BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002B11

Length=491
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011007948.1|  PREDICTED: methanol O-anthraniloyltransferas...    175   4e-49   Populus euphratica
ref|XP_002304071.1|  hypothetical protein POPTR_0003s01420g             175   6e-49   Populus trichocarpa [western balsam poplar]
emb|CBI25251.3|  unnamed protein product                                172   5e-48   Vitis vinifera
emb|CBI37444.3|  unnamed protein product                                166   6e-48   Vitis vinifera
ref|XP_002271603.1|  PREDICTED: methanol O-anthraniloyltransferase      171   1e-47   Vitis vinifera
gb|KDO36005.1|  hypothetical protein CISIN_1g041298mg                   163   2e-47   Citrus sinensis [apfelsine]
gb|ACV74416.1|  putative alcohol acyl transferase                       170   4e-47   Camellia sinensis [black tea]
gb|KDO48023.1|  hypothetical protein CISIN_1g031330mg                   162   5e-47   Citrus sinensis [apfelsine]
sp|Q3ZPN4.1|ACMAT_VITLA  RecName: Full=Methanol O-anthraniloyltra...    169   5e-47   Vitis labrusca [Concord grape]
ref|XP_010644575.1|  PREDICTED: methanol O-anthraniloyltransferas...    169   5e-47   
ref|XP_002517500.1|  Taxadien-5-alpha-ol O-acetyltransferase, put...    169   6e-47   Ricinus communis
ref|XP_002265841.1|  PREDICTED: methanol O-anthraniloyltransferase      167   3e-46   Vitis vinifera
ref|XP_010665210.1|  PREDICTED: methanol O-anthraniloyltransferas...    166   5e-46   
ref|XP_008344828.1|  PREDICTED: methanol O-anthraniloyltransferas...    160   5e-46   
ref|XP_011082158.1|  PREDICTED: methanol O-anthraniloyltransferas...    167   5e-46   Sesamum indicum [beniseed]
emb|CAN77583.1|  hypothetical protein VITISV_040970                     167   5e-46   Vitis vinifera
gb|ACF07921.1|  alcohol acyl transferase                                167   6e-46   Prunus armeniaca
ref|XP_002266114.1|  PREDICTED: methanol O-anthraniloyltransferas...    167   6e-46   Vitis vinifera
emb|CAN72252.1|  hypothetical protein VITISV_017467                     166   1e-45   Vitis vinifera
ref|XP_002265049.1|  PREDICTED: methanol O-anthraniloyltransferase      166   1e-45   Vitis vinifera
emb|CAN74729.1|  hypothetical protein VITISV_042062                     165   2e-45   Vitis vinifera
emb|CBI37443.3|  unnamed protein product                                165   4e-45   Vitis vinifera
ref|XP_002270240.1|  PREDICTED: methanol O-anthraniloyltransferase      164   4e-45   Vitis vinifera
gb|KEH17125.1|  benzyl alcohol O-benzoyltransferase                     156   5e-45   Medicago truncatula
ref|XP_009365763.1|  PREDICTED: methanol O-anthraniloyltransferas...    164   8e-45   Pyrus x bretschneideri [bai li]
ref|XP_007209120.1|  hypothetical protein PRUPE_ppa005455mg             164   9e-45   Prunus persica
ref|XP_010665177.1|  PREDICTED: methanol O-anthraniloyltransferas...    162   9e-45   
ref|XP_002266420.1|  PREDICTED: methanol O-anthraniloyltransferase      163   9e-45   Vitis vinifera
ref|XP_007209131.1|  hypothetical protein PRUPE_ppa005625mg             163   1e-44   Prunus persica
ref|XP_002270962.1|  PREDICTED: methanol O-anthraniloyltransferas...    163   1e-44   Vitis vinifera
emb|CAN69948.1|  hypothetical protein VITISV_009219                     163   1e-44   Vitis vinifera
emb|CAN68818.1|  hypothetical protein VITISV_012041                     163   1e-44   Vitis vinifera
ref|XP_006446267.1|  hypothetical protein CICLE_v10015194mg             163   2e-44   
ref|XP_006446264.1|  hypothetical protein CICLE_v10015163mg             163   2e-44   Citrus clementina [clementine]
emb|CBI37442.3|  unnamed protein product                                163   2e-44   Vitis vinifera
ref|XP_002325454.2|  transferase family protein                         162   2e-44   Populus trichocarpa [western balsam poplar]
gb|AJD25145.1|  benzoyl-CoA:benzyl alcohol O-benzoyltransferase         162   2e-44   Populus trichocarpa [western balsam poplar]
ref|XP_011012995.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    162   3e-44   Populus euphratica
ref|XP_006437408.1|  hypothetical protein CICLE_v10031489mg             162   4e-44   Citrus clementina [clementine]
ref|XP_006470748.1|  PREDICTED: anthraniloyl-CoA:methanol acyltra...    162   4e-44   Citrus sinensis [apfelsine]
ref|XP_006484694.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    162   5e-44   Citrus sinensis [apfelsine]
ref|XP_008384757.1|  PREDICTED: methanol O-anthraniloyltransferas...    161   6e-44   
gb|AAR99826.1|  alcohol acyl transferase                                161   9e-44   Malus domestica [apple tree]
ref|XP_006361592.1|  PREDICTED: anthraniloyl-CoA:methanol acyltra...    160   1e-43   Solanum tuberosum [potatoes]
ref|XP_006470571.1|  PREDICTED: anthraniloyl-CoA:methanol acyltra...    160   1e-43   Citrus sinensis [apfelsine]
ref|XP_008238035.1|  PREDICTED: methanol O-anthraniloyltransferas...    160   1e-43   
gb|AAS48090.1|  alcohol acyl transferase                                160   1e-43   Pyrus communis
ref|XP_009365778.1|  PREDICTED: methanol O-anthraniloyltransferas...    160   2e-43   
gb|AGW30205.1|  alcohol acyl transferase                                160   2e-43   Malus domestica [apple tree]
ref|XP_007208844.1|  hypothetical protein PRUPE_ppa025565mg             161   2e-43   
gb|AGW30204.1|  truncated alcohol acyl transferase                      157   3e-43   Malus domestica [apple tree]
ref|XP_009368287.1|  PREDICTED: methanol O-anthraniloyltransferas...    159   3e-43   
ref|XP_011009229.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    159   4e-43   Populus euphratica
gb|AHC32224.2|  alcohol acyl transferase 1                              159   4e-43   Eriobotrya japonica [loquat]
ref|XP_008355599.1|  PREDICTED: methanol O-anthraniloyltransferas...    159   4e-43   
ref|XP_002319767.1|  transferase family protein                         159   4e-43   Populus trichocarpa [western balsam poplar]
ref|XP_002524021.1|  transferase, putative                              155   5e-43   
ref|XP_002319766.1|  hypothetical protein POPTR_0013s07230g             159   6e-43   Populus trichocarpa [western balsam poplar]
gb|ABK96738.1|  unknown                                                 158   9e-43   Populus trichocarpa x Populus deltoides
gb|KJB82262.1|  hypothetical protein B456_013G185500                    158   1e-42   Gossypium raimondii
gb|KHF99421.1|  Benzyl alcohol O-benzoyltransferase                     158   1e-42   Gossypium arboreum [tree cotton]
ref|XP_006470570.1|  PREDICTED: anthraniloyl-CoA:methanol acyltra...    158   1e-42   Citrus sinensis [apfelsine]
emb|CDP11065.1|  unnamed protein product                                150   2e-42   Coffea canephora [robusta coffee]
gb|AAN85436.1|  acyltransferase 2                                       157   2e-42   Capsicum chinense [bonnet pepper]
gb|AJD18611.1|  alcohol acyltransferase                                 157   2e-42   Pyrus ussuriensis [Harbin pear]
gb|KDP39568.1|  hypothetical protein JCGZ_02588                         157   2e-42   Jatropha curcas
gb|AGW30203.1|  alcohol acyl transferase                                157   3e-42   Malus domestica [apple tree]
gb|KDO44966.1|  hypothetical protein CISIN_1g0133462mg                  149   3e-42   Citrus sinensis [apfelsine]
ref|XP_002319765.2|  hypothetical protein POPTR_0013s07220g             157   3e-42   
ref|XP_008797996.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    150   3e-42   
ref|XP_004239236.1|  PREDICTED: methanol O-anthraniloyltransferas...    156   4e-42   Solanum lycopersicum
ref|XP_010689156.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    156   4e-42   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008391402.1|  PREDICTED: methanol O-anthraniloyltransferas...    156   5e-42   Malus domestica [apple tree]
ref|XP_010689157.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    156   6e-42   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006368247.1|  hypothetical protein POPTR_0001s00950g             156   6e-42   
ref|XP_006470747.1|  PREDICTED: anthraniloyl-CoA:methanol acyltra...    156   7e-42   
ref|XP_008373476.1|  PREDICTED: methanol O-anthraniloyltransferas...    156   7e-42   
ref|XP_008368021.1|  PREDICTED: methanol O-anthraniloyltransferas...    155   8e-42   
ref|XP_007029789.1|  Benzoyl coenzyme A: Benzyl alcohol benzoyl t...    155   9e-42   
ref|XP_006351055.1|  PREDICTED: anthraniloyl-CoA:methanol acyltra...    155   9e-42   Solanum tuberosum [potatoes]
ref|NP_001275839.1|  alcohol acyl transferase                           155   1e-41   Citrus sinensis [apfelsine]
gb|KDO54865.1|  hypothetical protein CISIN_1g048162mg                   148   1e-41   Citrus sinensis [apfelsine]
gb|AAS79797.1|  alcohol acyl transferase                                155   1e-41   Malus domestica [apple tree]
ref|XP_010275172.1|  PREDICTED: benzyl alcohol O-benzoyltransferase     155   1e-41   Nelumbo nucifera [Indian lotus]
ref|XP_008232530.1|  PREDICTED: benzyl alcohol O-benzoyltransferase     155   1e-41   Prunus mume [ume]
gb|ACJ85557.1|  unknown                                                 155   2e-41   Medicago truncatula
ref|XP_011018694.1|  PREDICTED: methanol O-anthraniloyltransferas...    155   2e-41   Populus euphratica
ref|XP_004301775.1|  PREDICTED: methanol O-anthraniloyltransferas...    154   2e-41   Fragaria vesca subsp. vesca
gb|AFK36385.1|  unknown                                                 155   2e-41   Medicago truncatula
ref|XP_009336751.1|  PREDICTED: methanol O-anthraniloyltransferas...    154   2e-41   
ref|XP_009336752.1|  PREDICTED: methanol O-anthraniloyltransferas...    154   2e-41   
ref|XP_008362881.1|  PREDICTED: methanol O-anthraniloyltransferas...    154   2e-41   
gb|KDO36030.1|  hypothetical protein CISIN_1g044203mg                   147   3e-41   Citrus sinensis [apfelsine]
gb|AGK82816.1|  alcohol acyltransferase 2                               154   3e-41   Solanum pimpinellifolium [currant tomato]
ref|XP_006446263.1|  hypothetical protein CICLE_v10015199mg             154   4e-41   Citrus clementina [clementine]
gb|KDP39576.1|  hypothetical protein JCGZ_02596                         154   5e-41   Jatropha curcas
gb|AGW30201.1|  alcohol acyl transferase                                154   5e-41   Malus domestica [apple tree]
ref|XP_008343918.1|  PREDICTED: methanol O-anthraniloyltransferas...    153   6e-41   
ref|XP_008364483.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    153   6e-41   
ref|XP_004290447.1|  PREDICTED: benzyl alcohol O-benzoyltransferase     153   7e-41   Fragaria vesca subsp. vesca
ref|XP_006878641.1|  hypothetical protein AMTR_s00011p00264530          145   8e-41   
ref|XP_009374321.1|  PREDICTED: methanol O-anthraniloyltransferas...    153   9e-41   Pyrus x bretschneideri [bai li]
ref|XP_004244681.1|  PREDICTED: methanol O-anthraniloyltransferase      152   9e-41   Solanum lycopersicum
ref|XP_006350348.1|  PREDICTED: anthraniloyl-CoA:methanol acyltra...    153   9e-41   Solanum tuberosum [potatoes]
ref|XP_008779983.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    145   1e-40   
emb|CDP17523.1|  unnamed protein product                                152   1e-40   Coffea canephora [robusta coffee]
ref|XP_009778012.1|  PREDICTED: methanol O-anthraniloyltransferas...    152   1e-40   Nicotiana sylvestris
ref|XP_007029788.1|  Benzoyl coenzyme A: Benzyl alcohol benzoyl t...    152   1e-40   
gb|AAT68601.1|  benzoyl coenzyme A: benzyl alcohol benzoyl transf...    152   1e-40   Petunia x hybrida [garden petunia]
gb|KDP39569.1|  hypothetical protein JCGZ_02589                         150   2e-40   Jatropha curcas
ref|XP_009759678.1|  PREDICTED: methanol O-anthraniloyltransferas...    152   2e-40   Nicotiana sylvestris
ref|XP_009589917.1|  PREDICTED: methanol O-anthraniloyltransferas...    152   2e-40   Nicotiana tomentosiformis
ref|XP_004498041.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    147   3e-40   
dbj|BAE72881.1|  benzoyl CoA benzoic acid benzoyltransferase            152   3e-40   Glandularia x hybrida [garden verbena]
ref|XP_009372579.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    151   3e-40   Pyrus x bretschneideri [bai li]
ref|XP_002524020.1|  transferase, putative                              147   3e-40   
ref|XP_003518844.1|  PREDICTED: benzyl alcohol O-benzoyltransferase     151   3e-40   Glycine max [soybeans]
ref|XP_010110383.1|  Benzyl alcohol O-benzoyltransferase                151   4e-40   Morus notabilis
ref|XP_004305015.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    151   4e-40   Fragaria vesca subsp. vesca
ref|XP_008373467.1|  PREDICTED: methanol O-anthraniloyltransferas...    151   4e-40   
ref|XP_004151707.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    147   4e-40   
ref|XP_003516503.1|  PREDICTED: anthraniloyl-CoA:methanol acyltra...    151   5e-40   Glycine max [soybeans]
ref|XP_006600094.1|  PREDICTED: 13-hydroxylupanine O-tigloyltrans...    143   6e-40   
ref|XP_006368249.1|  hypothetical protein POPTR_0001s00970g             150   7e-40   Populus trichocarpa [western balsam poplar]
emb|CDP11061.1|  unnamed protein product                                150   8e-40   Coffea canephora [robusta coffee]
ref|XP_010933015.1|  PREDICTED: benzyl alcohol O-benzoyltransferase     143   9e-40   Elaeis guineensis
ref|XP_007029790.1|  Benzoyl coenzyme A: Benzyl alcohol benzoyl t...    150   9e-40   
gb|KHN41759.1|  Benzyl alcohol O-benzoyltransferase                     150   1e-39   Glycine soja [wild soybean]
ref|XP_009368754.1|  PREDICTED: methanol O-anthraniloyltransferas...    150   1e-39   Pyrus x bretschneideri [bai li]
ref|XP_009804829.1|  PREDICTED: benzyl alcohol O-benzoyltransferase     149   2e-39   Nicotiana sylvestris
ref|XP_008373466.1|  PREDICTED: methanol O-anthraniloyltransferas...    149   3e-39   
ref|XP_006470749.1|  PREDICTED: anthraniloyl-CoA:methanol acyltra...    149   3e-39   
gb|AIW04708.1|  alcohol acyltransferase 1                               149   3e-39   Solanum pennellii
ref|XP_006470741.1|  PREDICTED: anthraniloyl-CoA:methanol acyltra...    149   3e-39   Citrus sinensis [apfelsine]
ref|XP_008359502.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    149   3e-39   
ref|XP_007029777.1|  Benzoyl coenzyme A: Benzyl alcohol benzoyl t...    148   5e-39   
ref|XP_008238086.1|  PREDICTED: methanol O-anthraniloyltransferas...    149   5e-39   Prunus mume [ume]
ref|XP_010110389.1|  Benzyl alcohol O-benzoyltransferase                148   7e-39   
ref|XP_006446260.1|  hypothetical protein CICLE_v10015249mg             147   7e-39   Citrus clementina [clementine]
gb|KHN31436.1|  Benzyl alcohol O-benzoyltransferase                     147   8e-39   Glycine soja [wild soybean]
ref|XP_004498016.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    147   9e-39   Cicer arietinum [garbanzo]
gb|AIC83790.1|  alcohol acyltransferase                                 147   9e-39   Actinidia deliciosa [Chinese gooseberry]
ref|XP_008462816.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    147   1e-38   
ref|XP_007029780.1|  Benzoyl coenzyme A: Benzyl alcohol benzoyl t...    147   1e-38   
ref|XP_003520833.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    147   1e-38   Glycine max [soybeans]
gb|KHN31434.1|  Benzyl alcohol O-benzoyltransferase                     147   1e-38   Glycine soja [wild soybean]
gb|KJB80921.1|  hypothetical protein B456_013G121500                    143   1e-38   Gossypium raimondii
ref|XP_004294711.1|  PREDICTED: methanol O-anthraniloyltransferas...    147   1e-38   Fragaria vesca subsp. vesca
ref|XP_004151058.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    147   2e-38   Cucumis sativus [cucumbers]
ref|XP_006470742.1|  PREDICTED: anthraniloyl-CoA:methanol acyltra...    147   2e-38   Citrus sinensis [apfelsine]
ref|XP_011046335.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    147   2e-38   Populus euphratica
gb|KEH40976.1|  benzyl alcohol O-benzoyltransferase                     146   2e-38   Medicago truncatula
ref|XP_003521737.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    147   2e-38   Glycine max [soybeans]
ref|XP_006446261.1|  hypothetical protein CICLE_v10015234mg             146   2e-38   Citrus clementina [clementine]
ref|XP_009374085.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    146   2e-38   Pyrus x bretschneideri [bai li]
ref|XP_007147133.1|  hypothetical protein PHAVU_006G098500g             146   2e-38   Phaseolus vulgaris [French bean]
ref|XP_010058385.1|  PREDICTED: methanol O-anthraniloyltransferas...    145   2e-38   
ref|XP_007029781.1|  Benzoyl coenzyme A: Benzyl alcohol benzoyl t...    147   3e-38   
gb|KEH40971.1|  benzyl alcohol O-benzoyltransferase                     146   3e-38   Medicago truncatula
ref|XP_011098396.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    146   3e-38   Sesamum indicum [beniseed]
dbj|BAF49304.1|  putative acyltransferase                               146   3e-38   Clitoria ternatea
ref|XP_007029787.1|  Benzoyl coenzyme A: Benzyl alcohol benzoyl t...    146   3e-38   
ref|XP_007211147.1|  hypothetical protein PRUPE_ppa026958mg             139   3e-38   
emb|CAA64636.1|  hsr201                                                 146   3e-38   Nicotiana tabacum [American tobacco]
ref|XP_010689158.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    145   3e-38   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007029786.1|  Benzoyl coenzyme A: Benzyl alcohol benzoyl t...    146   4e-38   
gb|EYU41395.1|  hypothetical protein MIMGU_mgv1a006288mg                145   4e-38   Erythranthe guttata [common monkey flower]
gb|AES82602.2|  benzyl alcohol O-benzoyltransferase                     139   4e-38   Medicago truncatula
ref|XP_009803456.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    145   4e-38   Nicotiana sylvestris
gb|AAW51125.1|  putative alcohol acyl-transferases                      145   4e-38   Cucumis melo [Oriental melon]
ref|XP_003536235.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    145   5e-38   Glycine max [soybeans]
ref|XP_007029776.1|  Benzoyl coenzyme A: Benzyl alcohol benzoyl t...    146   5e-38   
ref|XP_008462818.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    145   5e-38   Cucumis melo [Oriental melon]
ref|XP_008356442.1|  PREDICTED: methanol O-anthraniloyltransferas...    145   6e-38   
ref|NP_001152518.1|  10-deacetylbaccatin III 10-O-acetyltransferase     145   6e-38   Zea mays [maize]
ref|XP_011085897.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    144   1e-37   Sesamum indicum [beniseed]
dbj|BAJ92444.1|  predicted protein                                      145   1e-37   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009365780.1|  PREDICTED: methanol O-anthraniloyltransferas...    144   1e-37   Pyrus x bretschneideri [bai li]
ref|XP_011046333.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    144   1e-37   Populus euphratica
gb|KEH40977.1|  benzyl alcohol O-benzoyltransferase                     144   1e-37   Medicago truncatula
ref|XP_006370913.1|  hypothetical protein POPTR_0019s01680g             144   1e-37   Populus trichocarpa [western balsam poplar]
gb|KJB82514.1|  hypothetical protein B456_013G200000                    144   1e-37   Gossypium raimondii
ref|XP_003626384.1|  Benzoyl coenzyme A benzyl alcohol benzoyl tr...    138   1e-37   
ref|XP_002466979.1|  hypothetical protein SORBIDRAFT_01g017800          144   2e-37   Sorghum bicolor [broomcorn]
ref|XP_009619718.1|  PREDICTED: benzyl alcohol O-benzoyltransferase     144   2e-37   Nicotiana tomentosiformis
ref|XP_006588255.1|  PREDICTED: 13-hydroxylupanine O-tigloyltrans...    141   2e-37   
ref|XP_009612038.1|  PREDICTED: methanol O-anthraniloyltransferas...    137   2e-37   
ref|XP_011085895.1|  PREDICTED: LOW QUALITY PROTEIN: benzyl alcoh...    144   2e-37   
sp|Q8GT20.1|BEBT_TOBAC  RecName: Full=Benzyl alcohol O-benzoyltra...    144   2e-37   Nicotiana tabacum [American tobacco]
ref|XP_006878638.1|  hypothetical protein AMTR_s00011p00264170          144   3e-37   
ref|XP_006370914.1|  hypothetical protein POPTR_0019s01690g             143   3e-37   Populus trichocarpa [western balsam poplar]
ref|XP_009612037.1|  PREDICTED: methanol O-anthraniloyltransferas...    136   4e-37   
gb|KJB80923.1|  hypothetical protein B456_013G121600                    143   4e-37   Gossypium raimondii
gb|EYU41388.1|  hypothetical protein MIMGU_mgv1a021683mg                142   4e-37   Erythranthe guttata [common monkey flower]
tpg|DAA49395.1|  TPA: 10-deacetylbaccatin III 10-O-acetyltransferase    143   4e-37   
ref|XP_011085899.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    143   5e-37   Sesamum indicum [beniseed]
gb|KEH40969.1|  benzyl alcohol O-benzoyltransferase                     142   5e-37   Medicago truncatula
gb|AFK34995.1|  unknown                                                 136   6e-37   Lotus japonicus
gb|AFK34239.1|  unknown                                                 142   8e-37   Medicago truncatula
ref|XP_003549135.1|  PREDICTED: 13-hydroxylupanine O-tigloyltrans...    142   1e-36   Glycine max [soybeans]
ref|XP_009803458.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    135   1e-36   Nicotiana sylvestris
emb|CDP22130.1|  unnamed protein product                                135   1e-36   Coffea canephora [robusta coffee]
gb|KCW72711.1|  hypothetical protein EUGRSUZ_E01163                     142   1e-36   Eucalyptus grandis [rose gum]
ref|XP_006290240.1|  hypothetical protein CARUB_v100037960mg            134   1e-36   
ref|XP_003626383.1|  Benzoyl coenzyme A benzyl alcohol benzoyl tr...    142   1e-36   
ref|XP_007147135.1|  hypothetical protein PHAVU_006G098700g             141   1e-36   Phaseolus vulgaris [French bean]
ref|XP_004151857.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    141   1e-36   Cucumis sativus [cucumbers]
ref|XP_004156760.1|  PREDICTED: LOW QUALITY PROTEIN: benzyl alcoh...    141   1e-36   
gb|AES82601.2|  benzyl alcohol O-benzoyltransferase                     142   1e-36   Medicago truncatula
ref|XP_010058392.1|  PREDICTED: methanol O-anthraniloyltransferas...    142   2e-36   
ref|XP_006878640.1|  hypothetical protein AMTR_s00011p00264480          134   2e-36   
gb|KDP39567.1|  hypothetical protein JCGZ_02587                         141   2e-36   Jatropha curcas
ref|XP_002264599.1|  PREDICTED: benzyl alcohol O-benzoyltransferase     141   2e-36   Vitis vinifera
ref|XP_004982683.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    141   2e-36   Setaria italica
gb|ABX57719.1|  acyltransferase                                         140   3e-36   Vanda hybrid cultivar
ref|XP_004243495.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    140   3e-36   Solanum lycopersicum
gb|KJB82515.1|  hypothetical protein B456_013G200100                    140   4e-36   Gossypium raimondii
gb|KJB82264.1|  hypothetical protein B456_013G185700                    140   4e-36   Gossypium raimondii
ref|NP_001234496.1|  alcohol acyl transferase                           140   5e-36   Solanum lycopersicum
gb|KJB78759.1|  hypothetical protein B456_013G017100                    139   5e-36   Gossypium raimondii
ref|XP_004243496.2|  PREDICTED: benzyl alcohol O-benzoyltransferase     140   5e-36   Solanum lycopersicum
ref|XP_010058390.1|  PREDICTED: methanol O-anthraniloyltransferas...    140   6e-36   Eucalyptus grandis [rose gum]
ref|XP_003521736.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    139   8e-36   Glycine max [soybeans]
ref|XP_009388282.1|  PREDICTED: benzyl alcohol O-benzoyltransferase     139   8e-36   Musa acuminata subsp. malaccensis [pisang utan]
sp|Q5H873.1|HLTT_LUPAL  RecName: Full=13-hydroxylupanine O-tigloy...    139   9e-36   Lupinus albus
ref|XP_007147136.1|  hypothetical protein PHAVU_006G098800g             139   1e-35   Phaseolus vulgaris [French bean]
ref|XP_003574156.1|  PREDICTED: benzyl alcohol O-benzoyltransferase     139   1e-35   Brachypodium distachyon [annual false brome]
ref|XP_007147132.1|  hypothetical protein PHAVU_006G098400g             139   1e-35   Phaseolus vulgaris [French bean]
gb|KJB82513.1|  hypothetical protein B456_013G199900                    138   2e-35   Gossypium raimondii
gb|KJB44358.1|  hypothetical protein B456_007G247700                    138   2e-35   Gossypium raimondii
ref|XP_007145940.1|  hypothetical protein PHAVU_007G280800g             138   2e-35   Phaseolus vulgaris [French bean]
ref|NP_001064997.1|  Os10g0503300                                       138   2e-35   
ref|XP_002298962.2|  hypothetical protein POPTR_0001s45210g             138   2e-35   
gb|AAG13627.1|AC078840_18  putative hypersensitivity-related (hsr...    139   2e-35   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007147134.1|  hypothetical protein PHAVU_006G098600g             138   2e-35   Phaseolus vulgaris [French bean]
gb|EYU41397.1|  hypothetical protein MIMGU_mgv1a024853mg                137   3e-35   Erythranthe guttata [common monkey flower]
ref|NP_197256.1|  HXXXD-type acyl-transferase family protein            138   3e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010058386.1|  PREDICTED: methanol O-anthraniloyltransferas...    138   3e-35   Eucalyptus grandis [rose gum]
gb|EYU34530.1|  hypothetical protein MIMGU_mgv1a006233mg                137   3e-35   Erythranthe guttata [common monkey flower]
ref|XP_009131598.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferase      138   3e-35   Brassica rapa
gb|KCW72709.1|  hypothetical protein EUGRSUZ_E01161                     137   4e-35   Eucalyptus grandis [rose gum]
ref|XP_010667734.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    134   4e-35   Beta vulgaris subsp. vulgaris [field beet]
gb|KFK25971.1|  hypothetical protein AALP_AA8G186800                    137   6e-35   Arabis alpina [alpine rockcress]
gb|ABN48480.1|  quinolizidine alkaloid O-tigloyltransferase             137   7e-35   Lupinus albus
ref|XP_010668237.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    131   7e-35   
emb|CDP09539.1|  unnamed protein product                                136   7e-35   Coffea canephora [robusta coffee]
gb|ACT82248.1|  alcohol acyltransferase                                 136   9e-35   Vasconcellea cundinamarcensis
ref|XP_010918388.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    130   1e-34   Elaeis guineensis
ref|XP_003554685.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    135   2e-34   Glycine max [soybeans]
ref|XP_010492711.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...    135   2e-34   Camelina sativa [gold-of-pleasure]
emb|CDX78752.1|  BnaA03g06640D                                          135   2e-34   
ref|XP_002524018.1|  3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransf...    135   2e-34   Ricinus communis
ref|XP_004506306.1|  PREDICTED: 13-hydroxylupanine O-tigloyltrans...    135   2e-34   Cicer arietinum [garbanzo]
ref|XP_004986631.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    135   2e-34   Setaria italica
gb|EYU41386.1|  hypothetical protein MIMGU_mgv1a006089mg                135   3e-34   Erythranthe guttata [common monkey flower]
ref|XP_008678444.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    135   3e-34   Zea mays [maize]
gb|EYU41396.1|  hypothetical protein MIMGU_mgv1a005907mg                135   3e-34   Erythranthe guttata [common monkey flower]
ref|XP_010420481.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...    135   3e-34   Camelina sativa [gold-of-pleasure]
gb|KCW72712.1|  hypothetical protein EUGRSUZ_E01165                     134   3e-34   Eucalyptus grandis [rose gum]
gb|KFK38057.1|  hypothetical protein AALP_AA3G064500                    136   4e-34   Arabis alpina [alpine rockcress]
ref|XP_010453955.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...    135   4e-34   Camelina sativa [gold-of-pleasure]
ref|XP_003536109.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    135   4e-34   Glycine max [soybeans]
gb|EYU41389.1|  hypothetical protein MIMGU_mgv1a006154mg                134   4e-34   Erythranthe guttata [common monkey flower]
ref|XP_004986643.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    134   4e-34   Setaria italica
gb|KFK38056.1|  hypothetical protein AALP_AA3G064500                    136   4e-34   Arabis alpina [alpine rockcress]
gb|KJB44361.1|  hypothetical protein B456_007G247900                    134   4e-34   Gossypium raimondii
ref|XP_003626388.1|  Benzoyl coenzyme A benzyl alcohol benzoyl tr...    134   5e-34   Medicago truncatula
ref|XP_003616154.1|  Benzoyl coenzyme A benzyl alcohol benzoyl tr...    134   5e-34   Medicago truncatula
ref|XP_009386561.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    134   7e-34   Musa acuminata subsp. malaccensis [pisang utan]
gb|AES82607.2|  benzyl alcohol O-benzoyltransferase                     134   8e-34   Medicago truncatula
ref|XP_003627912.1|  Taxadien-5-alpha-ol O-acetyltransferase            127   9e-34   Medicago truncatula
gb|KCW72714.1|  hypothetical protein EUGRSUZ_E01167                     134   1e-33   Eucalyptus grandis [rose gum]
ref|XP_006370717.1|  hypothetical protein POPTR_0001s45150g             132   1e-33   
ref|XP_006289628.1|  hypothetical protein CARUB_v10003180mg             133   1e-33   Capsella rubella
ref|XP_010672751.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    133   1e-33   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003626389.1|  Benzoyl coenzyme A benzyl alcohol benzoyl tr...    134   2e-33   
ref|XP_010058393.1|  PREDICTED: methanol O-anthraniloyltransferas...    134   2e-33   
ref|XP_006400294.1|  hypothetical protein EUTSA_v10013454mg             133   2e-33   Eutrema salsugineum [saltwater cress]
emb|CDP21409.1|  unnamed protein product                                133   2e-33   Coffea canephora [robusta coffee]
ref|XP_010058394.1|  PREDICTED: methanol O-anthraniloyltransferas...    133   2e-33   
ref|XP_010453953.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...    132   3e-33   
ref|NP_001266678.1|  10-deacetylbaccatin III 10-O-acetyltransferase     132   3e-33   
ref|XP_010420482.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...    132   4e-33   
ref|XP_003626386.1|  Alcohol acetyltransferase                          132   4e-33   
ref|XP_002300497.2|  hypothetical protein POPTR_0001s45180g             132   4e-33   
gb|KEH33832.1|  benzyl alcohol O-benzoyltransferase                     126   5e-33   
ref|XP_003626382.1|  Benzoyl coenzyme A benzyl alcohol benzoyl tr...    131   6e-33   
sp|Q8GT21.1|BEBT_CLABR  RecName: Full=Benzyl alcohol O-benzoyltra...    131   6e-33   
ref|XP_004156787.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    126   6e-33   
gb|KFK25975.1|  hypothetical protein AALP_AA8G187200                    131   7e-33   
ref|XP_010040517.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    131   7e-33   
ref|XP_010557036.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...    131   8e-33   
ref|XP_002298956.2|  hypothetical protein POPTR_0001s45160g             131   8e-33   
ref|XP_010040516.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    131   9e-33   
ref|XP_011041078.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    130   1e-32   
ref|XP_011041077.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    130   1e-32   
ref|XP_011016392.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    124   2e-32   
emb|CDY43120.1|  BnaA05g32660D                                          130   2e-32   
gb|AGW30202.1|  alcohol acyl transferase                                130   2e-32   
ref|XP_009130369.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...    130   2e-32   
ref|XP_007147137.1|  hypothetical protein PHAVU_006G098900g             130   2e-32   
emb|CDY50708.1|  BnaC05g47750D                                          130   2e-32   
emb|CDY50709.1|  BnaC05g47740D                                          130   2e-32   
ref|XP_010042878.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    123   4e-32   
emb|CDP18599.1|  unnamed protein product                                129   5e-32   
ref|XP_004494963.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    129   5e-32   
gb|KFK38055.1|  hypothetical protein AALP_AA3G064400                    129   6e-32   
gb|KJB80922.1|  hypothetical protein B456_013G121500                    126   9e-32   
gb|ABR16595.1|  unknown                                                 128   9e-32   
gb|ABR16407.1|  unknown                                                 128   1e-31   
ref|XP_010550256.1|  PREDICTED: LOW QUALITY PROTEIN: (Z)-3-hexen-...    127   1e-31   
ref|XP_006376283.1|  hypothetical protein POPTR_0013s11650g             127   2e-31   
ref|XP_011085894.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    127   2e-31   
gb|AAM61186.1|  putative hypersensitivity-related gene                  127   2e-31   
ref|XP_010667725.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    127   2e-31   
ref|NP_186998.1|  acetyl CoA:(Z)-3-hexen-1-ol acetyltransferase         127   2e-31   
ref|XP_010492712.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...    127   3e-31   
ref|XP_010038484.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    127   3e-31   
ref|XP_010557044.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...    127   3e-31   
ref|XP_010558859.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...    126   3e-31   
ref|XP_009130368.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...    126   4e-31   
ref|XP_010558858.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...    126   4e-31   
gb|KCW84614.1|  hypothetical protein EUGRSUZ_B01445                     125   4e-31   
ref|XP_010557037.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...    126   5e-31   
ref|XP_010045974.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    125   5e-31   
ref|XP_010058391.1|  PREDICTED: methanol O-anthraniloyltransferas...    126   6e-31   
ref|XP_010941427.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    125   6e-31   
ref|XP_003591040.1|  Benzoyl coenzyme A benzyl alcohol benzoyl tr...    125   7e-31   
gb|AFK49108.1|  unknown                                                 125   8e-31   
gb|EMT25788.1|  10-deacetylbaccatin III 10-O-acetyltransferase          120   9e-31   
ref|XP_010941428.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    125   1e-30   
ref|XP_010489657.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...    125   1e-30   
ref|XP_010521555.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...    124   2e-30   
ref|XP_004966402.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    124   2e-30   
ref|NP_001284403.1|  benzyl alcohol O-benzoyltransferase-like           124   2e-30   
gb|AAL77060.1|AF468022_1  putative acyltransferase                      124   2e-30   
ref|XP_002884383.1|  chat-3-HEXEN-1-OL ACETYLTRANSFERASE                124   3e-30   
ref|XP_004151858.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    124   3e-30   
gb|EMT21731.1|  Taxadien-5-alpha-ol O-acetyltransferase                 120   3e-30   
ref|XP_011040637.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    124   3e-30   
gb|EMS58180.1|  Omega-hydroxypalmitate O-feruloyl transferase           118   4e-30   
ref|XP_004156786.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    124   4e-30   
ref|XP_004151856.1|  PREDICTED: LOW QUALITY PROTEIN: benzyl alcoh...    123   5e-30   
ref|XP_002438993.1|  hypothetical protein SORBIDRAFT_10g029610          122   8e-30   
ref|XP_004156759.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    122   8e-30   
ref|XP_002437572.1|  hypothetical protein SORBIDRAFT_10g029590          122   1e-29   
ref|XP_003563544.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    122   2e-29   
gb|KGN63331.1|  hypothetical protein Csa_2G429040                       121   2e-29   
dbj|BAK02525.1|  predicted protein                                      121   2e-29   
ref|XP_002437575.1|  hypothetical protein SORBIDRAFT_10g029620          121   3e-29   
ref|XP_010676997.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    116   3e-29   
gb|EAZ02323.1|  hypothetical protein OsI_24425                          121   3e-29   
ref|NP_001058545.2|  Os06g0710700                                       121   3e-29   
ref|XP_008779984.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    121   3e-29   
ref|XP_006377894.1|  hypothetical protein POPTR_0011s15660g             120   4e-29   
ref|XP_008645066.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    120   5e-29   
gb|EMT26852.1|  10-deacetylbaccatin III 10-O-acetyltransferase          117   5e-29   
emb|CBI29212.3|  unnamed protein product                                120   6e-29   
gb|EPS60076.1|  hypothetical protein M569_14728                         115   7e-29   
ref|XP_010450554.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferase      120   8e-29   
gb|AEM43830.1|  alcohol acyl transferase                                119   1e-28   
ref|XP_008462820.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    119   1e-28   
ref|XP_008462821.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    119   1e-28   
dbj|BAB78588.1|  alcohol acetyltransferase                              119   1e-28   
emb|CAA94432.1|  unknown                                                119   1e-28   
ref|XP_010550257.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...    119   2e-28   
gb|EMT16226.1|  10-deacetylbaccatin III 10-O-acetyltransferase          117   2e-28   
gb|KJB82260.1|  hypothetical protein B456_013G185300                    118   3e-28   
gb|EMT25787.1|  10-deacetylbaccatin III 10-O-acetyltransferase          117   3e-28   
ref|XP_004966401.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    118   4e-28   
ref|XP_004960441.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    117   6e-28   
ref|XP_010527080.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...    117   7e-28   
ref|XP_010549748.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...    117   7e-28   
ref|XP_002464781.1|  hypothetical protein SORBIDRAFT_01g026670          117   8e-28   
gb|KDO39324.1|  hypothetical protein CISIN_1g045235mg                   111   9e-28   
ref|NP_001148798.1|  transferase family protein                         116   1e-27   
ref|XP_004983290.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    116   2e-27   
ref|XP_008662941.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    116   2e-27   
gb|KCW72708.1|  hypothetical protein EUGRSUZ_E01160                     109   2e-27   
ref|XP_002873835.1|  transferase family protein                         115   3e-27   
ref|XP_006657332.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    115   4e-27   
dbj|BAC58010.1|  alcohol acyltransferase                                115   4e-27   
gb|KDP43343.1|  hypothetical protein JCGZ_25448                         108   5e-27   
ref|XP_002447250.1|  hypothetical protein SORBIDRAFT_06g031260          114   6e-27   
ref|XP_003581404.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    114   7e-27   
gb|KEH40970.1|  benzyl alcohol O-benzoyltransferase                     113   1e-26   
ref|XP_003575185.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    113   2e-26   
ref|XP_004983425.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    113   2e-26   
gb|KHN31437.1|  Benzyl alcohol O-benzoyltransferase                     107   2e-26   
gb|EAY77931.1|  hypothetical protein OsI_32972                          109   2e-26   
ref|XP_002298960.2|  hypothetical protein POPTR_0001s45190g             112   3e-26   
ref|XP_006577743.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    107   3e-26   
ref|XP_006653585.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    111   4e-26   
ref|XP_002524013.1|  hypothetical protein RCOM_1516910                  108   4e-26   
ref|XP_006446721.1|  hypothetical protein CICLE_v10017956mg             111   5e-26   
ref|XP_006297655.1|  hypothetical protein CARUB_v10013677mg             112   5e-26   
ref|NP_001064288.1|  Os10g0195600                                       112   6e-26   
gb|EAY77933.1|  hypothetical protein OsI_32974                          112   6e-26   
ref|XP_010231737.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    112   6e-26   
ref|XP_008670946.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    111   7e-26   
ref|NP_001148135.1|  taxadien-5-alpha-ol O-acetyltransferase            111   7e-26   
gb|ACR36326.1|  unknown                                                 111   7e-26   
gb|KDP39574.1|  hypothetical protein JCGZ_02594                         109   1e-25   
ref|XP_006657584.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    110   2e-25   
dbj|BAJ88238.1|  predicted protein                                      110   2e-25   
gb|EEE61303.1|  hypothetical protein OsJ_15395                          109   3e-25   
gb|EAY94788.1|  hypothetical protein OsI_16567                          108   4e-25   
ref|XP_006654215.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    109   4e-25   
ref|XP_010108950.1|  Benzyl alcohol O-benzoyltransferase                103   5e-25   
ref|XP_011009230.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    108   5e-25   
emb|CAE04720.1|  OSJNBa0043L24.8                                        108   6e-25   
ref|XP_003573843.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    109   6e-25   
ref|NP_001059277.1|  Os07g0244200                                       108   6e-25   
gb|EAY80579.1|  hypothetical protein OsI_35761                          108   1e-24   
emb|CAH67336.1|  OSIGBa0157A06.5                                        108   1e-24   
gb|EEE62389.1|  hypothetical protein OsJ_17179                          107   1e-24   
gb|AAS55785.1|  putative benzyl alcohol benzoyl transferase             107   2e-24   
ref|XP_002440560.1|  hypothetical protein SORBIDRAFT_09g003170          107   2e-24   
ref|XP_003576099.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    107   3e-24   
ref|XP_006661593.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    107   3e-24   
ref|XP_008677983.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    107   3e-24   
gb|EMS47942.1|  Omega-hydroxypalmitate O-feruloyl transferase           106   6e-24   
gb|EEE62279.1|  hypothetical protein OsJ_17067                          106   6e-24   
gb|EAY96502.1|  hypothetical protein OsI_18404                          106   7e-24   
ref|NP_001054603.1|  Os05g0141300                                       106   7e-24   
ref|XP_008660766.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    106   7e-24   
gb|EMT07805.1|  10-deacetylbaccatin III 10-O-acetyltransferase          105   8e-24   
gb|EAZ04276.1|  hypothetical protein OsI_26418                          105   9e-24   
gb|EEE63219.1|  hypothetical protein OsJ_18029                          105   1e-23   
gb|EMT07181.1|  Taxadien-5-alpha-ol O-acetyltransferase                 105   1e-23   
gb|EPS68008.1|  hypothetical protein M569_06766                         105   2e-23   
ref|XP_006664808.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    105   2e-23   
ref|XP_007147131.1|  hypothetical protein PHAVU_006G098300g             103   2e-23   
gb|AAV32163.1|  hypothetical protein                                    105   2e-23   
dbj|BAJ96970.1|  predicted protein                                      104   4e-23   
ref|XP_008660975.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    104   4e-23   
ref|XP_002438731.1|  hypothetical protein SORBIDRAFT_10g025140          104   5e-23   
gb|EMS57580.1|  Taxadien-5-alpha-ol O-acetyltransferase               99.4    6e-23   
gb|EEC75861.1|  hypothetical protein OsI_12874                          103   6e-23   
gb|AAS07101.1|  putative hypersensitivity-related protein               103   6e-23   
gb|EMT01643.1|  10-deacetylbaccatin III 10-O-acetyltransferase          104   7e-23   
gb|EEE51952.1|  hypothetical protein OsJ_33591                          103   7e-23   
gb|EAY73940.1|  hypothetical protein OsI_01825                          102   1e-22   
emb|CBI29213.3|  unnamed protein product                              99.0    1e-22   
ref|XP_011007950.1|  PREDICTED: LOW QUALITY PROTEIN: methanol O-a...    101   1e-22   
ref|XP_004983468.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    102   1e-22   
ref|XP_004983467.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    102   2e-22   
gb|KHN43217.1|  Benzyl alcohol O-benzoyltransferase                     101   3e-22   
ref|XP_003576147.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    100   5e-22   
ref|XP_008660976.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    101   5e-22   
ref|XP_006664809.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    100   5e-22   
ref|NP_001042981.1|  Os01g0350000                                       100   6e-22   
ref|XP_002464789.1|  hypothetical protein SORBIDRAFT_01g026760          100   7e-22   
ref|XP_008659223.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    100   8e-22   
tpg|DAA46610.1|  TPA: hypothetical protein ZEAMMB73_163572              100   9e-22   
gb|AAG12478.2|AC037197_3  Putative hsr201 hypersensitivity-relate...  99.4    9e-22   
gb|KGN63336.1|  hypothetical protein Csa_2G430570                       100   9e-22   
gb|EEE63107.1|  hypothetical protein OsJ_17915                          100   1e-21   
gb|AAT01406.1|  hypothetical protein                                    100   1e-21   
ref|XP_006657816.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  99.8    2e-21   
gb|AAP51790.2|  Transferase family protein                            99.4    2e-21   
emb|CDM80509.1|  unnamed protein product                              99.0    3e-21   
gb|EAY77467.1|  hypothetical protein OsI_32511                        99.4    3e-21   
emb|CDY43121.1|  BnaA05g32650D                                        98.2    4e-21   
gb|KHN04051.1|  Benzyl alcohol O-benzoyltransferase                   98.2    4e-21   
ref|XP_006661592.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  98.6    4e-21   
ref|NP_001059940.1|  Os07g0550600                                     98.2    5e-21   
ref|XP_003577635.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  98.6    5e-21   
ref|XP_004951311.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  98.2    5e-21   
gb|EEE50698.1|  hypothetical protein OsJ_30968                        98.2    5e-21   
ref|XP_006388974.1|  hypothetical protein POPTR_0065s002302g          92.8    6e-21   
gb|EMT02923.1|  Taxadien-5-alpha-ol O-acetyltransferase               94.0    8e-21   
ref|XP_002440561.1|  hypothetical protein SORBIDRAFT_09g003180        98.2    1e-20   
ref|XP_002524024.1|  3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransf...  96.3    2e-20   
ref|XP_008348656.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  96.3    3e-20   
gb|AAX96461.1|  Transferase family                                    95.1    3e-20   
ref|XP_007029784.1|  Quinolizidine alkaloid O-tigloyltransferase      92.0    3e-20   
ref|XP_002464832.1|  hypothetical protein SORBIDRAFT_01g027380        95.9    4e-20   
ref|XP_002461609.1|  hypothetical protein SORBIDRAFT_02g005330        95.5    6e-20   
gb|EPS62909.1|  hypothetical protein M569_11881                       94.4    1e-19   
ref|XP_006658432.1|  PREDICTED: uncharacterized protein LOC102714479  94.7    2e-19   
ref|XP_006446265.1|  hypothetical protein CICLE_v10017548mg           90.1    2e-19   
dbj|BAC65990.1|  putative benzoyl coenzyme A                          93.6    3e-19   
gb|EAZ20412.1|  hypothetical protein OsJ_36019                        93.2    5e-19   
gb|ABA98390.1|  Transferase family protein                            91.7    5e-19   
gb|ABA98392.1|  Transferase family protein                            93.2    8e-19   
ref|XP_007217533.1|  hypothetical protein PRUPE_ppa023329mg           92.0    1e-18   
ref|XP_007029779.1|  Benzoyl coenzyme A: Benzyl alcohol benzoyl t...  90.1    1e-18   
ref|XP_009371837.1|  PREDICTED: benzyl alcohol O-benzoyltransferase   91.7    1e-18   
ref|XP_008229244.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferase    88.2    1e-18   
gb|EMT31153.1|  2-alpha-hydroxytaxane 2-O-benzoyltransferase          91.3    2e-18   
ref|NP_001066733.1|  Os12g0458100                                     90.9    2e-18   
ref|XP_004983466.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  90.5    4e-18   
gb|EMS57280.1|  Omega-hydroxypalmitate O-feruloyl transferase         89.7    6e-18   
ref|XP_010436740.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...  88.6    1e-17   
ref|XP_002272487.1|  PREDICTED: benzyl alcohol O-benzoyltransferase   89.4    1e-17   
emb|CAN74177.1|  hypothetical protein VITISV_029256                   89.4    1e-17   
ref|XP_007038058.1|  HXXXD-type acyl-transferase family protein i...  89.0    1e-17   
gb|EAY77618.1|  hypothetical protein OsI_32660                        89.4    1e-17   
ref|XP_004171600.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  85.1    1e-17   



>ref|XP_011007948.1| PREDICTED: methanol O-anthraniloyltransferase-like [Populus euphratica]
Length=468

 Score =   175 bits (444),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 74/127 (58%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            +KPTP E K+LSDIDDQ+GLRFHF  +MFYR++P +K +DPV+ I++A+ KALV+YYP A
Sbjct  38   SKPTPHEIKQLSDIDDQQGLRFHFPFVMFYRSHPSLKREDPVKVIKEALGKALVFYYPFA  97

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GR+I+GP  K +VDC+ +GI FVEAD+ ++++ LGD++ PP  Y +EFL++VPGS  ILG
Sbjct  98   GRIIEGPRSKLLVDCTGEGILFVEADADVTIDQLGDSIHPPFSYIEEFLHDVPGSSGILG  157

Query  471  CPLMIVQ  491
            CPL+++Q
Sbjct  158  CPLLLIQ  164



>ref|XP_002304071.1| hypothetical protein POPTR_0003s01420g [Populus trichocarpa]
 gb|EEE79050.1| hypothetical protein POPTR_0003s01420g [Populus trichocarpa]
Length=454

 Score =   175 bits (443),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 74/127 (58%), Positives = 104/127 (82%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            +KPTP E K+LSDIDDQ+GLRFH   +MFYR++P MK +DPV+ I++A+ KALV+YYP A
Sbjct  24   SKPTPHEIKQLSDIDDQQGLRFHLPFVMFYRSHPSMKREDPVKVIKEALGKALVFYYPFA  83

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GR+I+GP  K +VDC+ +GI FVEAD+ ++++ LGD++ PP  Y +EFL++VPGS  ILG
Sbjct  84   GRIIEGPRSKLLVDCTGEGILFVEADAGVTIDQLGDSIHPPFSYIEEFLHDVPGSSGILG  143

Query  471  CPLMIVQ  491
            CPL+++Q
Sbjct  144  CPLLLIQ  150



>emb|CBI25251.3| unnamed protein product [Vitis vinifera]
Length=443

 Score =   172 bits (435),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 101/127 (80%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            A PTP+E K+LSDIDDQ+GLRF   +IMFYR NPLM  KDPV+ IR+A+ KAL++YYP A
Sbjct  23   ANPTPREVKQLSDIDDQEGLRFQIPVIMFYRNNPLMDGKDPVKVIREALGKALIYYYPFA  82

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRLI+G   K MVDC+ +G+ F+EAD+  +LE+LGDA++P C   +E LY+VPGS +ILG
Sbjct  83   GRLIEGDNRKLMVDCTGEGVLFIEADADTTLENLGDAIQPMCPCFEELLYDVPGSTRILG  142

Query  471  CPLMIVQ  491
             PL+++Q
Sbjct  143  SPLILIQ  149



>emb|CBI37444.3| unnamed protein product [Vitis vinifera]
Length=222

 Score =   166 bits (420),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 99/127 (78%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
              PTP+E K+LSDIDDQ+GLRF   +IMFY  NPLMK KDPV+ IR+A+ KALV+YYP A
Sbjct  23   TNPTPREVKQLSDIDDQEGLRFQVPVIMFYPNNPLMKGKDPVKVIREALGKALVYYYPFA  82

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRLI+G   K MVDC+ +G+ F+EAD+  +LE+LGDA++P C   +E LY+VPGS  ILG
Sbjct  83   GRLIEGHNRKLMVDCTGEGVLFIEADADSTLENLGDAIQPMCPCFEELLYDVPGSGGILG  142

Query  471  CPLMIVQ  491
             PL+++Q
Sbjct  143  SPLILIQ  149



>ref|XP_002271603.1| PREDICTED: methanol O-anthraniloyltransferase [Vitis vinifera]
Length=449

 Score =   171 bits (434),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 101/127 (80%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            A PTP+E K+LSDIDDQ+GLRF   +IMFYR NPLM  KDPV+ IR+A+ KAL++YYP A
Sbjct  23   ANPTPREVKQLSDIDDQEGLRFQIPVIMFYRNNPLMDGKDPVKVIREALGKALIYYYPFA  82

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRLI+G   K MVDC+ +G+ F+EAD+  +LE+LGDA++P C   +E LY+VPGS +ILG
Sbjct  83   GRLIEGDNRKLMVDCTGEGVLFIEADADTTLENLGDAIQPMCPCFEELLYDVPGSTRILG  142

Query  471  CPLMIVQ  491
             PL+++Q
Sbjct  143  SPLILIQ  149



>gb|KDO36005.1| hypothetical protein CISIN_1g041298mg [Citrus sinensis]
Length=157

 Score =   163 bits (412),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 100/132 (76%), Gaps = 5/132 (4%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRAN-----PLMKAKDPVEAIRDAVAKALVW  275
            A+PTP+E K+LSDIDDQ+  RFH  +I  Y+ N     P++K KDPV+ I++A+++ALV+
Sbjct  22   ARPTPRELKQLSDIDDQESFRFHIPVIFLYKNNSASSPPVLKEKDPVKVIKEAISEALVY  81

Query  276  YYPLAGRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGS  455
            YYP AGRLI+GP  K MVDC+ +GI F+EA+++  LE LG A++PPC Y ++  Y VPGS
Sbjct  82   YYPFAGRLIEGPNRKLMVDCNGEGILFLEAEANFKLEQLGGAIQPPCPYLEQLTYNVPGS  141

Query  456  HQILGCPLMIVQ  491
              ILGCPL+++Q
Sbjct  142  EGILGCPLLLIQ  153



>gb|ACV74416.1| putative alcohol acyl transferase [Camellia sinensis]
Length=464

 Score =   170 bits (431),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 102/127 (80%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            +KPTP E K+LSDIDDQ+GLRF   +IMFY+ NP M+ KDP   IR+A+AKALV+YYP A
Sbjct  23   SKPTPHELKQLSDIDDQEGLRFQLPVIMFYKNNPSMEGKDPASVIREALAKALVFYYPFA  82

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL++GP  K  VDC+A+G+ F+EAD+++ ++ LGDAV+P C Y +E LY+VPGS  I+G
Sbjct  83   GRLVEGPNRKLSVDCTAEGVLFIEADANVEIDWLGDAVRPGCPYLEELLYDVPGSDGIVG  142

Query  471  CPLMIVQ  491
            CPL+++Q
Sbjct  143  CPLLLIQ  149



>gb|KDO48023.1| hypothetical protein CISIN_1g031330mg [Citrus sinensis]
Length=161

 Score =   162 bits (409),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 100/135 (74%), Gaps = 3/135 (2%)
 Frame = +3

Query  96   RAP---GTAKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKA  266
            RAP     AKPTP+E K LSDIDDQ+GLRFH  +I FY+ NP +  KDPV+ IR+A+A+ 
Sbjct  12   RAPELIAPAKPTPRELKPLSDIDDQEGLRFHIPVIQFYKYNPFVNGKDPVKVIREAIAQT  71

Query  267  LVWYYPLAGRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEV  446
            LV YYP AGRL +GP  K MVDC+ +G+ F+EAD+ ++LE  GDA++PP    +E L++V
Sbjct  72   LVSYYPFAGRLREGPNRKLMVDCTGEGVLFIEADADVTLEQFGDALQPPFPGLEELLFDV  131

Query  447  PGSHQILGCPLMIVQ  491
            PGS  +L CPL+++Q
Sbjct  132  PGSAGVLNCPLLLIQ  146



>sp|Q3ZPN4.1|ACMAT_VITLA RecName: Full=Methanol O-anthraniloyltransferase; AltName: Full=Anthraniloyl-CoA:methanol 
acyltransferase; AltName: Full=Benzyl 
alcohol O-benzoyltransferase [Vitis labrusca]
 gb|AAW22989.1| anthraniloyal-CoA: methanol anthraniloyal transferase [Vitis 
labrusca]
Length=449

 Score =   169 bits (429),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 100/127 (79%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            A PTP+E K+LSDIDDQ+G RF   +IMFYR NPLM+ KDPV+ IR+A+ KALV+YYP A
Sbjct  23   ANPTPREVKQLSDIDDQEGRRFQIPVIMFYRNNPLMEGKDPVKVIREALGKALVYYYPFA  82

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRLI+G   K MVDC+ +G+ F+EAD+  +LE+LGDA++P C   +E LY+VPGS  ILG
Sbjct  83   GRLIEGDNRKLMVDCTGEGVLFIEADADTTLENLGDAIQPMCPCFEELLYDVPGSTTILG  142

Query  471  CPLMIVQ  491
             PL+++Q
Sbjct  143  SPLILIQ  149



>ref|XP_010644575.1| PREDICTED: methanol O-anthraniloyltransferase-like [Vitis vinifera]
Length=445

 Score =   169 bits (429),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 100/127 (79%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            AKPT +E K+LSDIDDQ GLRF   MI FYR +PLM  KDPV+ IR+A+AKALV+YYP A
Sbjct  22   AKPTRRELKQLSDIDDQGGLRFQASMIFFYRNSPLMDGKDPVKVIREALAKALVYYYPFA  81

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL++G   K +VDC+ +G+ F+EAD+  +LE LGDA++P C   +E LY+VPGS +ILG
Sbjct  82   GRLVEGSNRKLLVDCTGEGVLFIEADADTTLEHLGDAIQPHCPCFEELLYDVPGSGEILG  141

Query  471  CPLMIVQ  491
            CPL+++Q
Sbjct  142  CPLLLIQ  148



>ref|XP_002517500.1| Taxadien-5-alpha-ol O-acetyltransferase, putative [Ricinus communis]
 gb|EEF45042.1| Taxadien-5-alpha-ol O-acetyltransferase, putative [Ricinus communis]
Length=458

 Score =   169 bits (429),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 103/127 (81%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            A+PTP+E K++SDIDDQ+GLRF    +MFYR+ P MK +DPVE IR A+++ALV+YYP A
Sbjct  23   ARPTPRELKKVSDIDDQEGLRFQISFVMFYRSLPSMKGRDPVEIIRKALSEALVFYYPFA  82

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRLI+GP  K +VDC+ +GI F+EAD+ +++E LGD+++PPC   +E LY+VPGS  I+G
Sbjct  83   GRLIEGPNRKLIVDCNGEGILFIEADADITIEQLGDSMQPPCPCIEELLYDVPGSSGIIG  142

Query  471  CPLMIVQ  491
            CPL+++Q
Sbjct  143  CPLLLIQ  149



>ref|XP_002265841.1| PREDICTED: methanol O-anthraniloyltransferase [Vitis vinifera]
 emb|CBI37446.3| unnamed protein product [Vitis vinifera]
Length=451

 Score =   167 bits (423),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 99/127 (78%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
              PTP+E K+LSDIDDQ+GLRF   +IMFY  NPLMK KDPV+ IR+A+ KALV+YYP A
Sbjct  23   TNPTPREVKQLSDIDDQEGLRFQIPVIMFYPNNPLMKGKDPVKVIREALGKALVYYYPFA  82

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRLI+G   K MVDC+ +G+ F+EAD+  +LE+LGDA++P C   +E LY+VPGS  ILG
Sbjct  83   GRLIEGDNRKLMVDCTGEGVLFIEADADTTLENLGDAIQPMCPCFEELLYDVPGSGGILG  142

Query  471  CPLMIVQ  491
             PL+++Q
Sbjct  143  SPLILIQ  149



>ref|XP_010665210.1| PREDICTED: methanol O-anthraniloyltransferase isoform X2 [Vitis 
vinifera]
Length=382

 Score =   166 bits (419),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 99/127 (78%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
              PTP+E K+LSDIDDQ+GLRF   +IMFY  NPLMK KDPV+ IR+A+ KALV+YYP A
Sbjct  23   TNPTPREVKQLSDIDDQEGLRFQVPVIMFYPNNPLMKGKDPVKVIREALGKALVYYYPFA  82

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRLI+G   K MVDC+ +G+ F+EAD+  +LE+LGDA++P C   +E LY+VPGS  ILG
Sbjct  83   GRLIEGHNRKLMVDCTGEGVLFIEADADSTLENLGDAIQPMCPCFEELLYDVPGSGGILG  142

Query  471  CPLMIVQ  491
             PL+++Q
Sbjct  143  SPLILIQ  149



>ref|XP_008344828.1| PREDICTED: methanol O-anthraniloyltransferase-like [Malus domestica]
Length=188

 Score =   160 bits (405),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 74/129 (57%), Positives = 101/129 (78%), Gaps = 2/129 (2%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLM--KAKDPVEAIRDAVAKALVWYYP  284
            AKPTP ETK LSDIDDQ+GLRF   ++M Y+ NPL+     DPV+ +++A++KALV+YYP
Sbjct  23   AKPTPHETKLLSDIDDQEGLRFQTPVLMSYKNNPLIPKDRTDPVKVLKEALSKALVFYYP  82

Query  285  LAGRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQI  464
            LAGRL +GP  K MV+C+ +G+ F+EAD+ ++LE LGDA+ PPC + +EFL + PGS  I
Sbjct  83   LAGRLREGPNRKLMVECTGEGVLFIEADADVTLEQLGDALVPPCPFLEEFLCDAPGSDGI  142

Query  465  LGCPLMIVQ  491
            LGCPL++VQ
Sbjct  143  LGCPLLLVQ  151



>ref|XP_011082158.1| PREDICTED: methanol O-anthraniloyltransferase-like [Sesamum indicum]
Length=453

 Score =   167 bits (422),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 102/127 (80%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            A+PTP E K LS +DDQ+ LR H+ MIMFY++ P M+  +PV+ IR+A+AK LV+YYP A
Sbjct  19   AQPTPHEIKALSTLDDQETLRCHYPMIMFYKSKPSMEGLNPVKIIREALAKTLVYYYPYA  78

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRLI+GP++KFMVDC+A+G+ FVEAD+S+S+  LGD V+PPC Y +  + +VPGS  +LG
Sbjct  79   GRLIEGPDNKFMVDCTAEGVVFVEADASVSIVQLGDTVQPPCRYPELLVSDVPGSDGMLG  138

Query  471  CPLMIVQ  491
            CPLM+VQ
Sbjct  139  CPLMLVQ  145



>emb|CAN77583.1| hypothetical protein VITISV_040970 [Vitis vinifera]
Length=451

 Score =   167 bits (422),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 99/127 (78%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
              PTP+E K+LSDIDDQ+GLRF   +IMFY  NPLMK KDPV+ IR+A+ KALV+YYP A
Sbjct  23   TNPTPREVKQLSDIDDQEGLRFQVPVIMFYPNNPLMKGKDPVKVIREALGKALVYYYPFA  82

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRLI+G   K MVDC+ +G+ F+EAD+  +LE+LGDA++P C   +E LY+VPGS  ILG
Sbjct  83   GRLIEGXNRKLMVDCTGEGVLFIEADADSTLENLGDAIQPMCPCFEELLYDVPGSGGILG  142

Query  471  CPLMIVQ  491
             PL+++Q
Sbjct  143  SPLILIQ  149



>gb|ACF07921.1| alcohol acyl transferase [Prunus armeniaca]
Length=453

 Score =   167 bits (422),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 99/127 (78%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            AKPTP ETK+LSDIDDQ GLRFHF +IM Y+ NP MK  D V  IR+A+++ALV+YYPLA
Sbjct  20   AKPTPIETKQLSDIDDQDGLRFHFPVIMSYKNNPSMKGNDAVMVIREALSRALVYYYPLA  79

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +GP  K MV+C+ +G+ F+EA++ ++LE LGD + PPC   +EFL+  PGS  ILG
Sbjct  80   GRLREGPNRKLMVECNGEGVLFIEANADVTLEQLGDRILPPCPVLEEFLFNPPGSDGILG  139

Query  471  CPLMIVQ  491
            CPL++VQ
Sbjct  140  CPLLLVQ  146



>ref|XP_002266114.1| PREDICTED: methanol O-anthraniloyltransferase isoform X1 [Vitis 
vinifera]
Length=451

 Score =   167 bits (422),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 99/127 (78%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
              PTP+E K+LSDIDDQ+GLRF   +IMFY  NPLMK KDPV+ IR+A+ KALV+YYP A
Sbjct  23   TNPTPREVKQLSDIDDQEGLRFQVPVIMFYPNNPLMKGKDPVKVIREALGKALVYYYPFA  82

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRLI+G   K MVDC+ +G+ F+EAD+  +LE+LGDA++P C   +E LY+VPGS  ILG
Sbjct  83   GRLIEGHNRKLMVDCTGEGVLFIEADADSTLENLGDAIQPMCPCFEELLYDVPGSGGILG  142

Query  471  CPLMIVQ  491
             PL+++Q
Sbjct  143  SPLILIQ  149



>emb|CAN72252.1| hypothetical protein VITISV_017467 [Vitis vinifera]
Length=451

 Score =   166 bits (420),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 99/127 (78%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
              PTP+E K+LSDIDDQ+GLRF   +IMFY  NPLMK KDPV+ IR+A+ KALV+YYP A
Sbjct  23   TNPTPRELKQLSDIDDQEGLRFQIPVIMFYPNNPLMKGKDPVKVIREALGKALVYYYPFA  82

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRLI+G   K MVDC+ +G+ F+EAD+  +LE+LGDA++P C   +E LY+VPGS  ILG
Sbjct  83   GRLIEGDNRKLMVDCTGEGVLFIEADADTTLENLGDAIQPMCPCFEELLYDVPGSGGILG  142

Query  471  CPLMIVQ  491
             P++++Q
Sbjct  143  SPVVLIQ  149



>ref|XP_002265049.1| PREDICTED: methanol O-anthraniloyltransferase [Vitis vinifera]
Length=451

 Score =   166 bits (419),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 99/127 (78%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
              PTP+E K+LSDIDDQ+GLRF   +IMFY  NPLMK KDPV+ IR+A+ KALV+YYP A
Sbjct  23   TNPTPRELKQLSDIDDQEGLRFQIPVIMFYPNNPLMKGKDPVKVIREALGKALVYYYPFA  82

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRLI+G   K MVDC+ +G+ F+EAD+  +LE+LGDA++P C   +E LY+VPGS  ILG
Sbjct  83   GRLIEGDNRKLMVDCTGEGVLFIEADADTTLENLGDAIQPMCPCFEELLYDVPGSGGILG  142

Query  471  CPLMIVQ  491
             P++++Q
Sbjct  143  SPVVLIQ  149



>emb|CAN74729.1| hypothetical protein VITISV_042062 [Vitis vinifera]
Length=451

 Score =   165 bits (418),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/134 (58%), Positives = 102/134 (76%), Gaps = 3/134 (2%)
 Frame = +3

Query  99   APGTAKPT---PQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKAL  269
            AP   +PT   P+E K+LSDIDDQ+GLRF   +IMFY  NPLMK KDPV+ IR+A+ KAL
Sbjct  16   APEFVRPTNLTPREVKQLSDIDDQEGLRFQIPVIMFYPNNPLMKGKDPVKVIREALGKAL  75

Query  270  VWYYPLAGRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVP  449
            V+YYP AGRLI+G   K MVDC+ +G+ F+EAD+  +LE+LGDA++P C   +E LY+VP
Sbjct  76   VYYYPFAGRLIEGDNRKLMVDCTGEGVLFIEADADTTLENLGDAIQPMCPCFEELLYDVP  135

Query  450  GSHQILGCPLMIVQ  491
            GS  ILG PL+++Q
Sbjct  136  GSGGILGSPLILIQ  149



>emb|CBI37443.3| unnamed protein product [Vitis vinifera]
Length=492

 Score =   165 bits (418),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 99/127 (78%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
              PTP+E K+LSDIDDQ+GLRF   +IMFY  NPLMK KDPV+ IR+A+ KALV+YYP A
Sbjct  23   TNPTPRELKQLSDIDDQEGLRFQIPVIMFYPNNPLMKGKDPVKVIREALGKALVYYYPFA  82

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRLI+G   K MVDC+ +G+ F+EAD+  +LE+LGDA++P C   +E LY+VPGS  ILG
Sbjct  83   GRLIEGDNRKLMVDCTGEGVLFIEADADTTLENLGDAIQPMCPCFEELLYDVPGSGGILG  142

Query  471  CPLMIVQ  491
             P++++Q
Sbjct  143  SPVVLIQ  149



>ref|XP_002270240.1| PREDICTED: methanol O-anthraniloyltransferase [Vitis vinifera]
Length=445

 Score =   164 bits (416),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 98/127 (77%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            AKPTP+E KELSDIDDQ+GLRF   +I FY  + LM  KDP + IR+A+AKAL++YYP A
Sbjct  22   AKPTPRELKELSDIDDQEGLRFQVPIIFFYGNSSLMDGKDPAKVIREALAKALIYYYPFA  81

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL++G   K +VDC+ +G+ FVEAD+  +LE LGDA++PPC   +E LY+VPGS  ILG
Sbjct  82   GRLVEGSNRKLLVDCTGEGVLFVEADADTTLEYLGDAIQPPCPCFEELLYDVPGSGGILG  141

Query  471  CPLMIVQ  491
            CPL++ Q
Sbjct  142  CPLLLFQ  148



>gb|KEH17125.1| benzyl alcohol O-benzoyltransferase [Medicago truncatula]
Length=155

 Score =   156 bits (395),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 93/127 (73%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            +KPTP E K LSDIDDQ+ LRFH  +I FY  NP+M+ KDPV  IR A+AK LV+YYPLA
Sbjct  20   SKPTPHEIKRLSDIDDQQSLRFHVPLIQFYNYNPIMEGKDPVVVIRKALAKTLVFYYPLA  79

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +GP  K MVDC+ +G+ F+EAD+ ++L+  GDA+ PP     E +Y+VPGS  +L 
Sbjct  80   GRLREGPGRKLMVDCTGEGVLFIEADADVTLKQFGDALHPPFPCLGELIYDVPGSSDVLN  139

Query  471  CPLMIVQ  491
             PL+++Q
Sbjct  140  TPLLLIQ  146



>ref|XP_009365763.1| PREDICTED: methanol O-anthraniloyltransferase-like [Pyrus x bretschneideri]
Length=451

 Score =   164 bits (414),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 97/127 (76%), Gaps = 2/127 (2%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            AKPTP+ETK LSD+DDQ+G RFHF +I+ YR        DPV AIRDA+++ALV+YYP+A
Sbjct  23   AKPTPRETKRLSDVDDQQGTRFHFPLILSYRNKE--NQGDPVTAIRDALSRALVYYYPVA  80

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +GP  K MVDC+ +G+ F+EAD+  +LE+LGD ++PPC    E L+ VPGS  ILG
Sbjct  81   GRLREGPNKKLMVDCNGEGVLFIEADADFTLEELGDTIRPPCPLLDELLFNVPGSDGILG  140

Query  471  CPLMIVQ  491
            CP+++VQ
Sbjct  141  CPILLVQ  147



>ref|XP_007209120.1| hypothetical protein PRUPE_ppa005455mg [Prunus persica]
 gb|EMJ10319.1| hypothetical protein PRUPE_ppa005455mg [Prunus persica]
Length=460

 Score =   164 bits (414),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 97/127 (76%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            AKPTP ETK LS+IDDQ+ LRF   +IM Y+ NP MK  D VE IR+A+++ALV+YYPLA
Sbjct  22   AKPTPHETKLLSNIDDQESLRFQVSVIMSYKNNPSMKGNDAVEVIREALSRALVYYYPLA  81

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +GP  K MV+C+ +G+ F+EA++ ++L  LGD + PP  + +EFLY VPGS  ILG
Sbjct  82   GRLREGPNRKLMVECNGEGVLFIEANADVTLAQLGDTIAPPSPFLEEFLYNVPGSDGILG  141

Query  471  CPLMIVQ  491
            CPL+++Q
Sbjct  142  CPLLLIQ  148



>ref|XP_010665177.1| PREDICTED: methanol O-anthraniloyltransferase isoform X2 [Vitis 
vinifera]
Length=382

 Score =   162 bits (410),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 99/127 (78%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
              PTP+E K+LSD+DDQ+GLRF   +IMFY  NPLMK KDP + I++A+ KALV+YYP A
Sbjct  23   TNPTPREVKQLSDLDDQEGLRFQVPVIMFYPNNPLMKGKDPAKVIKEALGKALVYYYPFA  82

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRLI+G   K MVDC+ +G+ F+EAD+  +LE+LGD+++P C   +E LY+VPGS +ILG
Sbjct  83   GRLIEGDNRKLMVDCTGEGVLFIEADADTTLENLGDSIQPMCPCYEEILYDVPGSGEILG  142

Query  471  CPLMIVQ  491
             PL+++Q
Sbjct  143  SPLILIQ  149



>ref|XP_002266420.1| PREDICTED: methanol O-anthraniloyltransferase [Vitis vinifera]
Length=451

 Score =   163 bits (413),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 98/127 (77%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
              PTP+E K+LSD+DDQ+GLRF   +IMFY  NPLMK KDP + I++A+ KALV+YYP A
Sbjct  23   TNPTPREVKQLSDLDDQEGLRFQIPVIMFYPNNPLMKGKDPAKVIKEALGKALVYYYPFA  82

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRLI+G   K MVDC+ +G+ F+EAD+  +LE+LGDA++P C   +E LY+VPGS  ILG
Sbjct  83   GRLIEGDNRKLMVDCTGEGVLFIEADADTTLENLGDAIQPMCPCFEELLYDVPGSGGILG  142

Query  471  CPLMIVQ  491
             PL+++Q
Sbjct  143  SPLILIQ  149



>ref|XP_007209131.1| hypothetical protein PRUPE_ppa005625mg [Prunus persica]
 gb|EMJ10330.1| hypothetical protein PRUPE_ppa005625mg [Prunus persica]
Length=450

 Score =   163 bits (413),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 98/127 (77%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            AKPTP ETK+LSDIDDQ GLRFHF +I+ Y+ NP MK  D V  IR+A+++ALV+YYPLA
Sbjct  22   AKPTPIETKQLSDIDDQDGLRFHFPVIISYKNNPSMKGNDAVMVIREALSRALVYYYPLA  81

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +GP  K MV+C+ +G+ F+EA++ ++LE LGD + PPC   +EFL   PGS  ILG
Sbjct  82   GRLREGPNRKLMVECNGEGVLFIEANADVTLEQLGDRILPPCPVLEEFLSNPPGSDGILG  141

Query  471  CPLMIVQ  491
            CPL++VQ
Sbjct  142  CPLLLVQ  148



>ref|XP_002270962.1| PREDICTED: methanol O-anthraniloyltransferase isoform X1 [Vitis 
vinifera]
 emb|CBI37440.3| unnamed protein product [Vitis vinifera]
Length=451

 Score =   163 bits (413),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 99/127 (78%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
              PTP+E K+LSD+DDQ+GLRF   +IMFY  NPLMK KDP + I++A+ KALV+YYP A
Sbjct  23   TNPTPREVKQLSDLDDQEGLRFQVPVIMFYPNNPLMKGKDPAKVIKEALGKALVYYYPFA  82

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRLI+G   K MVDC+ +G+ F+EAD+  +LE+LGD+++P C   +E LY+VPGS +ILG
Sbjct  83   GRLIEGDNRKLMVDCTGEGVLFIEADADTTLENLGDSIQPMCPCYEEILYDVPGSGEILG  142

Query  471  CPLMIVQ  491
             PL+++Q
Sbjct  143  SPLILIQ  149



>emb|CAN69948.1| hypothetical protein VITISV_009219 [Vitis vinifera]
Length=451

 Score =   163 bits (413),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 99/127 (78%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
              PTP+E K+LSD+DDQ+GLRF   +IMFY  NPLMK KDP + I++A+ KALV+YYP A
Sbjct  23   TNPTPREVKQLSDLDDQEGLRFQVPVIMFYPNNPLMKGKDPAKVIKEALGKALVYYYPFA  82

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRLI+G   K MVDC+ +G+ F+EAD+  +LE+LGD+++P C   +E LY+VPGS +ILG
Sbjct  83   GRLIEGDNRKLMVDCTGEGVLFIEADADTTLENLGDSIQPMCPCYEEILYDVPGSGEILG  142

Query  471  CPLMIVQ  491
             PL+++Q
Sbjct  143  SPLILIQ  149



>emb|CAN68818.1| hypothetical protein VITISV_012041 [Vitis vinifera]
Length=451

 Score =   163 bits (412),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 99/127 (78%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
              PTP+E K+LSD+DDQ+GLRF   +IMFY  NPLMK KDP + I++A+ KALV+YYP A
Sbjct  23   TNPTPREVKQLSDLDDQEGLRFQVPVIMFYPNNPLMKGKDPAKVIKEALGKALVYYYPFA  82

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRLI+G   K MVDC+ +G+ F+EAD+  +LE+LGD+++P C   +E LY+VPGS +ILG
Sbjct  83   GRLIEGDNRKLMVDCTGEGVLFIEADADTTLENLGDSIQPMCPCYEEILYDVPGSGEILG  142

Query  471  CPLMIVQ  491
             PL+++Q
Sbjct  143  SPLILIQ  149



>ref|XP_006446267.1| hypothetical protein CICLE_v10015194mg [Citrus clementina]
 gb|ESR59507.1| hypothetical protein CICLE_v10015194mg [Citrus clementina]
Length=456

 Score =   163 bits (412),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 72/129 (56%), Positives = 102/129 (79%), Gaps = 2/129 (2%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPL--MKAKDPVEAIRDAVAKALVWYYP  284
            A+PTP+E K+LSDIDDQ+ LRFH  +I FY+ +P   M+ +DPV+ IR+A++KALV+YYP
Sbjct  22   ARPTPREVKQLSDIDDQESLRFHVPVIFFYKNDPSPSMQGRDPVKVIREAISKALVFYYP  81

Query  285  LAGRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQI  464
            LAGRL +G   + MV+C+A+G+ F+EAD++ +LE LGD ++PPC Y  + LY+VPGS  I
Sbjct  82   LAGRLKEGYNRRLMVECNAEGVLFIEADANFTLEQLGDDIQPPCPYLNQLLYDVPGSEGI  141

Query  465  LGCPLMIVQ  491
            LGCPL ++Q
Sbjct  142  LGCPLFLIQ  150



>ref|XP_006446264.1| hypothetical protein CICLE_v10015163mg [Citrus clementina]
 gb|ESR59504.1| hypothetical protein CICLE_v10015163mg [Citrus clementina]
Length=464

 Score =   163 bits (412),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 72/132 (55%), Positives = 100/132 (76%), Gaps = 5/132 (4%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRAN-----PLMKAKDPVEAIRDAVAKALVW  275
            A+PTP+E K+LSDIDDQ+  RFH  +I  Y+ N     PL+K KDPV+ I++A+++ALV+
Sbjct  22   ARPTPRELKQLSDIDDQESFRFHIPVIFLYKNNSASSPPLLKEKDPVKVIKEAISEALVY  81

Query  276  YYPLAGRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGS  455
            YYP AGRLI+GP  K MVDC+ +GI F+EA+++  LE LG A++PPC Y ++  Y VPGS
Sbjct  82   YYPFAGRLIEGPNRKLMVDCNGEGILFLEAEANFKLEQLGGAIQPPCPYLEQLTYNVPGS  141

Query  456  HQILGCPLMIVQ  491
              ILGCPL+++Q
Sbjct  142  EGILGCPLLLIQ  153



>emb|CBI37442.3| unnamed protein product [Vitis vinifera]
Length=475

 Score =   163 bits (413),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 98/127 (77%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
              PTP+E K+LSD+DDQ+GLRF   +IMFY  NPLMK KDP + I++A+ KALV+YYP A
Sbjct  47   TNPTPREVKQLSDLDDQEGLRFQIPVIMFYPNNPLMKGKDPAKVIKEALGKALVYYYPFA  106

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRLI+G   K MVDC+ +G+ F+EAD+  +LE+LGDA++P C   +E LY+VPGS  ILG
Sbjct  107  GRLIEGDNRKLMVDCTGEGVLFIEADADTTLENLGDAIQPMCPCFEELLYDVPGSGGILG  166

Query  471  CPLMIVQ  491
             PL+++Q
Sbjct  167  SPLILIQ  173



>ref|XP_002325454.2| transferase family protein [Populus trichocarpa]
 gb|EEE99835.2| transferase family protein [Populus trichocarpa]
Length=460

 Score =   162 bits (411),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 98/127 (77%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            AKPTP E K LSDIDDQ+GLRFH  ++ FYR NP M+ KDPV+ IR+A+AK LV+YYP A
Sbjct  23   AKPTPHEFKLLSDIDDQEGLRFHIPVMQFYRNNPSMQGKDPVKIIREALAKTLVFYYPFA  82

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +GP  K MV+C+ +GI F+EAD+ ++LE  GDA++PP    +E L++VPGS  +L 
Sbjct  83   GRLREGPNRKLMVECTGEGILFIEADADVTLEQFGDALQPPFPCLEELLFDVPGSSGVLN  142

Query  471  CPLMIVQ  491
            CPL+++Q
Sbjct  143  CPLLLIQ  149



>gb|AJD25145.1| benzoyl-CoA:benzyl alcohol O-benzoyltransferase [Populus trichocarpa]
Length=460

 Score =   162 bits (411),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 98/127 (77%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            AKPTP E K LSDIDDQ+GLRFH  ++ FYR NP M+ KDPV+ IR+A+AK LV+YYP A
Sbjct  23   AKPTPHEFKLLSDIDDQEGLRFHIPVMQFYRNNPSMQGKDPVKIIREALAKTLVFYYPFA  82

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +GP  K MV+C+ +GI F+EAD+ ++LE  GDA++PP    +E L++VPGS  +L 
Sbjct  83   GRLREGPNRKLMVECTGEGILFIEADADVTLEQFGDALQPPFPCLEELLFDVPGSSGVLN  142

Query  471  CPLMIVQ  491
            CPL+++Q
Sbjct  143  CPLLLIQ  149



>ref|XP_011012995.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Populus 
euphratica]
Length=459

 Score =   162 bits (411),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 98/127 (77%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            AKPTP E K LSDIDDQ+GLRFH  ++ FYR NP M+ KDPV+ IR+A+AK LV+YYP A
Sbjct  23   AKPTPHEFKLLSDIDDQEGLRFHIPVMQFYRNNPSMQGKDPVKIIREALAKTLVFYYPFA  82

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +GP  K MV+C+ +GI F+EAD+ ++LE  GDA++PP    +E L++VPGS  +L 
Sbjct  83   GRLREGPNRKLMVECTGEGILFIEADADVTLEQFGDALQPPFPCLEELLFDVPGSSGVLN  142

Query  471  CPLMIVQ  491
            CPL+++Q
Sbjct  143  CPLLLIQ  149



>ref|XP_006437408.1| hypothetical protein CICLE_v10031489mg [Citrus clementina]
 gb|ESR50648.1| hypothetical protein CICLE_v10031489mg [Citrus clementina]
Length=458

 Score =   162 bits (410),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 75/135 (56%), Positives = 100/135 (74%), Gaps = 3/135 (2%)
 Frame = +3

Query  96   RAP---GTAKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKA  266
            RAP     AKPTP+E K LSDIDDQ+GLRFH  +I FY+ NP +  KDPV+ IR+AVA+ 
Sbjct  12   RAPELIAPAKPTPRELKPLSDIDDQEGLRFHIPVIQFYKYNPFVNGKDPVKVIREAVAQT  71

Query  267  LVWYYPLAGRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEV  446
            LV YYP AGRL +GP  K MVDC+ +G+ F+EAD+ ++LE  GDA++PP    +E L++V
Sbjct  72   LVSYYPFAGRLREGPNRKLMVDCTGEGVLFIEADADVTLEQFGDALQPPFPGLEELLFDV  131

Query  447  PGSHQILGCPLMIVQ  491
            PGS  +L CPL+++Q
Sbjct  132  PGSAGVLNCPLLLIQ  146



>ref|XP_006470748.1| PREDICTED: anthraniloyl-CoA:methanol acyltransferase-like [Citrus 
sinensis]
Length=463

 Score =   162 bits (410),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 100/132 (76%), Gaps = 5/132 (4%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRAN-----PLMKAKDPVEAIRDAVAKALVW  275
            A+PTP+E K+LSDIDDQ+  RFH  +I  Y+ N     P++K KDPV+ I++A+++ALV+
Sbjct  22   ARPTPRELKQLSDIDDQESFRFHIPVIFLYKNNSASSPPVLKEKDPVKVIKEAISEALVY  81

Query  276  YYPLAGRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGS  455
            YYP AGRLI+GP  K MVDC+ +GI F+EA+++  LE LG A++PPC Y ++  Y VPGS
Sbjct  82   YYPFAGRLIEGPNRKLMVDCNGEGILFLEAEANFKLEQLGGAIQPPCPYLEQLTYNVPGS  141

Query  456  HQILGCPLMIVQ  491
              ILGCPL+++Q
Sbjct  142  EGILGCPLLLIQ  153



>ref|XP_006484694.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Citrus sinensis]
Length=458

 Score =   162 bits (409),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 100/135 (74%), Gaps = 3/135 (2%)
 Frame = +3

Query  96   RAP---GTAKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKA  266
            RAP     AKPTP+E K LSDIDDQ+GLRFH  +I FY+ NP +  KDPV+ IR+A+A+ 
Sbjct  12   RAPELIAPAKPTPRELKPLSDIDDQEGLRFHIPVIQFYKYNPFVNGKDPVKVIREAIAQT  71

Query  267  LVWYYPLAGRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEV  446
            LV YYP AGRL +GP  K MVDC+ +G+ F+EAD+ ++LE  GDA++PP    +E L++V
Sbjct  72   LVSYYPFAGRLREGPNRKLMVDCTGEGVLFIEADADVTLEQFGDALQPPFPGLEELLFDV  131

Query  447  PGSHQILGCPLMIVQ  491
            PGS  +L CPL+++Q
Sbjct  132  PGSAGVLNCPLLLIQ  146



>ref|XP_008384757.1| PREDICTED: methanol O-anthraniloyltransferase-like [Malus domestica]
Length=459

 Score =   161 bits (408),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 76/128 (59%), Positives = 100/128 (78%), Gaps = 1/128 (1%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANP-LMKAKDPVEAIRDAVAKALVWYYPL  287
            AKPTPQETK LSDIDDQ+ LRF   +IM Y+ANP L K ++PV+ IR+A+++ALV+YYPL
Sbjct  20   AKPTPQETKFLSDIDDQESLRFQVPVIMCYKANPSLNKNRNPVKVIREALSRALVYYYPL  79

Query  288  AGRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQIL  467
            AGRL +GP  K +VDC+ +GI FVEA + ++LE LGD + PPC   +EFL+  PGS  I+
Sbjct  80   AGRLREGPNKKLVVDCNGEGILFVEASADVTLEQLGDXILPPCPLLEEFLFNFPGSDGII  139

Query  468  GCPLMIVQ  491
            GCPL++VQ
Sbjct  140  GCPLLLVQ  147



>gb|AAR99826.1| alcohol acyl transferase [Malus domestica]
Length=470

 Score =   161 bits (407),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 77/128 (60%), Positives = 99/128 (77%), Gaps = 1/128 (1%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANP-LMKAKDPVEAIRDAVAKALVWYYPL  287
            AKPTPQETK LSDIDDQ+GLRF   +IM Y+ NP L K  +PV+ IR+A+++ALV+YYPL
Sbjct  20   AKPTPQETKFLSDIDDQEGLRFQVPVIMCYKDNPSLNKNCNPVKVIREALSRALVYYYPL  79

Query  288  AGRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQIL  467
            AGRL +GP  K MVDC+ +GI FVEA + ++LE LGD + PPC   +EFL+  PGS  I+
Sbjct  80   AGRLKEGPNRKLMVDCNGEGILFVEASADVTLEQLGDKILPPCPLLEEFLFNFPGSDGII  139

Query  468  GCPLMIVQ  491
            GCPL++VQ
Sbjct  140  GCPLLLVQ  147



>ref|XP_006361592.1| PREDICTED: anthraniloyl-CoA:methanol acyltransferase-like [Solanum 
tuberosum]
Length=447

 Score =   160 bits (406),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 68/124 (55%), Positives = 94/124 (76%), Gaps = 0/124 (0%)
 Frame = +3

Query  120  TPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLAGRL  299
            TP E K LS+IDDQ   RFH  ++MFY+ N LM+ KDP + I+D ++K LV+YYPLAGRL
Sbjct  24   TPHEIKHLSEIDDQGSTRFHVSLLMFYKYNSLMEGKDPAKFIKDGLSKTLVFYYPLAGRL  83

Query  300  IQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILGCPL  479
            I+GP  K MV+C+ +G+ F+EAD+++ LE LGD++KPPC Y    L+ VPGS  I+GCPL
Sbjct  84   IEGPNKKLMVNCNGEGVLFIEADANVELEKLGDSIKPPCPYLDLLLHNVPGSDGIIGCPL  143

Query  480  MIVQ  491
            +++Q
Sbjct  144  LLIQ  147



>ref|XP_006470571.1| PREDICTED: anthraniloyl-CoA:methanol acyltransferase-like [Citrus 
sinensis]
Length=456

 Score =   160 bits (406),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 72/129 (56%), Positives = 101/129 (78%), Gaps = 2/129 (2%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPL--MKAKDPVEAIRDAVAKALVWYYP  284
            A+PTP+E K+LSDIDDQ+ LRF   +I FY+ +P   M+ +DPV+ IR+A++KALV+YYP
Sbjct  22   ARPTPREVKQLSDIDDQESLRFRVPVIFFYKNDPSPSMQGRDPVKVIREAISKALVFYYP  81

Query  285  LAGRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQI  464
            LAGRL +G   K MV+C+A+G+ F+EAD++ +LE LGD ++PPC Y  + LY+VPGS  I
Sbjct  82   LAGRLKEGYNRKLMVECNAEGVLFIEADANFTLEQLGDDIQPPCPYLNQLLYDVPGSEGI  141

Query  465  LGCPLMIVQ  491
            LGCPL ++Q
Sbjct  142  LGCPLFLIQ  150



>ref|XP_008238035.1| PREDICTED: methanol O-anthraniloyltransferase-like [Prunus mume]
Length=460

 Score =   160 bits (406),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 96/127 (76%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            AKPTP ETK LS+IDDQ+ LRF   +IM Y+ NP MK  D VE IR+A+++ALV+YYPLA
Sbjct  22   AKPTPHETKLLSNIDDQESLRFQVPVIMSYKNNPSMKGNDAVEVIREALSRALVYYYPLA  81

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +GP  K MV+C+ +G+ F+EA++ + L  LGD + PP  + +EFLY VPGS  ILG
Sbjct  82   GRLREGPNRKLMVECNGEGVLFMEANADVRLAQLGDTIAPPSPFLEEFLYNVPGSDGILG  141

Query  471  CPLMIVQ  491
            CPL+++Q
Sbjct  142  CPLLLIQ  148



>gb|AAS48090.1| alcohol acyl transferase [Pyrus communis]
Length=442

 Score =   160 bits (405),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 74/128 (58%), Positives = 100/128 (78%), Gaps = 1/128 (1%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANP-LMKAKDPVEAIRDAVAKALVWYYPL  287
            AKPTPQETK LSDIDDQ+GLRF   +IM Y+ NP L K ++P++ I++A+++ALV+YYPL
Sbjct  20   AKPTPQETKFLSDIDDQEGLRFQLPVIMCYKDNPSLNKNRNPIKVIKEALSRALVYYYPL  79

Query  288  AGRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQIL  467
            AGRL +GP  K MV+C+ +GI FVEA + ++LE LGD + PPC   +EFL+  PGS  I+
Sbjct  80   AGRLREGPNRKLMVNCNGEGILFVEASADVTLEQLGDKILPPCPLLEEFLFNFPGSDGII  139

Query  468  GCPLMIVQ  491
            GCPL++VQ
Sbjct  140  GCPLLLVQ  147



>ref|XP_009365778.1| PREDICTED: methanol O-anthraniloyltransferase-like [Pyrus x bretschneideri]
Length=454

 Score =   160 bits (405),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/128 (59%), Positives = 99/128 (77%), Gaps = 1/128 (1%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANP-LMKAKDPVEAIRDAVAKALVWYYPL  287
            AKPTPQETK LSDIDDQ+GLRF   +IM Y+ NP L + ++PV+ IR+A+++ALV+YYPL
Sbjct  20   AKPTPQETKFLSDIDDQEGLRFQVPVIMCYKDNPSLNENRNPVKVIREALSRALVYYYPL  79

Query  288  AGRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQIL  467
            AGRL +GP  K MVDC+ +GI FVEA + ++LE LGD + PPC    EFL+  PGS  I+
Sbjct  80   AGRLREGPNRKLMVDCNGEGILFVEASADVTLEQLGDKILPPCPLLDEFLFNFPGSDGII  139

Query  468  GCPLMIVQ  491
            GCPL++VQ
Sbjct  140  GCPLLLVQ  147



>gb|AGW30205.1| alcohol acyl transferase [Malus domestica]
Length=455

 Score =   160 bits (405),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/128 (59%), Positives = 100/128 (78%), Gaps = 1/128 (1%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANP-LMKAKDPVEAIRDAVAKALVWYYPL  287
            AKPTPQETK LS+IDDQ+ LRF   +IM Y+ANP L K ++PV+ IR+A+++ALV+YYPL
Sbjct  20   AKPTPQETKFLSEIDDQESLRFQVPVIMCYKANPSLNKNRNPVKVIREALSRALVYYYPL  79

Query  288  AGRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQIL  467
            AGRL +GP  K +VDC+ +GI FVEA + ++LE LGD + PPC   +EFL+  PGS  I+
Sbjct  80   AGRLREGPNKKLVVDCNGEGILFVEASADVTLEQLGDKILPPCPLLEEFLFNFPGSGGII  139

Query  468  GCPLMIVQ  491
            GCPL++VQ
Sbjct  140  GCPLLLVQ  147



>ref|XP_007208844.1| hypothetical protein PRUPE_ppa025565mg [Prunus persica]
 gb|EMJ10043.1| hypothetical protein PRUPE_ppa025565mg [Prunus persica]
Length=558

 Score =   161 bits (408),  Expect = 2e-43, Method: Composition-based stats.
 Identities = 72/127 (57%), Positives = 97/127 (76%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            AKPTP ETK LS+IDDQ+ LRF   +IM Y+ NP MK  D VE IR+A+++ALV+YYPLA
Sbjct  23   AKPTPHETKLLSNIDDQESLRFQVPVIMSYKNNPSMKGNDAVEVIREALSRALVYYYPLA  82

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +GP  K MV+C+ +G+ F+EA++ ++L  LGD + PP  + +EFLY VPGS  ILG
Sbjct  83   GRLREGPNRKLMVECNGEGVLFIEANADVTLAQLGDTIAPPSPFLEEFLYNVPGSDGILG  142

Query  471  CPLMIVQ  491
            CPL+++Q
Sbjct  143  CPLLLIQ  149



>gb|AGW30204.1| truncated alcohol acyl transferase [Malus domestica]
Length=323

 Score =   157 bits (396),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 76/128 (59%), Positives = 98/128 (77%), Gaps = 1/128 (1%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANP-LMKAKDPVEAIRDAVAKALVWYYPL  287
            AKPT QETK LSDIDDQ+GLRF   +IM Y+ NP L K  +PV+ IR+A+++ALV+YYPL
Sbjct  20   AKPTLQETKFLSDIDDQEGLRFQVPVIMCYKDNPSLNKNCNPVKVIREALSRALVYYYPL  79

Query  288  AGRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQIL  467
            AGRL +GP  K MVDC+ +GI FVEA + ++LE LGD + PPC   +EFL+  PGS  I+
Sbjct  80   AGRLKEGPNRKLMVDCNGEGILFVEASADVTLEQLGDKILPPCPLLEEFLFNFPGSDGII  139

Query  468  GCPLMIVQ  491
            GCPL++VQ
Sbjct  140  GCPLLLVQ  147



>ref|XP_009368287.1| PREDICTED: methanol O-anthraniloyltransferase-like [Pyrus x bretschneideri]
Length=463

 Score =   159 bits (403),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 74/128 (58%), Positives = 99/128 (77%), Gaps = 1/128 (1%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANP-LMKAKDPVEAIRDAVAKALVWYYPL  287
            AKPTPQETK LSDIDDQ+G RF   +IM Y+ NP + K ++PV+ IR+A+++ALV+YYPL
Sbjct  20   AKPTPQETKFLSDIDDQEGFRFQVPIIMCYKDNPSVNKNRNPVQVIREALSRALVYYYPL  79

Query  288  AGRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQIL  467
            AGRL +GP  K +VDC+ +GI FVEA + ++LE LGD + PPC   +EFL+  PGS  I+
Sbjct  80   AGRLREGPNKKLVVDCNGEGILFVEASADVTLEQLGDKILPPCPLLEEFLFNFPGSDGII  139

Query  468  GCPLMIVQ  491
            GCPL++VQ
Sbjct  140  GCPLLLVQ  147



>ref|XP_011009229.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Populus 
euphratica]
Length=456

 Score =   159 bits (403),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 96/127 (76%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            AKPTP+E K LSDIDDQ+GLRFH  +I FYR NP M  KDPV+ IR+A+AK LV+YYP A
Sbjct  23   AKPTPREFKLLSDIDDQEGLRFHIPLIHFYRHNPSMHGKDPVKVIREAIAKTLVFYYPFA  82

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +G   K MV+C+ +GI F+EAD+ ++LE  GD ++PP    +E L++VPGS  +L 
Sbjct  83   GRLREGHNRKLMVECTGEGILFIEADADVTLEQFGDPLQPPFPCLEELLFDVPGSSGVLN  142

Query  471  CPLMIVQ  491
            CPL+++Q
Sbjct  143  CPLLLIQ  149



>gb|AHC32224.2| alcohol acyl transferase 1 [Eriobotrya japonica]
Length=459

 Score =   159 bits (403),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 76/128 (59%), Positives = 102/128 (80%), Gaps = 1/128 (1%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANP-LMKAKDPVEAIRDAVAKALVWYYPL  287
            AKP PQETK LSDIDDQ+GLRFH  +IM Y+ NP L + ++PV+ IR+AV++ALV+YYPL
Sbjct  20   AKPMPQETKFLSDIDDQEGLRFHVPVIMCYKDNPSLNENRNPVKVIREAVSRALVYYYPL  79

Query  288  AGRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQIL  467
            AGRL + P  K +VDC+++GI FVEA ++++LE LGD + PPC   +EFL+ VPGS  I+
Sbjct  80   AGRLREWPNRKLVVDCNSEGILFVEAFANVTLEQLGDKILPPCPLLEEFLFNVPGSDGII  139

Query  468  GCPLMIVQ  491
            GCPL++VQ
Sbjct  140  GCPLLLVQ  147



>ref|XP_008355599.1| PREDICTED: methanol O-anthraniloyltransferase-like [Malus domestica]
Length=454

 Score =   159 bits (402),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 74/129 (57%), Positives = 101/129 (78%), Gaps = 2/129 (2%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLM--KAKDPVEAIRDAVAKALVWYYP  284
            AKPTP ETK LSDIDDQ+GLRF   ++M Y+ NPL+     DPV+ +++A++KALV+YYP
Sbjct  23   AKPTPHETKLLSDIDDQEGLRFQTPVLMSYKNNPLIPKDRTDPVKVLKEALSKALVFYYP  82

Query  285  LAGRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQI  464
            LAGRL +GP  K MV+C+ +G+ F+EAD+ ++LE LGDA+ PPC + +EFL + PGS  I
Sbjct  83   LAGRLREGPNRKLMVECTGEGVLFIEADADVTLEQLGDALVPPCPFLEEFLCDAPGSDGI  142

Query  465  LGCPLMIVQ  491
            LGCPL++VQ
Sbjct  143  LGCPLLLVQ  151



>ref|XP_002319767.1| transferase family protein [Populus trichocarpa]
 gb|EEE95690.1| transferase family protein [Populus trichocarpa]
 gb|AJD25144.1| benzoyl-CoA:salicyl alcohol O-benzoyltransferase [Populus trichocarpa]
Length=459

 Score =   159 bits (402),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 71/127 (56%), Positives = 97/127 (76%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            AKPTP E K LSDIDDQ+GLRFH  +I FYR NP ++ KDPV+ IR+A+AK LV+YYP A
Sbjct  23   AKPTPHEFKLLSDIDDQEGLRFHIPVIQFYRHNPSVQGKDPVKVIREAIAKTLVFYYPFA  82

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +G   K MV+C+ +GI F+EAD+ ++LE  GDA++PP    +E +++VPGS  +L 
Sbjct  83   GRLREGQNRKLMVECTGEGILFIEADADVTLEQFGDALQPPFPCLEELIFDVPGSSGVLN  142

Query  471  CPLMIVQ  491
            CPL+++Q
Sbjct  143  CPLLLIQ  149



>ref|XP_002524021.1| transferase, putative [Ricinus communis]
 gb|EEF38389.1| transferase, putative [Ricinus communis]
Length=265

 Score =   155 bits (391),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 69/127 (54%), Positives = 97/127 (76%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            AKPTP E K LSDIDDQ+GLRFH  +I FYR +P MK KDP + IR+A+A+ LV+YYP A
Sbjct  24   AKPTPHEFKPLSDIDDQEGLRFHIPVIQFYRCDPSMKGKDPAKVIREALAETLVFYYPFA  83

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +GP+ K MV+C+ +G+ F+EAD+ +SL+  GDA++PP    ++ L++VPGS  +L 
Sbjct  84   GRLREGPDRKLMVECTGEGVLFIEADADVSLQQFGDALQPPFPCLEDLLFDVPGSTAVLN  143

Query  471  CPLMIVQ  491
             PL+++Q
Sbjct  144  SPLLLIQ  150



>ref|XP_002319766.1| hypothetical protein POPTR_0013s07230g [Populus trichocarpa]
 gb|EEE95689.1| hypothetical protein POPTR_0013s07230g [Populus trichocarpa]
Length=456

 Score =   159 bits (401),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 95/127 (75%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            AKPTP E K LSDIDDQ+GLRFH  +I FYR NP M  KDPV+ IR+A+AK LV+YYP A
Sbjct  23   AKPTPHEFKLLSDIDDQEGLRFHVPIIQFYRHNPSMHGKDPVKVIREAIAKTLVFYYPFA  82

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +G   K MV+C+ +GI F+EAD+ ++LE  GD ++PP    +E L++VPGS  +L 
Sbjct  83   GRLREGHNRKLMVECTGEGILFIEADADVTLEQFGDPLQPPFPCLEELLFDVPGSSGVLN  142

Query  471  CPLMIVQ  491
            CPL+++Q
Sbjct  143  CPLLLIQ  149



>gb|ABK96738.1| unknown [Populus trichocarpa x Populus deltoides]
Length=440

 Score =   158 bits (399),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 71/127 (56%), Positives = 96/127 (76%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            AKPTP+E K LSDIDDQ+GLRFH  +I FYR NP M  KDPV+ IR+A+AK L++YYP A
Sbjct  23   AKPTPREFKLLSDIDDQEGLRFHIPLIQFYRHNPSMHGKDPVKVIREAIAKTLLFYYPFA  82

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +G   K MV+C+ +GI F+EAD+ ++LE  GD ++PP    +E L++VPGS  +L 
Sbjct  83   GRLREGHNRKLMVECTGEGILFIEADADVTLEQFGDPLQPPFPCLEELLFDVPGSSGVLN  142

Query  471  CPLMIVQ  491
            CPL+++Q
Sbjct  143  CPLLLIQ  149



>gb|KJB82262.1| hypothetical protein B456_013G185500 [Gossypium raimondii]
Length=454

 Score =   158 bits (399),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 97/127 (76%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            AKPTP E K LSDIDDQ+GLRF   +I FY+ NP M+ KDPV  IR+A+A+ALV+YYP A
Sbjct  23   AKPTPHEYKLLSDIDDQEGLRFQIPVIQFYKYNPSMQGKDPVRVIREALAQALVFYYPFA  82

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +G + K MVDCS +G+ F+EAD+ ++LE  GDA++PP    +E LY+VPGS  +L 
Sbjct  83   GRLREGAQRKLMVDCSGEGVMFIEADADVTLEQFGDALQPPFPCLEELLYDVPGSTGVLN  142

Query  471  CPLMIVQ  491
            CP++++Q
Sbjct  143  CPVILIQ  149



>gb|KHF99421.1| Benzyl alcohol O-benzoyltransferase [Gossypium arboreum]
Length=454

 Score =   158 bits (399),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 71/127 (56%), Positives = 97/127 (76%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            AKPTP E K LSDIDDQ+GLRF   +I FY+ NP M+ KDPV  IR+A+A+ALV+YYP A
Sbjct  23   AKPTPHEYKLLSDIDDQEGLRFQIPVIQFYKYNPSMQGKDPVRVIREALAQALVFYYPFA  82

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +GP+ K MVDC+ +G+ F+EAD+ ++LE  GD ++PP    +E LY+VPGS  +L 
Sbjct  83   GRLREGPQRKLMVDCTGEGLMFIEADADVTLEQFGDVLQPPFPCLEELLYDVPGSTGVLN  142

Query  471  CPLMIVQ  491
            CP++++Q
Sbjct  143  CPVILIQ  149



>ref|XP_006470570.1| PREDICTED: anthraniloyl-CoA:methanol acyltransferase-like [Citrus 
sinensis]
Length=456

 Score =   158 bits (399),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 68/128 (53%), Positives = 101/128 (79%), Gaps = 2/128 (2%)
 Frame = +3

Query  114  KPTPQETKELSDIDDQKGLRFHFCMIMFYRANPL--MKAKDPVEAIRDAVAKALVWYYPL  287
            +PTP+E K++SDIDDQ+ LRF   ++ FY+ +P   M+ +DPV+ IR+A++KALV+YYPL
Sbjct  23   RPTPREVKQISDIDDQESLRFQIPLLFFYKNDPSPSMQGRDPVKVIREAISKALVFYYPL  82

Query  288  AGRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQIL  467
            AGRL +G   K MV+C+A+G+ F+EAD++ +LE LGD ++PPC Y  + +Y+VPGS  IL
Sbjct  83   AGRLKEGYNRKLMVECNAEGVLFIEADANFTLEQLGDDIQPPCPYLNQLIYDVPGSEGIL  142

Query  468  GCPLMIVQ  491
            GCPL+++Q
Sbjct  143  GCPLLLIQ  150



>emb|CDP11065.1| unnamed protein product [Coffea canephora]
Length=169

 Score =   150 bits (379),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 76/129 (59%), Positives = 92/129 (71%), Gaps = 2/129 (2%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            AK TPQE + LSDIDDQKG RFH  MIMFY  N  M  K+PV  IRDAVAKALV+YYP A
Sbjct  16   AKTTPQEIRPLSDIDDQKGHRFHLPMIMFYSYNQCMDEKNPVGVIRDAVAKALVYYYPYA  75

Query  291  GRLIQGPE--DKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQI  464
            GRLI+GP    K  V+C+A+G  F EA + + LE L D ++PPC +SKEFL +  GS +I
Sbjct  76   GRLIEGPTGAGKIFVNCTAEGAVFREAIAEVMLEQLRDFIRPPCPFSKEFLVDSFGSTEI  135

Query  465  LGCPLMIVQ  491
            L  PLM++Q
Sbjct  136  LDSPLMLIQ  144



>gb|AAN85436.1| acyltransferase 2 [Capsicum chinense]
Length=453

 Score =   157 bits (398),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 94/124 (76%), Gaps = 0/124 (0%)
 Frame = +3

Query  120  TPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLAGRL  299
            TP+ETK LSDIDDQ   R    ++MFY+ N LM+ KDP + I+D ++K L +YYPLAGRL
Sbjct  29   TPRETKHLSDIDDQGSARLQIPILMFYKYNSLMEGKDPAKLIKDGLSKTLSFYYPLAGRL  88

Query  300  IQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILGCPL  479
            I+GP  K MV+C+++G+ FVEAD+++ LE LGD++KPPC Y    L+ VPGS  I+GCPL
Sbjct  89   IEGPNRKLMVNCNSEGVLFVEADANVELEKLGDSIKPPCPYLDLLLHNVPGSDGIIGCPL  148

Query  480  MIVQ  491
            ++VQ
Sbjct  149  LLVQ  152



>gb|AJD18611.1| alcohol acyltransferase [Pyrus ussuriensis]
Length=459

 Score =   157 bits (398),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 74/128 (58%), Positives = 100/128 (78%), Gaps = 1/128 (1%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANP-LMKAKDPVEAIRDAVAKALVWYYPL  287
            AK TPQETK LSDIDDQ+ LRFH  +IM Y+ NP L K ++PV+ IR+A+++ALV+YYPL
Sbjct  20   AKSTPQETKFLSDIDDQEFLRFHVPVIMCYKDNPSLNKNRNPVKVIREALSRALVYYYPL  79

Query  288  AGRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQIL  467
            AGRL +GP  K +V+C+ +GI FVEA ++++LE LGD + PPC   +EFL+  PGS  I+
Sbjct  80   AGRLREGPNRKLVVNCNGEGILFVEASANVTLEQLGDKILPPCPLLEEFLFNFPGSDGII  139

Query  468  GCPLMIVQ  491
            GCPL++VQ
Sbjct  140  GCPLLLVQ  147



>gb|KDP39568.1| hypothetical protein JCGZ_02588 [Jatropha curcas]
Length=459

 Score =   157 bits (398),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 71/127 (56%), Positives = 96/127 (76%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            +KPTP E K LSDIDDQ GLRFH  +I FYR +P MK KDPV+ IR+A+ K LV+YYP A
Sbjct  23   SKPTPHEFKLLSDIDDQDGLRFHIPVIQFYRYDPSMKGKDPVKVIREAIGKTLVFYYPFA  82

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +GPE K MV+C+ +G+ F+EAD+ +SLED GDA++PP    ++ L++VPGS  +L 
Sbjct  83   GRLREGPERKLMVECTGEGVLFIEADADVSLEDFGDALQPPFPCLEDLLFDVPGSTSVLN  142

Query  471  CPLMIVQ  491
              L+++Q
Sbjct  143  SALLLIQ  149



>gb|AGW30203.1| alcohol acyl transferase [Malus domestica]
Length=455

 Score =   157 bits (396),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 74/128 (58%), Positives = 99/128 (77%), Gaps = 1/128 (1%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANP-LMKAKDPVEAIRDAVAKALVWYYPL  287
            AKPTPQETK LSDIDDQ+ LRF   +IM Y+ NP L K ++PV+ IR+A+++ALV+YYPL
Sbjct  20   AKPTPQETKFLSDIDDQEFLRFQVPIIMCYKDNPSLNKNRNPVKVIREALSRALVYYYPL  79

Query  288  AGRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQIL  467
            AGRL +GP  K +VDC+ +GI F+EA + ++LE LGD + PPC   +EFL+  PGS  I+
Sbjct  80   AGRLREGPNRKLVVDCNGEGILFIEASADVTLEQLGDKILPPCPLLEEFLFNFPGSDGII  139

Query  468  GCPLMIVQ  491
            GCPL++VQ
Sbjct  140  GCPLVLVQ  147



>gb|KDO44966.1| hypothetical protein CISIN_1g0133462mg, partial [Citrus sinensis]
Length=152

 Score =   149 bits (376),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 98/133 (74%), Gaps = 4/133 (3%)
 Frame = +3

Query  105  GTAKPTPQETKELSDIDDQKGLRFHFCMIMFYRANP--LMKAKDPVEAIRDAVAKALVWY  278
            G A+PT +  K+LS++DDQ+ +RF   MI FY+ +P   M+ KDPV+ IR+A++KAL +Y
Sbjct  20   GPARPTARVIKQLSNLDDQQCVRFQIPMIFFYKNDPSPAMEGKDPVKVIREALSKALTFY  79

Query  279  YPLAGRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDL--GDAVKPPCLYSKEFLYEVPG  452
            YPLAGRL +    K MVDC+ +G+ F EA+++++LE L  GDAV+PPC Y  E LY VPG
Sbjct  80   YPLAGRLKEVSNRKLMVDCNGEGVLFTEAEANITLEQLEVGDAVRPPCPYLHELLYNVPG  139

Query  453  SHQILGCPLMIVQ  491
            S  ILGCPL+++Q
Sbjct  140  SEGILGCPLLLIQ  152



>ref|XP_002319765.2| hypothetical protein POPTR_0013s07220g [Populus trichocarpa]
 gb|EEE95688.2| hypothetical protein POPTR_0013s07220g [Populus trichocarpa]
Length=440

 Score =   157 bits (396),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 95/127 (75%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            AKPTP E K LSDIDDQ+GLR+H   I FYR NP ++ KDPV+ IR+A+AK LV+YYP A
Sbjct  23   AKPTPHEFKLLSDIDDQEGLRYHIPFIQFYRHNPSLQGKDPVKVIREAIAKTLVFYYPFA  82

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL+ G   K MV+C+ +GI F+EAD+ ++LE  GD ++PP    +E L++VPGS  +L 
Sbjct  83   GRLMAGHNRKLMVECTGEGILFIEADADVTLEQFGDPLQPPFPCLEELLFDVPGSSGVLN  142

Query  471  CPLMIVQ  491
            CPL+++Q
Sbjct  143  CPLLLIQ  149



>ref|XP_008797996.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Phoenix 
dactylifera]
Length=182

 Score =   150 bits (378),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 90/127 (71%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            A+PTP E K LSD+DDQ+GLRF    I FYR +P M  +DP   IR+A+AKALV YYP A
Sbjct  20   AEPTPHEFKRLSDVDDQEGLRFQIPAIQFYRHDPSMAGRDPARVIREALAKALVHYYPFA  79

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +G   K +V+C+ +G+ F+EAD+ + LE  GDA++PP  Y +E LY+V GS  +L 
Sbjct  80   GRLREGARRKLVVECTGEGVLFIEADADVRLEQFGDALQPPSPYLEELLYDVEGSGDVLN  139

Query  471  CPLMIVQ  491
            CPL++ Q
Sbjct  140  CPLLLFQ  146



>ref|XP_004239236.1| PREDICTED: methanol O-anthraniloyltransferase-like [Solanum lycopersicum]
Length=448

 Score =   156 bits (395),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 93/124 (75%), Gaps = 0/124 (0%)
 Frame = +3

Query  120  TPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLAGRL  299
            TP E K LS+IDDQ   RFH  ++MFY+ N LM+  DP + I++ ++K LV+YYPLAGRL
Sbjct  24   TPHEIKHLSEIDDQGSTRFHVSVLMFYKYNSLMEGNDPAKIIKNGLSKTLVFYYPLAGRL  83

Query  300  IQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILGCPL  479
            I+GP  K MV+C+ +G+ F+EAD+++ LE LGD++KPPC Y    L+ VPGS  ++GCPL
Sbjct  84   IEGPNKKLMVNCNGEGVLFIEADANVELEKLGDSIKPPCPYMDLLLHNVPGSDGMIGCPL  143

Query  480  MIVQ  491
            +++Q
Sbjct  144  LLIQ  147



>ref|XP_010689156.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Beta vulgaris 
subsp. vulgaris]
Length=443

 Score =   156 bits (395),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 97/127 (76%), Gaps = 1/127 (1%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            A+PTPQE K LSDIDDQ+GLRF    IMFYRA+P M+ KDPV+ ++DA+AKALV+YYP A
Sbjct  26   AQPTPQELKPLSDIDDQEGLRFQMPAIMFYRADPSMEGKDPVKVVKDALAKALVFYYPYA  85

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL++GP  K  VDC+ +G+ F+EAD+   LED GD + PP    ++ LY++PG+  +LG
Sbjct  86   GRLVEGPTRKLSVDCTGEGLPFIEADADARLEDFGDEIHPP-FPLEDLLYDIPGTDGMLG  144

Query  471  CPLMIVQ  491
             PL+IVQ
Sbjct  145  TPLIIVQ  151



>ref|XP_008391402.1| PREDICTED: methanol O-anthraniloyltransferase-like [Malus domestica]
Length=459

 Score =   156 bits (395),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 74/127 (58%), Positives = 98/127 (77%), Gaps = 1/127 (1%)
 Frame = +3

Query  114  KPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMK-AKDPVEAIRDAVAKALVWYYPLA  290
            K TP+ETK LSDIDDQ+ LRFH  +IM Y+ NP +K  ++PV+AIR+A+++ALV+YYPLA
Sbjct  21   KSTPRETKFLSDIDDQESLRFHVPVIMCYKDNPSLKENRNPVKAIREALSRALVYYYPLA  80

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +GP  K MVDC+ +GI FVEA + ++LE LGD + PPC   +EFL   PGS  I+G
Sbjct  81   GRLREGPNRKLMVDCNGEGILFVEASADVTLEQLGDKILPPCPLLEEFLVNFPGSDGIIG  140

Query  471  CPLMIVQ  491
            CPL++VQ
Sbjct  141  CPLLLVQ  147



>ref|XP_010689157.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Beta vulgaris 
subsp. vulgaris]
Length=443

 Score =   156 bits (394),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 98/127 (77%), Gaps = 1/127 (1%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            A+PTP+E K LSDIDDQ+GLRFH   IMFYRA+P M+ KDPV+ ++DA+AKALV+YYP A
Sbjct  26   AEPTPRELKPLSDIDDQEGLRFHMPAIMFYRADPSMEEKDPVKVVKDALAKALVFYYPYA  85

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL++GP  K  VDC+ +G+ F+EA++   LED GD + PP    ++ LY++PG+  +LG
Sbjct  86   GRLVEGPTRKLSVDCTGEGVPFIEAEADARLEDFGDEIHPP-FPLQDLLYDMPGTDGMLG  144

Query  471  CPLMIVQ  491
             PL+IVQ
Sbjct  145  TPLLIVQ  151



>ref|XP_006368247.1| hypothetical protein POPTR_0001s00950g [Populus trichocarpa]
 gb|ERP64816.1| hypothetical protein POPTR_0001s00950g [Populus trichocarpa]
Length=462

 Score =   156 bits (394),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 96/132 (73%), Gaps = 5/132 (4%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAK----DPVEAIRDAVAKALVWY  278
            AKPTP E K+LSD+DDQ+GLRFH   I F+R            DPV+ IRDA+A ALV Y
Sbjct  24   AKPTPSEVKQLSDLDDQEGLRFHMPFIAFFRNTNKKGGNGTYPDPVKVIRDALAHALVCY  83

Query  279  YPLAGRLIQGPEDKFMVDCSAQ-GIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGS  455
            YPLAGRL +G   K MVDC+ + G+ F+EAD+ ++LE LGDA++PPC Y + FLY++PGS
Sbjct  84   YPLAGRLKEGDSRKLMVDCTGELGVLFIEADADITLEHLGDAIQPPCPYLEHFLYDIPGS  143

Query  456  HQILGCPLMIVQ  491
              I+GCPLM++Q
Sbjct  144  SGIIGCPLMLIQ  155



>ref|XP_006470747.1| PREDICTED: anthraniloyl-CoA:methanol acyltransferase-like [Citrus 
sinensis]
Length=468

 Score =   156 bits (394),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 68/127 (54%), Positives = 100/127 (79%), Gaps = 2/127 (2%)
 Frame = +3

Query  114  KPTPQETKELSDIDDQKGLRFHFCMIMFYRANPL--MKAKDPVEAIRDAVAKALVWYYPL  287
            +PTP+E K++SDIDDQ+ LRF   ++ FY+ +P   M+ +DPV+ IR+A++KALV+YYPL
Sbjct  23   RPTPREVKQISDIDDQESLRFQIPLLFFYKNDPSPSMQGRDPVKVIREAISKALVFYYPL  82

Query  288  AGRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQIL  467
            AGRL +G   K MV+C+A+G+ F+EAD++ +LE LGD ++PPC Y  + +Y+VPGS  IL
Sbjct  83   AGRLKEGYNRKLMVECNAEGVLFIEADANFTLEQLGDDIQPPCPYLNQLIYDVPGSEGIL  142

Query  468  GCPLMIV  488
            GCPL++V
Sbjct  143  GCPLLLV  149



>ref|XP_008373476.1| PREDICTED: methanol O-anthraniloyltransferase-like [Malus domestica]
Length=460

 Score =   156 bits (394),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 100/128 (78%), Gaps = 1/128 (1%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANP-LMKAKDPVEAIRDAVAKALVWYYPL  287
            AKPTP+ETK LSDIDDQ+G+RF   +IM Y+ NP L + ++PV+ IR+A+++ALV+YYPL
Sbjct  20   AKPTPRETKFLSDIDDQEGMRFQLPIIMCYKDNPSLNENRNPVKTIREALSRALVYYYPL  79

Query  288  AGRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQIL  467
            AGRL +GP+ K MVDC+ +GI FVEA ++++LE LGD   PPC   +EFL+   GS  I+
Sbjct  80   AGRLREGPDRKLMVDCNGEGILFVEASANVTLEQLGDKXLPPCPLLEEFLFNFLGSDGII  139

Query  468  GCPLMIVQ  491
            GCPL++VQ
Sbjct  140  GCPLLLVQ  147



>ref|XP_008368021.1| PREDICTED: methanol O-anthraniloyltransferase-like [Malus domestica]
Length=455

 Score =   155 bits (393),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 75/128 (59%), Positives = 97/128 (76%), Gaps = 1/128 (1%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANP-LMKAKDPVEAIRDAVAKALVWYYPL  287
            AKPT QETK LSDIDDQ+GLRF   +IM Y+ NP L K  +PV+ IR+A+++ALV+YYPL
Sbjct  20   AKPTXQETKFLSDIDDQEGLRFQVPVIMCYKDNPSLNKNCNPVKVIREALSRALVYYYPL  79

Query  288  AGRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQIL  467
            AGRL +GP  K  VDC+ +GI FVEA + ++LE LGD + PPC   +EFL+  PGS  I+
Sbjct  80   AGRLKEGPNXKLXVDCNGEGILFVEASADVTLEQLGDXILPPCPLLEEFLFNFPGSDGII  139

Query  468  GCPLMIVQ  491
            GCPL++VQ
Sbjct  140  GCPLLLVQ  147



>ref|XP_007029789.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase [Theobroma 
cacao]
 gb|EOY10291.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase [Theobroma 
cacao]
Length=452

 Score =   155 bits (393),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 93/127 (73%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            AKPTP E K LSDIDDQ+ L F   +I FYR NP M+ KDPV+ IR+A+AKALV+YYP A
Sbjct  23   AKPTPHECKLLSDIDDQESLHFQVPVIQFYRHNPSMQGKDPVKIIREALAKALVFYYPFA  82

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +GP  K MVDC+ +G+ F+EAD+ ++LE  GD + PP     E LY+VPGS  +L 
Sbjct  83   GRLREGPNRKLMVDCTGEGVLFIEADADVTLEQFGDELHPPFPCLDELLYDVPGSEGMLN  142

Query  471  CPLMIVQ  491
            CPL+++Q
Sbjct  143  CPLLLIQ  149



>ref|XP_006351055.1| PREDICTED: anthraniloyl-CoA:methanol acyltransferase-like [Solanum 
tuberosum]
Length=447

 Score =   155 bits (392),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 68/124 (55%), Positives = 95/124 (77%), Gaps = 0/124 (0%)
 Frame = +3

Query  120  TPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLAGRL  299
            TP+ETK LS+IDDQ   RFH  +++FY+ N  MK KDP + I++ ++K LV+YYPLAGRL
Sbjct  23   TPRETKYLSEIDDQGSTRFHSHILIFYKYNSSMKGKDPAKIIKNGLSKTLVFYYPLAGRL  82

Query  300  IQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILGCPL  479
            I+GP  K MV+C+++GI F+EAD+ + L+ LGD++KPPC Y    L+ VPGS  I+GCPL
Sbjct  83   IEGPNRKLMVNCNSEGIMFIEADAYVVLDKLGDSIKPPCPYLDLLLHNVPGSDGIIGCPL  142

Query  480  MIVQ  491
            ++VQ
Sbjct  143  LLVQ  146



>ref|NP_001275839.1| alcohol acyl transferase [Citrus sinensis]
 gb|ABW81204.1| alcohol acyl transferase [Citrus sinensis]
Length=456

 Score =   155 bits (392),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 68/128 (53%), Positives = 100/128 (78%), Gaps = 2/128 (2%)
 Frame = +3

Query  114  KPTPQETKELSDIDDQKGLRFHFCMIMFYRANPL--MKAKDPVEAIRDAVAKALVWYYPL  287
            +PTP+E K++SDIDDQ+ LRF   ++ FY+ +P   M+ +DPV+ IR+A++KALV+YYPL
Sbjct  23   RPTPREVKQISDIDDQESLRFQIPLLFFYKNDPSPSMQGRDPVKVIREAISKALVFYYPL  82

Query  288  AGRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQIL  467
            AGRL +G   K MV+C+A+G+ F+EAD++ +LE L D V+PPC Y  + +Y+VPGS  IL
Sbjct  83   AGRLKEGYNRKLMVECNAEGVLFIEADANFTLEQLRDDVQPPCPYLNQLIYDVPGSEGIL  142

Query  468  GCPLMIVQ  491
            GCPL+++Q
Sbjct  143  GCPLLLIQ  150



>gb|KDO54865.1| hypothetical protein CISIN_1g048162mg [Citrus sinensis]
Length=152

 Score =   148 bits (373),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/128 (55%), Positives = 93/128 (73%), Gaps = 3/128 (2%)
 Frame = +3

Query  117  PTPQETKELSDIDDQKGLRFHFCMIMFYRANPL--MKAKDPVEAIRDAVAKALVWYYPLA  290
            P   E K+LSDIDDQ+GL F   +I FY+ NP   MK KDPV+ I++A+++ALV+YYP A
Sbjct  25   PKSHEVKQLSDIDDQQGLWFQVPLIFFYKNNPSPSMKGKDPVKVIKEALSRALVYYYPFA  84

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLG-DAVKPPCLYSKEFLYEVPGSHQIL  467
            GRL +G   K MVDC+ +G+ F EAD+  SL+ LG D +KPPC Y  E LY+VPGS  IL
Sbjct  85   GRLREGSNGKLMVDCNGEGVLFTEADADFSLDQLGDDEIKPPCPYLDELLYDVPGSEGIL  144

Query  468  GCPLMIVQ  491
            GCPL++++
Sbjct  145  GCPLLLIR  152



>gb|AAS79797.1| alcohol acyl transferase [Malus domestica]
Length=459

 Score =   155 bits (392),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/128 (59%), Positives = 97/128 (76%), Gaps = 1/128 (1%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANP-LMKAKDPVEAIRDAVAKALVWYYPL  287
            AKPT QE K LSDIDDQ+GLRF   +IM Y+ NP L K  +PV+ IR+A+++ALV+YYPL
Sbjct  20   AKPTLQEAKFLSDIDDQEGLRFQVPVIMCYKDNPSLNKNCNPVKVIREALSRALVYYYPL  79

Query  288  AGRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQIL  467
            AGRL +GP  K MVDC+ +GI FVEA + ++LE LGD + PPC   +EFL+  PGS  I+
Sbjct  80   AGRLKEGPNRKLMVDCNGEGILFVEASADVTLEQLGDKILPPCPLLEEFLFNFPGSDGII  139

Query  468  GCPLMIVQ  491
            GCPL++VQ
Sbjct  140  GCPLLLVQ  147



>ref|XP_010275172.1| PREDICTED: benzyl alcohol O-benzoyltransferase [Nelumbo nucifera]
Length=459

 Score =   155 bits (392),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 69/127 (54%), Positives = 96/127 (76%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            AKPTP E K+LSDIDDQ+GLRF   +I FYR +P M+ ++P +AIR A+AKALV+YYP A
Sbjct  22   AKPTPHEFKDLSDIDDQEGLRFQIPVIQFYRYDPSMEGRNPTQAIRQAIAKALVFYYPFA  81

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +GP  K  V+C+ +G+ F+EAD+ + LE  GDA++PP    +E L++VPGS  +L 
Sbjct  82   GRLREGPHRKLTVECTGEGVMFIEADADVRLEQFGDALQPPFPCLEELLFDVPGSGGVLN  141

Query  471  CPLMIVQ  491
            CPL+++Q
Sbjct  142  CPLLLIQ  148



>ref|XP_008232530.1| PREDICTED: benzyl alcohol O-benzoyltransferase [Prunus mume]
Length=461

 Score =   155 bits (392),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 95/127 (75%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            AK TP E ++LSDIDDQ+GLRF   +I FYR +P M+  DPV  IR+A+A+ LV+YYP A
Sbjct  23   AKATPHEFQQLSDIDDQEGLRFQIPVIQFYRYDPSMQGSDPVTVIREAIAETLVFYYPFA  82

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +GP  K MVDC+A+GI F+EAD+ ++L+  GDA++PP    +E LY VPGS  +L 
Sbjct  83   GRLREGPARKLMVDCTAEGILFIEADADVTLQQFGDALQPPFPCLEELLYNVPGSDGVLN  142

Query  471  CPLMIVQ  491
            CPL+++Q
Sbjct  143  CPLLLIQ  149



>gb|ACJ85557.1| unknown [Medicago truncatula]
Length=459

 Score =   155 bits (391),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 95/127 (75%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            +KPTP E K LSDIDDQ+GLRF   +I FY+ +P M  KDPV+ IR A AK LV+YYP A
Sbjct  20   SKPTPHEIKLLSDIDDQEGLRFQIPVIQFYKYDPNMAGKDPVDIIRKASAKTLVFYYPFA  79

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +GP  K MVDC+ +G+ F+EAD+ +SL++ GDA++PP     E L++VPGS ++L 
Sbjct  80   GRLREGPGRKLMVDCTGEGVLFIEADADVSLKEFGDALQPPFPCLDELLFDVPGSSEVLN  139

Query  471  CPLMIVQ  491
            CPL+++Q
Sbjct  140  CPLLVIQ  146



>ref|XP_011018694.1| PREDICTED: methanol O-anthraniloyltransferase-like [Populus euphratica]
Length=461

 Score =   155 bits (391),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 96/132 (73%), Gaps = 5/132 (4%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAK----DPVEAIRDAVAKALVWY  278
            AKPTP E K+LSD+DDQ+GLRFH   I F+R            DPV+ IRDA+A ALV+Y
Sbjct  23   AKPTPSEVKQLSDLDDQEGLRFHMPFIAFFRNTNKKGGNETYPDPVKVIRDALAHALVYY  82

Query  279  YPLAGRLIQGPEDKFMVDCSAQ-GIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGS  455
            YPLAGRL +G   K MVDC+ + G+ F+EA + ++LE LGDA++PPC Y + FLY++PGS
Sbjct  83   YPLAGRLKEGDSRKLMVDCTGELGVLFIEAVADITLEHLGDAIQPPCPYLEHFLYDIPGS  142

Query  456  HQILGCPLMIVQ  491
              I+GCPLM++Q
Sbjct  143  SGIIGCPLMLIQ  154



>ref|XP_004301775.1| PREDICTED: methanol O-anthraniloyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=444

 Score =   154 bits (390),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 72/128 (56%), Positives = 99/128 (77%), Gaps = 1/128 (1%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRA-NPLMKAKDPVEAIRDAVAKALVWYYPL  287
            AKPTPQE K LS+ID Q+GLRF    I+ Y+  NP MK KDPVE IRDA+ +ALV+YYP 
Sbjct  22   AKPTPQEKKLLSEIDIQEGLRFQTPFILSYKNDNPSMKQKDPVEVIRDALRRALVYYYPF  81

Query  288  AGRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQIL  467
            AGR+ +G   K +VDC+ +GI F+EAD+ ++LE LGD+++PPC + ++FL++VPGS  IL
Sbjct  82   AGRVRKGSNGKLLVDCNGEGIVFIEADADVTLEQLGDSLQPPCSFLEDFLFDVPGSDDIL  141

Query  468  GCPLMIVQ  491
            G PL+++Q
Sbjct  142  GTPLLLLQ  149



>gb|AFK36385.1| unknown [Medicago truncatula]
Length=459

 Score =   155 bits (391),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 95/127 (75%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            +KPTP E K LSDIDDQ+GLRF   +I FY+ +P M  KDPV+ IR A AK LV+YYP A
Sbjct  20   SKPTPHEIKLLSDIDDQEGLRFQIPVIQFYKYDPNMAGKDPVDIIRKASAKTLVFYYPFA  79

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +GP  K MVDC+ +G+ F+EAD+ +SL++ GDA++PP     E L++VPGS ++L 
Sbjct  80   GRLREGPGRKLMVDCTGEGVLFIEADADVSLKEFGDALQPPFPCLDELLFDVPGSSEVLN  139

Query  471  CPLMIVQ  491
            CPL+++Q
Sbjct  140  CPLLVIQ  146



>ref|XP_009336751.1| PREDICTED: methanol O-anthraniloyltransferase-like [Pyrus x bretschneideri]
Length=459

 Score =   154 bits (390),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 71/128 (55%), Positives = 98/128 (77%), Gaps = 1/128 (1%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANP-LMKAKDPVEAIRDAVAKALVWYYPL  287
            AKPTPQETK LSD+DDQ+GLRF   +IM Y+ N  L + ++P++ IR+A+++ALV+YYPL
Sbjct  20   AKPTPQETKFLSDVDDQEGLRFQLPIIMCYKDNSSLNENRNPIKVIREALSRALVYYYPL  79

Query  288  AGRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQIL  467
            AGRL +GP    MVDC+ +GI FVEA + ++LE +GD + PPC   +EFL+  PGS  I+
Sbjct  80   AGRLREGPNRMLMVDCNGEGILFVEASADVTLEQVGDKILPPCPLLEEFLFNFPGSDGII  139

Query  468  GCPLMIVQ  491
            GCPL++VQ
Sbjct  140  GCPLLLVQ  147



>ref|XP_009336752.1| PREDICTED: methanol O-anthraniloyltransferase-like [Pyrus x bretschneideri]
Length=459

 Score =   154 bits (390),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 71/128 (55%), Positives = 98/128 (77%), Gaps = 1/128 (1%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANP-LMKAKDPVEAIRDAVAKALVWYYPL  287
            AKPTPQETK LSD+DDQ+GLRF   +IM Y+ N  L + ++P++ IR+A+++ALV+YYPL
Sbjct  20   AKPTPQETKFLSDVDDQEGLRFQLPIIMCYKDNSSLNENRNPIKVIREALSRALVYYYPL  79

Query  288  AGRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQIL  467
            AGRL +GP    MVDC+ +GI FVEA + ++LE +GD + PPC   +EFL+  PGS  I+
Sbjct  80   AGRLREGPNRMLMVDCNGEGILFVEASADVTLEQVGDKILPPCPLLEEFLFNFPGSDGII  139

Query  468  GCPLMIVQ  491
            GCPL++VQ
Sbjct  140  GCPLLLVQ  147



>ref|XP_008362881.1| PREDICTED: methanol O-anthraniloyltransferase-like [Malus domestica]
Length=468

 Score =   154 bits (390),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 75/128 (59%), Positives = 97/128 (76%), Gaps = 1/128 (1%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANP-LMKAKDPVEAIRDAVAKALVWYYPL  287
            AKPT QE K LSDIDDQ+GLRF   +IM Y+ NP L K  +PV+ IR+A+++ALV+YYPL
Sbjct  20   AKPTLQEAKFLSDIDDQEGLRFQVPVIMCYKDNPSLNKNCNPVKVIREALSRALVYYYPL  79

Query  288  AGRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQIL  467
            AGRL +GP  K MVDC+ +GI FVEA + ++LE LGD + PPC   +EFL+  PGS  I+
Sbjct  80   AGRLKEGPNRKLMVDCNGEGILFVEASADVTLEQLGDKILPPCPLLEEFLFNFPGSDGII  139

Query  468  GCPLMIVQ  491
            GCPL++VQ
Sbjct  140  GCPLLLVQ  147



>gb|KDO36030.1| hypothetical protein CISIN_1g044203mg [Citrus sinensis]
Length=156

 Score =   147 bits (370),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 73/139 (53%), Positives = 96/139 (69%), Gaps = 7/139 (5%)
 Frame = +3

Query  96   RAPGTAKPT----PQETKELSDIDDQKGLRFHFCMIMFYRANPL--MKAKDPVEAIRDAV  257
            RAP    P       E K+LSDIDDQ+GL F   +I FY+ NP   MK KDPV+ I++A+
Sbjct  14   RAPELIGPALALKSHEVKQLSDIDDQQGLWFQVPLIFFYKNNPSPSMKGKDPVKVIKEAL  73

Query  258  AKALVWYYPLAGRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLG-DAVKPPCLYSKEF  434
            ++ALV+YYP AGRL +G + K MVDC+ +G+ F EAD+  SL+ LG D +KPPC Y  E 
Sbjct  74   SRALVYYYPFAGRLREGSDGKLMVDCNGEGVLFTEADADFSLDQLGDDEIKPPCPYLDEL  133

Query  435  LYEVPGSHQILGCPLMIVQ  491
            LY+VPGS   LGCPL+++Q
Sbjct  134  LYDVPGSEGTLGCPLLLIQ  152



>gb|AGK82816.1| alcohol acyltransferase 2 [Solanum pimpinellifolium]
Length=447

 Score =   154 bits (388),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 93/124 (75%), Gaps = 0/124 (0%)
 Frame = +3

Query  120  TPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLAGRL  299
            TP ETK LS+IDDQ   RFH  +++FY+ N LM+ KDP + I+D ++K LV+YYPLAGRL
Sbjct  23   TPHETKYLSEIDDQGSTRFHSHILIFYKYNSLMEGKDPAKIIKDGLSKTLVFYYPLAGRL  82

Query  300  IQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILGCPL  479
            I+GP  K MV+C+ +G+ F+E D+++ LE LG+++KPPC Y    L+ VPGS  I+G PL
Sbjct  83   IEGPNKKLMVNCNGEGVLFIEGDANVELEKLGESIKPPCPYLDLLLHNVPGSDGIIGSPL  142

Query  480  MIVQ  491
            ++VQ
Sbjct  143  LLVQ  146



>ref|XP_006446263.1| hypothetical protein CICLE_v10015199mg [Citrus clementina]
 gb|ESR59503.1| hypothetical protein CICLE_v10015199mg [Citrus clementina]
Length=456

 Score =   154 bits (389),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 100/128 (78%), Gaps = 2/128 (2%)
 Frame = +3

Query  114  KPTPQETKELSDIDDQKGLRFHFCMIMFYRANPL--MKAKDPVEAIRDAVAKALVWYYPL  287
            +PTP+E K++SDIDDQ+ LRF   ++ FY+ +P   M+ +DPV+ IR+A++KALV+YYPL
Sbjct  23   RPTPREVKQISDIDDQESLRFQIPLLFFYKNDPSPSMQGRDPVKVIREAISKALVFYYPL  82

Query  288  AGRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQIL  467
            AGRL +G   K MV+C+A+G+ F+EAD++ +LE L D ++PPC Y  + +Y+VPGS  IL
Sbjct  83   AGRLKEGYNRKLMVECNAEGVLFIEADANFTLEQLRDDLQPPCPYLNQLIYDVPGSEGIL  142

Query  468  GCPLMIVQ  491
            GCPL+++Q
Sbjct  143  GCPLLLIQ  150



>gb|KDP39576.1| hypothetical protein JCGZ_02596 [Jatropha curcas]
Length=454

 Score =   154 bits (388),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 68/127 (54%), Positives = 97/127 (76%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            +KP P E K LSDIDDQ+GLRFH  +I  YR +P M+ KDPV+ IR+A+AKALV+YYP A
Sbjct  21   SKPPPHELKPLSDIDDQEGLRFHIPVIQIYRHDPSMEGKDPVQVIRNAIAKALVFYYPFA  80

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +G   K ++DC+ +G+ F+EAD+++SL+  GDA++PP  +  E L++VPGS  IL 
Sbjct  81   GRLREGANRKLIMDCNGEGVLFIEADANVSLDQSGDALQPPFPFLDELLFDVPGSSGILN  140

Query  471  CPLMIVQ  491
            CP++++Q
Sbjct  141  CPVVLIQ  147



>gb|AGW30201.1| alcohol acyl transferase [Malus domestica]
Length=455

 Score =   154 bits (388),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 97/128 (76%), Gaps = 1/128 (1%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANP-LMKAKDPVEAIRDAVAKALVWYYPL  287
            AK TPQETK LSDIDDQ+ LR    +IM Y+ NP L K ++PV+AIR+A+++ALV+YYPL
Sbjct  20   AKSTPQETKFLSDIDDQESLRVQIPIIMCYKDNPSLNKNRNPVKAIREALSRALVYYYPL  79

Query  288  AGRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQIL  467
            AGRL +GP  K +VDC+ +GI FVEA + ++LE LGD + PPC   +EFLY  PGS  I+
Sbjct  80   AGRLREGPNRKLVVDCNGEGILFVEASADVTLEQLGDKILPPCPLLEEFLYNFPGSDGII  139

Query  468  GCPLMIVQ  491
             CPL+++Q
Sbjct  140  DCPLLLIQ  147



>ref|XP_008343918.1| PREDICTED: methanol O-anthraniloyltransferase-like [Malus domestica]
 gb|AAU14879.2| alcohol acyl transferase [Malus domestica]
 gb|AGW30200.1| alcohol acyl transferase [Malus domestica]
Length=455

 Score =   153 bits (387),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 97/128 (76%), Gaps = 1/128 (1%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANP-LMKAKDPVEAIRDAVAKALVWYYPL  287
            AK TPQETK LSDIDDQ+ LR    +IM Y+ NP L K ++PV+AIR+A+++ALV+YYPL
Sbjct  20   AKSTPQETKFLSDIDDQESLRVQIPIIMCYKDNPSLNKNRNPVKAIREALSRALVYYYPL  79

Query  288  AGRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQIL  467
            AGRL +GP  K +VDC+ +GI FVEA + ++LE LGD + PPC   +EFLY  PGS  I+
Sbjct  80   AGRLREGPNRKLVVDCNGEGILFVEASADVTLEQLGDKILPPCPLLEEFLYNFPGSDGII  139

Query  468  GCPLMIVQ  491
             CPL+++Q
Sbjct  140  DCPLLLIQ  147



>ref|XP_008364483.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Malus domestica]
Length=437

 Score =   153 bits (386),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 72/124 (58%), Positives = 97/124 (78%), Gaps = 1/124 (1%)
 Frame = +3

Query  123  PQETKELSDIDDQKGLRFHFCMIMFYRANP-LMKAKDPVEAIRDAVAKALVWYYPLAGRL  299
            PQETK LSDIDDQ+GLRF   +IM Y+ NP L K ++PV+ IR+A+++ALV+YYPLAGRL
Sbjct  2    PQETKFLSDIDDQEGLRFQVPIIMCYKDNPSLNKNRNPVKVIREALSRALVYYYPLAGRL  61

Query  300  IQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILGCPL  479
             +GP  K MVDC+ +GI FVEA ++++LE LGD + PPC   +EFL+  P S+ I+GCPL
Sbjct  62   REGPNRKLMVDCNGEGILFVEAFANVTLEQLGDKILPPCPLLEEFLFNFPSSNGIIGCPL  121

Query  480  MIVQ  491
            ++VQ
Sbjct  122  LLVQ  125



>ref|XP_004290447.1| PREDICTED: benzyl alcohol O-benzoyltransferase [Fragaria vesca 
subsp. vesca]
Length=463

 Score =   153 bits (387),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 71/127 (56%), Positives = 95/127 (75%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            AKPTP+E K LSDIDDQ+GLRF   +I FYR +P MK KD V+ IR+A+++ALV+YYP A
Sbjct  23   AKPTPRELKHLSDIDDQEGLRFQIPVIQFYRYDPSMKGKDCVKVIREAISQALVFYYPFA  82

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +GP  K MVDC+ +GI F+EAD+ ++L   GDA++PP    +E LY VPGS  +L 
Sbjct  83   GRLREGPGRKLMVDCTGEGILFIEADADVTLRQFGDALQPPFPCLEELLYNVPGSDGVLN  142

Query  471  CPLMIVQ  491
             PL+++Q
Sbjct  143  SPLLLIQ  149



>ref|XP_006878641.1| hypothetical protein AMTR_s00011p00264530 [Amborella trichopoda]
 gb|ERM94786.1| hypothetical protein AMTR_s00011p00264530 [Amborella trichopoda]
Length=160

 Score =   145 bits (367),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 91/127 (72%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            ++PTP E K LSDIDDQ+G RF   +I FYR +P M  +DP   + DA+++ALV+YYP A
Sbjct  21   SRPTPYEIKPLSDIDDQEGFRFQIPVIQFYRKDPKMDGRDPARVVTDALSEALVYYYPFA  80

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRLI+G   K  V+CS +G+ FVE D+ +SLE+ GDA+KPP    ++ L  VPGS  ++G
Sbjct  81   GRLIEGENKKLSVECSGEGVLFVEGDADVSLEEFGDALKPPFPCWEKLLMHVPGSDGVIG  140

Query  471  CPLMIVQ  491
            CPL+++Q
Sbjct  141  CPLLLIQ  147



>ref|XP_009374321.1| PREDICTED: methanol O-anthraniloyltransferase-like [Pyrus x bretschneideri]
Length=454

 Score =   153 bits (386),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 72/129 (56%), Positives = 99/129 (77%), Gaps = 2/129 (2%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLM--KAKDPVEAIRDAVAKALVWYYP  284
            AKPTP ETK LSDIDDQ+GLRF   ++M Y+ NPL+     DPV+ +++A++KALV+YYP
Sbjct  23   AKPTPHETKLLSDIDDQEGLRFQTPVLMSYKNNPLIPKDRTDPVKVLKEALSKALVFYYP  82

Query  285  LAGRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQI  464
            LAGRL +GP  K MV+C+ +G+ F+EAD++++LE LGDA+ PP  + +EFL + P S  I
Sbjct  83   LAGRLREGPNRKLMVECTGEGVLFIEADANVTLEQLGDAIVPPSPFLEEFLCDAPASDGI  142

Query  465  LGCPLMIVQ  491
            LGCPL +VQ
Sbjct  143  LGCPLPLVQ  151



>ref|XP_004244681.1| PREDICTED: methanol O-anthraniloyltransferase [Solanum lycopersicum]
 gb|AGK82804.1| alcohol acyltransferase 2 [Solanum lycopersicum]
Length=447

 Score =   152 bits (385),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 93/124 (75%), Gaps = 0/124 (0%)
 Frame = +3

Query  120  TPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLAGRL  299
            TP ETK LS+IDDQ   RFH  +++FY+ N LM+ KDP + I+D ++K LV+YYPLAGRL
Sbjct  23   TPHETKYLSEIDDQGSTRFHSHLLIFYKYNSLMEGKDPAKIIKDGLSKTLVFYYPLAGRL  82

Query  300  IQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILGCPL  479
            I+GP  K MV+C+ +G+ F+E ++++ LE LG+++KPPC Y    L+ VPGS  I+G PL
Sbjct  83   IEGPNKKLMVNCNGEGVLFIEGNANVELEKLGESIKPPCPYLDLLLHNVPGSDGIIGSPL  142

Query  480  MIVQ  491
            ++VQ
Sbjct  143  LLVQ  146



>ref|XP_006350348.1| PREDICTED: anthraniloyl-CoA:methanol acyltransferase-like [Solanum 
tuberosum]
Length=453

 Score =   153 bits (386),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 94/123 (76%), Gaps = 0/123 (0%)
 Frame = +3

Query  123  PQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLAGRLI  302
            P++   LSDIDDQ+GLRF   ++MFY+ N  MK KD  + I+D ++K LV+YYPLAGR+I
Sbjct  27   PKKILYLSDIDDQEGLRFQMPILMFYKYNSSMKGKDHAKIIKDGLSKTLVFYYPLAGRII  86

Query  303  QGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILGCPLM  482
            +GP  K MV+C+++GI F+EAD+++ LE LGD++ PPC Y +E LY  PGS  I+GCPLM
Sbjct  87   EGPNRKLMVNCNSEGIMFIEADANVELEKLGDSILPPCPYLEELLYNEPGSVGIIGCPLM  146

Query  483  IVQ  491
            +VQ
Sbjct  147  LVQ  149



>ref|XP_008779983.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like, partial 
[Phoenix dactylifera]
Length=146

 Score =   145 bits (366),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 90/127 (71%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            A+PTP E K LSD+DDQ+GLRF   +I FYR +P M  +DP   IR+A+AKALV YYP A
Sbjct  20   AEPTPHEFKRLSDVDDQEGLRFQIPVIQFYRHDPSMAGRDPARVIREALAKALVHYYPFA  79

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +G   K +V+C+ +G+ F+EAD+ + LE  GDA++PP    +E LY+V GS  +L 
Sbjct  80   GRLREGARRKLVVECTGEGVLFIEADADVRLEQFGDALQPPFPCLEELLYDVEGSGDVLN  139

Query  471  CPLMIVQ  491
            CPL++ Q
Sbjct  140  CPLLLFQ  146



>emb|CDP17523.1| unnamed protein product [Coffea canephora]
Length=459

 Score =   152 bits (385),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 94/127 (74%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            AKPTP+E + LSDIDDQKG RFH  MIMF+  N  +  K+PV  IRDAVAKALV+YYP A
Sbjct  18   AKPTPREIRPLSDIDDQKGHRFHLPMIMFFSYNQFLDEKNPVGVIRDAVAKALVYYYPYA  77

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRLI+GP DK +V+C+A+G+ F EA + + L+ L D ++PP  YSKEFL +   S +IL 
Sbjct  78   GRLIEGPSDKILVNCTAEGVVFREAIAEVGLDQLRDFMQPPFPYSKEFLVDASDSTEILD  137

Query  471  CPLMIVQ  491
             PLM++Q
Sbjct  138  SPLMLIQ  144



>ref|XP_009778012.1| PREDICTED: methanol O-anthraniloyltransferase-like [Nicotiana 
sylvestris]
Length=461

 Score =   152 bits (385),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 72/131 (55%), Positives = 99/131 (76%), Gaps = 3/131 (2%)
 Frame = +3

Query  102  PGTAKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYY  281
            P TA  TP+E K LSDIDDQ  LRF   ++MFY+ +P M+ KDPV+ I++ ++K LV+YY
Sbjct  21   PATA--TPRERKHLSDIDDQGSLRFQIPILMFYKFSPSMEGKDPVKVIKEGLSKTLVFYY  78

Query  282  PLAGRLIQ-GPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSH  458
            PLAGR+I+  P+ K +VDC+ +GI FVEAD+ + L+ LGD++KPPC Y  + LY VPGS 
Sbjct  79   PLAGRIIELMPDRKLVVDCNGEGILFVEADAQVELDKLGDSIKPPCPYLDQLLYSVPGSA  138

Query  459  QILGCPLMIVQ  491
             I+GCPL++VQ
Sbjct  139  AIIGCPLLLVQ  149



>ref|XP_007029788.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase [Theobroma 
cacao]
 gb|EOY10290.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase [Theobroma 
cacao]
Length=454

 Score =   152 bits (385),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 68/127 (54%), Positives = 96/127 (76%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            AKPTP E K LSDIDDQ+GLRF   +I FY+ +P M+ KDP   IR+A+A+ LV+YYP A
Sbjct  21   AKPTPHEYKLLSDIDDQEGLRFQIPVIQFYQYSPSMQGKDPARVIREALAQTLVFYYPFA  80

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +GP+ K MVDC+ +G+ F+EAD+ ++LE  GDA++PP    ++ L++VPGS  +L 
Sbjct  81   GRLREGPQRKLMVDCTGEGVMFIEADADVTLEQFGDALQPPFPCLEDLLHDVPGSAGVLN  140

Query  471  CPLMIVQ  491
            CPL+++Q
Sbjct  141  CPLLLIQ  147



>gb|AAT68601.1| benzoyl coenzyme A: benzyl alcohol benzoyl transferase [Petunia 
x hybrida]
 gb|AAU06226.1| benzoyl-CoA:benzyl alcohol/phenylethanol benzoyltransferase [Petunia 
x hybrida]
Length=460

 Score =   152 bits (385),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 96/127 (76%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            AKPTP+ETK LSDIDDQ+GLRF   +I FYR +  M  KDPVE I+ A+A+ LV+YYP A
Sbjct  24   AKPTPRETKFLSDIDDQEGLRFQIPVINFYRKDSSMGGKDPVEVIKKAIAETLVFYYPFA  83

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +G + K MVDC+ +G+ FVEA++ ++LE+ GD ++PP    +E LY+VPGS  +L 
Sbjct  84   GRLREGNDRKLMVDCTGEGVMFVEANADVTLEEFGDELQPPFPCLEELLYDVPGSAGVLH  143

Query  471  CPLMIVQ  491
            CPL+++Q
Sbjct  144  CPLLLIQ  150



>gb|KDP39569.1| hypothetical protein JCGZ_02589 [Jatropha curcas]
Length=347

 Score =   150 bits (379),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 95/126 (75%), Gaps = 0/126 (0%)
 Frame = +3

Query  114  KPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLAG  293
            KPTP E K LSDIDDQ+GLR     I  YR +P M+ KDPV+ IR+A+AKALV+YYP AG
Sbjct  22   KPTPHEFKPLSDIDDQEGLRIQIPFIQIYRHDPSMEGKDPVQVIRNAIAKALVFYYPFAG  81

Query  294  RLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILGC  473
            RL +GP  K +++C+ +G+ F+EAD+++SL+  GDA++PP  +  E L++VPGS  IL C
Sbjct  82   RLREGPNRKLIMECNGEGVLFIEADANVSLDQSGDALQPPFPFLDELLFDVPGSSGILHC  141

Query  474  PLMIVQ  491
            P++++Q
Sbjct  142  PVILIQ  147



>ref|XP_009759678.1| PREDICTED: methanol O-anthraniloyltransferase-like [Nicotiana 
sylvestris]
Length=444

 Score =   152 bits (383),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 93/127 (73%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            AK TP ETK LSDIDDQ    F    I+FY+ N  ++ KDP + I+D ++K LV+YYPLA
Sbjct  16   AKATPLETKHLSDIDDQGSTHFQMPTILFYKYNSSIEGKDPAKYIKDGLSKTLVFYYPLA  75

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GR+I+GP  K +V+C+ +GI FVEAD+++ L+ LGD++KPPC Y    ++ VPGS  I+G
Sbjct  76   GRIIEGPNKKLLVNCNGEGILFVEADANIELDKLGDSIKPPCPYLDILIHNVPGSDGIIG  135

Query  471  CPLMIVQ  491
            CPL++VQ
Sbjct  136  CPLLLVQ  142



>ref|XP_009589917.1| PREDICTED: methanol O-anthraniloyltransferase-like [Nicotiana 
tomentosiformis]
Length=444

 Score =   152 bits (383),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 93/127 (73%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            AK TP+ETK LSDIDDQ    F    IMFY+ N  M+ KDP + I++ ++K LV+YYPLA
Sbjct  16   AKVTPRETKHLSDIDDQGSTHFQMPTIMFYKYNSSMEGKDPAKFIKNGLSKTLVFYYPLA  75

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GR+ +GP  K +V+C+ +GI FVEAD+++ L+ LG+++KPPC Y    ++ VPGS  I+G
Sbjct  76   GRIFEGPNKKLLVNCNGEGILFVEADANIELDKLGNSIKPPCTYLDLVIHNVPGSDGIIG  135

Query  471  CPLMIVQ  491
            CPL+++Q
Sbjct  136  CPLLLIQ  142



>ref|XP_004498041.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Cicer arietinum]
Length=251

 Score =   147 bits (371),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 93/127 (73%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            +KPTP ETK LSDIDDQ GLRF   ++ FY  +P MK KDPV+ IR A+AK LV+YYP A
Sbjct  20   SKPTPNETKLLSDIDDQDGLRFQIPVVQFYNYDPNMKGKDPVDVIRKALAKTLVFYYPFA  79

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +G + K MVDC+ +G+ F+EAD+ +S+E+ G  ++PP     + L++VPGS Q++ 
Sbjct  80   GRLREGNDRKLMVDCNGEGVLFIEADADVSVEEFGGQLQPPFPCWDQLLFDVPGSSQVIN  139

Query  471  CPLMIVQ  491
             PL+++Q
Sbjct  140  TPLLLIQ  146



>dbj|BAE72881.1| benzoyl CoA benzoic acid benzoyltransferase [Verbena x hybrida]
Length=461

 Score =   152 bits (383),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 69/127 (54%), Positives = 94/127 (74%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            AKPTP+E K LSDIDDQ+GLRF   +I FYR +P M+ K+P   IR+A+AK LV+YYP A
Sbjct  23   AKPTPRELKPLSDIDDQEGLRFQIPVIQFYRHDPKMRNKNPARVIREALAKVLVFYYPFA  82

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +GP  K MVDCS +G+ F+EA++ ++L   GDA++PP    +E LY+VPGS  +L 
Sbjct  83   GRLKEGPAKKLMVDCSGEGVLFIEAEADVTLNQFGDALQPPFPCLEELLYDVPGSGGVLD  142

Query  471  CPLMIVQ  491
             PL+++Q
Sbjct  143  SPLLLIQ  149



>ref|XP_009372579.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Pyrus x 
bretschneideri]
Length=461

 Score =   151 bits (382),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 96/127 (76%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            AK TP E ++LSDIDDQ+GLRF   +I FY+ +P M+ +DPV  +R+A+A+ LV+YYP A
Sbjct  23   AKATPYEFRQLSDIDDQEGLRFQIPVIQFYKYDPSMQGRDPVHVLREAIAQTLVFYYPFA  82

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +GP+ K  V+C+A+G+ F+EAD+ ++LE  GDA++PP    +E LY VPGS  +L 
Sbjct  83   GRLREGPDRKLTVECTAEGVMFIEADADVTLEQFGDALQPPFPCLEELLYNVPGSDGVLN  142

Query  471  CPLMIVQ  491
            CPL+++Q
Sbjct  143  CPLLLIQ  149



>ref|XP_002524020.1| transferase, putative [Ricinus communis]
 gb|EEF38388.1| transferase, putative [Ricinus communis]
Length=244

 Score =   147 bits (370),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 97/127 (76%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            AKPTP + K LSDIDDQ+GLRFH  ++  Y+ +P M+ KDPV+ I +A+AKALV+YYP A
Sbjct  23   AKPTPYDFKPLSDIDDQEGLRFHIPVVQIYKHDPSMQGKDPVKVISEALAKALVFYYPFA  82

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL + P  K +V+C+++G+ F+EAD++++LE  GDA++PP     E L++VPGS  ++ 
Sbjct  83   GRLREWPNRKLVVECTSEGVLFIEADANVTLEQCGDALQPPFPLLDELLFDVPGSSGVIN  142

Query  471  CPLMIVQ  491
            CPL+++Q
Sbjct  143  CPLLLIQ  149



>ref|XP_003518844.1| PREDICTED: benzyl alcohol O-benzoyltransferase [Glycine max]
Length=459

 Score =   151 bits (382),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 71/127 (56%), Positives = 93/127 (73%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            AKPTP+E K LSDIDDQ GLRF   +I FYR +P M  KDPV+ IR AVAK LV+YYP A
Sbjct  20   AKPTPREVKLLSDIDDQDGLRFQIPVIQFYRHDPSMAGKDPVDVIRKAVAKTLVFYYPFA  79

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +G   K MVDC+ +G+ F+EAD+ ++L+  GDA++PP    +E LY+VPGS  +L 
Sbjct  80   GRLREGLGRKLMVDCTGEGVLFIEADADVTLKQFGDALQPPFPCWEELLYDVPGSQGVLN  139

Query  471  CPLMIVQ  491
             PL+++Q
Sbjct  140  TPLLLIQ  146



>ref|XP_010110383.1| Benzyl alcohol O-benzoyltransferase [Morus notabilis]
 gb|EXC26215.1| Benzyl alcohol O-benzoyltransferase [Morus notabilis]
Length=465

 Score =   151 bits (382),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 71/130 (55%), Positives = 94/130 (72%), Gaps = 3/130 (2%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRAN--PLMK-AKDPVEAIRDAVAKALVWYY  281
            +KPTP+E K LSDIDDQ+GLRFH   I FY+ N  P +K  KDP   IR+A+ +ALV+YY
Sbjct  24   SKPTPKEIKLLSDIDDQEGLRFHVPFIFFYKKNNHPSVKLGKDPNRVIREALGRALVYYY  83

Query  282  PLAGRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQ  461
            P AGRL +G   K MVDC+ +G+ FV A + +  + LGDA++PPC +  +FLY VPGS  
Sbjct  84   PFAGRLREGSNRKLMVDCTGEGVLFVAAKADVGYDRLGDAIRPPCPFLDKFLYNVPGSDG  143

Query  462  ILGCPLMIVQ  491
            ILGCPL+++Q
Sbjct  144  ILGCPLLLIQ  153



>ref|XP_004305015.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=445

 Score =   151 bits (381),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 73/129 (57%), Positives = 99/129 (77%), Gaps = 2/129 (2%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRA-NP-LMKAKDPVEAIRDAVAKALVWYYP  284
            AKPTPQE + LS+ID Q+GLRF    I+ Y+  NP  MK KDPVE IRDA+++ALV+YYP
Sbjct  22   AKPTPQEKRLLSEIDIQEGLRFQTPFILSYKNDNPNSMKQKDPVEVIRDALSRALVYYYP  81

Query  285  LAGRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQI  464
             AGR+ +G   K  VDC+ +GI F+EAD+ +SLE LGD+++PPC + ++FL++VPGS  I
Sbjct  82   FAGRVREGRNGKLFVDCNGEGILFIEADADVSLEQLGDSLQPPCPFLEDFLFDVPGSDDI  141

Query  465  LGCPLMIVQ  491
            LG PL++VQ
Sbjct  142  LGTPLLLVQ  150



>ref|XP_008373467.1| PREDICTED: methanol O-anthraniloyltransferase-like [Malus domestica]
Length=459

 Score =   151 bits (381),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 72/128 (56%), Positives = 97/128 (76%), Gaps = 1/128 (1%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANP-LMKAKDPVEAIRDAVAKALVWYYPL  287
            AKPTP ETK LSD+DDQ+GLRF   +IM Y+ NP L K  +PV+ IR+A+++ALV+YYPL
Sbjct  20   AKPTPHETKFLSDMDDQEGLRFQVPIIMCYKDNPSLNKHHNPVKVIREALSRALVYYYPL  79

Query  288  AGRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQIL  467
            AGRL +GP  K MVDC+ +GI F+EA + ++LE LG+ + P C   +EFLY  PGS +I+
Sbjct  80   AGRLREGPNRKLMVDCNGEGILFIEAFADVTLEQLGEKILPHCPPLEEFLYNFPGSDRII  139

Query  468  GCPLMIVQ  491
             CPL++VQ
Sbjct  140  SCPLLLVQ  147



>ref|XP_004151707.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like, partial 
[Cucumis sativus]
Length=260

 Score =   147 bits (370),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 91/127 (72%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            + PTP E K+LSDIDDQ+GLRF   +I FYR +P M   DP   I++A+AKALV+YYP A
Sbjct  20   SDPTPHEFKQLSDIDDQEGLRFQIPVIQFYRHDPRMAGTDPARVIKEAIAKALVFYYPFA  79

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +GP  K  V+C+ +G+ F EAD+ +SLE  GDA++PP    +E L++VP S  +L 
Sbjct  80   GRLREGPGRKLFVECTGEGVLFTEADADVSLEQFGDALQPPFPCLEELLFDVPNSSGVLD  139

Query  471  CPLMIVQ  491
            CPL+++Q
Sbjct  140  CPLLLIQ  146



>ref|XP_003516503.1| PREDICTED: anthraniloyl-CoA:methanol acyltransferase-like [Glycine 
max]
Length=452

 Score =   151 bits (381),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 99/144 (69%), Gaps = 0/144 (0%)
 Frame = +3

Query  60   SRKSFCCLA*GSRAPGTAKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVE  239
            SR SF  +         A PTP+E K LSDIDDQ+GLRF   +IMFY+ + +M+ K P  
Sbjct  4    SRTSFSVVHGEPELVVPAGPTPRELKNLSDIDDQEGLRFQHQVIMFYQKSHVMEGKHPAT  63

Query  240  AIRDAVAKALVWYYPLAGRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCL  419
             I+  +A+ALV YYPLAGRL + P  K  VDCS +GI FVEA++ +SL++LG+++ PPC 
Sbjct  64   VIKYGLAEALVHYYPLAGRLREWPNRKLTVDCSGEGILFVEAEAHVSLKELGNSILPPCP  123

Query  420  YSKEFLYEVPGSHQILGCPLMIVQ  491
            + KE L +VPGS  ILGCPL++ Q
Sbjct  124  HMKELLLDVPGSQGILGCPLLLFQ  147



>ref|XP_006600094.1| PREDICTED: 13-hydroxylupanine O-tigloyltransferase-like [Glycine 
max]
 gb|KHN24394.1| 13-hydroxylupanine O-tigloyltransferase [Glycine soja]
Length=158

 Score =   143 bits (361),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 63/127 (50%), Positives = 90/127 (71%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            A PTP+E K LSDIDDQ GLR+   +++F+   P M+ KDPVE IR+A++K LV+YYP A
Sbjct  23   ANPTPREVKLLSDIDDQNGLRYQLPLVLFFPYQPSMEGKDPVEVIREALSKTLVFYYPFA  82

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +GP+ K MVDC+ +G+ F+EAD+ +++E  G+   PP     E LY VPGS  ++ 
Sbjct  83   GRLREGPDGKLMVDCNGEGVMFIEADADVTIEQFGNNFMPPFPCFDELLYNVPGSDGMID  142

Query  471  CPLMIVQ  491
             PL+++Q
Sbjct  143  TPLLLIQ  149



>ref|XP_006368249.1| hypothetical protein POPTR_0001s00970g [Populus trichocarpa]
 gb|ERP64818.1| hypothetical protein POPTR_0001s00970g [Populus trichocarpa]
Length=459

 Score =   150 bits (380),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 96/129 (74%), Gaps = 2/129 (2%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFY--RANPLMKAKDPVEAIRDAVAKALVWYYP  284
            AKP P E K+LSD+DDQ+ LR+    IMFY   +NP M+ +D V+ IR A+A+ALV+YYP
Sbjct  23   AKPVPYEQKQLSDVDDQEALRYQIPFIMFYDSNSNPCMEGEDQVKIIRAALAEALVYYYP  82

Query  285  LAGRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQI  464
            LAGRL +GP+ K +VDC+ +G+ F+EAD+  +LE L D ++PPC Y  + LY VPGS  I
Sbjct  83   LAGRLKEGPDGKLLVDCTGEGVLFLEADADTTLELLEDTIQPPCPYLDQLLYNVPGSTGI  142

Query  465  LGCPLMIVQ  491
            +GCPL+++Q
Sbjct  143  VGCPLLLIQ  151



>emb|CDP11061.1| unnamed protein product [Coffea canephora]
Length=459

 Score =   150 bits (379),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 93/127 (73%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            AK TP+E + LSDIDDQKG RFH  MIMFY  N  M  K+PV  IR+A+AKALV+YYP A
Sbjct  18   AKTTPEEIRPLSDIDDQKGHRFHLPMIMFYSYNQCMDEKNPVGVIRNALAKALVYYYPYA  77

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRLI+GP DK +V+C+A+G+ F EA + + L+ L D ++PP  YSKEFL +  GS  IL 
Sbjct  78   GRLIEGPSDKILVNCTAEGVVFREAIAEVRLDQLRDFMQPPFPYSKEFLIDASGSTAILD  137

Query  471  CPLMIVQ  491
             PLM++Q
Sbjct  138  SPLMLIQ  144



>ref|XP_010933015.1| PREDICTED: benzyl alcohol O-benzoyltransferase [Elaeis guineensis]
Length=160

 Score =   143 bits (361),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 89/127 (70%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            A+PTP E K LSDIDDQ+GLRF   +I FYR +P M  +DP   IR+A+AK LV YYP A
Sbjct  20   AEPTPHEFKRLSDIDDQEGLRFQIPVIQFYRNDPSMAGRDPARVIREALAKTLVHYYPFA  79

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +G   K +V+C+ +G+ F+EAD+ + LE  GDA++PP    +E LY V GS ++L 
Sbjct  80   GRLREGARRKLVVECTGEGVLFIEADADVRLEQFGDALQPPFPCLEELLYNVEGSGEVLN  139

Query  471  CPLMIVQ  491
             PL+++Q
Sbjct  140  APLLLIQ  146



>ref|XP_007029790.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase [Theobroma 
cacao]
 gb|EOY10292.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase [Theobroma 
cacao]
Length=457

 Score =   150 bits (379),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 72/131 (55%), Positives = 93/131 (71%), Gaps = 4/131 (3%)
 Frame = +3

Query  105  GTAKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYP  284
            G AKPTP E K LSDIDDQ+  RF   +I FYR NP M+ KDP   +R+A+A+ALV+YYP
Sbjct  21   GPAKPTPNECKRLSDIDDQESFRFQVPVIQFYRYNPCMQGKDPAMIVREALAQALVFYYP  80

Query  285  LAGRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKP--PCLYSKEFLYEVPGSH  458
            LAGRL +GP  K MVDC+ +G  FVEAD+ ++LE  GDA++P  PCL+  E LY+ P S 
Sbjct  81   LAGRLREGPNRKLMVDCNGEGALFVEADADVTLEQFGDALQPPFPCLH--ELLYDTPSSE  138

Query  459  QILGCPLMIVQ  491
             +L  PL+ +Q
Sbjct  139  GMLNSPLLFIQ  149



>gb|KHN41759.1| Benzyl alcohol O-benzoyltransferase [Glycine soja]
Length=469

 Score =   150 bits (379),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 99/144 (69%), Gaps = 0/144 (0%)
 Frame = +3

Query  60   SRKSFCCLA*GSRAPGTAKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVE  239
            SR SF  +         A PTP+E K LSDIDDQ+GLRF   +IMFY+ + +M+ K P  
Sbjct  4    SRTSFSVVHGEPELVVPAGPTPRELKNLSDIDDQEGLRFQHQVIMFYQKSHVMEGKHPAT  63

Query  240  AIRDAVAKALVWYYPLAGRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCL  419
             I+  +A+ALV YYPLAGRL + P  K  VDCS +GI FVEA++ +SL++LG+++ PPC 
Sbjct  64   VIKYGLAEALVHYYPLAGRLREWPNRKLTVDCSGEGILFVEAEAHVSLKELGNSILPPCP  123

Query  420  YSKEFLYEVPGSHQILGCPLMIVQ  491
            + KE L +VPGS  ILGCPL++ Q
Sbjct  124  HMKELLLDVPGSQGILGCPLLLFQ  147



>ref|XP_009368754.1| PREDICTED: methanol O-anthraniloyltransferase-like [Pyrus x bretschneideri]
Length=461

 Score =   150 bits (378),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 68/127 (54%), Positives = 95/127 (75%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            A PTP E K LSDID+Q+ LR     I  Y +NP  K  DPV+ IRDA++++LV+YYPLA
Sbjct  23   ASPTPCEQKILSDIDNQEALRCQTPFIWSYTSNPSSKEIDPVQVIRDAISRSLVYYYPLA  82

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GR+ +GP  K MVDC+ +G+ F+EAD+ ++LE LGD ++PPC   ++FLY+VPG++ I+G
Sbjct  83   GRVREGPNKKLMVDCNGEGVLFIEADADVTLEQLGDTLQPPCPVLEDFLYDVPGTYDIVG  142

Query  471  CPLMIVQ  491
             PL+IVQ
Sbjct  143  TPLLIVQ  149



>ref|XP_009804829.1| PREDICTED: benzyl alcohol O-benzoyltransferase [Nicotiana sylvestris]
Length=460

 Score =   149 bits (377),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 93/127 (73%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            AKPTP+ETK LSDIDDQ+GLRF   +I FY  N  M+ KDPV  I+ A+A+ LV+YYP A
Sbjct  24   AKPTPRETKFLSDIDDQEGLRFQIPVIQFYSKNSSMEGKDPVNIIKKAIAETLVFYYPFA  83

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +G   K MVDC+ +GI FVEAD+ ++LE+ GD ++PP    +E LY+VP S  +L 
Sbjct  84   GRLREGNGRKLMVDCTGEGIMFVEADADVTLEEFGDELQPPFPCLEELLYDVPNSAGVLH  143

Query  471  CPLMIVQ  491
            CPL+++Q
Sbjct  144  CPLLLIQ  150



>ref|XP_008373466.1| PREDICTED: methanol O-anthraniloyltransferase-like [Malus domestica]
Length=460

 Score =   149 bits (376),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 94/127 (74%), Gaps = 1/127 (1%)
 Frame = +3

Query  114  KPTPQETKELSDIDDQKGLRFHFCMIMFYRANP-LMKAKDPVEAIRDAVAKALVWYYPLA  290
            K TP ETK LSDIDDQ+GLRF   +IM Y+ NP L + ++P++ IR+A+++ALV+YYPLA
Sbjct  21   KSTPXETKFLSDIDDQEGLRFQLPVIMCYKDNPSLNENRNPIKVIREALSRALVYYYPLA  80

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +GP    MVDC+ +GI FVEA   ++LE LGD + PPC   +EFL+  P S  I+G
Sbjct  81   GRLXEGPNXMLMVDCNGEGILFVEASXDVTLEQLGDKILPPCPLLEEFLFNFPXSDGIIG  140

Query  471  CPLMIVQ  491
            CPL++VQ
Sbjct  141  CPLLLVQ  147



>ref|XP_006470749.1| PREDICTED: anthraniloyl-CoA:methanol acyltransferase-like [Citrus 
sinensis]
Length=445

 Score =   149 bits (375),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 97/133 (73%), Gaps = 4/133 (3%)
 Frame = +3

Query  105  GTAKPTPQETKELSDIDDQKGLRFHFCMIMFYRANP--LMKAKDPVEAIRDAVAKALVWY  278
            G A+PT +  K+LS +DDQ+ LRF   MI FY+ +P   M+ KDPV+ IR+A++KAL +Y
Sbjct  20   GPARPTARVIKQLSSLDDQQCLRFQIPMIFFYKNDPSPAMEGKDPVKVIREALSKALTFY  79

Query  279  YPLAGRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDL--GDAVKPPCLYSKEFLYEVPG  452
            YPLAGRL +    K MVDC+ +G+ F EA+++++LE L  GDAV+PPC Y  E LY VPG
Sbjct  80   YPLAGRLKEVSNRKLMVDCNGEGVLFTEAEANITLEQLEVGDAVRPPCPYLHELLYNVPG  139

Query  453  SHQILGCPLMIVQ  491
            S  ILGCPL+++Q
Sbjct  140  SEGILGCPLLLIQ  152



>gb|AIW04708.1| alcohol acyltransferase 1 [Solanum pennellii]
Length=442

 Score =   149 bits (375),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 90/124 (73%), Gaps = 0/124 (0%)
 Frame = +3

Query  120  TPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLAGRL  299
            TP ETK LS+IDDQ  +RF   ++MFY+ N  MK KDP   I D ++K LV+Y+PLAGRL
Sbjct  23   TPHETKRLSEIDDQGFIRFQIPILMFYKYNSSMKGKDPARIIEDGLSKTLVFYHPLAGRL  82

Query  300  IQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILGCPL  479
            I+GP  K MV+C+ +G+ F+E D+++ LE LG+++KPPC Y    L+ VPGS  I+G PL
Sbjct  83   IEGPNKKLMVNCNGEGVLFIEGDANIELEKLGESIKPPCPYLDLLLHNVPGSDGIIGSPL  142

Query  480  MIVQ  491
            +++Q
Sbjct  143  LLIQ  146



>ref|XP_006470741.1| PREDICTED: anthraniloyl-CoA:methanol acyltransferase-like [Citrus 
sinensis]
Length=445

 Score =   149 bits (375),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 97/133 (73%), Gaps = 4/133 (3%)
 Frame = +3

Query  105  GTAKPTPQETKELSDIDDQKGLRFHFCMIMFYRANP--LMKAKDPVEAIRDAVAKALVWY  278
            G A+PT +  K+LS +DDQ+ LRF   MI FY+ +P   M+ KDPV+ IR+A++KAL +Y
Sbjct  20   GPARPTARVIKQLSSLDDQQCLRFQIPMIFFYKNDPSPAMEGKDPVKVIREALSKALTFY  79

Query  279  YPLAGRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDL--GDAVKPPCLYSKEFLYEVPG  452
            YPLAGRL +    K MVDC+ +G+ F EA+++++LE L  GDAV+PPC Y  E LY VPG
Sbjct  80   YPLAGRLKEVSNRKLMVDCNGEGVLFTEAEANITLEQLEVGDAVRPPCPYLHELLYNVPG  139

Query  453  SHQILGCPLMIVQ  491
            S  ILGCPL+++Q
Sbjct  140  SEGILGCPLLLIQ  152



>ref|XP_008359502.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Malus domestica]
Length=461

 Score =   149 bits (375),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 94/127 (74%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            AK TP E ++LSDIDDQ+GLRF   +I FY+ +P M+ +DPV  +R+A+A+ LV+YYP A
Sbjct  23   AKATPHEFRQLSDIDDQEGLRFQIPVIQFYKYDPSMQGRDPVHVLREAIAQTLVFYYPFA  82

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +GP  K  V+C+A+G+ F+EAD+ ++LE  GDA++PP    +E LY V GS  +L 
Sbjct  83   GRLREGPNRKLTVECTAEGVMFIEADADVTLEQFGDALQPPFPCLEELLYNVRGSDGVLN  142

Query  471  CPLMIVQ  491
            CPL+++Q
Sbjct  143  CPLLLIQ  149



>ref|XP_007029777.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase, putative 
[Theobroma cacao]
 gb|EOY10279.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase, putative 
[Theobroma cacao]
Length=471

 Score =   148 bits (374),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 92/127 (72%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            A+PTP+E K LSDIDDQ+ LR    +I FY+ NP M+ KDP + IR+A+ K LV+YYP A
Sbjct  39   ARPTPRELKLLSDIDDQECLRTQIPIIQFYKYNPSMQGKDPAKVIREALGKTLVFYYPFA  98

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +GP  K MVDC+  G+ F+EAD+ + LE  G+A++PP     + LY+VPGS +IL 
Sbjct  99   GRLREGPNGKLMVDCTGDGVLFIEADADVKLEQFGEALQPPFPCLDQLLYDVPGSGEILN  158

Query  471  CPLMIVQ  491
            CPL+++Q
Sbjct  159  CPLLLIQ  165



>ref|XP_008238086.1| PREDICTED: methanol O-anthraniloyltransferase-like [Prunus mume]
Length=532

 Score =   149 bits (376),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 95/130 (73%), Gaps = 3/130 (2%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRAN---PLMKAKDPVEAIRDAVAKALVWYY  281
            +KPTP ETK LS++DDQ+ LRF   +IM YR N    +   +DPV+ IR+ +++ALV+YY
Sbjct  22   SKPTPHETKLLSNVDDQESLRFQIPVIMSYRNNNPSSMNANRDPVKVIREGLSRALVYYY  81

Query  282  PLAGRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQ  461
            P+AGRL +GP  K MV+C+ +G+ F+E ++ ++L  LGD + PP  + +EFLY VPGS  
Sbjct  82   PMAGRLREGPNRKLMVECNGEGVLFIEGNADVTLAQLGDTIAPPSPFLEEFLYNVPGSDG  141

Query  462  ILGCPLMIVQ  491
            ILGCPL+++Q
Sbjct  142  ILGCPLLLIQ  151



>ref|XP_010110389.1| Benzyl alcohol O-benzoyltransferase [Morus notabilis]
 gb|EXC26221.1| Benzyl alcohol O-benzoyltransferase [Morus notabilis]
Length=493

 Score =   148 bits (374),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 69/130 (53%), Positives = 94/130 (72%), Gaps = 3/130 (2%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRAN--PLMK-AKDPVEAIRDAVAKALVWYY  281
            +KPTP+E K LSDIDDQ+GLRFH  +I FY+ N  P +K  +DP   IR+A+ +ALV+YY
Sbjct  24   SKPTPKEIKLLSDIDDQEGLRFHVPVIFFYKNNNNPSVKLGQDPNRVIREALGRALVYYY  83

Query  282  PLAGRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQ  461
            P AGRL +G   K MVDC+ +G+ FV A + +  + LGDA++PP  +  +FLY VPGS  
Sbjct  84   PFAGRLREGSNGKLMVDCTGEGVLFVAAKADVGFDQLGDAIRPPSPFLDQFLYNVPGSDG  143

Query  462  ILGCPLMIVQ  491
            ILGCPL+++Q
Sbjct  144  ILGCPLLLIQ  153



>ref|XP_006446260.1| hypothetical protein CICLE_v10015249mg [Citrus clementina]
 gb|ESR59500.1| hypothetical protein CICLE_v10015249mg [Citrus clementina]
Length=445

 Score =   147 bits (372),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 96/133 (72%), Gaps = 4/133 (3%)
 Frame = +3

Query  105  GTAKPTPQETKELSDIDDQKGLRFHFCMIMFYRANP--LMKAKDPVEAIRDAVAKALVWY  278
            G A+PT +  K+LS +DDQ+ LRF   MI FY+ +P   M+ KDPV+ IR+A++KAL +Y
Sbjct  20   GPARPTARVIKQLSSLDDQQCLRFQIPMIFFYKNDPSPAMEGKDPVKVIREALSKALTFY  79

Query  279  YPLAGRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDL--GDAVKPPCLYSKEFLYEVPG  452
            YPLAGRL +    K MVDC+ +G+ F EA+ +++LE L  GDAV+PPC Y  E LY VPG
Sbjct  80   YPLAGRLKEVSNRKLMVDCNGEGVLFTEAEGNITLEQLEVGDAVRPPCPYLHELLYNVPG  139

Query  453  SHQILGCPLMIVQ  491
            S  ILGCPL+++Q
Sbjct  140  SDGILGCPLLLIQ  152



>gb|KHN31436.1| Benzyl alcohol O-benzoyltransferase [Glycine soja]
Length=440

 Score =   147 bits (371),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 69/127 (54%), Positives = 91/127 (72%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            A PTP E K LSDIDDQ+GLRFH  MI  YR  P M  KDPV+ IR A+AK LV+YYP A
Sbjct  15   AIPTPHELKPLSDIDDQEGLRFHIPMIQVYRNQPSMAEKDPVQVIRKALAKTLVFYYPFA  74

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL + P+ K MVDC+ +G+ F+EAD+ ++L+ LGDA++PP    ++ LY VP S +I  
Sbjct  75   GRLRERPDHKLMVDCTGEGVLFIEADADVTLDQLGDALQPPFPCFEQLLYNVPDSEEITD  134

Query  471  CPLMIVQ  491
             PL+++Q
Sbjct  135  TPLLLIQ  141



>ref|XP_004498016.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Cicer arietinum]
Length=463

 Score =   147 bits (372),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 93/127 (73%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            +KPTP ETK LSDIDDQ GLRF   ++ FY  +P MK KDPV+ IR A+AK LV+YYP A
Sbjct  20   SKPTPNETKLLSDIDDQDGLRFQIPVVQFYNYDPNMKGKDPVDVIRKALAKTLVFYYPFA  79

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +G + K MVDC+ +G+ F+EAD+ +S+E+ G  ++PP     + L++VPGS Q++ 
Sbjct  80   GRLREGNDRKLMVDCNGEGVLFIEADADVSVEEFGGQLQPPFPCWDQLLFDVPGSSQVIN  139

Query  471  CPLMIVQ  491
             PL+++Q
Sbjct  140  TPLLLIQ  146



>gb|AIC83790.1| alcohol acyltransferase [Actinidia deliciosa]
Length=456

 Score =   147 bits (372),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 69/128 (54%), Positives = 96/128 (75%), Gaps = 2/128 (2%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            +KPTP+E K+LSDIDDQ+GLRF   +IMFY+     + +DPV+ IR+A+A+AL +YYP A
Sbjct  23   SKPTPRELKQLSDIDDQEGLRFQVPVIMFYKRKLSTEGEDPVKVIREALAEALAFYYPFA  82

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDL-GDAVKPPCLYSKEFLYEVPGSHQIL  467
            GRLI+GP  K MVDC+++G+ F+EAD+ + L  L GD + P   Y  E L++VPGS  IL
Sbjct  83   GRLIEGPNRKLMVDCTSEGVLFIEADADIELNQLIGDTIDPGT-YLDELLHDVPGSEGIL  141

Query  468  GCPLMIVQ  491
            GCPL+++Q
Sbjct  142  GCPLLLIQ  149



>ref|XP_008462816.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Cucumis 
melo]
Length=459

 Score =   147 bits (372),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 92/127 (72%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            + PTP E K+LSDIDDQ+GLRF   +I FYR +P M   DP   I++A+AKALV+YYP A
Sbjct  20   SDPTPHEFKQLSDIDDQEGLRFQIPVIQFYRHDPRMAGTDPARVIKEAIAKALVFYYPFA  79

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +GP  K  V+C+ +G+ F+EAD+ +SLE  GDA++PP    +E L++VP S  +L 
Sbjct  80   GRLREGPGRKLFVECTGEGVMFIEADADVSLEQFGDALQPPFPCLEELLFDVPNSSGVLD  139

Query  471  CPLMIVQ  491
            CPL+++Q
Sbjct  140  CPLLLIQ  146



>ref|XP_007029780.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase [Theobroma 
cacao]
 gb|EOY10282.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase [Theobroma 
cacao]
Length=475

 Score =   147 bits (372),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 68/127 (54%), Positives = 92/127 (72%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            AKPTP+E K LSDIDDQ G RF    + FYR  P M+ KDP   I++A+ KALV+YYP A
Sbjct  45   AKPTPRECKLLSDIDDQDGHRFQIRGLHFYRFKPSMQGKDPACIIKEALTKALVFYYPYA  104

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +GP  K +VDC+ +G+ F++AD+ ++L+  GD++ PP    KE LYEVPGS++IL 
Sbjct  105  GRLREGPNRKLVVDCTGEGVLFIQADADVTLDQFGDSLHPPFPCYKELLYEVPGSNEILN  164

Query  471  CPLMIVQ  491
            CPL+ +Q
Sbjct  165  CPLLQIQ  171



>ref|XP_003520833.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Glycine 
max]
Length=452

 Score =   147 bits (371),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/127 (54%), Positives = 91/127 (72%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            A PTP E K LSDIDDQ+GLRFH  MI  YR  P M  KDPV+ IR A+AK LV+YYP A
Sbjct  27   AIPTPHELKPLSDIDDQEGLRFHIPMIQVYRNQPSMAEKDPVQVIRKALAKTLVFYYPFA  86

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL + P+ K MVDC+ +G+ F+EAD+ ++L+ LGDA++PP    ++ LY VP S +I  
Sbjct  87   GRLRERPDHKLMVDCTGEGVLFIEADADVTLDQLGDALQPPFPCFEQLLYNVPDSEEITD  146

Query  471  CPLMIVQ  491
             PL+++Q
Sbjct  147  TPLLLIQ  153



>gb|KHN31434.1| Benzyl alcohol O-benzoyltransferase [Glycine soja]
Length=471

 Score =   147 bits (371),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 92/127 (72%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            AKPTP+E K LSDIDDQ+GLRF    I+FY   P M  KDP + IR+A+A+ LV+YYP A
Sbjct  23   AKPTPREVKPLSDIDDQQGLRFQIPFILFYGNEPSMAGKDPAKVIREALAQTLVFYYPFA  82

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GR+ +GP  K +VDC+ +G+ F+EAD+  +L+ LGD ++PP    ++ LY+VPGS  ++ 
Sbjct  83   GRIREGPGRKLVVDCTGEGVMFIEADADATLDQLGDTLQPPFPCFEQLLYDVPGSEGVID  142

Query  471  CPLMIVQ  491
            CPLM+ Q
Sbjct  143  CPLMLFQ  149



>gb|KJB80921.1| hypothetical protein B456_013G121500 [Gossypium raimondii]
Length=269

 Score =   143 bits (361),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 65/126 (52%), Positives = 93/126 (74%), Gaps = 0/126 (0%)
 Frame = +3

Query  114  KPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLAG  293
            +PTP E K LSDIDDQ+G RFH     F+++N  MK +DP + I++A+AKALV+YYP AG
Sbjct  25   EPTPHECKPLSDIDDQEGHRFHVRGFHFHQSNLSMKGQDPAKVIKEALAKALVFYYPFAG  84

Query  294  RLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILGC  473
            RL +GP  K +VDC+ +G+ F+EAD+ +SL D GD + PP   ++E LY+VPGS+ +L  
Sbjct  85   RLREGPNRKLIVDCTGEGVLFIEADADVSLVDFGDELYPPFPCAEELLYDVPGSNGLLNS  144

Query  474  PLMIVQ  491
            PL+++Q
Sbjct  145  PLLLIQ  150



>ref|XP_004294711.1| PREDICTED: methanol O-anthraniloyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=461

 Score =   147 bits (371),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 72/129 (56%), Positives = 97/129 (75%), Gaps = 2/129 (2%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLM-KAKDPVEAI-RDAVAKALVWYYP  284
            A+PTP+E K LSDIDDQ+GLRF   +I+  + NP M   KDPV  I R+A+++ALV+YYP
Sbjct  25   ARPTPREIKMLSDIDDQEGLRFQIPVIIACKNNPSMSNRKDPVPVIIREAISRALVYYYP  84

Query  285  LAGRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQI  464
            LAGRL +GP  K MVDC+ +G+ FVEA + ++LE LGDA++PPC + + FL +VPGS  I
Sbjct  85   LAGRLREGPNRKLMVDCNGEGVLFVEAKADVTLEQLGDAIRPPCPFLEGFLCDVPGSDGI  144

Query  465  LGCPLMIVQ  491
            LG PL++ Q
Sbjct  145  LGYPLLLFQ  153



>ref|XP_004151058.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Cucumis 
sativus]
 ref|XP_004164522.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Cucumis 
sativus]
 gb|KGN63337.1| hypothetical protein Csa_2G431070 [Cucumis sativus]
Length=459

 Score =   147 bits (370),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 91/127 (72%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            + PTP E K+LSDIDDQ+GLRF   +I FYR +P M   DP   I++A+AKALV+YYP A
Sbjct  20   SDPTPHEFKQLSDIDDQEGLRFQIPVIQFYRHDPRMAGTDPARVIKEAIAKALVFYYPFA  79

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +GP  K  V+C+ +G+ F EAD+ +SLE  GDA++PP    +E L++VP S  +L 
Sbjct  80   GRLREGPGRKLFVECTGEGVLFTEADADVSLEQFGDALQPPFPCLEELLFDVPNSSGVLD  139

Query  471  CPLMIVQ  491
            CPL+++Q
Sbjct  140  CPLLLIQ  146



>ref|XP_006470742.1| PREDICTED: anthraniloyl-CoA:methanol acyltransferase-like [Citrus 
sinensis]
Length=447

 Score =   147 bits (370),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 73/139 (53%), Positives = 96/139 (69%), Gaps = 7/139 (5%)
 Frame = +3

Query  96   RAPGTAKPT----PQETKELSDIDDQKGLRFHFCMIMFYRANPL--MKAKDPVEAIRDAV  257
            RAP    P       E K+LSDIDDQ+GL F   +I FY+ NP   MK KDPV+ I++A+
Sbjct  14   RAPELIGPALALKSHEVKQLSDIDDQQGLWFQVPLIFFYKNNPSPSMKGKDPVKVIKEAL  73

Query  258  AKALVWYYPLAGRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLG-DAVKPPCLYSKEF  434
            ++ALV+YYP AGRL +G + K MVDC+ +G+ F EAD+  SL+ LG D +KPPC Y  E 
Sbjct  74   SRALVYYYPFAGRLREGSDGKLMVDCNGEGVLFTEADADFSLDQLGDDEIKPPCPYLDEL  133

Query  435  LYEVPGSHQILGCPLMIVQ  491
            LY+VPGS   LGCPL+++Q
Sbjct  134  LYDVPGSEGTLGCPLLLIQ  152



>ref|XP_011046335.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Populus 
euphratica]
Length=452

 Score =   147 bits (370),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 95/127 (75%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            ++PTP E K LSDIDDQ GLR    +I+FY  +P M+ +DPV+ I++A+AK LV+YYP A
Sbjct  23   SEPTPHELKPLSDIDDQDGLRVQIPLILFYTYDPSMQRRDPVKVIKEALAKTLVFYYPFA  82

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +GP+ K +V+C+ +GI F+EAD+ ++LE  GDA+ PP    +E L++VPGS  ++ 
Sbjct  83   GRLREGPKRKLLVECTGEGILFIEADADVTLEQFGDALYPPIPCLEELLFDVPGSSGMIN  142

Query  471  CPLMIVQ  491
            CPL++VQ
Sbjct  143  CPLLLVQ  149



>gb|KEH40976.1| benzyl alcohol O-benzoyltransferase [Medicago truncatula]
Length=417

 Score =   146 bits (368),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 91/127 (72%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            +KPTP E K LSDIDDQ+GLR+   +I FY   P+M  KDPV+ IR A+AK LV+YYP A
Sbjct  20   SKPTPHEIKLLSDIDDQEGLRYQMPVIQFYNYVPVMAEKDPVDVIRKALAKTLVFYYPFA  79

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +GP  K MVDC+ +G+ F+EAD+ ++++DLGD + PP     E LY+V GS  +L 
Sbjct  80   GRLREGPGRKLMVDCTGEGVLFIEADADVTIKDLGDTLHPPFRCLDELLYDVLGSSDVLN  139

Query  471  CPLMIVQ  491
             PL+++Q
Sbjct  140  TPLLLIQ  146



>ref|XP_003521737.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Glycine 
max]
Length=475

 Score =   147 bits (370),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 92/127 (72%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            AKPTP+E K LSDIDDQ+GLRF    I+FY   P M  KDP + IR+A+A+ LV+YYP A
Sbjct  23   AKPTPREVKPLSDIDDQQGLRFQIPFILFYGNEPSMAGKDPAKVIREALAQTLVFYYPFA  82

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GR+ +GP  K +VDC+ +G+ F+EAD+  +L+ LGD ++PP    ++ LY+VPGS  ++ 
Sbjct  83   GRIREGPGRKLVVDCTGEGLMFIEADADATLDQLGDTLQPPFPCFEQLLYDVPGSEGVID  142

Query  471  CPLMIVQ  491
            CPLM+ Q
Sbjct  143  CPLMLFQ  149



>ref|XP_006446261.1| hypothetical protein CICLE_v10015234mg [Citrus clementina]
 gb|ESR59501.1| hypothetical protein CICLE_v10015234mg [Citrus clementina]
Length=447

 Score =   146 bits (369),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/128 (55%), Positives = 92/128 (72%), Gaps = 3/128 (2%)
 Frame = +3

Query  117  PTPQETKELSDIDDQKGLRFHFCMIMFYRANPL--MKAKDPVEAIRDAVAKALVWYYPLA  290
            P   E K+LSDIDDQ+GL F   +I FY+ NP   MK KDPV+ I++A+++ALV+YYP A
Sbjct  25   PKSHEVKQLSDIDDQQGLWFQVPLIFFYKNNPSPSMKGKDPVKVIKEALSRALVYYYPFA  84

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLG-DAVKPPCLYSKEFLYEVPGSHQIL  467
            GRL +G + K MVDC+ +G+ F EAD+  SL+ LG D +KPPC Y  E LY+VPGS   L
Sbjct  85   GRLREGSDGKLMVDCNGEGVLFTEADADFSLDQLGDDEIKPPCPYLDELLYDVPGSEGTL  144

Query  468  GCPLMIVQ  491
            GCPL++ Q
Sbjct  145  GCPLLLFQ  152



>ref|XP_009374085.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Pyrus x 
bretschneideri]
Length=458

 Score =   146 bits (369),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 92/127 (72%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            AK TP E ++LSDIDDQ+GLRF   ++ FYR +  M+ +DPV  IR+A+A+ LV+YYP A
Sbjct  23   AKATPYEFRQLSDIDDQEGLRFQIPVLQFYRYDLSMQGRDPVHVIREAIAQTLVFYYPFA  82

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +GP  K  V+C+A+GI F+EAD+ ++LE  GD + PP    +E LY VPGS  +L 
Sbjct  83   GRLKEGPNRKLAVECTAEGIMFIEADADITLEHFGDNLHPPFPCLEELLYNVPGSDGVLN  142

Query  471  CPLMIVQ  491
            CPL+++Q
Sbjct  143  CPLLLIQ  149



>ref|XP_007147133.1| hypothetical protein PHAVU_006G098500g [Phaseolus vulgaris]
 gb|ESW19127.1| hypothetical protein PHAVU_006G098500g [Phaseolus vulgaris]
Length=463

 Score =   146 bits (369),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/127 (54%), Positives = 89/127 (70%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            A PTP E K LSDIDDQ+ LRFH  MI  YR    M  KDPVE IR A+++ LV+YYP A
Sbjct  29   AIPTPHELKLLSDIDDQEALRFHIPMIQIYRKQASMAEKDPVEVIRKALSQTLVFYYPFA  88

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +GP+ K MVDC+ +G+ F+E D+ ++L + GD+++PP     E LY+VPGS QI  
Sbjct  89   GRLREGPQRKLMVDCTGEGVMFMEGDADVTLAEFGDSLQPPFPCFDELLYDVPGSQQITN  148

Query  471  CPLMIVQ  491
             PL++VQ
Sbjct  149  TPLLLVQ  155



>ref|XP_010058385.1| PREDICTED: methanol O-anthraniloyltransferase-like [Eucalyptus 
grandis]
Length=397

 Score =   145 bits (367),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/128 (52%), Positives = 95/128 (74%), Gaps = 1/128 (1%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAK-DPVEAIRDAVAKALVWYYPL  287
            ++ TP+E K LSD+DDQ+GLRF F  + FY  NP ++ + DP   +++A+ KALV+YYPL
Sbjct  45   SQATPRELKPLSDLDDQEGLRFQFPFLFFYPNNPPIRGREDPARVVKEALGKALVYYYPL  104

Query  288  AGRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQIL  467
            AGR+ +GP     VDC+ +GI FVEAD+ +SLE+LGD+++PPC +  E L +V GS  I+
Sbjct  105  AGRIRKGPNRMLAVDCTGEGILFVEADADVSLEELGDSMRPPCGFVDEVLCDVGGSGGII  164

Query  468  GCPLMIVQ  491
            GCPL++VQ
Sbjct  165  GCPLLLVQ  172



>ref|XP_007029781.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase [Theobroma 
cacao]
 gb|EOY10283.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase [Theobroma 
cacao]
Length=562

 Score =   147 bits (371),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 68/127 (54%), Positives = 92/127 (72%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            AKPTP+E K LSDIDDQ G RF    + FYR  P M+ KDP   I++A+ KALV+YYP A
Sbjct  133  AKPTPRECKLLSDIDDQDGHRFQIRGLHFYRFKPSMQGKDPACIIKEALTKALVFYYPYA  192

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +GP  K +VDC+ +G+ F++AD+ ++L+  GD++ PP    KE LYEVPGS++IL 
Sbjct  193  GRLREGPNRKLVVDCTGEGVLFIQADADVTLDQFGDSLHPPFPCYKELLYEVPGSNEILN  252

Query  471  CPLMIVQ  491
            CPL+ +Q
Sbjct  253  CPLLQIQ  259



>gb|KEH40971.1| benzyl alcohol O-benzoyltransferase [Medicago truncatula]
Length=461

 Score =   146 bits (369),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 68/127 (54%), Positives = 91/127 (72%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            +KPTP E K LSDIDDQ+GLR+   +I FY+ +P M  KDPV+ IR A+AK LV+YYP A
Sbjct  20   SKPTPHEIKLLSDIDDQEGLRYQTRLIQFYKYDPNMAGKDPVDIIRKALAKTLVFYYPFA  79

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +GP  K MVDC+ +GI F+EAD+ ++LE  G+ + PP     E LY+VPGS  +L 
Sbjct  80   GRLREGPSRKLMVDCNDEGILFIEADADVTLEQFGEDLHPPFPCIDELLYDVPGSSVVLN  139

Query  471  CPLMIVQ  491
             PL+++Q
Sbjct  140  TPLLLIQ  146



>ref|XP_011098396.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Sesamum 
indicum]
Length=460

 Score =   146 bits (368),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 68/127 (54%), Positives = 91/127 (72%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            AKPTP E K LSDIDDQ+ LRF    I FYR NP M  KDPV  IRDAV++ALV+YYPLA
Sbjct  22   AKPTPHELKPLSDIDDQESLRFQVPAIQFYRRNPAMDGKDPVMVIRDAVSRALVFYYPLA  81

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +    K +V+C+ +G+ F+EA + ++L+  GDA+ PP    +E LY+VPGS  ++ 
Sbjct  82   GRLREAAGRKLVVECTGEGVLFIEAVADVTLQQFGDALLPPFPCLEELLYDVPGSGGVVN  141

Query  471  CPLMIVQ  491
            CPL+++Q
Sbjct  142  CPLLLIQ  148



>dbj|BAF49304.1| putative acyltransferase [Clitoria ternatea]
Length=461

 Score =   146 bits (368),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 89/127 (70%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            AKPTP+E K LSDIDDQ+GLRF   +I FYR N  M  KDPVE IR A+AK LV+YYP A
Sbjct  25   AKPTPREVKLLSDIDDQEGLRFQIPVIQFYRYNETMAGKDPVEVIRKALAKTLVFYYPFA  84

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +GP  K MVDC+ +G+ F+EA + ++L+  GD+++PP       LY +P S  +L 
Sbjct  85   GRLREGPGRKLMVDCTGEGVLFIEAHADVTLQQFGDSLQPPFPGLDHLLYNLPNSDGVLN  144

Query  471  CPLMIVQ  491
             PL+++Q
Sbjct  145  SPLLLIQ  151



>ref|XP_007029787.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase isoform 
2, partial [Theobroma cacao]
 gb|EOY10289.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase isoform 
2, partial [Theobroma cacao]
Length=485

 Score =   146 bits (369),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 92/127 (72%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            AKPTP+E K LSDIDDQ G RF    + FYR  P M+ KDP   I++A+ KALV+YYP A
Sbjct  37   AKPTPRECKLLSDIDDQDGHRFQIRGLHFYRFKPSMQGKDPACIIKEALTKALVFYYPYA  96

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +GP  K +VDC+ +G+ F++AD+ ++L+  GD++ PP    KE LYEVPGS+++L 
Sbjct  97   GRLREGPNRKLVVDCTGEGVLFIQADADVTLDQFGDSLHPPFPCYKELLYEVPGSNELLN  156

Query  471  CPLMIVQ  491
            CPL+ +Q
Sbjct  157  CPLLQIQ  163



>ref|XP_007211147.1| hypothetical protein PRUPE_ppa026958mg, partial [Prunus persica]
 gb|EMJ12346.1| hypothetical protein PRUPE_ppa026958mg, partial [Prunus persica]
Length=146

 Score =   139 bits (349),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 68/124 (55%), Positives = 89/124 (72%), Gaps = 3/124 (2%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            AKPTP ETK LSDID+Q G+RFH+ +IM Y+ NP MK  D V  I++A+++ALV+YYPLA
Sbjct  22   AKPTPLETKLLSDIDNQVGIRFHYSVIMTYKNNPSMKGNDAVMVIKEALSRALVFYYPLA  81

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +GP  K MVDC+ +G   VEA++ ++LE LGD + PPC     FL+   GS  IL 
Sbjct  82   GRLREGPNRKLMVDCNGEG---VEANADVTLEQLGDTILPPCPPLVLFLFNPLGSDGILD  138

Query  471  CPLM  482
            CPL+
Sbjct  139  CPLL  142



>emb|CAA64636.1| hsr201 [Nicotiana tabacum]
Length=460

 Score =   146 bits (368),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 69/127 (54%), Positives = 92/127 (72%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            AKPTP+ETK LSDIDDQ+GLRF   +I FY  +  M  KDPV+ I+ A+A+ LV+YYP A
Sbjct  24   AKPTPRETKFLSDIDDQEGLRFQIPVIQFYHKDSSMGRKDPVKVIKKAIAETLVFYYPFA  83

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +G   K MVDC+ +GI FVEAD+ ++LE  GD ++PP    +E LY+VP S  +L 
Sbjct  84   GRLREGNGRKLMVDCTGEGIMFVEADADVTLEQFGDELQPPFPCLEELLYDVPDSAGVLN  143

Query  471  CPLMIVQ  491
            CPL+++Q
Sbjct  144  CPLLLIQ  150



>ref|XP_010689158.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Beta vulgaris 
subsp. vulgaris]
Length=443

 Score =   145 bits (367),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            A+PTP+E K LSDIDDQ+GLRFH   +MFY+A+P M  +DPVE +++ +A+ALV +YP A
Sbjct  26   AEPTPRELKPLSDIDDQEGLRFHMPAVMFYKADPSMDGRDPVEVVKEGLARALVLFYPYA  85

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL++G   K  VDC+ +G+ FVEAD+   LED GD + PP    ++ LY++PG+  +LG
Sbjct  86   GRLVEGQARKLSVDCTGEGVVFVEADADARLEDFGDEIHPP-FPLEDLLYDMPGTDAMLG  144

Query  471  CPLMIVQ  491
             PL+I Q
Sbjct  145  TPLLIFQ  151



>ref|XP_007029786.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase isoform 
1 [Theobroma cacao]
 gb|EOY10288.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase isoform 
1 [Theobroma cacao]
Length=525

 Score =   146 bits (369),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 92/127 (72%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            AKPTP+E K LSDIDDQ G RF    + FYR  P M+ KDP   I++A+ KALV+YYP A
Sbjct  45   AKPTPRECKLLSDIDDQDGHRFQIRGLHFYRFKPSMQGKDPACIIKEALTKALVFYYPYA  104

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +GP  K +VDC+ +G+ F++AD+ ++L+  GD++ PP    KE LYEVPGS+++L 
Sbjct  105  GRLREGPNRKLVVDCTGEGVLFIQADADVTLDQFGDSLHPPFPCYKELLYEVPGSNELLN  164

Query  471  CPLMIVQ  491
            CPL+ +Q
Sbjct  165  CPLLQIQ  171



>gb|EYU41395.1| hypothetical protein MIMGU_mgv1a006288mg [Erythranthe guttata]
Length=449

 Score =   145 bits (367),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 92/127 (72%), Gaps = 1/127 (1%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            AKPTP E K LSDIDDQ+GLRFH  +I FYR  P ++A DPVE IR A+AKALV YYP A
Sbjct  23   AKPTPHEFKPLSDIDDQEGLRFHVPLIQFYRNIPSIEA-DPVEVIRKAIAKALVPYYPFA  81

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +    K +V+C+ +G+ F+EAD+ ++LE  GD ++PP     E LY+VPGS  I+ 
Sbjct  82   GRLREQAARKLVVECTGEGVMFIEADADVALEQFGDEIRPPVPCLDELLYDVPGSGGIIN  141

Query  471  CPLMIVQ  491
            CPL+++Q
Sbjct  142  CPLLLIQ  148



>gb|AES82602.2| benzyl alcohol O-benzoyltransferase [Medicago truncatula]
Length=153

 Score =   139 bits (349),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 60/127 (47%), Positives = 94/127 (74%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            A PTP+E K LSDIDDQ+ LRF+  +I  YR  P M  KDP + ++ A+++ LV+YYPLA
Sbjct  21   AAPTPREVKLLSDIDDQECLRFNMPIIFIYRHEPSMIEKDPAKVLKRALSQTLVYYYPLA  80

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GR+ +G  DK MVDC+ +G+ F+EA++ ++L++ GDA+ PP    +E +Y+VPG++QI+ 
Sbjct  81   GRIREGARDKLMVDCTGEGVMFIEAETDVTLDEFGDALHPPFPCFQELIYDVPGTNQIID  140

Query  471  CPLMIVQ  491
             P++++Q
Sbjct  141  HPILLIQ  147



>ref|XP_009803456.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like isoform X1 
[Nicotiana sylvestris]
Length=462

 Score =   145 bits (367),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 91/126 (72%), Gaps = 0/126 (0%)
 Frame = +3

Query  114  KPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLAG  293
            KPTP+ETK LSDIDDQ+G+RF   +I FY  N  M+ KDPV  I+ A+A+ LV+YYP AG
Sbjct  25   KPTPRETKFLSDIDDQEGMRFQIPVIQFYSKNSSMEGKDPVNVIKKAIAETLVFYYPFAG  84

Query  294  RLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILGC  473
            RL +G   K MVDC+ +GI FVEAD+ ++LE+ GD ++PP     E L++VP S  +L C
Sbjct  85   RLREGTGRKLMVDCTGEGIMFVEADADVTLEEFGDELQPPFPCLDELLFDVPHSAGVLNC  144

Query  474  PLMIVQ  491
            PL+++Q
Sbjct  145  PLLLIQ  150



>gb|AAW51125.1| putative alcohol acyl-transferases [Cucumis melo]
Length=459

 Score =   145 bits (367),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 92/127 (72%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            + PTP E K+LSDIDDQ+GLRF   +I FYR +P M   DP   I++A+AKALV+YYP A
Sbjct  20   SDPTPHEFKQLSDIDDQEGLRFQIPVIQFYRHDPRMAGTDPARVIKEAIAKALVFYYPFA  79

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +GP  K  V+C+ +G+ F+EAD+ +SLE  GDA++PP    +E L++VP S  +L 
Sbjct  80   GRLREGPGRKLFVECTGEGVMFIEADADVSLEQFGDALQPPFPCLEEPLFDVPNSSGVLD  139

Query  471  CPLMIVQ  491
            CPL+++Q
Sbjct  140  CPLLLIQ  146



>ref|XP_003536235.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Glycine 
max]
Length=454

 Score =   145 bits (366),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 69/128 (54%), Positives = 93/128 (73%), Gaps = 1/128 (1%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            AKPTP+E K LSDIDDQ GLRF   +I  YR +P M  KDPVE IR A+A+ LV+YYP A
Sbjct  20   AKPTPREVKLLSDIDDQDGLRFQIPVIQIYRHDPSMAGKDPVEVIRKALARTLVFYYPFA  79

Query  291  GRLIQGPEDKFMVDCSAQ-GIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQIL  467
            GRL +G + K MVDC+ + G+ F+EAD+ ++L+  GDA++PP    +E LY+VPGS  +L
Sbjct  80   GRLREGRDRKLMVDCTGELGVLFIEADADVTLKHFGDALQPPFPCWEELLYDVPGSQGVL  139

Query  468  GCPLMIVQ  491
              PL+++Q
Sbjct  140  NTPLLLIQ  147



>ref|XP_007029776.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase [Theobroma 
cacao]
 gb|EOY10278.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase [Theobroma 
cacao]
Length=540

 Score =   146 bits (368),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 91/127 (72%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            AKPTP+E K LSDIDD++G RF + +I FYR +P M+ +DP   IRDA+AK LV+YYP A
Sbjct  119  AKPTPREYKPLSDIDDREGHRFEYPVIQFYRYSPSMQGRDPARVIRDALAKTLVFYYPYA  178

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +GP  K  VDC+ +G+ F E D+ ++LE  G+ ++PP    +E LY+VPG   +L 
Sbjct  179  GRLREGPNRKLTVDCTGEGVLFSEGDADVTLEQFGEELQPPFPCMEELLYDVPGYGGVLN  238

Query  471  CPLMIVQ  491
            CPL+++Q
Sbjct  239  CPLLLIQ  245



>ref|XP_008462818.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Cucumis 
melo]
Length=461

 Score =   145 bits (366),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 91/127 (72%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            AKPTP E K+LSDIDDQ+  RFH  ++ FY  NP M+  DPV+ I+ A+++ LV+YYP A
Sbjct  24   AKPTPYEFKQLSDIDDQECFRFHVPLLFFYANNPRMEGSDPVKVIKKAISETLVFYYPFA  83

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +GP  K  V+C+A+GI F+EAD+++ L+  GDAV+PP  +  + LY VP S  I+ 
Sbjct  84   GRLREGPGKKLFVECTAEGILFIEADANVDLQQFGDAVQPPFAFLDDVLYNVPNSDGIIN  143

Query  471  CPLMIVQ  491
             PL++VQ
Sbjct  144  SPLLLVQ  150



>ref|XP_008356442.1| PREDICTED: methanol O-anthraniloyltransferase-like [Malus domestica]
Length=460

 Score =   145 bits (366),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 94/127 (74%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            A PTP E K LS+ID+Q+ LR     I  Y +NP  K  DPV+ IRDA++++LV+YYPLA
Sbjct  23   ASPTPCEQKILSEIDNQEALRCQTPFIWSYTSNPSSKEIDPVQVIRDALSRSLVYYYPLA  82

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GR+ +GP  K MVDC+ +G+ F+EA++ ++LE LGD ++PPC   ++FLY+VPG++ I+G
Sbjct  83   GRVREGPNKKLMVDCNGEGVLFIEAEADVTLEQLGDTLQPPCPLLEDFLYDVPGTNDIVG  142

Query  471  CPLMIVQ  491
             PL+ VQ
Sbjct  143  TPLLJVQ  149



>ref|NP_001152518.1| 10-deacetylbaccatin III 10-O-acetyltransferase [Zea mays]
 gb|ACG48011.1| 10-deacetylbaccatin III 10-O-acetyltransferase [Zea mays]
Length=462

 Score =   145 bits (366),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 90/127 (71%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            A PTP+E K LSDIDDQ GLRFH  +I FYR N LM  +DP   +RDAVA+ALV YYP A
Sbjct  20   ASPTPRELKRLSDIDDQDGLRFHIPVIQFYRRNALMGGRDPAPVVRDAVARALVHYYPFA  79

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +    K  V+C+ +G+ F+EAD+ + L+  GDA++PP    +E +++VPGS ++LG
Sbjct  80   GRLRELEGRKLAVECTGEGVLFIEADTDVRLDHFGDALQPPFPCLEELIFDVPGSSEVLG  139

Query  471  CPLMIVQ  491
             PL++ Q
Sbjct  140  SPLLLFQ  146



>ref|XP_011085897.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Sesamum 
indicum]
Length=465

 Score =   144 bits (364),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 90/127 (71%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            AKPTP E K LSDIDDQ+  RFH  +I F+  NP M  KDPV+  RDA+AKALV+YYPLA
Sbjct  22   AKPTPHEFKTLSDIDDQEAFRFHLPLIAFFPKNPAMDIKDPVKVFRDALAKALVFYYPLA  81

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +    K +V+C+ +G  F+EAD+ + L+  GD ++PP    +E LY+VPGS  ++ 
Sbjct  82   GRLRETAGRKLVVECTGEGALFIEADADVRLQQFGDTLQPPFPCLEELLYDVPGSGGVVN  141

Query  471  CPLMIVQ  491
            CPL+++Q
Sbjct  142  CPLLLIQ  148



>dbj|BAJ92444.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=482

 Score =   145 bits (365),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 90/127 (71%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            A PTP+E K LSDIDDQ GLRFH  +I FYR +  M  +DP   +RDAVA+ALV YYP A
Sbjct  42   AGPTPRELKRLSDIDDQDGLRFHIPVIQFYRRDASMGGRDPAAVVRDAVARALVHYYPFA  101

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +    K  VDC+ +G+ F+EAD+++ LE  GDA++PP    +E +++VPGS ++LG
Sbjct  102  GRLRELEGRKLAVDCTGEGVLFIEADANVRLEHFGDALQPPFPGLEELVFDVPGSSEVLG  161

Query  471  CPLMIVQ  491
             PL++ Q
Sbjct  162  TPLLLFQ  168



>ref|XP_009365780.1| PREDICTED: methanol O-anthraniloyltransferase-like [Pyrus x bretschneideri]
Length=461

 Score =   144 bits (364),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 92/127 (72%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            A PTP E K LS+ID+Q+ LR     I  Y +NP  K  DPV+ IRDA++++LV+YYPLA
Sbjct  23   ASPTPCEQKILSEIDNQEALRCQVPFIWSYTSNPSSKEIDPVQVIRDALSRSLVYYYPLA  82

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GR+ +GP  K MVDC+ +G+ F EAD+  +LE LGD ++PPC   ++FLY+VPG+  I+G
Sbjct  83   GRVRKGPNKKLMVDCNGEGVLFREADADFTLEQLGDTLQPPCPLLEDFLYDVPGTSDIVG  142

Query  471  CPLMIVQ  491
             PL+IVQ
Sbjct  143  TPLLIVQ  149



>ref|XP_011046333.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Populus 
euphratica]
Length=452

 Score =   144 bits (363),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 92/127 (72%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            ++PTP E K LSDIDDQ GLR    +I FY  +P M+ +DPVE I+ A+AK LV+YYP A
Sbjct  23   SEPTPHELKPLSDIDDQDGLRVQIPLIYFYPYDPSMQRRDPVEVIKKALAKTLVFYYPFA  82

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +GP+ K +V+C+ +GI F+EAD+ ++LE  GD + PP    +E LY+VPGS  ++ 
Sbjct  83   GRLREGPKRKLLVECTGEGILFIEADADVTLEQFGDELYPPIPCLEELLYDVPGSSGMIN  142

Query  471  CPLMIVQ  491
            CPL+++Q
Sbjct  143  CPLLLIQ  149



>gb|KEH40977.1| benzyl alcohol O-benzoyltransferase [Medicago truncatula]
Length=425

 Score =   144 bits (363),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 89/127 (70%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            +KPT  ETK LSDIDDQ  LR+   +I FY  +P M  KDPV+ IR A+AK LV+YYP A
Sbjct  20   SKPTLHETKLLSDIDDQDSLRWQVPLIQFYNHDPNMAGKDPVDVIRKALAKTLVFYYPFA  79

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +GP  K MVDC+ +G+ F+EAD+ ++L++ GDA+ PP     E LY VPGS  ++ 
Sbjct  80   GRLREGPGRKLMVDCTGEGVLFIEADADVTLKEFGDALHPPFPCLDELLYYVPGSSDVIN  139

Query  471  CPLMIVQ  491
             PLM++Q
Sbjct  140  TPLMLIQ  146



>ref|XP_006370913.1| hypothetical protein POPTR_0019s01680g [Populus trichocarpa]
 gb|ERP48710.1| hypothetical protein POPTR_0019s01680g [Populus trichocarpa]
Length=452

 Score =   144 bits (363),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 64/127 (50%), Positives = 94/127 (74%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            ++PTP E K LSDIDDQ GLR    +I FY  +P M+ +DPVE I++A+AK LV+YYP A
Sbjct  23   SEPTPHELKPLSDIDDQDGLRVQIPLIYFYPYDPSMQRRDPVEVIKEALAKTLVFYYPFA  82

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +GP+ K +V+C+ +GI F+EAD+ ++LE  G+A+ PP    +E L++VPGS  ++ 
Sbjct  83   GRLREGPKRKLLVECTGEGILFIEADADVTLEQFGNALYPPIPCLEELLFDVPGSSGMIN  142

Query  471  CPLMIVQ  491
            CPL+++Q
Sbjct  143  CPLLLIQ  149



>gb|KJB82514.1| hypothetical protein B456_013G200000 [Gossypium raimondii]
Length=450

 Score =   144 bits (363),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 90/127 (71%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            AKPTP E K LSDIDDQ  LRF   +I FY+  P M+ KDPVE IR+A+A+ LV YYP A
Sbjct  24   AKPTPYEQKLLSDIDDQASLRFQIRVINFYQYEPSMEGKDPVEVIREALAQTLVCYYPFA  83

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +G   K +VDC+ +G+ F++AD+ ++LE  G+ ++PP   S E LY VPGS  +L 
Sbjct  84   GRLREGANGKLIVDCTGEGVMFIKADADVTLEQFGEPLRPPFPCSDELLYIVPGSEGMLN  143

Query  471  CPLMIVQ  491
            CPL+++Q
Sbjct  144  CPLLLIQ  150



>ref|XP_003626384.1| Benzoyl coenzyme A benzyl alcohol benzoyl transferase [Medicago 
truncatula]
Length=196

 Score =   138 bits (348),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 60/127 (47%), Positives = 94/127 (74%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            A PTP+E K LSDIDDQ+ LRF+  +I  YR  P M  KDP + ++ A+++ LV+YYPLA
Sbjct  21   AAPTPREVKLLSDIDDQECLRFNMPIIFIYRHEPSMIEKDPAKVLKRALSQTLVYYYPLA  80

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GR+ +G  DK MVDC+ +G+ F+EA++ ++L++ GDA+ PP    +E +Y+VPG++QI+ 
Sbjct  81   GRIREGARDKLMVDCTGEGVMFIEAETDVTLDEFGDALHPPFPCFQELIYDVPGTNQIID  140

Query  471  CPLMIVQ  491
             P++++Q
Sbjct  141  HPILLIQ  147



>ref|XP_002466979.1| hypothetical protein SORBIDRAFT_01g017800 [Sorghum bicolor]
 gb|EER93977.1| hypothetical protein SORBIDRAFT_01g017800 [Sorghum bicolor]
Length=465

 Score =   144 bits (363),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 89/127 (70%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            A PTP+E K LSDIDDQ GLRFH  +I FYR + LM  +DP   IRDAVA+ALV YYP A
Sbjct  20   ASPTPRELKRLSDIDDQDGLRFHIPVIQFYRRSALMGGRDPAPVIRDAVARALVHYYPFA  79

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +    K  V+C+ +G+ F+EAD+ + L+  GDA++PP     E +++VPGS Q+LG
Sbjct  80   GRLRELQARKLAVECTGEGVLFIEADADVRLDHFGDALQPPFPCLDELIFDVPGSSQVLG  139

Query  471  CPLMIVQ  491
             PL++ Q
Sbjct  140  SPLLLFQ  146



>ref|XP_009619718.1| PREDICTED: benzyl alcohol O-benzoyltransferase [Nicotiana tomentosiformis]
Length=460

 Score =   144 bits (363),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/127 (54%), Positives = 91/127 (72%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            AKPTP+ETK LSD DDQ+GLRF   +I FY  +  M  KDPV+ I+ A+A+ LV+YYP A
Sbjct  24   AKPTPRETKFLSDTDDQEGLRFQIPVIQFYHKDSSMGRKDPVKVIKKAIAETLVFYYPFA  83

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +G   K MVDC+ +GI FVEAD+ ++LE  GD ++PP    +E LY+VP S  +L 
Sbjct  84   GRLREGNGRKLMVDCTGEGIIFVEADADVTLEQFGDELQPPFPCLEELLYDVPDSAGVLN  143

Query  471  CPLMIVQ  491
            CPL+++Q
Sbjct  144  CPLLLIQ  150



>ref|XP_006588255.1| PREDICTED: 13-hydroxylupanine O-tigloyltransferase-like [Glycine 
max]
Length=304

 Score =   141 bits (356),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 84/127 (66%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            A PTP+E K LS IDDQ GLR+    + FYR  P M  KDPV+ IR A+AK LV+YY  A
Sbjct  99   ANPTPRELKLLSGIDDQHGLRYQLPFVQFYRYQPAMAGKDPVQVIRKALAKTLVFYYRFA  158

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +GP  K  VDC  +G+ F+EAD+ +++E  GD   PP  +  E LY VPGS  I+ 
Sbjct  159  GRLREGPNGKLTVDCDEEGVLFIEADADVAIEQFGDNFMPPFPFFDEILYNVPGSDGIIE  218

Query  471  CPLMIVQ  491
            CPL+++Q
Sbjct  219  CPLVLIQ  225



>ref|XP_009612038.1| PREDICTED: methanol O-anthraniloyltransferase-like isoform X2 
[Nicotiana tomentosiformis]
Length=150

 Score =   137 bits (344),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 62/123 (50%), Positives = 91/123 (74%), Gaps = 1/123 (1%)
 Frame = +3

Query  126  QETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLAGRLIQ  305
            ++ K LSDIDDQ  L F   ++MFY+ +P M+ K PV+ I++ ++K LV+YYPLAGR+++
Sbjct  27   RDRKHLSDIDDQGSLGFQIPILMFYKYSPSMEGKYPVKVIKEGLSKTLVFYYPLAGRIVE  86

Query  306  -GPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILGCPLM  482
              P+ K +VDC+ +GI FVEAD+ + L+ LGD++KPPC Y  + LY VPGS  I+ CPL+
Sbjct  87   LMPDRKLVVDCNGEGILFVEADAQVELDKLGDSIKPPCPYLDQLLYNVPGSAGIIDCPLL  146

Query  483  IVQ  491
            +VQ
Sbjct  147  LVQ  149



>ref|XP_011085895.1| PREDICTED: LOW QUALITY PROTEIN: benzyl alcohol O-benzoyltransferase-like 
[Sesamum indicum]
Length=466

 Score =   144 bits (363),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 93/132 (70%), Gaps = 5/132 (4%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            AKPTP E K LSDIDDQ+GLRF   +I FYR NP M  KDPV  IRDA+A+ALV+YYP A
Sbjct  22   AKPTPHELKPLSDIDDQEGLRFQIPLIQFYRRNPAMNRKDPVMVIRDALARALVFYYPFA  81

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDA-----VKPPCLYSKEFLYEVPGS  455
            GRL +    K +V+C+ +G+ F+EAD+ ++L+  GDA     ++PP    +E LY+VP S
Sbjct  82   GRLREAAGRKLVVECTGEGVLFIEADADVTLQQFGDASSAVPLQPPFPCLEELLYDVPES  141

Query  456  HQILGCPLMIVQ  491
              ++ CPL+++Q
Sbjct  142  AGVVNCPLLLIQ  153



>sp|Q8GT20.1|BEBT_TOBAC RecName: Full=Benzyl alcohol O-benzoyltransferase; AltName: Full=Benzoyl 
coenzyme A:benzyl alcohol benzoyl transferase [Nicotiana 
tabacum]
 gb|AAN09798.1| benzoyl coenzyme A: benzyl alcohol benzoyl transferase [Nicotiana 
tabacum]
Length=460

 Score =   144 bits (362),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/127 (54%), Positives = 91/127 (72%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            AKPTP+E K LSDIDDQ+GLRF   +I FY  +  M  KDPV+ I+ A+A+ LV+YYP A
Sbjct  24   AKPTPREIKFLSDIDDQEGLRFQIPVIQFYHKDSSMGRKDPVKVIKKAIAETLVFYYPFA  83

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +G   K MVDC+ +GI FVEAD+ ++LE  GD ++PP    +E LY+VP S  +L 
Sbjct  84   GRLREGNGRKLMVDCTGEGIMFVEADADVTLEQFGDELQPPFPCLEELLYDVPDSAGVLN  143

Query  471  CPLMIVQ  491
            CPL+++Q
Sbjct  144  CPLLLIQ  150



>ref|XP_006878638.1| hypothetical protein AMTR_s00011p00264170 [Amborella trichopoda]
 gb|ERM94783.1| hypothetical protein AMTR_s00011p00264170 [Amborella trichopoda]
Length=476

 Score =   144 bits (362),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 63/127 (50%), Positives = 90/127 (71%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            ++PTP E K LSDIDDQ+G RF   ++ FYR +P M  +DP   +RDA+++ALV+YYP A
Sbjct  21   SRPTPYEIKPLSDIDDQEGFRFQIPVVQFYRKDPQMDGRDPARVVRDALSEALVYYYPFA  80

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +G   K  V+CS +G+ FVE D+ +SLE+ GDA++PP    ++ L  VPGS  ++G
Sbjct  81   GRLREGENRKLSVECSGEGVLFVEGDADVSLEEFGDALQPPFPCWEKLLIHVPGSDGVIG  140

Query  471  CPLMIVQ  491
            CPL+ +Q
Sbjct  141  CPLLFIQ  147



>ref|XP_006370914.1| hypothetical protein POPTR_0019s01690g [Populus trichocarpa]
 gb|ERP48711.1| hypothetical protein POPTR_0019s01690g [Populus trichocarpa]
Length=451

 Score =   143 bits (361),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 63/127 (50%), Positives = 95/127 (75%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            ++PTP E K LSDIDDQ GLR H  +I+FY  +  M+ +DPV+ I++A+AK LV+YYP A
Sbjct  23   SEPTPHELKPLSDIDDQDGLRVHIPLILFYPYDHSMQRRDPVQVIKEALAKTLVFYYPFA  82

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +GP+ K +V+C+ +GI F+EA++ ++LE  GDA+ PP    +E L++VPGS  ++ 
Sbjct  83   GRLREGPKRKLLVECTGEGILFIEANADVTLEQFGDALWPPIPCLEELLFDVPGSSGMIN  142

Query  471  CPLMIVQ  491
            CPL+++Q
Sbjct  143  CPLLLIQ  149



>ref|XP_009612037.1| PREDICTED: methanol O-anthraniloyltransferase-like isoform X1 
[Nicotiana tomentosiformis]
Length=164

 Score =   136 bits (343),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 93/126 (74%), Gaps = 2/126 (2%)
 Frame = +3

Query  120  TP-QETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLAGR  296
            TP ++ K LSDIDDQ  L F   ++MFY+ +P M+ K PV+ I++ ++K LV+YYPLAGR
Sbjct  24   TPSRDRKHLSDIDDQGSLGFQIPILMFYKYSPSMEGKYPVKVIKEGLSKTLVFYYPLAGR  83

Query  297  LIQ-GPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILGC  473
            +++  P+ K +VDC+ +GI FVEAD+ + L+ LGD++KPPC Y  + LY VPGS  I+ C
Sbjct  84   IVELMPDRKLVVDCNGEGILFVEADAQVELDKLGDSIKPPCPYLDQLLYNVPGSAGIIDC  143

Query  474  PLMIVQ  491
            PL++VQ
Sbjct  144  PLLLVQ  149



>gb|KJB80923.1| hypothetical protein B456_013G121600 [Gossypium raimondii]
Length=448

 Score =   143 bits (360),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 93/126 (74%), Gaps = 0/126 (0%)
 Frame = +3

Query  114  KPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLAG  293
            +PTP E K LSD+DDQ+G RFH     F+++N  MK +DP + I++A+AKALV+YYP AG
Sbjct  25   EPTPHECKPLSDVDDQEGHRFHVRGFHFHQSNLSMKGQDPAKVIKEALAKALVFYYPFAG  84

Query  294  RLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILGC  473
            RL +GP  K +VDC+ +G+ F+EAD+ +SL D GD + PP   ++E LY+VPGS+ +L  
Sbjct  85   RLREGPNRKLIVDCTGEGVLFIEADADVSLVDFGDELYPPFPCAEELLYDVPGSNGLLNS  144

Query  474  PLMIVQ  491
            PL+++Q
Sbjct  145  PLLLIQ  150



>gb|EYU41388.1| hypothetical protein MIMGU_mgv1a021683mg [Erythranthe guttata]
Length=418

 Score =   142 bits (359),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 69/127 (54%), Positives = 90/127 (71%), Gaps = 1/127 (1%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            AKPTP E K LSDIDDQ+GLRFH   I  YR+ P ++A DPVE IR A+AKALV YYP A
Sbjct  23   AKPTPHEFKPLSDIDDQEGLRFHVPFIQLYRSIPSVEA-DPVEVIRKAIAKALVPYYPFA  81

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +    K +V+C+ +G+ F+EAD+ ++LE  GD ++PP     E LY+VPGS  I  
Sbjct  82   GRLREHAARKLVVECTGEGVMFIEADADVALEQFGDEIRPPVPCLDELLYDVPGSGGITN  141

Query  471  CPLMIVQ  491
            CPL+++Q
Sbjct  142  CPLLLIQ  148



>tpg|DAA49395.1| TPA: 10-deacetylbaccatin III 10-O-acetyltransferase [Zea mays]
Length=462

 Score =   143 bits (360),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 90/127 (71%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            A PTP+E K LSDIDDQ GLRFH  +I FYR + LM  +DP   +RDAVA+ALV YYP A
Sbjct  20   ASPTPRELKRLSDIDDQDGLRFHIPVIQFYRRSALMGGRDPAPVVRDAVARALVHYYPFA  79

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +    K  V+C+ +G+ F+EAD+ + L+  GDA++PP    +E +++VPGS ++LG
Sbjct  80   GRLRELEGRKLAVECTGEGVLFIEADTDVRLDHFGDALQPPFPCLEELIFDVPGSSEVLG  139

Query  471  CPLMIVQ  491
             PL++ Q
Sbjct  140  SPLLLFQ  146



>ref|XP_011085899.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Sesamum 
indicum]
Length=464

 Score =   143 bits (360),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 90/127 (71%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            AKPTP E K LSDIDDQ+GLRF   +I F+  NP M  KDPV+  RDA+AKALV+YYP A
Sbjct  22   AKPTPHEFKPLSDIDDQEGLRFQLPLIAFFPKNPAMDRKDPVKVFRDALAKALVFYYPFA  81

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +    K +V+C+ +G  F+EAD+ + L+  GD ++PP    +E LY+VPGS  ++ 
Sbjct  82   GRLRETAGRKLVVECTGEGALFIEADADVGLQQFGDTLQPPFPCLEELLYDVPGSGGMVN  141

Query  471  CPLMIVQ  491
            CPL+++Q
Sbjct  142  CPLLLIQ  148



>gb|KEH40969.1| benzyl alcohol O-benzoyltransferase [Medicago truncatula]
Length=458

 Score =   142 bits (359),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 90/127 (71%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            +KPTP ETK LSDIDDQ  LR+    I FY+ +P M  KDPV+ IR A+AK LV+YYP A
Sbjct  20   SKPTPHETKLLSDIDDQDSLRWQVPGIQFYKYDPNMAGKDPVDIIRKALAKTLVFYYPFA  79

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +GP  K MVDC+ +G+ F+EAD+ +SL++ G+ + PP     E LY+VPGS  +L 
Sbjct  80   GRLREGPGRKLMVDCTGEGVLFIEADADVSLKEFGEDLHPPFPCIDELLYDVPGSSDMLN  139

Query  471  CPLMIVQ  491
             PL+++Q
Sbjct  140  TPLLLIQ  146



>gb|AFK34995.1| unknown [Lotus japonicus]
Length=177

 Score =   136 bits (343),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 65/128 (51%), Positives = 88/128 (69%), Gaps = 1/128 (1%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            A  TP ETK LSDIDDQ GLR +  +I FYR  P M  KDPV+ IR+AVAKALV+YYPLA
Sbjct  29   AVSTPHETKHLSDIDDQAGLRANVPIIQFYRNEPSMAGKDPVDIIRNAVAKALVFYYPLA  88

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQ-IL  467
            GRL +      +VDC+ +G+ F+EAD+ ++ E  GD +KPP    +E L+E PGS   ++
Sbjct  89   GRLREAAGGNLVVDCNEEGVMFIEADADITFEQFGDTLKPPFPCFQELLHEAPGSEGVVI  148

Query  468  GCPLMIVQ  491
              P++++Q
Sbjct  149  NSPIILIQ  156



>gb|AFK34239.1| unknown [Medicago truncatula]
Length=445

 Score =   142 bits (358),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 93/127 (73%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            A PTP+E K LSDIDDQ+GLRF+  M+  YR  P MK KDPV+ +R A+++ALV+YYP A
Sbjct  21   AAPTPREVKLLSDIDDQEGLRFNIPMMFIYRHEPSMKEKDPVKVLRHALSQALVYYYPFA  80

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GR+ +G   K MVDC+ +G+ FVEA++ ++L++ GDA+ PP    +E LY+VPGS  I+ 
Sbjct  81   GRIREGAGRKLMVDCTGEGVMFVEAEADVTLDEFGDALHPPLPCFEELLYDVPGSELIID  140

Query  471  CPLMIVQ  491
             P+ ++Q
Sbjct  141  RPIRLIQ  147



>ref|XP_003549135.1| PREDICTED: 13-hydroxylupanine O-tigloyltransferase-like [Glycine 
max]
 gb|KHN31562.1| 13-hydroxylupanine O-tigloyltransferase [Glycine soja]
Length=455

 Score =   142 bits (357),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 63/127 (50%), Positives = 89/127 (70%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            A PTP E K LSDIDDQ GLR+   +++F+   P M+ KDPVE IR+A++K LV+YYP A
Sbjct  23   ANPTPHEVKLLSDIDDQNGLRYQLPLVLFFPYQPSMEGKDPVEVIREALSKTLVFYYPFA  82

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +GP+ K MVDC+ +G+ F+EAD+ +++E  G+   PP     E LY VPGS  ++ 
Sbjct  83   GRLREGPDGKLMVDCNGEGVMFIEADADVTIEQFGNNFMPPFPCFDELLYNVPGSDGMID  142

Query  471  CPLMIVQ  491
             PL+++Q
Sbjct  143  TPLLLIQ  149



>ref|XP_009803458.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Nicotiana 
sylvestris]
Length=158

 Score =   135 bits (340),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 86/126 (68%), Gaps = 0/126 (0%)
 Frame = +3

Query  114  KPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLAG  293
            KPTP+ETK LSDIDDQ+G+RF   +I FY  N  M  KDPV  I+ A+A+ LV+YYP AG
Sbjct  25   KPTPRETKFLSDIDDQEGMRFQIPVIQFYSKNSPMGGKDPVNVIKKAIAETLVFYYPFAG  84

Query  294  RLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILGC  473
            RL +G   K MVDC+ +G  FV+AD+ ++LE+ GD + PP     E L+ VP S  +L C
Sbjct  85   RLREGTGRKLMVDCTGEGNMFVDADADVTLEEFGDELHPPFPCLDELLFYVPHSAGVLNC  144

Query  474  PLMIVQ  491
             L+++Q
Sbjct  145  TLLLIQ  150



>emb|CDP22130.1| unnamed protein product [Coffea canephora]
Length=161

 Score =   135 bits (340),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 92/127 (72%), Gaps = 2/127 (2%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            AK TP+E K LSDIDDQ+GLRF   +I FYR++     +DPV+ IR+A+AKALV+YYP A
Sbjct  21   AKSTPRECKVLSDIDDQEGLRFQIPVIQFYRSDD--GRRDPVKVIREAIAKALVFYYPFA  78

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +    K +VDC+ +G+ F+EAD+ ++LE  GD ++PP    +E LY+VP S  +L 
Sbjct  79   GRLRECARRKLVVDCTGEGVMFIEADAEVTLEQYGDELQPPFPCLEELLYDVPESAGVLH  138

Query  471  CPLMIVQ  491
            CPL+++Q
Sbjct  139  CPLLLIQ  145



>gb|KCW72711.1| hypothetical protein EUGRSUZ_E01163 [Eucalyptus grandis]
Length=464

 Score =   142 bits (357),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 64/128 (50%), Positives = 95/128 (74%), Gaps = 1/128 (1%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAK-DPVEAIRDAVAKALVWYYPL  287
            ++ TP+E K LSD+DDQ+GLRF    + FY  +P ++ + DP   +++A+ KALV+YYPL
Sbjct  25   SQATPRELKPLSDLDDQEGLRFQIPFLFFYPNSPPIRGREDPARVVKEALRKALVYYYPL  84

Query  288  AGRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQIL  467
            AGR+ +GP  K +VDC+ +GI FV+AD+  SLE+LGD+++PPC +  E L +V GS  I+
Sbjct  85   AGRIREGPNRKLVVDCTGEGILFVKADADFSLEELGDSMRPPCGFVDEVLCDVAGSGGII  144

Query  468  GCPLMIVQ  491
            GCPL++VQ
Sbjct  145  GCPLLLVQ  152



>ref|XP_006290240.1| hypothetical protein CARUB_v100037960mg, partial [Capsella rubella]
 gb|EOA23138.1| hypothetical protein CARUB_v100037960mg, partial [Capsella rubella]
Length=147

 Score =   134 bits (338),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 90/129 (70%), Gaps = 3/129 (2%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            AKPTP+  K LSDIDDQ+GLRFH   I FYR NP   + DPV  IR A+A+ LV+YYP A
Sbjct  20   AKPTPRGFKLLSDIDDQEGLRFHIPTIFFYRHNPKTYS-DPVAVIRRALAETLVYYYPFA  78

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDL--GDAVKPPCLYSKEFLYEVPGSHQI  464
            GRL +GP  K  VDC+ +G+ F+EAD+ ++L +    DA+KPP    +E L++V GS ++
Sbjct  79   GRLREGPNRKLAVDCTGEGVLFIEADADVTLVEFEEKDALKPPFPCFEELLFDVEGSSEV  138

Query  465  LGCPLMIVQ  491
            L  PLM++Q
Sbjct  139  LNAPLMLMQ  147



>ref|XP_003626383.1| Benzoyl coenzyme A benzyl alcohol benzoyl transferase [Medicago 
truncatula]
Length=510

 Score =   142 bits (358),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 93/127 (73%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            A PTP+E K LSDIDDQ+GLRF+  M+  YR  P MK KDPV+ +R A+++ALV+YYP A
Sbjct  21   AAPTPREVKLLSDIDDQEGLRFNIPMMFIYRHEPSMKEKDPVKVLRHALSQALVYYYPFA  80

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GR+ +G   K MVDC+ +G+ FVEA++ ++L++ GDA+ PP    +E LY+VPGS  I+ 
Sbjct  81   GRIREGAGRKLMVDCTGEGVMFVEAEADVTLDEFGDALHPPLPCFEELLYDVPGSELIID  140

Query  471  CPLMIVQ  491
             P+ ++Q
Sbjct  141  RPIRLIQ  147



>ref|XP_007147135.1| hypothetical protein PHAVU_006G098700g [Phaseolus vulgaris]
 gb|ESW19129.1| hypothetical protein PHAVU_006G098700g [Phaseolus vulgaris]
Length=457

 Score =   141 bits (356),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 69/127 (54%), Positives = 88/127 (69%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            A PTP ETK LSDIDDQ  LRFH+ +I  Y+    M  KDPV  IR A+A+ALV+YYP A
Sbjct  23   AIPTPDETKLLSDIDDQSYLRFHYSIIQIYQNESSMANKDPVIVIRQALARALVFYYPFA  82

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +G   K MVDC  +G+ FVEAD+ ++LE  GD ++PP +YSK FL +VP S  I  
Sbjct  83   GRLREGRGRKLMVDCGGEGVMFVEADADVTLEQFGDNLQPPFIYSKAFLCDVPDSEDIKK  142

Query  471  CPLMIVQ  491
             PL+++Q
Sbjct  143  LPLLLIQ  149



>ref|XP_004151857.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Cucumis 
sativus]
 gb|KGN63330.1| hypothetical protein Csa_2G429030 [Cucumis sativus]
Length=461

 Score =   141 bits (356),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 63/127 (50%), Positives = 89/127 (70%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            AKPTP E K+LSDIDDQ+  RF   ++  Y  NP M+  DPV+ I+ A++  LV+YYP A
Sbjct  24   AKPTPYEFKQLSDIDDQEAFRFQVPLLFLYAHNPRMEGSDPVKVIKKAISDTLVFYYPFA  83

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +GP  K  V+C+A+GI F+EAD++++L+  GDAV+PP  +  + LY VP S  I+ 
Sbjct  84   GRLREGPGKKLFVECTAEGILFIEADANVALQQFGDAVQPPFAFLDDVLYNVPSSDGIIN  143

Query  471  CPLMIVQ  491
             PL++VQ
Sbjct  144  SPLLLVQ  150



>ref|XP_004156760.1| PREDICTED: LOW QUALITY PROTEIN: benzyl alcohol O-benzoyltransferase-like 
[Cucumis sativus]
Length=461

 Score =   141 bits (356),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 63/127 (50%), Positives = 89/127 (70%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            AKPTP E K+LSDIDDQ+  RF   ++  Y  NP M+  DPV+ I+ A++  LV+YYP A
Sbjct  24   AKPTPYEFKQLSDIDDQEAFRFQVPLLFLYAHNPRMEGSDPVKVIKKAISDTLVFYYPFA  83

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +GP  K  V+C+A+GI F+EAD++++L+  GDAV+PP  +  + LY VP S  I+ 
Sbjct  84   GRLREGPGKKLFVECTAEGILFIEADANVALQQFGDAVQPPFAFLDDVLYNVPSSDGIIN  143

Query  471  CPLMIVQ  491
             PL++VQ
Sbjct  144  SPLLLVQ  150



>gb|AES82601.2| benzyl alcohol O-benzoyltransferase [Medicago truncatula]
Length=502

 Score =   142 bits (357),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 93/127 (73%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            A PTP+E K LSDIDDQ+GLRF+  M+  YR  P MK KDPV+ +R A+++ALV+YYP A
Sbjct  21   AAPTPREVKLLSDIDDQEGLRFNIPMMFIYRHEPSMKEKDPVKVLRHALSQALVYYYPFA  80

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GR+ +G   K MVDC+ +G+ FVEA++ ++L++ GDA+ PP    +E LY+VPGS  I+ 
Sbjct  81   GRIREGAGRKLMVDCTGEGVMFVEAEADVTLDEFGDALHPPLPCFEELLYDVPGSELIID  140

Query  471  CPLMIVQ  491
             P+ ++Q
Sbjct  141  RPIRLIQ  147



>ref|XP_010058392.1| PREDICTED: methanol O-anthraniloyltransferase-like [Eucalyptus 
grandis]
Length=483

 Score =   142 bits (357),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 64/128 (50%), Positives = 95/128 (74%), Gaps = 1/128 (1%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAK-DPVEAIRDAVAKALVWYYPL  287
            ++ TP+E K LSD+DDQ+GLRF    + FY  +P ++ + DP   +++A+ KALV+YYPL
Sbjct  25   SQATPRELKPLSDLDDQEGLRFQIPFLFFYPNSPPIRGREDPARVVKEALRKALVYYYPL  84

Query  288  AGRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQIL  467
            AGR+ +GP  K +VDC+ +GI FV+AD+  SLE+LGD+++PPC +  E L +V GS  I+
Sbjct  85   AGRIREGPNRKLVVDCTGEGILFVKADADFSLEELGDSMRPPCGFVDEVLCDVAGSGGII  144

Query  468  GCPLMIVQ  491
            GCPL++VQ
Sbjct  145  GCPLLLVQ  152



>ref|XP_006878640.1| hypothetical protein AMTR_s00011p00264480 [Amborella trichopoda]
 gb|ERM94785.1| hypothetical protein AMTR_s00011p00264480 [Amborella trichopoda]
Length=155

 Score =   134 bits (338),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 60/127 (47%), Positives = 88/127 (69%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            ++PTP E K +SDIDDQ+ LRF   +I FY  +P M  +DP   + DA++++LV+YYP A
Sbjct  6    SRPTPYEIKPVSDIDDQESLRFQMSVIEFYGKDPKMDGRDPARVVWDALSESLVYYYPYA  65

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL++G + K  V+CS +G+ FVE D+ +SLE+ GDA+ PP    +  L  VPGS  ++G
Sbjct  66   GRLVEGEKRKLSVECSGEGVLFVEGDADVSLEEFGDALHPPFPCWERLLIHVPGSDGVIG  125

Query  471  CPLMIVQ  491
            CPL+ +Q
Sbjct  126  CPLLFIQ  132



>gb|KDP39567.1| hypothetical protein JCGZ_02587 [Jatropha curcas]
Length=444

 Score =   141 bits (355),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 64/127 (50%), Positives = 91/127 (72%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            AKPTP+E K LSDIDDQ GLR    +I  YR +P M+ KDPV+ ++ A+A+ LV+YYP A
Sbjct  21   AKPTPREFKSLSDIDDQDGLRTQLPLIHIYRYHPSMERKDPVQVLKQAIAETLVFYYPFA  80

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GR+ + P  K +V+C+ +GI FVEAD+ ++L+  GDA++PP     E L++VPGS  I  
Sbjct  81   GRIRERPNRKLVVECTGEGILFVEADADVALDQFGDAIRPPFPCFGELLFDVPGSSGIAN  140

Query  471  CPLMIVQ  491
            CPL+++Q
Sbjct  141  CPLLLIQ  147



>ref|XP_002264599.1| PREDICTED: benzyl alcohol O-benzoyltransferase [Vitis vinifera]
 emb|CBI26419.3| unnamed protein product [Vitis vinifera]
Length=459

 Score =   141 bits (355),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 91/127 (72%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            AKPTP E K LSDIDDQ+GLRF   +I FY+  P M  +DP + I+DAVA+ALV+YYP A
Sbjct  22   AKPTPHEFKPLSDIDDQEGLRFQIPVIQFYKKVPSMHGRDPAKVIKDAVARALVFYYPFA  81

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +    K +V+C+ +GI F+EAD+ ++LE  GDA++PP    +E +Y+ PGS  +L 
Sbjct  82   GRLREEAGRKLVVECTGEGIVFIEADADVTLEQFGDALQPPFPGLEELIYDAPGSGGVLN  141

Query  471  CPLMIVQ  491
             PL+++Q
Sbjct  142  SPLLLIQ  148



>ref|XP_004982683.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Setaria 
italica]
Length=463

 Score =   141 bits (355),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 89/127 (70%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            A PTP+E K LSDIDDQ GLRFH  +I F+R + LM A+DP   IR A+A+ALV YYP A
Sbjct  20   ASPTPRELKRLSDIDDQDGLRFHIPVIQFHRRSALMGARDPAPVIRGAIARALVHYYPFA  79

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +    K  VDC+ +G+ F+EAD+ + L+  GDA++PP     E +++VPGS ++LG
Sbjct  80   GRLRELEGRKLAVDCTGEGVLFIEADADVRLDHFGDALQPPFPCLDELIFDVPGSSEVLG  139

Query  471  CPLMIVQ  491
             PL++ Q
Sbjct  140  SPLLLFQ  146



>gb|ABX57719.1| acyltransferase [Vanda hybrid cultivar]
Length=447

 Score =   140 bits (354),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 63/127 (50%), Positives = 88/127 (69%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            A PTP+E K LSDIDDQ+GLRF   +I FYR  P M  ++P   IRDA+A+ LV+YYP A
Sbjct  21   ASPTPRELKRLSDIDDQEGLRFQIPVIQFYRHEPAMAGQNPASVIRDALARTLVFYYPFA  80

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +G   K  VDC+ +G+ F+EA++ + L+D GDA+ PP    +E L++V GS  +L 
Sbjct  81   GRLREGAGKKLFVDCTGEGVLFIEAEADVKLKDFGDALHPPFPCLEELLFDVDGSSAVLN  140

Query  471  CPLMIVQ  491
             PL+++Q
Sbjct  141  TPLLLIQ  147



>ref|XP_004243495.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Solanum 
lycopersicum]
Length=471

 Score =   140 bits (354),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 93/135 (69%), Gaps = 8/135 (6%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLM--------KAKDPVEAIRDAVAKA  266
            AKPTP+E+K LSDIDDQ+GLRF   +I FYR +              +PV+ I+ A+A+A
Sbjct  26   AKPTPRESKFLSDIDDQEGLRFQIPVINFYRKDSYSDLDSSMGGNYNEPVKVIKKAIAEA  85

Query  267  LVWYYPLAGRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEV  446
            LV+YYP AGRL +G   K MVDCS +G+ FVEAD+ ++LE  GD +KPP    +E LY+V
Sbjct  86   LVFYYPFAGRLREGNGRKLMVDCSGEGVMFVEADADVTLEQFGDELKPPFPCLEELLYDV  145

Query  447  PGSHQILGCPLMIVQ  491
            PGS  +L CPL+++Q
Sbjct  146  PGSAGVLNCPLLLIQ  160



>gb|KJB82515.1| hypothetical protein B456_013G200100 [Gossypium raimondii]
Length=461

 Score =   140 bits (353),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 87/127 (69%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            AKPTP E K LSDIDDQ  LRF   +I FY+  P M+  DP E IR+A+A+ LV YYP A
Sbjct  24   AKPTPYEQKLLSDIDDQASLRFQIPVINFYQYEPSMEGNDPAEVIREALAQTLVCYYPFA  83

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +G   K +VDC+ +G+ F++AD+ ++LE  G+ + PP   S E LY VPGS  +L 
Sbjct  84   GRLREGANGKLIVDCTGEGVMFIKADADVTLEQFGEPLLPPFPCSDELLYNVPGSEGMLN  143

Query  471  CPLMIVQ  491
            CPL+++Q
Sbjct  144  CPLLLIQ  150



>gb|KJB82264.1| hypothetical protein B456_013G185700 [Gossypium raimondii]
Length=465

 Score =   140 bits (353),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 64/127 (50%), Positives = 88/127 (69%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            AKPTP E K +SDIDDQ+  R H  +  FY+  P M+ KDP E IR+A+A+ LV YYP A
Sbjct  29   AKPTPYEQKLVSDIDDQEAFRLHVPIFNFYQYEPSMEGKDPAEIIREALAQTLVCYYPFA  88

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +G   K +VDC+ +G+ F++AD+ ++LE  G+ + PP  Y  + LY+VPGS  IL 
Sbjct  89   GRLREGANGKLIVDCTGEGVMFIKADADVTLEQFGEPLLPPFPYLDQLLYDVPGSEGILN  148

Query  471  CPLMIVQ  491
            CPL++VQ
Sbjct  149  CPLLLVQ  155



>ref|NP_001234496.1| alcohol acyl transferase [Solanum lycopersicum]
 gb|AAS48091.1| alcohol acyl transferase [Solanum lycopersicum]
 gb|AFD29888.1| alcohol acyl transferase [Solanum lycopersicum]
 gb|AGK82805.1| alcohol acyltransferase 3 [Solanum lycopersicum]
 gb|AIW04709.1| alcohol acyltransferase 1 [Solanum lycopersicum]
Length=442

 Score =   140 bits (352),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 61/124 (49%), Positives = 88/124 (71%), Gaps = 0/124 (0%)
 Frame = +3

Query  120  TPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLAGRL  299
            T  ETK LS+IDDQ  +R    ++MFY+ N  MK KD  + I+D ++K LV+YYPLAGRL
Sbjct  23   TSHETKRLSEIDDQGFIRLQIPILMFYKYNSSMKGKDLAKIIKDGLSKTLVFYYPLAGRL  82

Query  300  IQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILGCPL  479
            I+GP  K MV+C+ +G+ F+E D+++ LE LG+++KPPC Y    L+ V GS  I+G PL
Sbjct  83   IEGPNKKLMVNCNGEGVLFIEGDANIELEKLGESIKPPCPYLDLLLHNVHGSDGIIGSPL  142

Query  480  MIVQ  491
            +++Q
Sbjct  143  LLIQ  146



>gb|KJB78759.1| hypothetical protein B456_013G017100 [Gossypium raimondii]
Length=388

 Score =   139 bits (350),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 88/125 (70%), Gaps = 0/125 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            AKPTP E K LSDIDDQ+ LR  F  I FYR  P MK KD  E I++A+A+ LV+YYP A
Sbjct  24   AKPTPHEQKLLSDIDDQESLRAQFPAIQFYRYEPSMKGKDIAEVIKEALAQTLVFYYPFA  83

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +G   K +VDC+ +G+ F++AD+ ++LE  G+ ++PP    +E L++VPGS  +L 
Sbjct  84   GRLKEGANGKLIVDCNGEGVMFIKADADITLEQFGEPIQPPFPCFEELLFDVPGSQAMLN  143

Query  471  CPLMI  485
            CPL+I
Sbjct  144  CPLLI  148



>ref|XP_004243496.2| PREDICTED: benzyl alcohol O-benzoyltransferase [Solanum lycopersicum]
Length=485

 Score =   140 bits (353),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 93/130 (72%), Gaps = 3/130 (2%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKA---KDPVEAIRDAVAKALVWYY  281
            AKPTP+ETK LSDIDDQ+GLRF   +I FYR +  +      DPV+ I+ A+A+ LV+YY
Sbjct  44   AKPTPRETKFLSDIDDQEGLRFQIPVINFYRKDSDISTGGNHDPVKVIKKAIAETLVFYY  103

Query  282  PLAGRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQ  461
            P AGRL +G   K MVDC+ +G+ FVEAD+ ++LE  GD ++PP    +E LY+VPGS +
Sbjct  104  PFAGRLREGNGRKLMVDCTGEGVMFVEADADVTLEQFGDELQPPFPCLEELLYDVPGSAE  163

Query  462  ILGCPLMIVQ  491
            +L  PL+++Q
Sbjct  164  VLNSPLLLIQ  173



>ref|XP_010058390.1| PREDICTED: methanol O-anthraniloyltransferase-like [Eucalyptus 
grandis]
Length=465

 Score =   140 bits (352),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 94/128 (73%), Gaps = 1/128 (1%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAK-DPVEAIRDAVAKALVWYYPL  287
            A  TP+E K LSD+D Q  LRF   +++FY  +P MK + DP   +++A+AKALV+YYPL
Sbjct  30   AGDTPRELKPLSDLDGQDWLRFMLPLLLFYPQSPSMKGREDPARVVKEALAKALVYYYPL  89

Query  288  AGRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQIL  467
            AGR+ +GP+ K  VDC+ +GI FVEAD+ +SL++LGD++KPPC +  E L +V GS  I+
Sbjct  90   AGRIREGPDCKLGVDCTGEGILFVEADADVSLQELGDSMKPPCGFVNEVLCDVAGSGGII  149

Query  468  GCPLMIVQ  491
            GCPL+ VQ
Sbjct  150  GCPLLSVQ  157



>ref|XP_003521736.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Glycine 
max]
Length=464

 Score =   139 bits (351),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 88/129 (68%), Gaps = 2/129 (2%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            AKPTP+E K+LSDIDDQ+GLRF    I FY  N     KDPVE IR A+ K LV+YYP A
Sbjct  25   AKPTPREVKKLSDIDDQEGLRFQIPFIQFYGNNKESSMKDPVEVIRKALTKTLVFYYPFA  84

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDA--VKPPCLYSKEFLYEVPGSHQI  464
            GRL +GP  K MVDC+ +G+ F+EAD+ ++L   G +  + PP    +E L++VPGS  +
Sbjct  85   GRLREGPGRKLMVDCNGEGVLFIEADADVTLHQFGPSYLLHPPFPCLEELLHDVPGSRGV  144

Query  465  LGCPLMIVQ  491
              CPL+++Q
Sbjct  145  TNCPLLLIQ  153



>ref|XP_009388282.1| PREDICTED: benzyl alcohol O-benzoyltransferase [Musa acuminata 
subsp. malaccensis]
Length=457

 Score =   139 bits (351),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 64/127 (50%), Positives = 88/127 (69%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            A  TP E K LSDIDDQ GLRFH  +I FYR +P M  +D  + IR+A+A+ALV+YYP A
Sbjct  20   AGSTPHEFKRLSDIDDQDGLRFHIPVIQFYRNDPSMGGRDQAKVIREALARALVFYYPFA  79

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +    K +V+C+ +GI F+EAD+ + LE  GD ++PP    +E +Y VPGS  +L 
Sbjct  80   GRLREAAGRKLVVECTGEGILFIEADADVRLEQFGDELQPPFPCLEELVYNVPGSDGVLD  139

Query  471  CPLMIVQ  491
            CPL+++Q
Sbjct  140  CPLLLIQ  146



>sp|Q5H873.1|HLTT_LUPAL RecName: Full=13-hydroxylupanine O-tigloyltransferase; AltName: 
Full=(-)-13alpha-hydroxymultiflorine/(+)-13alpha-hydroxylupanine 
O-tigloyltransferase; Short=HMT/HLTase; AltName: Full=Quinolizidine 
alkaloid O-tigloyltransferase [Lupinus albus]
 dbj|BAD89275.1| (-)-13alpha-hydroxymultiflorine/(+)-13alpha- hydroxylupanine 
O-tigloyltransferase [Lupinus albus]
Length=453

 Score =   139 bits (350),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 88/127 (69%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            AKPTP+E K LSDIDDQ  LR    ++  YR NP M+ KDPVE IR+A++K LV+YYP A
Sbjct  23   AKPTPKEFKLLSDIDDQTSLRSLTPLVTIYRNNPSMEGKDPVEIIREALSKTLVFYYPFA  82

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL  GP  K MVDC+ +G+ F+EAD+ ++L+  G  + PP     + LY+VPGS  IL 
Sbjct  83   GRLRNGPNGKLMVDCTGEGVIFIEADADVTLDQFGIDLHPPFPCFDQLLYDVPGSDGILD  142

Query  471  CPLMIVQ  491
             PL+++Q
Sbjct  143  SPLLLIQ  149



>ref|XP_007147136.1| hypothetical protein PHAVU_006G098800g [Phaseolus vulgaris]
 gb|ESW19130.1| hypothetical protein PHAVU_006G098800g [Phaseolus vulgaris]
Length=460

 Score =   139 bits (350),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 86/127 (68%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            A PTP E K LSDIDDQ+ LRFH   I  Y     M  KDPVE IR A+++ LV+YYPLA
Sbjct  28   AIPTPHELKLLSDIDDQEALRFHSPAIQIYGKQASMAEKDPVEVIRKALSQTLVFYYPLA  87

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GR+ +GP  K MV+C+ +G  F+EAD+ ++L + GD+++PP     E LY VPGS QI  
Sbjct  88   GRVREGPHRKLMVECTGEGAMFIEADADVTLHEFGDSLQPPFPCFHELLYHVPGSQQITN  147

Query  471  CPLMIVQ  491
             PL++VQ
Sbjct  148  TPLLLVQ  154



>ref|XP_003574156.1| PREDICTED: benzyl alcohol O-benzoyltransferase [Brachypodium 
distachyon]
Length=463

 Score =   139 bits (349),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/127 (50%), Positives = 86/127 (68%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            A PTP+E K LSDIDDQ GLRFH  +I FYR    M  ++P   +R+AV++ALV YYP A
Sbjct  23   AGPTPRELKRLSDIDDQDGLRFHIPVIQFYRRQASMAGRNPAAVVREAVSRALVPYYPFA  82

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +    K  VDC+ +G+ F EAD+ + LE  GDA++PP     E +++VPGS Q+LG
Sbjct  83   GRLRELEARKLAVDCTGEGVLFTEADADVRLEHFGDALQPPFPGLDELIFDVPGSSQVLG  142

Query  471  CPLMIVQ  491
             PL++ Q
Sbjct  143  TPLLLFQ  149



>ref|XP_007147132.1| hypothetical protein PHAVU_006G098400g [Phaseolus vulgaris]
 gb|ESW19126.1| hypothetical protein PHAVU_006G098400g [Phaseolus vulgaris]
Length=485

 Score =   139 bits (350),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 87/127 (69%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            A PTP E K LSDIDDQ+ LRFH  MI  Y     M  KDPVE IR A+++ LV+YYP A
Sbjct  67   AIPTPHELKLLSDIDDQEALRFHIPMIQIYGKQESMAEKDPVEVIRQALSQTLVFYYPFA  126

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +GP+ K MVDC+ +G  F+EAD+ ++L + GD+++PP     E +Y+VP S QI  
Sbjct  127  GRLREGPQRKLMVDCTGEGAMFIEADADVTLAEFGDSLQPPFPCFHELMYDVPCSQQITE  186

Query  471  CPLMIVQ  491
             PL++VQ
Sbjct  187  TPLLLVQ  193



>gb|KJB82513.1| hypothetical protein B456_013G199900 [Gossypium raimondii]
Length=461

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/127 (50%), Positives = 88/127 (69%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            AKPTP E K L DIDDQ  LRF   +I FY+  P M+ KDP E IR+A+A+ LV YYP A
Sbjct  24   AKPTPYEQKLLLDIDDQASLRFQVRVINFYQYEPSMEGKDPAEVIREALAQTLVCYYPFA  83

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +G   K +VDC+++G+ F++AD+ ++LE  G+ ++PP   S E LY VP S  +L 
Sbjct  84   GRLREGANGKLIVDCTSEGVMFIKADADVTLEQFGEPLRPPFPCSDELLYNVPDSEGMLN  143

Query  471  CPLMIVQ  491
            CPL+++Q
Sbjct  144  CPLLLIQ  150



>gb|KJB44358.1| hypothetical protein B456_007G247700 [Gossypium raimondii]
Length=455

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/127 (50%), Positives = 86/127 (68%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
             KPTP+E K LSDIDD+ G RF   +I+ YR NP M+ KDP + IRDA+AK LV+YYP A
Sbjct  25   VKPTPREYKPLSDIDDRHGHRFLHPVILLYRYNPSMEGKDPAKVIRDAIAKTLVFYYPFA  84

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +GP  K  VDC+ +G+ F+E D+ ++L+  GD   PP     E L++V G  ++L 
Sbjct  85   GRLKEGPNGKLSVDCTGEGVLFIEGDADVTLQQFGDNPLPPFPCMDELLFDVKGYGEMLN  144

Query  471  CPLMIVQ  491
            CPL ++Q
Sbjct  145  CPLFLIQ  151



>ref|XP_007145940.1| hypothetical protein PHAVU_007G280800g [Phaseolus vulgaris]
 gb|ESW17934.1| hypothetical protein PHAVU_007G280800g [Phaseolus vulgaris]
Length=458

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/127 (50%), Positives = 89/127 (70%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            AK TP+E K LSDIDDQ GLRF   +I FYR +P    +DPV  IR+A+AK LV+YYP A
Sbjct  20   AKATPREVKLLSDIDDQDGLRFQIPVIQFYRYDPSQAGRDPVAVIREALAKTLVFYYPFA  79

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +GP  K MVDC+ +G+ F+EAD+ ++L+  G +++PP    +  LY++P S  +L 
Sbjct  80   GRLREGPGRKLMVDCTGEGVLFIEADADVTLDHFGHSLQPPFPCWENLLYDLPSSQGVLH  139

Query  471  CPLMIVQ  491
             PL+++Q
Sbjct  140  TPLLLIQ  146



>ref|NP_001064997.1| Os10g0503300 [Oryza sativa Japonica Group]
 dbj|BAF26911.1| Os10g0503300 [Oryza sativa Japonica Group]
 gb|EAY79120.1| hypothetical protein OsI_34226 [Oryza sativa Indica Group]
 gb|EAZ16606.1| hypothetical protein OsJ_32078 [Oryza sativa Japonica Group]
Length=475

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 88/127 (69%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            A PTP+E K+LSDIDDQ GLRFH  +I FYR +  M  +DP   IR AVA+ALV YYP A
Sbjct  24   AGPTPRELKKLSDIDDQDGLRFHIPVIQFYRRSAAMGGRDPAPVIRAAVARALVSYYPFA  83

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +    K  VDC+ +G+ F+EAD+ + LE  G A++PP    +E +++VPGS ++LG
Sbjct  84   GRLRELEGRKLAVDCTGEGVLFIEADADVRLEHFGGALQPPFPCLEELVFDVPGSSEVLG  143

Query  471  CPLMIVQ  491
             PL++ Q
Sbjct  144  SPLLLFQ  150



>ref|XP_002298962.2| hypothetical protein POPTR_0001s45210g [Populus trichocarpa]
 gb|EEE83767.2| hypothetical protein POPTR_0001s45210g [Populus trichocarpa]
Length=469

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 89/127 (70%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            AK TP E+K LSDID Q  L+F      FY  NP M+ KDPV+ IR+ +A+ALV+YYP A
Sbjct  22   AKATPHESKPLSDIDRQLYLQFQSPHYNFYAHNPSMQGKDPVKVIREGIAQALVYYYPYA  81

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GR+ Q PE+K +VDC+ +G+ F+EAD+  +LE  GD ++PP   ++E LY VPGS  I+ 
Sbjct  82   GRIRQEPENKLVVDCTGEGVLFIEADADGTLEQFGDPIQPPFPCAEELLYNVPGSAGIIN  141

Query  471  CPLMIVQ  491
             PL+I+Q
Sbjct  142  TPLLIIQ  148



>gb|AAG13627.1|AC078840_18 putative hypersensitivity-related (hsr)protein [Oryza sativa 
Japonica Group]
 gb|ABB47848.2| benzoyl-CoA:benzyl alcohol/phenylethanol benzoyltransferase, 
putative, expressed [Oryza sativa Japonica Group]
Length=553

 Score =   139 bits (349),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 88/127 (69%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            A PTP+E K+LSDIDDQ GLRFH  +I FYR +  M  +DP   IR AVA+ALV YYP A
Sbjct  24   AGPTPRELKKLSDIDDQDGLRFHIPVIQFYRRSAAMGGRDPAPVIRAAVARALVSYYPFA  83

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +    K  VDC+ +G+ F+EAD+ + LE  G A++PP    +E +++VPGS ++LG
Sbjct  84   GRLRELEGRKLAVDCTGEGVLFIEADADVRLEHFGGALQPPFPCLEELVFDVPGSSEVLG  143

Query  471  CPLMIVQ  491
             PL++ Q
Sbjct  144  SPLLLFQ  150



>ref|XP_007147134.1| hypothetical protein PHAVU_006G098600g [Phaseolus vulgaris]
 gb|ESW19128.1| hypothetical protein PHAVU_006G098600g [Phaseolus vulgaris]
Length=462

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 86/127 (68%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            A PTP E K LSDIDDQ+ LRF   MI  Y     M  KDPVE IR A+++ LV+YYP A
Sbjct  29   AIPTPHELKLLSDIDDQEALRFQVPMIQIYGKQASMAEKDPVEVIRKALSQTLVFYYPFA  88

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +GP  K +VDC+ +G+ F+E D+ ++L + GD+++PP     E LY+VPGS QI  
Sbjct  89   GRLREGPHRKLIVDCTGEGVMFIEGDADVTLAEFGDSLQPPFPCFDELLYDVPGSQQITD  148

Query  471  CPLMIVQ  491
             PL++VQ
Sbjct  149  TPLLLVQ  155



>gb|EYU41397.1| hypothetical protein MIMGU_mgv1a024853mg, partial [Erythranthe 
guttata]
Length=433

 Score =   137 bits (346),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 89/127 (70%), Gaps = 1/127 (1%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            AKPTP E K LSD D+ +GLRF   +I FYR NP ++A DPVE IR A+AKALV YYP A
Sbjct  17   AKPTPHEFKPLSDFDNYEGLRFQVPIIQFYRKNPSVEA-DPVEVIRKAIAKALVSYYPFA  75

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +    K  V+C+ +G+ F+EAD+ ++LE  GD +KPP    +E LY+VPGS  I+ 
Sbjct  76   GRLREHAARKLAVECTGEGVMFIEADADVALEQFGDELKPPVPCLEELLYDVPGSGGIIN  135

Query  471  CPLMIVQ  491
             PL+++Q
Sbjct  136  APLLLIQ  142



>ref|NP_197256.1| HXXXD-type acyl-transferase family protein [Arabidopsis thaliana]
 emb|CAC01898.1| putative protein [Arabidopsis thaliana]
 gb|ACF37204.1| At5g17540 [Arabidopsis thaliana]
 gb|AED92441.1| HXXXD-type acyl-transferase family protein [Arabidopsis thaliana]
Length=461

 Score =   138 bits (347),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 68/129 (53%), Positives = 90/129 (70%), Gaps = 3/129 (2%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            AKPTP+E K LSDIDDQ+GLRFH   I FYR NP   + DPV  IR A+A+ LV+YYP A
Sbjct  20   AKPTPRELKPLSDIDDQEGLRFHIPTIFFYRHNPTTNS-DPVAVIRRALAETLVYYYPFA  78

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDL--GDAVKPPCLYSKEFLYEVPGSHQI  464
            GRL +GP  K  VDC+ +G+ F+EAD+ ++L +    DA+KPP    +E L+ V GS ++
Sbjct  79   GRLREGPNRKLAVDCTGEGVLFIEADADVTLVEFEEKDALKPPFPCFEELLFNVEGSCEM  138

Query  465  LGCPLMIVQ  491
            L  PLM++Q
Sbjct  139  LNTPLMLMQ  147



>ref|XP_010058386.1| PREDICTED: methanol O-anthraniloyltransferase-like [Eucalyptus 
grandis]
Length=483

 Score =   138 bits (347),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 90/125 (72%), Gaps = 1/125 (1%)
 Frame = +3

Query  120  TPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAK-DPVEAIRDAVAKALVWYYPLAGR  296
            TP+E K LSD+DDQ+GLRF    + FY  +P ++ + DP   +++A+ KALV+YYPLAGR
Sbjct  28   TPRELKPLSDLDDQEGLRFQIPFLFFYPNSPPIRGREDPARVVKEALGKALVYYYPLAGR  87

Query  297  LIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILGCP  476
            + +GP  K  VDC+ +GI FVEAD+ +SLE+LGD+++PPC +  E L +   S  I+GCP
Sbjct  88   IQEGPNRKLAVDCTGKGILFVEADADVSLEELGDSMRPPCGFVDEVLCDEAASGSIIGCP  147

Query  477  LMIVQ  491
            L+ VQ
Sbjct  148  LLFVQ  152



>gb|EYU34530.1| hypothetical protein MIMGU_mgv1a006233mg [Erythranthe guttata]
Length=451

 Score =   137 bits (346),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 92/127 (72%), Gaps = 1/127 (1%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            AKPTP E K LSDIDDQ+GLRF   +I FYR  P ++A DPV  IR A+++ALV+YYP A
Sbjct  19   AKPTPHEFKSLSDIDDQEGLRFQIPVIQFYRNIPFIQA-DPVHVIRAAISEALVFYYPFA  77

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +  + K +V+C+ +G+ F+EAD+ +SL+  GD ++PP    +E LY+VPGS  I+ 
Sbjct  78   GRLREVADRKLVVECTGEGVMFIEADADVSLQQFGDDLQPPFPCLEELLYDVPGSSGIVN  137

Query  471  CPLMIVQ  491
             PL+++Q
Sbjct  138  TPLLLIQ  144



>ref|XP_009131598.1| PREDICTED: (Z)-3-hexen-1-ol acetyltransferase [Brassica rapa]
Length=472

 Score =   138 bits (347),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 92/129 (71%), Gaps = 3/129 (2%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            AKPTP+E K LSDIDDQ+GLRFH   I FYR NP + + DPV  IR A+A+ LV+YYPLA
Sbjct  29   AKPTPRELKLLSDIDDQEGLRFHIPSIFFYRHNPNVYS-DPVAVIRRALAQTLVYYYPLA  87

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDL--GDAVKPPCLYSKEFLYEVPGSHQI  464
            GRL +GP  K  VDC+ QG+ F+EAD+ ++L +    DA+ PP    +E L++V GS ++
Sbjct  88   GRLREGPNRKLAVDCTGQGVLFIEADADVTLAEFEEKDALSPPFPCFEELLFDVEGSSEV  147

Query  465  LGCPLMIVQ  491
            +  PL+++Q
Sbjct  148  INAPLILIQ  156



>gb|KCW72709.1| hypothetical protein EUGRSUZ_E01161 [Eucalyptus grandis]
Length=463

 Score =   137 bits (346),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAK-DPVEAIRDAVAKALVWYYPL  287
            A  TP+E K LSD+D Q  LRF   +++FY  +P MK + DP   +++A+AKALV+YYPL
Sbjct  30   AGDTPRELKPLSDLDGQDWLRFMLPLLLFYPQSPSMKGREDPARVVKEALAKALVYYYPL  89

Query  288  AGRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQIL  467
            AGR+ +GP+ K  VDC+ +GI FVEAD+ +SL++LGD++KPPC +  E L +V GS  I+
Sbjct  90   AGRIREGPDCKLGVDCTGEGILFVEADADVSLQELGDSMKPPCGFVNEVLCDVAGSGGII  149

Query  468  GCPLMIV  488
            GCPL+ V
Sbjct  150  GCPLLSV  156



>ref|XP_010667734.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like, partial 
[Beta vulgaris subsp. vulgaris]
Length=262

 Score =   134 bits (337),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 67/140 (48%), Positives = 91/140 (65%), Gaps = 8/140 (6%)
 Frame = +3

Query  96   RAPGTAKP---TPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKA-----KDPVEAIRD  251
            R P    P   TP E KELS+IDDQ+ LRFH  +I+FYR N   K+     +DP   I++
Sbjct  19   RTPELITPAVSTPYEFKELSNIDDQEALRFHIPIILFYRNNNSSKSTVVGRQDPARVIKE  78

Query  252  AVAKALVWYYPLAGRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKE  431
            AVAKALV YYP AGRL + PE K +V+C+ +GI F+EAD+ ++LE+ GD ++PP    + 
Sbjct  79   AVAKALVPYYPFAGRLREKPERKLVVECNGEGIIFIEADADVTLEEFGDIIQPPFPLKQL  138

Query  432  FLYEVPGSHQILGCPLMIVQ  491
              Y+VPGS   L  PL++ Q
Sbjct  139  LFYDVPGSTAFLDTPLLLFQ  158



>gb|KFK25971.1| hypothetical protein AALP_AA8G186800 [Arabis alpina]
Length=472

 Score =   137 bits (345),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 90/129 (70%), Gaps = 3/129 (2%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            AKPTP+E K LSDIDDQ+GLRFH   I FYR NP   A DPV  IR A+A+ LV+YYP A
Sbjct  30   AKPTPRELKLLSDIDDQEGLRFHIPSIFFYRHNPTSYA-DPVTVIRRALAETLVYYYPFA  88

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDL--GDAVKPPCLYSKEFLYEVPGSHQI  464
            GRL +GP  K  VDC+ +G+ F+EAD+ ++L +    DA++PP    +E L++V GS ++
Sbjct  89   GRLREGPNRKLAVDCTGEGVLFIEADADVALAEFEEKDALRPPFPCFEELLFDVEGSSEV  148

Query  465  LGCPLMIVQ  491
            L  PL+ +Q
Sbjct  149  LNAPLLFIQ  157



>gb|ABN48480.1| quinolizidine alkaloid O-tigloyltransferase [Lupinus albus]
Length=453

 Score =   137 bits (344),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 87/127 (69%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            AKPTP+E K LSDIDDQ  LR    ++  YR NP M+ KDPV  IR+A++K LV+YYP A
Sbjct  23   AKPTPKEFKLLSDIDDQTSLRSLTPLVTIYRNNPSMEGKDPVAIIREALSKTLVFYYPFA  82

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL  GP  K MVDC+ +G+ F+EAD+ ++L+  G  + PP     + LY+VPGS  IL 
Sbjct  83   GRLRNGPNGKLMVDCTGEGVIFIEADADVTLDQFGIDLHPPFPCFDQLLYDVPGSDGILD  142

Query  471  CPLMIVQ  491
             PL+++Q
Sbjct  143  SPLLLIQ  149



>ref|XP_010668237.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Beta vulgaris 
subsp. vulgaris]
Length=174

 Score =   131 bits (329),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 90/130 (69%), Gaps = 4/130 (3%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPL---MKAKDPVEAIRDAVAKALVWYY  281
            A+PTP E KELSDIDDQ+ LR+    I FYR       M  +DPV  +++AVAKALV YY
Sbjct  29   AEPTPYEFKELSDIDDQESLRYQIPFIQFYRNESTHMHMGRRDPVRVLKEAVAKALVPYY  88

Query  282  PLAGRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQ  461
            PLAGRL +    K  V+C+ +GI F+EAD+ ++LED GD ++PP    ++ L++VPGS  
Sbjct  89   PLAGRLREKSGRKLEVECNGEGIIFIEADADVTLEDFGDIIQPP-FPLEDLLFDVPGSTA  147

Query  462  ILGCPLMIVQ  491
            ILG PL+++Q
Sbjct  148  ILGTPLILMQ  157



>emb|CDP09539.1| unnamed protein product [Coffea canephora]
Length=437

 Score =   136 bits (343),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 91/133 (68%), Gaps = 6/133 (5%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRA------NPLMKAKDPVEAIRDAVAKALV  272
            AK TP+E K LSDIDDQ+ LR     I FYR       N   +  DPV+ IR+A+AKALV
Sbjct  26   AKSTPRECKLLSDIDDQEALRIQIPFIQFYRNRDDPGINESRRRSDPVKVIREAIAKALV  85

Query  273  WYYPLAGRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPG  452
            +YYPLA RL +GP  K MV+C+ +G+ F+EAD+ ++LE  GDA++PP    +E LY+VP 
Sbjct  86   FYYPLAARLREGPGRKLMVECTGEGVLFIEADADVTLEQFGDAIQPPFPCLEELLYDVPH  145

Query  453  SHQILGCPLMIVQ  491
            S  IL CP++++Q
Sbjct  146  SGGILHCPIVLIQ  158



>gb|ACT82248.1| alcohol acyltransferase [Vasconcellea cundinamarcensis]
Length=463

 Score =   136 bits (343),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 89/127 (70%), Gaps = 0/127 (0%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            AKPTP+E K LSDIDDQ GLRF   +I FY+ N  M+ K+P + I+ A+A+ LV YYPLA
Sbjct  23   AKPTPREIKLLSDIDDQDGLRFQVPIIQFYKNNSSMQGKNPAKIIKSALAETLVHYYPLA  82

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQILG  470
            GRL +G   K MV+C+ +GI F+EAD+ ++L + GD + PP     E LY+VPGS  I+ 
Sbjct  83   GRLREGFGRKLMVECTGEGILFIEADADVTLHEFGDDLPPPFPCLVELLYDVPGSSGIID  142

Query  471  CPLMIVQ  491
             PL+++Q
Sbjct  143  TPLLLIQ  149



>ref|XP_010918388.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Elaeis guineensis]
Length=192

 Score =   130 bits (328),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 60/128 (47%), Positives = 90/128 (70%), Gaps = 1/128 (1%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLR-FHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPL  287
            ++PTP E K LSDID+ + LR     MI +Y   P M  +DPV+ I+DA++KALV+YYPL
Sbjct  20   SQPTPYELKNLSDIDNHENLRILQVPMIQYYSNEPSMIGQDPVKVIKDALSKALVYYYPL  79

Query  288  AGRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDLGDAVKPPCLYSKEFLYEVPGSHQIL  467
            AGRL +G + K +V+C+ +G+ F+EA +++ LE  GD + PP    +E LY++PGS  I+
Sbjct  80   AGRLREGTKRKLVVECTGEGVLFIEAKANIRLEQFGDQLPPPVPCLEELLYDIPGSAGII  139

Query  468  GCPLMIVQ  491
             CPL+++Q
Sbjct  140  DCPLLLIQ  147



>ref|XP_003554685.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Glycine 
max]
 gb|KHN43218.1| Benzyl alcohol O-benzoyltransferase [Glycine soja]
Length=464

 Score =   135 bits (341),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/128 (50%), Positives = 86/128 (67%), Gaps = 1/128 (1%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            A PTP + K LSDIDDQ G RF   +I  Y   P M  KDPVE IR A+AK LV+YYP A
Sbjct  23   ATPTPHQLKPLSDIDDQDGFRFQVPIIQIYHNQPSMAGKDPVEVIRQALAKTLVFYYPFA  82

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDL-GDAVKPPCLYSKEFLYEVPGSHQIL  467
            GRL +GP+ K MVDC+ +G+ F+EAD+ ++L    G+A++PP    +E LY VP + +I 
Sbjct  83   GRLREGPDRKLMVDCTGEGVMFIEADADVTLYQFGGEALQPPFPCFQELLYNVPETEEIT  142

Query  468  GCPLMIVQ  491
              PL+++Q
Sbjct  143  NTPLLLIQ  150



>ref|XP_010492711.1| PREDICTED: (Z)-3-hexen-1-ol acetyltransferase-like [Camelina 
sativa]
Length=461

 Score =   135 bits (341),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 90/129 (70%), Gaps = 3/129 (2%)
 Frame = +3

Query  111  AKPTPQETKELSDIDDQKGLRFHFCMIMFYRANPLMKAKDPVEAIRDAVAKALVWYYPLA  290
            A PTP+E K LSDIDDQ+GLRFH   I FYR NP   + DPV  IR A+ + LV+YYP A
Sbjct  20   ANPTPRELKLLSDIDDQEGLRFHIPTIFFYRHNPKTYS-DPVAVIRRALTETLVYYYPFA  78

Query  291  GRLIQGPEDKFMVDCSAQGIWFVEADSSLSLEDL--GDAVKPPCLYSKEFLYEVPGSHQI  464
            GRL +GP  K +VDC+ +G+ F+EAD+ ++L +    DA+KPP    +E L++V GS ++
Sbjct  79   GRLREGPNRKLVVDCTGEGVLFIEADADVTLVEFEEKDALKPPFPCFEELLFDVEGSSEV  138

Query  465  LGCPLMIVQ  491
            L  PLM++Q
Sbjct  139  LNTPLMLMQ  147



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 557548962370