LNTGAK+PS+GLGTW+A PGVVG+AV AA+K GYRHID AR Y+ EKEIG  LK++F+
Sbjct  9    FELNTGAKMPSIGLGTWKAPPGVVGEAVIAAVKAGYRHIDCARVYDNEKEIGAALKEVFS  68

Query  331  DGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            +GVVKR +++ITSKLW  DHAPEDV  AL+
Sbjct  69   NGVVKRNEIWITSKLWCSDHAPEDVSRALS  98



>ref|NP_001242750.1| uncharacterized protein LOC100788951 [Glycine max]
 gb|ACU17797.1| unknown [Glycine max]
Length=312

 Score =   131 bits (330),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 62/97 (64%), Positives = 76/97 (78%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            M+  ++ F LNTGA IPS+GLGTW A+PGVVG  +  A++ GYRHID A+ Y  ++EIG 
Sbjct  1    MSNEIRFFELNTGANIPSLGLGTWLADPGVVGDVIAHAVEAGYRHIDCAQIYGNQEEIGL  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
             LKKLF +GVVKREDL+ITSKLW  DHAPEDVP AL+
Sbjct  61   ALKKLFEEGVVKREDLWITSKLWCTDHAPEDVPEALD  97



>gb|EMS64420.1| Aldo-keto reductase family 4 member C9 [Triticum urartu]
Length=305

 Score =   131 bits (330),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 75/106 (71%), Gaps = 14/106 (13%)
 Frame = +1

Query  145  KCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKE--------  300
            + FVLNTGA++PSVGLGTWQ EP VVG A+ AA+K GYRHID A  Y  EK+        
Sbjct  3    RSFVLNTGARMPSVGLGTWQIEPDVVGDAIYAAVKAGYRHIDCAPVYRNEKQVKYLNWSA  62

Query  301  ------IGEVLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
                  +G  LKKLF DGVVKREDLFITSKLW  DHAPEDVP A++
Sbjct  63   PQNNVGVGFALKKLFEDGVVKREDLFITSKLWSGDHAPEDVPEAID  108



>ref|XP_006493577.1| PREDICTED: aldo-keto reductase family 4 member C9-like isoform 
X3 [Citrus sinensis]
Length=311

 Score =   131 bits (330),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 65/97 (67%), Positives = 73/97 (75%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            M    + F LN GAKIPS+GLGTW A P VVG A+ AA+KVGYRHID A+ Y  EK IG 
Sbjct  1    MEEGFRFFKLNAGAKIPSLGLGTWAAAPDVVGDAIAAAVKVGYRHIDCAQIYGNEKGIGS  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
             LKKLF DGVVKREDL+ITSKLW  +H PEDVP AL+
Sbjct  61   ALKKLFDDGVVKREDLWITSKLWCNNHLPEDVPKALD  97



>ref|XP_010088587.1| Aldo-keto reductase family 4 member C10 [Morus notabilis]
 gb|EXB36728.1| Aldo-keto reductase family 4 member C10 [Morus notabilis]
Length=307

 Score =   130 bits (328),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 63/95 (66%), Positives = 74/95 (78%), Gaps = 0/95 (0%)
 Frame = +1

Query  136  GAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGEVL  315
            G ++ F LNTGAKIPSVGLGT+ AE  ++   + AAIK+GYRHID A+ Y  EKEIG  L
Sbjct  2    GDIRFFELNTGAKIPSVGLGTYAAESSLIDSTISAAIKLGYRHIDCAQMYGNEKEIGSAL  61

Query  316  KKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            KKLF DGVVKRE+L+ITSKLW  DH PEDVP AL+
Sbjct  62   KKLFDDGVVKREELWITSKLWCTDHEPEDVPKALD  96



>ref|XP_006493576.1| PREDICTED: aldo-keto reductase family 4 member C9-like isoform 
X2 [Citrus sinensis]
Length=311

 Score =   130 bits (328),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 65/97 (67%), Positives = 73/97 (75%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            M    + F LN GAKIPS+GLGTW A P VVG A+ AA+KVGYRHID A+ Y  EK IG 
Sbjct  1    MEEGFRFFKLNAGAKIPSLGLGTWAAAPDVVGDAIAAAVKVGYRHIDCAQIYGNEKGIGS  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
             LKKLF DGVVKREDL+ITSKLW  +H PEDVP AL+
Sbjct  61   ALKKLFDDGVVKREDLWITSKLWCNNHLPEDVPKALD  97



>ref|NP_001241957.1| uncharacterized protein LOC100809492 [Glycine max]
 gb|ACU18180.1| unknown [Glycine max]
Length=328

 Score =   131 bits (329),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 67/102 (66%), Positives = 75/102 (74%), Gaps = 9/102 (9%)
 Frame = +1

Query  142  VKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEK--------  297
            ++ F LNTGAKIPSVGLGTW AEPGVV +A+  AI VGYRHID A+ Y  EK        
Sbjct  6    LRFFELNTGAKIPSVGLGTWLAEPGVVARALATAINVGYRHIDCAQIYGNEKEYFYGLAG  65

Query  298  -EIGEVLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
             EIG  LKKLFADGVVKRED+FITSKLW  DH PE+VP A +
Sbjct  66   DEIGAALKKLFADGVVKREDMFITSKLWCNDHLPENVPEAFD  107



>ref|XP_008673076.1| PREDICTED: uncharacterized protein LOC100381673 isoform X3 [Zea 
mays]
Length=297

 Score =   130 bits (327),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 72/90 (80%), Gaps = 0/90 (0%)
 Frame = +1

Query  151  FVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGEVLKKLFA  330
            F LNTGA+IPSVGLGT++A PGVV  A+ AA+K GYRHID A  Y  EKEIG  L KLF 
Sbjct  5    FTLNTGARIPSVGLGTYKAGPGVVADAITAAVKAGYRHIDCAPLYKNEKEIGVALNKLFD  64

Query  331  DGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            DGVVKREDLFITSK+W  D APEDVP+A++
Sbjct  65   DGVVKREDLFITSKIWCSDLAPEDVPLAID  94



>ref|XP_007205574.1| hypothetical protein PRUPE_ppa008802mg [Prunus persica]
 gb|EMJ06773.1| hypothetical protein PRUPE_ppa008802mg [Prunus persica]
Length=318

 Score =   130 bits (328),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/90 (72%), Positives = 73/90 (81%), Gaps = 0/90 (0%)
 Frame = +1

Query  151  FVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGEVLKKLFA  330
            F LNTGAKIPSVGLGTW+AEPGVVGQAV AA+K GYRHID A  Y  EKE+G  LK+LF+
Sbjct  12   FDLNTGAKIPSVGLGTWKAEPGVVGQAVIAAVKNGYRHIDCASIYGNEKEVGVALKELFS  71

Query  331  DGVVKREDLFITSKLWGRDHAPEDVPVALN  420
             GVV+R +LFITSKLW  DHAP DV  AL+
Sbjct  72   TGVVQRSELFITSKLWCSDHAPADVSKALS  101



>ref|XP_008240372.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Prunus 
mume]
Length=318

 Score =   130 bits (328),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/90 (72%), Positives = 73/90 (81%), Gaps = 0/90 (0%)
 Frame = +1

Query  151  FVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGEVLKKLFA  330
            F LNTGAKIPSVGLGTW+AEPGVVGQAV AA+K GYRHID A  Y  EKE+G  LK+LF+
Sbjct  12   FDLNTGAKIPSVGLGTWKAEPGVVGQAVIAAVKNGYRHIDCASIYGNEKEVGVALKELFS  71

Query  331  DGVVKREDLFITSKLWGRDHAPEDVPVALN  420
             GVV+R +LFITSKLW  DHAP DV  AL+
Sbjct  72   TGVVQRSELFITSKLWCSDHAPADVSKALS  101



>ref|XP_006493575.1| PREDICTED: aldo-keto reductase family 4 member C9-like isoform 
X1 [Citrus sinensis]
Length=335

 Score =   130 bits (328),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/97 (67%), Positives = 73/97 (75%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            M    + F LN GAKIPS+GLGTW A P VVG A+ AA+KVGYRHID A+ Y  EK IG 
Sbjct  1    MEEGFRFFKLNAGAKIPSLGLGTWAAAPDVVGDAIAAAVKVGYRHIDCAQIYGNEKGIGS  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
             LKKLF DGVVKREDL+ITSKLW  +H PEDVP AL+
Sbjct  61   ALKKLFDDGVVKREDLWITSKLWCNNHLPEDVPKALD  97



>gb|ACG36524.1| aldose reductase [Zea mays]
Length=312

 Score =   130 bits (326),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/87 (69%), Positives = 69/87 (79%), Gaps = 0/87 (0%)
 Frame = +1

Query  145  KCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGEVLKKL  324
            + FVLNTG++IPSVGLG WQ +P     A+ AA+K GYRHID A AYN EKE+G  LKKL
Sbjct  3    ESFVLNTGSRIPSVGLGVWQIQPDAANDAIYAAVKAGYRHIDCAAAYNNEKEVGLALKKL  62

Query  325  FADGVVKREDLFITSKLWGRDHAPEDV  405
            F DGVVKR+DLFITSKLW  +HAPEDV
Sbjct  63   FEDGVVKRDDLFITSKLWAANHAPEDV  89



>ref|XP_008673074.1| PREDICTED: uncharacterized protein LOC100381673 isoform X1 [Zea 
mays]
Length=311

 Score =   130 bits (326),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 72/90 (80%), Gaps = 0/90 (0%)
 Frame = +1

Query  151  FVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGEVLKKLFA  330
            F LNTGA+IPSVGLGT++A PGVV  A+ AA+K GYRHID A  Y  EKEIG  L KLF 
Sbjct  5    FTLNTGARIPSVGLGTYKAGPGVVADAITAAVKAGYRHIDCAPLYKNEKEIGVALNKLFD  64

Query  331  DGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            DGVVKREDLFITSK+W  D APEDVP+A++
Sbjct  65   DGVVKREDLFITSKIWCSDLAPEDVPLAID  94



>ref|XP_008369939.1| PREDICTED: aldo-keto reductase family 4 member C10-like [Malus 
domestica]
Length=315

 Score =   130 bits (326),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 73/97 (75%), Positives = 82/97 (85%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA A++ F LNTGAKIPSVGLGTWQAEPGVV  AV AA+KVGYRHID A+AY  EKEIG 
Sbjct  1    MAEAIRFFELNTGAKIPSVGLGTWQAEPGVVAAAVTAAVKVGYRHIDCAQAYGNEKEIGF  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
             LKKL+ADGVVKREDL+ITSKLW  +HAPEDV  A++
Sbjct  61   ALKKLYADGVVKREDLWITSKLWCSNHAPEDVRKAID  97



>ref|XP_008673075.1| PREDICTED: uncharacterized protein LOC100381673 isoform X2 [Zea 
mays]
Length=304

 Score =   129 bits (325),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 72/90 (80%), Gaps = 0/90 (0%)
 Frame = +1

Query  151  FVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGEVLKKLFA  330
            F LNTGA+IPSVGLGT++A PGVV  A+ AA+K GYRHID A  Y  EKEIG  L KLF 
Sbjct  5    FTLNTGARIPSVGLGTYKAGPGVVADAITAAVKAGYRHIDCAPLYKNEKEIGVALNKLFD  64

Query  331  DGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            DGVVKREDLFITSK+W  D APEDVP+A++
Sbjct  65   DGVVKREDLFITSKIWCSDLAPEDVPLAID  94



>ref|XP_002272736.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Vitis 
vinifera]
Length=313

 Score =   130 bits (326),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/89 (70%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = +1

Query  151  FVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGEVLKKLFA  330
            F LN GAKIPSVGLGTW+A+ G++G A+  AIKVGYRHID A+ Y  E+EIG  LKK+F 
Sbjct  5    FELNIGAKIPSVGLGTWRADHGLIGDALATAIKVGYRHIDCAQLYENEEEIGFALKKIFE  64

Query  331  DGVVKREDLFITSKLWGRDHAPEDVPVAL  417
            DG+VKREDL+ITSKLW  DH+PEDVP AL
Sbjct  65   DGIVKREDLWITSKLWCSDHSPEDVPKAL  93



>ref|XP_009346417.1| PREDICTED: aldo-keto reductase family 4 member C10-like [Pyrus 
x bretschneideri]
Length=315

 Score =   129 bits (325),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 73/97 (75%), Positives = 82/97 (85%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGE  309
            MA A++ F LNTGAKIPSVGLGTWQAEPGVV  AV AA+KVGYRHID A+AY  EKEIG 
Sbjct  1    MAEAIRFFELNTGAKIPSVGLGTWQAEPGVVAAAVTAAVKVGYRHIDCAQAYGNEKEIGF  60

Query  310  VLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
             LKKL+ADGVVKREDL+ITSKLW  +HAPEDV  A++
Sbjct  61   ALKKLYADGVVKREDLWITSKLWCSNHAPEDVRKAID  97



>gb|EMT09402.1| Alcohol dehydrogenase (NADP+) A [Aegilops tauschii]
Length=305

 Score =   129 bits (325),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 77/110 (70%), Gaps = 17/110 (15%)
 Frame = +1

Query  130  MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKE---  300
            MAG+   FVLNTGA++PSVGLGTWQ +P VVG A+ AA+K GYRHID A  Y  EK+   
Sbjct  1    MAGS---FVLNTGARMPSVGLGTWQIDPDVVGDAIYAAVKAGYRHIDCAPVYRNEKQVKY  57

Query  301  -----------IGEVLKKLFADGVVKREDLFITSKLWGRDHAPEDVPVAL  417
                       +G  LKKLF DGVVKREDLFITSKLW  DHAPEDVP A+
Sbjct  58   LNWSAPQNNVGVGFALKKLFEDGVVKREDLFITSKLWSGDHAPEDVPEAI  107



>ref|XP_010037792.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Eucalyptus 
grandis]
 gb|KCW49536.1| hypothetical protein EUGRSUZ_K03059 [Eucalyptus grandis]
Length=324

 Score =   129 bits (325),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 63/91 (69%), Positives = 71/91 (78%), Gaps = 0/91 (0%)
 Frame = +1

Query  148  CFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGEVLKKLF  327
            CF LNTG KIPSVGLGTW+A PGVVGQAV  A++ GYRHID AR Y+ EKEIG  LK+LF
Sbjct  17   CFDLNTGGKIPSVGLGTWKAPPGVVGQAVIEAVQAGYRHIDCARVYDNEKEIGVALKELF  76

Query  328  ADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            + GVV R ++FITSKLW  DHA EDV  AL 
Sbjct  77   STGVVDRNEMFITSKLWCSDHAAEDVSKALT  107



>emb|CBI30497.3| unnamed protein product [Vitis vinifera]
Length=368

 Score =   130 bits (327),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/89 (70%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = +1

Query  151  FVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGEVLKKLFA  330
            F LN GAKIPSVGLGTW+A+ G++G A+  AIKVGYRHID A+ Y  E+EIG  LKK+F 
Sbjct  61   FELNIGAKIPSVGLGTWRADHGLIGDALATAIKVGYRHIDCAQLYENEEEIGFALKKIFE  120

Query  331  DGVVKREDLFITSKLWGRDHAPEDVPVAL  417
            DG+VKREDL+ITSKLW  DH+PEDVP AL
Sbjct  121  DGIVKREDLWITSKLWCSDHSPEDVPKAL  149



>gb|EEC79337.1| hypothetical protein OsI_20196 [Oryza sativa Indica Group]
Length=297

 Score =   129 bits (323),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 70/92 (76%), Gaps = 0/92 (0%)
 Frame = +1

Query  145  KCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDGARAYNXEKEIGEVLKKL  324
            + FVLNT A IPSVGLGTWQ  PG V  A+ AA++VGYRHID +  Y  +KE+G  LKKL
Sbjct  3    ESFVLNTNAAIPSVGLGTWQISPGAVQDAIRAAVQVGYRHIDCSPQYGNQKEVGLALKKL  62

Query  325  FADGVVKREDLFITSKLWGRDHAPEDVPVALN  420
            F +G VKREDLFITSKLW   HAPEDVP A+N
Sbjct  63   FDEGAVKREDLFITSKLWCTHHAPEDVPEAIN  94



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 557844602525