BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002B10

Length=511
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004230291.1|  PREDICTED: protein disulfide-isomerase like 2-1    267   2e-85   
ref|XP_009593712.1|  PREDICTED: probable protein disulfide-isomer...    266   6e-85   Nicotiana tomentosiformis
ref|XP_009757547.1|  PREDICTED: probable protein disulfide-isomer...    266   7e-85   Nicotiana sylvestris
ref|NP_001275470.1|  protein disulfide-isomerase like 2-1-like pr...    263   5e-84   Solanum tuberosum [potatoes]
emb|CAA72092.1|  protein disulfide-isomerase precursor                  263   6e-84   Nicotiana tabacum [American tobacco]
emb|CDP18230.1|  unnamed protein product                                258   4e-82   Coffea canephora [robusta coffee]
gb|EYU38104.1|  hypothetical protein MIMGU_mgv1a0087951mg               252   1e-81   Erythranthe guttata [common monkey flower]
ref|XP_008451506.1|  PREDICTED: probable protein disulfide-isomer...    252   2e-79   Cucumis melo [Oriental melon]
ref|XP_006444457.1|  hypothetical protein CICLE_v10020618mg             252   2e-79   
ref|XP_004136003.1|  PREDICTED: probable protein disulfide-isomer...    251   4e-79   Cucumis sativus [cucumbers]
ref|XP_011087481.1|  PREDICTED: protein disulfide-isomerase like ...    250   6e-79   Sesamum indicum [beniseed]
gb|KDO87057.1|  hypothetical protein CISIN_1g018270mg                   250   8e-79   Citrus sinensis [apfelsine]
ref|XP_006480049.1|  PREDICTED: probable protein disulfide-isomer...    251   9e-79   
gb|KJB24398.1|  hypothetical protein B456_004G143300                    246   3e-78   Gossypium raimondii
ref|XP_010268045.1|  PREDICTED: probable protein disulfide-isomer...    248   5e-78   Nelumbo nucifera [Indian lotus]
gb|KJB24396.1|  hypothetical protein B456_004G143300                    247   5e-78   Gossypium raimondii
gb|KJB24395.1|  hypothetical protein B456_004G143300                    248   9e-78   Gossypium raimondii
ref|XP_008370389.1|  PREDICTED: probable protein disulfide-isomer...    246   2e-77   Malus domestica [apple tree]
ref|XP_004302250.1|  PREDICTED: probable protein disulfide-isomer...    246   4e-77   Fragaria vesca subsp. vesca
ref|XP_009338195.1|  PREDICTED: probable protein disulfide-isomer...    246   4e-77   Pyrus x bretschneideri [bai li]
ref|XP_011042212.1|  PREDICTED: probable protein disulfide-isomer...    246   5e-77   Populus euphratica
gb|KDP28233.1|  hypothetical protein JCGZ_14004                         245   6e-77   Jatropha curcas
gb|KCW50094.1|  hypothetical protein EUGRSUZ_K03531                     243   6e-77   Eucalyptus grandis [rose gum]
gb|KCW50095.1|  hypothetical protein EUGRSUZ_K03531                     243   1e-76   Eucalyptus grandis [rose gum]
ref|XP_010038272.1|  PREDICTED: protein disulfide-isomerase like 2-1    244   2e-76   Eucalyptus grandis [rose gum]
ref|NP_001236300.1|  protein disulfide isomerase-like protein pre...    243   3e-76   
gb|ACU18460.1|  unknown                                                 240   4e-76   Glycine max [soybeans]
ref|XP_009383733.1|  PREDICTED: protein disulfide isomerase-like 2-2    243   5e-76   Musa acuminata subsp. malaccensis [pisang utan]
gb|KCW50096.1|  hypothetical protein EUGRSUZ_K03531                     240   6e-76   Eucalyptus grandis [rose gum]
gb|ACU23175.1|  unknown                                                 241   2e-75   Glycine max [soybeans]
ref|XP_008797434.1|  PREDICTED: protein disulfide isomerase-like 2-2    241   2e-75   
ref|XP_008797191.1|  PREDICTED: probable protein disulfide-isomer...    241   3e-75   Phoenix dactylifera
gb|KHG01519.1|  Protein disulfide-isomerase like 2-1                    241   4e-75   Gossypium arboreum [tree cotton]
ref|XP_009381750.1|  PREDICTED: protein disulfide isomerase-like 2-2    240   5e-75   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002282603.1|  PREDICTED: probable protein disulfide-isomer...    240   6e-75   Vitis vinifera
emb|CAN70962.1|  hypothetical protein VITISV_038267                     240   6e-75   Vitis vinifera
ref|XP_010259370.1|  PREDICTED: protein disulfide-isomerase like ...    239   1e-74   Nelumbo nucifera [Indian lotus]
ref|XP_008245854.1|  PREDICTED: probable protein disulfide-isomer...    239   1e-74   Prunus mume [ume]
ref|XP_002515309.1|  protein disulfide isomerase, putative              239   1e-74   Ricinus communis
ref|XP_008388480.1|  PREDICTED: probable protein disulfide-isomer...    239   1e-74   
ref|XP_010523977.1|  PREDICTED: protein disulfide-isomerase like ...    238   3e-74   Tarenaya hassleriana [spider flower]
ref|XP_007145165.1|  hypothetical protein PHAVU_007G215900g             238   3e-74   Phaseolus vulgaris [French bean]
ref|XP_010095297.1|  putative protein disulfide-isomerase A6            238   5e-74   Morus notabilis
ref|XP_010931733.1|  PREDICTED: probable protein disulfide-isomer...    238   6e-74   Elaeis guineensis
ref|XP_004163154.1|  PREDICTED: protein disulfide isomerase-like ...    230   9e-74   
gb|KJB49807.1|  hypothetical protein B456_008G141100                    237   1e-73   Gossypium raimondii
ref|XP_007051067.1|  Thioredoxin family protein                         236   2e-73   
gb|ABK93392.1|  unknown                                                 234   2e-73   Populus trichocarpa [western balsam poplar]
gb|KDP23408.1|  hypothetical protein JCGZ_23241                         236   3e-73   Jatropha curcas
gb|KJB49808.1|  hypothetical protein B456_008G141100                    236   3e-73   Gossypium raimondii
ref|XP_002512495.1|  protein disulfide isomerase, putative              236   3e-73   Ricinus communis
ref|XP_002302750.1|  thioredoxin family protein                         235   4e-73   Populus trichocarpa [western balsam poplar]
ref|XP_011041511.1|  PREDICTED: probable protein disulfide-isomer...    235   4e-73   Populus euphratica
ref|XP_006397941.1|  hypothetical protein EUTSA_v10001515mg             235   5e-73   Eutrema salsugineum [saltwater cress]
ref|XP_010107024.1|  Protein disulfide isomerase-like 2-2               234   7e-73   
ref|XP_011092133.1|  PREDICTED: protein disulfide-isomerase like ...    234   1e-72   Sesamum indicum [beniseed]
ref|XP_002320314.1|  thioredoxin family protein                         234   2e-72   Populus trichocarpa [western balsam poplar]
gb|KHN08651.1|  Hypothetical protein glysoja_024560                     235   2e-72   Glycine soja [wild soybean]
ref|XP_010914538.1|  PREDICTED: probable protein disulfide-isomer...    233   2e-72   Elaeis guineensis
gb|AFK44605.1|  unknown                                                 233   3e-72   Lotus japonicus
ref|NP_001236289.1|  protein disufide isomerase-like protein prec...    233   4e-72   Glycine max [soybeans]
gb|KHN30654.1|  Hypothetical protein glysoja_037686                     233   4e-72   Glycine soja [wild soybean]
gb|EPS61150.1|  protein disulfide-isomerase                             232   4e-72   Genlisea aurea
ref|XP_010674165.1|  PREDICTED: protein disulfide-isomerase like 2-1    233   5e-72   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001236313.1|  protein disulfide isomerase-like protein pre...    232   7e-72   Glycine max [soybeans]
ref|XP_006644146.1|  PREDICTED: protein disulfide isomerase-like ...    233   7e-72   Oryza brachyantha
ref|XP_009373270.1|  PREDICTED: probable protein disulfide-isomer...    232   8e-72   Pyrus x bretschneideri [bai li]
ref|XP_004977081.1|  PREDICTED: protein disulfide isomerase-like ...    232   8e-72   Setaria italica
gb|KHN43339.1|  Hypothetical protein glysoja_001922                     231   2e-71   Glycine soja [wild soybean]
ref|XP_007163329.1|  hypothetical protein PHAVU_001G225600g             231   3e-71   Phaseolus vulgaris [French bean]
ref|NP_001105759.1|  protein disulfide isomerase7 precursor             231   3e-71   Zea mays [maize]
ref|XP_004968698.1|  PREDICTED: protein disulfide isomerase-like ...    231   4e-71   Setaria italica
ref|XP_002455594.1|  hypothetical protein SORBIDRAFT_03g013630          231   4e-71   Sorghum bicolor [broomcorn]
gb|AEK80406.1|  protein disulfide isomerase                             229   8e-71   Gossypium hirsutum [American cotton]
dbj|BAG94075.1|  unnamed protein product                                229   8e-71   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001054696.1|  Os05g0156300                                       229   9e-71   
gb|KJB09452.1|  hypothetical protein B456_001G143100                    228   1e-70   Gossypium raimondii
ref|XP_004495918.1|  PREDICTED: probable protein disulfide-isomer...    229   2e-70   Cicer arietinum [garbanzo]
ref|XP_003567659.1|  PREDICTED: protein disulfide isomerase-like 2-2    229   2e-70   Brachypodium distachyon [annual false brome]
gb|KHG01186.1|  putative disulfide-isomerase A6                         228   2e-70   Gossypium arboreum [tree cotton]
ref|XP_010544982.1|  PREDICTED: protein disulfide-isomerase like 2-1    228   2e-70   Tarenaya hassleriana [spider flower]
ref|XP_003521666.1|  PREDICTED: probable protein disulfide-isomer...    228   3e-70   Glycine max [soybeans]
ref|XP_010507889.1|  PREDICTED: protein disulfide-isomerase like ...    227   3e-70   
ref|XP_010507887.1|  PREDICTED: protein disulfide-isomerase like ...    228   3e-70   Camelina sativa [gold-of-pleasure]
gb|ACU18972.1|  unknown                                                 228   3e-70   Glycine max [soybeans]
ref|XP_010518448.1|  PREDICTED: protein disulfide-isomerase like ...    226   4e-70   Camelina sativa [gold-of-pleasure]
gb|ACG38245.1|  PDIL2-2 - Zea mays protein disulfide isomerase          228   4e-70   Zea mays [maize]
ref|XP_010518447.1|  PREDICTED: protein disulfide-isomerase like ...    228   4e-70   Camelina sativa [gold-of-pleasure]
ref|NP_001105758.1|  protein disulfide isomerase6 precursor             228   5e-70   Zea mays [maize]
gb|KJB09450.1|  hypothetical protein B456_001G143100                    227   6e-70   Gossypium raimondii
tpg|DAA54512.1|  TPA: putative protein disulfide isomerase family...    227   6e-70   
ref|NP_001042949.1|  Os01g0339900                                       227   9e-70   
gb|KJB41848.1|  hypothetical protein B456_007G124200                    226   2e-69   Gossypium raimondii
emb|CBG91907.1|  putative PDI-like protein                              226   2e-69   Triticum aestivum [Canadian hard winter wheat]
gb|KFK37496.1|  hypothetical protein AALP_AA4G265000                    226   3e-69   Arabis alpina [alpine rockcress]
gb|KHG23389.1|  Protein disulfide isomerase-like 2-2                    225   3e-69   Gossypium arboreum [tree cotton]
gb|EMT22855.1|  Putative protein disulfide-isomerase A6                 225   3e-69   
emb|CBG91906.1|  putative PDI-like protein                              226   3e-69   Triticum aestivum [Canadian hard winter wheat]
emb|CBG91898.1|  putative PDI-like protein                              225   4e-69   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002880305.1|  hypothetical protein ARALYDRAFT_904222             225   5e-69   Arabidopsis lyrata subsp. lyrata
ref|XP_003568890.1|  PREDICTED: protein disulfide isomerase-like 2-1    224   8e-69   Brachypodium distachyon [annual false brome]
gb|KJB41847.1|  hypothetical protein B456_007G124200                    222   8e-69   Gossypium raimondii
ref|XP_002440636.1|  hypothetical protein SORBIDRAFT_09g004370          224   9e-69   Sorghum bicolor [broomcorn]
ref|XP_003591444.1|  Protein disulfide-isomerase                        223   4e-68   
gb|ACJ84687.1|  unknown                                                 221   4e-68   Medicago truncatula
gb|AES61695.2|  protein disulfide isomerase-like protein                223   4e-68   Medicago truncatula
ref|XP_004494539.1|  PREDICTED: probable protein disulfide-isomer...    221   6e-68   
ref|XP_004494538.1|  PREDICTED: probable protein disulfide-isomer...    222   9e-68   Cicer arietinum [garbanzo]
gb|AAS68180.1|  putative protein disulphide isomerase                   217   2e-67   Brassica napus var. napus [annual rape]
gb|KJB49809.1|  hypothetical protein B456_008G141100                    219   4e-67   Gossypium raimondii
ref|XP_009133817.1|  PREDICTED: protein disulfide-isomerase like 2-1    220   5e-67   Brassica rapa
emb|CDX83326.1|  BnaA03g21800D                                          220   5e-67   
ref|XP_006654072.1|  PREDICTED: protein disulfide isomerase-like ...    219   7e-67   Oryza brachyantha
sp|P38661.1|PDIA6_MEDSA  RecName: Full=Probable protein disulfide...    219   8e-67   Medicago sativa [alfalfa]
ref|XP_006855312.1|  hypothetical protein AMTR_s00057p00073380          219   8e-67   Amborella trichopoda
gb|ACF83353.1|  unknown                                                 211   2e-66   Zea mays [maize]
ref|XP_010105665.1|  Protein disulfide isomerase-like 2-2               218   2e-66   
emb|CDY57723.1|  BnaC04g51940D                                          218   4e-66   Brassica napus [oilseed rape]
ref|XP_009142530.1|  PREDICTED: protein disulfide-isomerase like ...    217   6e-66   Brassica rapa
emb|CDX95726.1|  BnaC03g26070D                                          215   3e-65   
gb|KEH24481.1|  protein disulfide isomerase-like protein                214   1e-64   Medicago truncatula
gb|ABK25411.1|  unknown                                                 212   3e-64   Picea sitchensis
gb|ACN40539.1|  unknown                                                 210   2e-63   Picea sitchensis
ref|NP_973708.1|  protein disulfide-isomerase like 2-1                  206   5e-63   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001078074.1|  protein disulfide-isomerase like 2-1               208   8e-63   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006294808.1|  hypothetical protein CARUB_v10023860mg             206   8e-63   
ref|NP_182269.1|  protein disulfide-isomerase like 2-1                  209   9e-63   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001031555.1|  protein disulfide-isomerase like 2-1               207   1e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001776169.1|  predicted protein                                  191   4e-56   
gb|ACJ84386.1|  unknown                                                 177   2e-53   Medicago truncatula
gb|KHG25232.1|  putative disulfide-isomerase A6                         175   3e-50   Gossypium arboreum [tree cotton]
gb|EMS64693.1|  Protein disulfide isomerase-like 2-1                    176   1e-49   Triticum urartu
ref|XP_002988430.1|  hypothetical protein SELMODRAFT_269397             175   1e-49   
ref|XP_002979862.1|  hypothetical protein SELMODRAFT_268311             174   2e-49   
gb|KDO87059.1|  hypothetical protein CISIN_1g018270mg                   172   5e-49   Citrus sinensis [apfelsine]
ref|XP_008807783.1|  PREDICTED: protein disulfide-isomerase like ...    172   9e-49   Phoenix dactylifera
ref|XP_008807785.1|  PREDICTED: protein disulfide-isomerase like ...    172   9e-49   Phoenix dactylifera
ref|XP_010921537.1|  PREDICTED: protein disulfide-isomerase like ...    172   9e-49   Elaeis guineensis
gb|KDO87058.1|  hypothetical protein CISIN_1g018270mg                   166   1e-47   Citrus sinensis [apfelsine]
gb|KHG10177.1|  Protein disulfide-isomerase like 2-1                    159   4e-45   Gossypium arboreum [tree cotton]
ref|XP_008372639.1|  PREDICTED: protein disulfide-isomerase A3-like     152   1e-42   
ref|XP_009519313.1|  hypothetical protein PHYSODRAFT_353904             145   3e-38   Phytophthora sojae
gb|ETP47794.1|  protein disulfide-isomerase domain                      144   5e-38   Phytophthora parasitica P10297
gb|ETI50084.1|  protein disulfide-isomerase domain                      144   5e-38   Phytophthora parasitica P1569
ref|XP_002901765.1|  thioredoxin-like protein                           144   5e-38   Phytophthora infestans T30-4
ref|XP_008891720.1|  protein disulfide-isomerase domain                 142   3e-37   Phytophthora parasitica INRA-310
gb|ETM49714.1|  protein disulfide-isomerase domain                      142   3e-37   Phytophthora parasitica
gb|ETK89975.1|  protein disulfide-isomerase domain                      142   3e-37   Phytophthora parasitica
ref|XP_003293769.1|  hypothetical protein DICPUDRAFT_51128              142   4e-37   Dictyostelium purpureum
ref|XP_001745181.1|  hypothetical protein                               142   4e-37   Monosiga brevicollis MX1
emb|CCA15328.1|  SSP8                                                   142   8e-37   Albugo laibachii Nc14
ref|XP_004354984.1|  protein disulfide isomerase                        140   1e-36   Cavenderia fasciculata
dbj|GAM25799.1|  hypothetical protein SAMD00019534_089740               138   7e-36   Acytostelium subglobosum LB1
ref|XP_003384600.1|  PREDICTED: protein disulfide isomerase-like 2-1    136   3e-35   Amphimedon queenslandica
ref|XP_006681835.1|  hypothetical protein BATDEDRAFT_91424              136   4e-35   Batrachochytrium dendrobatidis JAM81
ref|XP_007207338.1|  hypothetical protein PRUPE_ppa008282mg             134   2e-34   
gb|EFA84124.1|  SNF2-related domain-containing protein                  139   2e-34   Heterostelium album PN500
gb|AIG55436.1|  secreted protein                                        134   4e-34   Thraustotheca clavata
ref|XP_004996279.1|  hypothetical protein PTSG_02776                    132   1e-33   Salpingoeca rosetta
emb|CDO71019.1|  hypothetical protein BN946_scf184844.g23               133   1e-33   Trametes cinnabarina
emb|CBK23734.2|  unnamed protein product                                132   2e-33   Blastocystis hominis
ref|XP_004340793.1|  Protein disulfideisomerase, putative               132   2e-33   Acanthamoeba castellanii str. Neff
ref|XP_566486.1|  disulfide-isomerase precursor                         132   4e-33   Cryptococcus neoformans var. neoformans JEC21
gb|KFH67976.1|  protein disulfide isomerase family A, member 6          131   5e-33   Mortierella verticillata NRRL 6337
gb|KFH68275.1|  hypothetical protein MVEG_05093                         130   5e-33   Mortierella verticillata NRRL 6337
gb|EJU04800.1|  disulfide-isomerase precursor                           131   7e-33   Dacryopinax primogenitus
gb|AFR92209.2|  protein disulfide-isomerase                             130   1e-32   Cryptococcus neoformans var. grubii H99
ref|XP_002985095.1|  hypothetical protein SELMODRAFT_121347             130   1e-32   
ref|XP_001639403.1|  predicted protein                                  130   1e-32   Nematostella vectensis
gb|EMD32246.1|  hypothetical protein CERSUDRAFT_88243                   130   1e-32   Gelatoporia subvermispora B
gb|ESA01709.1|  hypothetical protein GLOINDRAFT_337817                  129   2e-32   
ref|XP_008042147.1|  protein disulfide isomerase                        129   4e-32   Trametes versicolor FP-101664 SS1
ref|XP_001470409.1|  putative protein disulfide isomerase               129   4e-32   Leishmania infantum JPCM5
gb|AIG56094.1|  secreted protein                                        127   7e-32   Achlya hypogyna
gb|KDO32944.1|  hypothetical protein SPRG_02637                         126   2e-31   Saprolegnia parasitica CBS 223.65
gb|KIX08267.1|  protein disulfide-isomerase domain                      126   2e-31   Rhinocladiella mackenziei CBS 650.93
emb|CCC91291.1|  putative protein disulfide isomerase                   126   3e-31   Trypanosoma congolense IL3000
ref|XP_009313187.1|  putative protein disulfide isomerase               125   4e-31   Trypanosoma grayi
gb|AAB86685.1|  protein disulfide isomerase                             125   5e-31   Dictyostelium discoideum
emb|CCI44606.1|  unnamed protein product                                125   5e-31   Albugo candida
ref|XP_643357.1|  protein disulfide isomerase                           125   5e-31   Dictyostelium discoideum AX4
emb|CDS12432.1|  hypothetical protein LRAMOSA04626                      126   5e-31   Lichtheimia ramosa
gb|EWM29745.1|  protein disulfide isomerase                             125   6e-31   Nannochloropsis gaditana
ref|XP_009841234.1|  protein disulfide-isomerase domain                 125   6e-31   Aphanomyces astaci
gb|KIY03763.1|  hypothetical protein Z520_00454                         125   9e-31   Fonsecaea multimorphosa CBS 102226
ref|XP_003031662.1|  hypothetical protein SCHCODRAFT_67855              125   1e-30   Schizophyllum commune H4-8
gb|KIW33769.1|  protein disulfide-isomerase domain                      124   1e-30   Cladophialophora immunda
ref|XP_002682926.1|  predicted protein                                  124   1e-30   Naegleria gruberi strain NEG-M
dbj|BAH20372.1|  AT2G47470                                              122   1e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007387800.1|  protein disulfide isomerase                        124   2e-30   Punctularia strigosozonata HHB-11173 SS5
gb|EIE88364.1|  hypothetical protein RO3G_13075                         124   3e-30   Rhizopus delemar RA 99-880
ref|XP_002839804.1|  hypothetical protein                               123   3e-30   Tuber melanosporum Mel28
ref|XP_003876367.1|  putative protein disulfide isomerase               123   3e-30   Leishmania mexicana MHOM/GT/2001/U1103
emb|CDH59896.1|  protein disulfide isomerase                            124   3e-30   Lichtheimia corymbifera JMRC:FSU:9682
gb|KIW60351.1|  protein disulfide-isomerase domain                      123   4e-30   Exophiala xenobiotica
gb|KHN45206.1|  Hypothetical protein glysoja_044134                     119   4e-30   Glycine soja [wild soybean]
ref|XP_845754.1|  protein disulfide isomerase                           123   4e-30   Trypanosoma brucei brucei TREU927
ref|NP_593584.1|  protein disulfide isomerase                           123   4e-30   Schizosaccharomyces pombe
gb|KIV87529.1|  protein disulfide-isomerase domain                      123   5e-30   Exophiala sideris
gb|KIK41739.1|  hypothetical protein CY34DRAFT_805685                   123   5e-30   Suillus luteus UH-Slu-Lm8-n1
ref|XP_001229051.1|  hypothetical protein CHGG_02535                    122   6e-30   Chaetomium globosum CBS 148.51
gb|KIW98029.1|  protein disulfide-isomerase domain                      122   6e-30   Cladophialophora bantiana CBS 173.52
gb|KIW40190.1|  protein disulfide-isomerase domain                      122   6e-30   Exophiala oligosperma
ref|XP_007003322.1|  hypothetical protein TREMEDRAFT_38433              122   7e-30   Tremella mesenterica DSM 1558
gb|KEF53112.1|  protein disulfide-isomerase A6                          122   8e-30   Exophiala aquamarina CBS 119918
ref|XP_007740657.1|  protein disulfide-isomerase A6                     122   8e-30   Cladophialophora psammophila CBS 110553
ref|XP_009153118.1|  protein disulfide isomerase family A, member 6     122   9e-30   Exophiala dermatitidis NIH/UT8656
ref|XP_003661464.1|  hypothetical protein MYCTH_2300901                 122   9e-30   Thermothelomyces thermophila ATCC 42464
gb|KIP07233.1|  hypothetical protein PHLGIDRAFT_105975                  122   1e-29   Phlebiopsis gigantea 11061_1 CR5-6
ref|XP_006582592.1|  PREDICTED: probable protein disulfide-isomer...    120   2e-29   
gb|KIV92919.1|  protein disulfide-isomerase domain                      121   2e-29   Exophiala mesophila
ref|XP_003648981.1|  hypothetical protein THITE_2107066                 121   2e-29   Thielavia terrestris NRRL 8126
emb|CBH12152.1|  protein disulfide isomerase, putative                  121   2e-29   Trypanosoma brucei gambiense DAL972
emb|CAJ77505.1|  putative disulphide isomerase                          119   2e-29   Solanum tuberosum [potatoes]
ref|XP_005100750.1|  PREDICTED: protein disulfide-isomerase A3-li...    122   2e-29   Aplysia californica
gb|KFA63218.1|  hypothetical protein S40285_04917                       121   2e-29   Stachybotrys chlorohalonata IBT 40285
ref|XP_008874577.1|  protein disulfide-isomerase domain                 120   2e-29   Aphanomyces invadans
gb|KHN95748.1|  protein disulfide-isomerase tigA precursor              121   3e-29   Metarhizium album ARSEF 1941
gb|AAU45393.1|  protein disulfide isomerase                             120   3e-29   Entamoeba histolytica
dbj|BAN38303.1|  protein disulfide isomerase, putative                  120   3e-29   Entamoeba histolytica
ref|XP_650651.1|  protein disulfide isomerase                           120   3e-29   Entamoeba histolytica HM-1:IMSS
ref|XP_001684070.1|  putative protein disulfide isomerase               120   3e-29   Leishmania major strain Friedlin
emb|CCM04393.1|  predicted protein                                      122   3e-29   Fibroporia radiculosa
ref|XP_004258971.1|  protein disulfide isomerase, putative              115   4e-29   Entamoeba invadens IP1
ref|XP_008730139.1|  protein disulfide-isomerase domain                 120   4e-29   Cladophialophora carrionii CBS 160.54
ref|XP_007733462.1|  protein disulfide-isomerase A6                     120   4e-29   Capronia epimyces CBS 606.96
ref|XP_005833128.1|  hypothetical protein GUITHDRAFT_157801             116   4e-29   Guillardia theta CCMP2712
gb|ESS69956.1|  protein disulfide isomerase                             120   4e-29   Trypanosoma cruzi Dm28c
ref|XP_011112771.1|  hypothetical protein H072_6996                     120   5e-29   
gb|KIW64262.1|  protein disulfide-isomerase domain                      120   5e-29   Phialophora americana
gb|KIW86012.1|  protein disulfide-isomerase domain                      120   5e-29   Fonsecaea pedrosoi CBS 271.37
dbj|BAJ33558.1|  protein disulfide isomerase S-1                        119   5e-29   Glycine max [soybeans]
ref|XP_003302794.1|  hypothetical protein PTT_14744                     120   5e-29   
ref|XP_001734779.1|  protein disulfide isomerase                        119   5e-29   Entamoeba dispar SAW760
ref|XP_007922552.1|  hypothetical protein MYCFIDRAFT_52408              120   6e-29   Pseudocercospora fijiensis CIRAD86
ref|XP_007262963.1|  thioredoxin-domain-containing protein              115   7e-29   Fomitiporia mediterranea MF3/22
ref|XP_001936301.1|  protein disulfide-isomerase A4 precursor           119   8e-29   Pyrenophora tritici-repentis Pt-1C-BFP
ref|XP_002174561.1|  protein disulfide isomerase                        119   8e-29   Schizosaccharomyces japonicus yFS275
emb|CCE28619.1|  probable protein disulfide-isomerase precursor         119   9e-29   Claviceps purpurea 20.1
dbj|GAN11239.1|  protein disulfide isomerase-like 2-1-like              120   1e-28   Mucor ambiguus
emb|CCX16619.1|  Similar to Protein disulfide-isomerase erp38; ac...    119   1e-28   Pyronema omphalodes CBS 100304
ref|XP_007760811.1|  protein disulfide-isomerase tigA                   119   1e-28   Cladophialophora yegresii CBS 114405
ref|XP_002126714.1|  PREDICTED: protein disulfide-isomerase A3          119   1e-28   
gb|KIR33635.1|  protein disulfide-isomerase domain                      119   1e-28   Cryptococcus gattii VGII MMRL2647
gb|KGB74644.1|  disulfide-isomerase                                     119   2e-28   Cryptococcus gattii VGII R265
ref|XP_003191872.1|  disulfide-isomerase precursor                      119   2e-28   Cryptococcus gattii WM276
gb|KIR55900.1|  protein disulfide-isomerase domain                      119   2e-28   Cryptococcus gattii Ru294
emb|CEP19187.1|  hypothetical protein                                   119   2e-28   Parasitella parasitica
gb|KIR87562.1|  protein disulfide-isomerase domain                      119   2e-28   Cryptococcus gattii VGIV IND107
ref|XP_007699519.1|  hypothetical protein COCSADRAFT_159986             118   2e-28   Bipolaris sorokiniana ND90Pr
gb|EPB91170.1|  hypothetical protein HMPREF1544_02050                   119   2e-28   Mucor circinelloides f. circinelloides 1006PhL
gb|KJA26303.1|  hypothetical protein HYPSUDRAFT_36578                   118   2e-28   Hypholoma sublateritium FD-334 SS-4
gb|AGH70133.1|  protein disulfide-isomerase                             115   3e-28   Placozoa sp. H4
gb|KHG11729.1|  Protein disulfide isomerase-like 2-2                    116   3e-28   Gossypium arboreum [tree cotton]
ref|XP_001211226.1|  protein disulfide-isomerase tigA precursor         118   3e-28   Aspergillus terreus NIH2624
gb|KIW11988.1|  protein disulfide-isomerase domain                      118   3e-28   Exophiala spinifera
ref|XP_005708042.1|  protein disulfide-isomerase                        118   3e-28   Galdieria sulphuraria
ref|XP_007721682.1|  protein disulfide-isomerase A6                     117   3e-28   Capronia coronata CBS 617.96
ref|XP_007786193.1|  Protein disulfide-isomerase tigA                   117   4e-28   Endocarpon pusillum Z07020
gb|KEQ98241.1|  hypothetical protein AUEXF2481DRAFT_94966               117   4e-28   Aureobasidium subglaciale EXF-2481
ref|XP_007814732.1|  protein disulfide-isomerase tigA precursor         117   5e-28   Metarhizium acridum CQMa 102
gb|KIW01653.1|  protein disulfide-isomerase domain                      117   5e-28   Verruconis gallopava
ref|XP_002740183.1|  PREDICTED: protein disulfide-isomerase A3-like     118   5e-28   Saccoglossus kowalevskii
emb|CEI88679.1|  hypothetical protein RMCBS344292_03059                 118   5e-28   Rhizopus microsporus
gb|ABJ98156.1|  40 kDa PDI                                              117   5e-28   Leishmania amazonensis
ref|XP_753425.1|  disulfide isomerase (TigA)                            117   5e-28   Aspergillus fumigatus Af293
ref|XP_001259471.1|  disulfide isomerase (TigA), putative               117   6e-28   Aspergillus fischeri NRRL 181
ref|XP_008678607.1|  PREDICTED: protein disulfide isomerase-like 2-1    114   6e-28   Zea mays [maize]
gb|EKG06544.1|  protein disulfide isomerase, putative                   117   6e-28   Trypanosoma cruzi
gb|KEY69765.1|  hypothetical protein S7711_03745                        117   6e-28   Stachybotrys chartarum IBT 7711
gb|KHF97557.1|  putative disulfide-isomerase A6                         115   7e-28   Gossypium arboreum [tree cotton]
ref|XP_007330564.1|  hypothetical protein AGABI1DRAFT_114352            117   7e-28   Agaricus bisporus var. burnettii JB137-S8
ref|XP_006459384.1|  hypothetical protein AGABI2DRAFT_191372            117   7e-28   Agaricus bisporus var. bisporus H97
gb|ERT02118.1|  protein disulfide-isomerase domain                      117   8e-28   Sporothrix schenckii ATCC 58251
ref|XP_007262962.1|  protein disulfide isomerase                        117   8e-28   Fomitiporia mediterranea MF3/22
emb|CBY39388.1|  unnamed protein product                                115   8e-28   Oikopleura dioica
ref|XP_007785195.1|  hypothetical protein W97_09142                     117   8e-28   Coniosporium apollinis CBS 100218
gb|KIR50136.1|  protein disulfide-isomerase domain                      117   8e-28   Cryptococcus gattii CA1280
ref|XP_008716496.1|  protein disulfide-isomerase domain                 117   8e-28   Cyphellophora europaea CBS 101466
ref|XP_005717285.1|  Disulfide-isomerase, PDIA-1 Endoplasmic reti...    117   8e-28   
gb|AFW70661.1|  putative protein disulfide isomerase family protein     113   8e-28   
gb|EPS98299.1|  hypothetical protein FOMPIDRAFT_1051692                 117   8e-28   
gb|KEQ58997.1|  protein disulfide-isomerase A4 precursor                116   9e-28   
gb|KIR67114.1|  protein disulfide-isomerase domain                      117   9e-28   
ref|XP_001274516.1|  disulfide isomerase (TigA), putative               116   9e-28   
ref|XP_782981.3|  PREDICTED: protein disulfide-isomerase A3-like        117   1e-27   
ref|XP_007393057.1|  hypothetical protein PHACADRAFT_251513             116   1e-27   
ref|XP_002146684.1|  disulfide isomerase (TigA), putative               116   1e-27   
ref|XP_007368918.1|  protein disulfide isomerase                        116   1e-27   
ref|XP_007686161.1|  hypothetical protein COCMIDRAFT_35156              116   1e-27   
ref|XP_006696873.1|  hypothetical protein CTHT_0065740                  116   1e-27   
ref|XP_001398661.1|  protein disulfide-isomerase                        116   1e-27   
ref|XP_813067.1|  protein disulfide isomerase                           116   1e-27   
emb|CCA75639.1|  probable protein disulfide-isomerase precursor         116   1e-27   
ref|XP_007585677.1|  putative disulfide isomerase protein               116   1e-27   
gb|EKF38723.1|  protein disulfide isomerase, putative                   116   2e-27   
emb|CEG84494.1|  hypothetical protein RMATCC62417_18290                 116   2e-27   
emb|CEG68726.1|  hypothetical protein RMATCC62417_04932                 116   2e-27   
ref|XP_009056950.1|  hypothetical protein LOTGIDRAFT_190816             116   2e-27   
ref|NP_001141506.1|  uncharacterized protein LOC100273618 precursor     115   2e-27   
dbj|GAM35798.1|  hypothetical protein TCE0_017r04398                    115   2e-27   
gb|KIM84847.1|  hypothetical protein PILCRDRAFT_817647                  115   2e-27   
dbj|GAA83239.1|  disulfide isomerase TigA                               115   2e-27   
ref|XP_007289766.1|  protein disulfide-isomerase tigA precursor         115   2e-27   
gb|KEQ86324.1|  protein disulfide-isomerase tigA precursor              115   2e-27   
gb|KDQ59241.1|  hypothetical protein JAAARDRAFT_33964                   115   2e-27   
gb|KIO14900.1|  hypothetical protein M404DRAFT_191640                   115   2e-27   
gb|EUN24425.1|  hypothetical protein COCVIDRAFT_40029                   115   2e-27   
gb|KEQ74908.1|  disulfide isomerase                                     115   2e-27   
ref|XP_007713551.1|  hypothetical protein COCCADRAFT_6110               115   2e-27   
gb|EYE94073.1|  putative disulfide isomerase                            115   2e-27   
ref|XP_007346032.1|  protein disulfide isomerase                        115   3e-27   
ref|XP_002478988.1|  disulfide isomerase (TigA), putative               115   3e-27   
ref|XP_001417532.1|  predicted protein                                  109   3e-27   
ref|XP_009545328.1|  thioredoxin protein disulfide isomerase            115   3e-27   
ref|XP_008025829.1|  hypothetical protein SETTUDRAFT_116415             115   3e-27   
gb|KIH88413.1|  protein disulfide-isomerase A6                          115   3e-27   
ref|XP_001551951.1|  hypothetical protein BC1G_09563                    115   4e-27   
ref|XP_005851068.1|  hypothetical protein CHLNCDRAFT_14696              109   4e-27   
ref|XP_657679.1|  hypothetical protein AN0075.2                         114   4e-27   
ref|XP_008083669.1|  Thioredoxin-like protein                           114   4e-27   
ref|XP_001912015.1|  hypothetical protein                               114   4e-27   
gb|KID95230.1|  protein disulfide-isomerase tigA precursor              114   4e-27   
gb|EGC44518.1|  disulfide isomerase                                     114   5e-27   
gb|EEH10043.1|  conserved hypothetical protein                          114   5e-27   
gb|EER38884.1|  disulfide-isomerase tigA                                114   5e-27   
gb|KEZ39066.1|  Protein disulfide-isomerase erp38                       114   5e-27   
gb|ELR02322.1|  hypothetical protein GMDG_05389                         114   5e-27   
gb|EMF15933.1|  disulfide isomerase                                     114   5e-27   
ref|XP_007318840.1|  hypothetical protein SERLADRAFT_468685             114   5e-27   
emb|CBY33167.1|  unnamed protein product                                115   6e-27   
ref|XP_001542420.1|  protein disulfide-isomerase tigA precursor         114   6e-27   
gb|KIM24452.1|  hypothetical protein M408DRAFT_331804                   114   6e-27   
emb|CBY21606.1|  unnamed protein product                                115   6e-27   
gb|EHL03665.1|  putative protein disulfide-isomerase erp38              114   6e-27   
ref|XP_002584351.1|  protein disulfide-isomerase tigA                   114   6e-27   
emb|CCG82076.1|  Protein disulfide-isomerase erp38                      112   6e-27   
ref|NP_001131590.1|  uncharacterized protein LOC100192937               113   7e-27   
gb|KFY20742.1|  hypothetical protein V491_03469                         110   8e-27   
ref|XP_007765505.1|  protein disulfide isomerase                        114   8e-27   
emb|CDI55397.1|  probable proteine disulfate isomerase                  115   9e-27   
gb|AGI60170.1|  ER protein precursor                                    114   9e-27   
gb|ELU16122.1|  hypothetical protein CAPTEDRAFT_168943                  112   9e-27   
ref|XP_003849201.1|  hypothetical protein MYCGRDRAFT_101365             113   1e-26   
emb|CDI52670.1|  probable protein disulfide-isomerase precursor         114   1e-26   
ref|XP_005807506.1|  PREDICTED: protein disulfide-isomerase A3-like     114   1e-26   
ref|XP_007573518.1|  PREDICTED: protein disulfide-isomerase A3          114   1e-26   
gb|KIJ04710.1|  hypothetical protein PAXINDRAFT_104050                  113   1e-26   
ref|XP_001595273.1|  hypothetical protein SS1G_03362                    113   2e-26   
ref|XP_846202.1|  protein disulfide isomerase                           108   2e-26   
gb|ACI33158.1|  disulfide-isomerase A3 precursor                        114   2e-26   
gb|KIM62690.1|  hypothetical protein SCLCIDRAFT_787385                  113   2e-26   
ref|XP_008292211.1|  PREDICTED: protein disulfide-isomerase A3          114   2e-26   
ref|XP_011117428.1|  hypothetical protein AOL_s00004g477                113   2e-26   
ref|XP_001800274.1|  hypothetical protein SNOG_09990                    112   2e-26   
ref|XP_005731533.1|  PREDICTED: protein disulfide-isomerase A3-like     114   2e-26   
dbj|GAD96672.1|  XPG I-region protein                                   116   2e-26   
emb|CEG79371.1|  hypothetical protein RMATCC62417_13849                 111   2e-26   
ref|XP_002913224.1|  PREDICTED: protein disulfide-isomerase A3          114   2e-26   
ref|XP_005931703.1|  PREDICTED: protein disulfide-isomerase A3-like     113   2e-26   
ref|XP_007234388.1|  PREDICTED: protein disulfide-isomerase A3-like     113   3e-26   
gb|AAL50638.1|AF436858_1  protein disulfide isomerase                   110   3e-26   
ref|XP_001747756.1|  hypothetical protein                               113   3e-26   
emb|CCO33918.1|  protein disulfide isomerase family A, member 6         112   3e-26   
gb|ESZ94564.1|  putative protein disulfide-isomerase erp38              112   3e-26   
gb|KIY67547.1|  protein disulfide isomerase                             112   3e-26   
ref|XP_008662985.1|  PREDICTED: protein disulfide isomerase-like 2-1    112   3e-26   
ref|XP_501758.1|  YALI0C12386p                                          112   3e-26   
gb|KIK10381.1|  hypothetical protein K443DRAFT_671001                   112   3e-26   
emb|CDM30684.1|  Protein disulfide-isomerase tigA                       112   3e-26   
ref|XP_009254597.1|  hypothetical protein FPSE_03203                    112   3e-26   
ref|XP_011326902.1|  disulfide-isomerase erp38                          112   3e-26   
emb|CEJ03658.1|  hypothetical protein RMCBS344292_17637                 113   3e-26   
ref|XP_001888384.1|  protein disulfide isomerase                        112   3e-26   
ref|XP_004069455.1|  PREDICTED: protein disulfide-isomerase A3          113   3e-26   
emb|CEL62400.1|  protein disulfide isomerase family A, member 6         112   3e-26   
ref|XP_010738984.1|  PREDICTED: protein disulfide-isomerase A6          112   4e-26   
ref|XP_008309703.1|  PREDICTED: protein disulfide-isomerase A3          113   4e-26   
emb|CEF83181.1|  unnamed protein product                                112   4e-26   
ref|XP_010733510.1|  PREDICTED: protein disulfide-isomerase A3          113   4e-26   
emb|CCC91663.1|  putative protein disulfide isomerase                   107   4e-26   
gb|KFG78276.1|  protein disulfide-isomerase tigA precursor              112   4e-26   
gb|KDN44078.1|  disulfide isomerase                                     112   5e-26   
gb|KDQ08694.1|  hypothetical protein BOTBODRAFT_37692                   112   5e-26   
ref|XP_004564581.1|  PREDICTED: protein disulfide-isomerase A3-like     112   5e-26   
ref|XP_007825643.1|  Thioredoxin-like fold protein                      112   5e-26   
gb|ABG81451.1|  protein disulfide isomerase-associated 6                108   6e-26   
ref|XP_007867443.1|  protein disulfide isomerase                        112   6e-26   
ref|XP_001824067.1|  protein disulfide-isomerase                        111   6e-26   
gb|EPY51700.1|  protein disulfide isomerase                             111   6e-26   
emb|CBN77707.1|  protein disulfide isomerase                            111   7e-26   
gb|KID74867.1|  protein disulfide-isomerase tigA precursor              111   7e-26   
ref|XP_006869520.1|  PREDICTED: protein disulfide-isomerase A6          112   7e-26   
gb|KID82970.1|  protein disulfide-isomerase tigA precursor              111   7e-26   
emb|CEG66909.1|  hypothetical protein RMATCC62417_03405                 112   8e-26   
ref|XP_003715134.1|  protein disulfide-isomerase erp38                  111   8e-26   
ref|XP_007933283.1|  PREDICTED: protein disulfide-isomerase A6          111   9e-26   
ref|XP_008609671.1|  hypothetical protein SDRG_05719                    110   9e-26   
ref|XP_004499455.1|  PREDICTED: probable peptide/nitrate transpor...    107   9e-26   
ref|XP_003455475.1|  PREDICTED: protein disulfide-isomerase A3          112   1e-25   
ref|XP_005989802.1|  PREDICTED: protein disulfide-isomerase A3          112   1e-25   
ref|XP_003067198.1|  Protein disulfide isomerase                        110   1e-25   
gb|EPX70542.1|  protein disulfide isomerase                             110   1e-25   
ref|XP_007674881.1|  hypothetical protein BAUCODRAFT_412282             110   1e-25   
ref|XP_001239631.1|  hypothetical protein CIMG_09252                    110   1e-25   
ref|XP_006903376.1|  PREDICTED: protein disulfide-isomerase A6-like     112   1e-25   
ref|XP_004259952.1|  protein disulfide isomerase, putative              110   1e-25   
emb|CEF97621.1|  Thioredoxin, conserved site                            108   1e-25   
gb|EMD87971.1|  hypothetical protein COCHEDRAFT_1112500                 110   1e-25   
dbj|BAN42363.1|  protein disulfide isomerase, putative                  110   1e-25   
gb|KIL91114.1|  hypothetical protein FAVG1_05811                        110   1e-25   
gb|EST07751.1|  thioredoxin/protein disulfide isomerase                 110   2e-25   
ref|XP_003411934.1|  PREDICTED: protein disulfide-isomerase A6          110   2e-25   
ref|XP_961515.1|  protein disulfide-isomerase tigA                      110   2e-25   
gb|EME47840.1|  hypothetical protein DOTSEDRAFT_69688                   110   2e-25   
emb|CAA68847.1|  ERp38                                                  110   2e-25   
gb|ELU01307.1|  hypothetical protein CAPTEDRAFT_164804                  111   2e-25   
gb|AAI48887.1|  PDIA6 protein                                           110   2e-25   
emb|CEJ81013.1|  Putative Disulfide-isomerase erp38                     110   2e-25   
ref|XP_003050405.1|  predicted protein                                  110   2e-25   
ref|XP_503481.1|  YALI0E03036p                                          111   2e-25   
ref|XP_007127699.1|  PREDICTED: protein disulfide-isomerase A6          110   2e-25   
gb|EJT48709.1|  hypothetical protein A1Q1_02254                         111   2e-25   
ref|XP_010772910.1|  PREDICTED: protein disulfide-isomerase A3          110   2e-25   
ref|NP_001268327.1|  ERp57 precursor                                    110   2e-25   
ref|XP_004310310.1|  PREDICTED: protein disulfide-isomerase A6 is...    110   2e-25   
ref|XP_007456979.1|  PREDICTED: protein disulfide-isomerase A6          110   2e-25   
emb|CDQ82142.1|  unnamed protein product                                110   2e-25   
ref|XP_004609672.1|  PREDICTED: protein disulfide-isomerase A3 is...    110   2e-25   
ref|XP_007195772.1|  PREDICTED: protein disulfide-isomerase A6          110   2e-25   
ref|XP_002388076.1|  hypothetical protein MPER_12953                    106   2e-25   
ref|XP_002567783.1|  Pc21g07430                                         110   2e-25   
ref|XP_004274932.1|  PREDICTED: protein disulfide-isomerase A6          110   2e-25   
gb|ACE77637.1|  protein disulfide isomerase-associated 3 (predicted)    110   2e-25   
ref|XP_003742545.1|  PREDICTED: thioredoxin domain-containing pro...    110   3e-25   
ref|XP_003791822.1|  PREDICTED: protein disulfide-isomerase A3          110   3e-25   
emb|CBK23078.2|  unnamed protein product                                108   3e-25   
ref|XP_003170357.1|  disulfide-isomerase tigA                           109   3e-25   
ref|XP_001740260.1|  protein disulfide isomerase                        105   3e-25   
ref|XP_011489880.1|  PREDICTED: protein disulfide-isomerase A6 is...    110   3e-25   
ref|XP_004083501.1|  PREDICTED: protein disulfide-isomerase A6 is...    110   3e-25   
ref|XP_001623734.1|  predicted protein                                  110   3e-25   
emb|CCC48769.1|  putative protein disulfide isomerase, fragment         108   3e-25   
gb|KGO47933.1|  Endoplasmic reticulum, protein ERp29, C-terminal        109   3e-25   
ref|NP_001182048.1|  protein disulfide-isomerase A6 precursor           110   3e-25   
ref|XP_003234087.1|  disulfide isomerase                                109   3e-25   
ref|XP_007257385.1|  PREDICTED: protein disulfide-isomerase A6          110   3e-25   
tpg|DAA34067.1|  TPA: protein disulfide isomerase                       108   3e-25   
gb|ENH78748.1|  disulfide isomerase                                     109   3e-25   
ref|NP_989329.1|  protein disulfide-isomerase A3 precursor              110   3e-25   
ref|XP_532876.2|  PREDICTED: protein disulfide-isomerase A6             110   3e-25   
emb|CDH58543.1|  protein disulfide-isomerase precursor                  110   4e-25   
gb|EKV10665.1|  Protein disulfide-isomerase tigA                        109   4e-25   
emb|CDS11053.1|  hypothetical protein LRAMOSA03317                      110   4e-25   
ref|XP_006093170.1|  PREDICTED: protein disulfide-isomerase A3          110   4e-25   
ref|XP_006792591.1|  PREDICTED: protein disulfide-isomerase A6-li...    109   4e-25   
pdb|2ALB|A  Chain A, Nmr Structure Of The N-Terminal Domain A Of ...    104   4e-25   
ref|XP_006792592.1|  PREDICTED: protein disulfide-isomerase A6-li...    109   4e-25   
ref|XP_002845254.1|  disulfide-isomerase tigA                           109   4e-25   
gb|KEP46636.1|  protein disulfide isomerase                             109   4e-25   
ref|XP_006641791.1|  PREDICTED: protein disulfide-isomerase A3-like     110   5e-25   
gb|KDB16625.1|  protein disulfide-isomerase tigA precursor              109   5e-25   
gb|KFX94540.1|  hypothetical protein O988_06236                         109   5e-25   
ref|XP_002289024.1|  predicted protein                                  106   5e-25   
ref|XP_004366446.1|  hypothetical protein DFA_04036                     105   5e-25   
ref|XP_004568809.1|  PREDICTED: protein disulfide-isomerase A6-li...    109   5e-25   
ref|XP_004568810.1|  PREDICTED: protein disulfide-isomerase A6-li...    109   5e-25   
ref|XP_005731103.1|  PREDICTED: protein disulfide-isomerase A6-like     109   5e-25   
gb|EPE05781.1|  protein disulfide-isomerase erp38                       108   5e-25   
pdb|3VWW|A  Chain A, Crystal Structure Of A0-domain Of P5 From H....    103   5e-25   
ref|NP_001193274.1|  protein disulfide-isomerase A6 precursor           109   5e-25   
ref|XP_004005735.1|  PREDICTED: protein disulfide-isomerase A6 is...    109   5e-25   
emb|CBH12780.1|  protein disulfide isomerase, putative                  104   5e-25   
ref|XP_001996440.1|  GH25032                                            109   5e-25   
ref|XP_006073828.1|  PREDICTED: LOW QUALITY PROTEIN: protein disu...    110   6e-25   
gb|EEH22757.1|  protein disulfide-isomerase domain                      108   6e-25   
gb|EGD96579.1|  disulfide isomerase                                     108   6e-25   
gb|KFY77936.1|  hypothetical protein V499_02805                         112   6e-25   
gb|EZF33158.1|  protein disulfide-isomerase domain-containing pro...    108   6e-25   
ref|XP_005687063.1|  PREDICTED: protein disulfide-isomerase A6          109   6e-25   
ref|XP_010761076.1|  protein disulfide-isomerase domain                 108   6e-25   
gb|EKG09842.1|  Thioredoxin                                             108   6e-25   
ref|XP_004005734.1|  PREDICTED: protein disulfide-isomerase A6 is...    109   6e-25   
tpg|DAA24511.1|  TPA: protein disulfide isomerase family A, member 6    110   6e-25   
gb|EGE08173.1|  tigA protein                                            108   6e-25   
gb|ELR58675.1|  Protein disulfide-isomerase A6                          109   6e-25   
ref|XP_005967905.1|  PREDICTED: protein disulfide-isomerase A6          108   7e-25   
ref|XP_007873545.1|  hypothetical protein PNEG_01591                    108   7e-25   
gb|EXK42709.1|  protein disulfide-isomerase erp38                       108   7e-25   
ref|XP_002111036.1|  hypothetical protein TRIADDRAFT_63251              109   7e-25   
ref|XP_003012534.1|  hypothetical protein ARB_01147                     108   7e-25   
gb|EHK27319.1|  protein disulfide isomerase                             108   7e-25   
ref|XP_568417.1|  hypothetical protein CNM02410                         109   7e-25   
emb|CCC48757.1|  putative protein disulfide isomerase                   108   7e-25   
ref|XP_003971872.1|  PREDICTED: protein disulfide-isomerase A6-like     108   7e-25   
gb|KFY38710.1|  hypothetical protein V494_04252                         108   7e-25   
gb|KGQ01781.1|  protein disulfide-isomerase domain                      108   7e-25   
gb|KFY07227.1|  hypothetical protein V492_07324                         108   7e-25   
ref|XP_003037952.1|  hypothetical protein SCHCODRAFT_63209              109   8e-25   
ref|XP_003984581.1|  PREDICTED: protein disulfide-isomerase A6          108   8e-25   



>ref|XP_004230291.1| PREDICTED: protein disulfide-isomerase like 2-1 [Solanum lycopersicum]
Length=359

 Score =   267 bits (683),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 124/142 (87%), Positives = 137/142 (96%), Gaps = 1/142 (1%)
 Frame = +1

Query  88   MSRSRICTALAIVALFF-SAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLA  264
            M RS+IC+ALAI+ALFF S+A ADDVVVLTEENF+KE+GQDRAALVEFYAPWCGHCKKLA
Sbjct  1    MGRSQICSALAILALFFFSSALADDVVVLTEENFDKEIGQDRAALVEFYAPWCGHCKKLA  60

Query  265  PEYEQLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTA  444
            PEYE+LGASFKKAKSVLIGK+DCDEHKSVCSKYGV GYPTIQWFPKGSLEPKKYEGAR+A
Sbjct  61   PEYEKLGASFKKAKSVLIGKIDCDEHKSVCSKYGVQGYPTIQWFPKGSLEPKKYEGARSA  120

Query  445  EALTEFVNTEAGTNVKVAAIPS  510
            EAL E+VN+EAGTNVK+A+IPS
Sbjct  121  EALAEYVNSEAGTNVKIASIPS  142


 Score =   124 bits (310),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 80/116 (69%), Gaps = 1/116 (1%)
 Frame = +1

Query  142  AAFADDVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLI  318
            A+    VVVL+ +NF++ V  + +  LVEFYAPWCGHCK LAP YE++  +F++ + V+I
Sbjct  138  ASIPSSVVVLSSDNFDEIVLDETKDVLVEFYAPWCGHCKSLAPIYEKVATAFRQEEDVII  197

Query  319  GKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
              +D D HK +  KYGVSGYPT+++FPKG+   + Y+G R A+    F+N + GT+
Sbjct  198  ANLDADNHKDLAEKYGVSGYPTLKFFPKGNKAGEDYDGGRDADDFVNFINEKCGTS  253



>ref|XP_009593712.1| PREDICTED: probable protein disulfide-isomerase A6 [Nicotiana 
tomentosiformis]
Length=359

 Score =   266 bits (679),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 123/142 (87%), Positives = 133/142 (94%), Gaps = 1/142 (1%)
 Frame = +1

Query  88   MSRSRICTALAIVALF-FSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLA  264
            M RSRIC  LAI+ALF FS+AFA+DVVVLTEENFEKE+GQDRAALVEFYAPWCGHCKKLA
Sbjct  1    MGRSRICNTLAILALFLFSSAFAEDVVVLTEENFEKEIGQDRAALVEFYAPWCGHCKKLA  60

Query  265  PEYEQLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTA  444
            PEYE+LGASF+KAKS+LIGKVDCDEHKSVCSKYGV GYPTIQWFPKGSLEPKKYEG RTA
Sbjct  61   PEYEKLGASFRKAKSILIGKVDCDEHKSVCSKYGVQGYPTIQWFPKGSLEPKKYEGGRTA  120

Query  445  EALTEFVNTEAGTNVKVAAIPS  510
            EAL EFVN+E GTNVK+A+ PS
Sbjct  121  EALAEFVNSEGGTNVKIASTPS  142


 Score =   120 bits (301),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 79/110 (72%), Gaps = 1/110 (1%)
 Frame = +1

Query  160  VVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDCD  336
            VVVL+ +NF++ V  + +  LVEFYAPWCGHCK LAP YE++  SFK+ + V+I  +D D
Sbjct  144  VVVLSPDNFDEIVLDETKDVLVEFYAPWCGHCKSLAPIYEKVATSFKQEEDVVIANLDAD  203

Query  337  EHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
            +H+ +  KYGVSG+PT+++FPKG+   + Y+G R  +    F+N ++GT+
Sbjct  204  KHRDLGEKYGVSGFPTLKFFPKGNKAGEDYDGGRDLDDFVNFINEKSGTS  253



>ref|XP_009757547.1| PREDICTED: probable protein disulfide-isomerase A6 [Nicotiana 
sylvestris]
Length=359

 Score =   266 bits (679),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 124/142 (87%), Positives = 132/142 (93%), Gaps = 1/142 (1%)
 Frame = +1

Query  88   MSRSRICTALAIVALF-FSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLA  264
            M RSRIC  LAI+ALF FS+A ADDVVVLTEENFEKE+GQDRAALVEFYAPWCGHCKKLA
Sbjct  1    MGRSRICNTLAILALFLFSSALADDVVVLTEENFEKEIGQDRAALVEFYAPWCGHCKKLA  60

Query  265  PEYEQLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTA  444
            PEYE+LGASFKKAKS+LIGKVDCDEHKSVCSKYGV GYPTIQWFPKGSLEPKKYEG RTA
Sbjct  61   PEYEKLGASFKKAKSILIGKVDCDEHKSVCSKYGVQGYPTIQWFPKGSLEPKKYEGGRTA  120

Query  445  EALTEFVNTEAGTNVKVAAIPS  510
            EAL EFVN+E GTNVK+A+ PS
Sbjct  121  EALAEFVNSEGGTNVKLASTPS  142


 Score =   119 bits (297),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 79/110 (72%), Gaps = 1/110 (1%)
 Frame = +1

Query  160  VVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDCD  336
            VVVL+ +NF++ V  + +  LVEFYAPWCGHCK LAP YE++  +FK+ + V+I  +D D
Sbjct  144  VVVLSPDNFDEIVLDETKDVLVEFYAPWCGHCKSLAPIYEKVATAFKQEEGVVIANLDAD  203

Query  337  EHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
            +H+ +  KYGVSG+PT+++FPKG+   + Y+G R  +    F+N ++GT+
Sbjct  204  KHRDLGEKYGVSGFPTLKFFPKGNKAGEDYDGGRDLDDFVNFINEKSGTS  253



>ref|NP_001275470.1| protein disulfide-isomerase like 2-1-like precursor [Solanum 
tuberosum]
 gb|ABB02620.1| disulfide-isomerase precursor-like protein [Solanum tuberosum]
Length=359

 Score =   263 bits (673),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 121/142 (85%), Positives = 135/142 (95%), Gaps = 1/142 (1%)
 Frame = +1

Query  88   MSRSRICTALAIVALFF-SAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLA  264
            M RS+IC+ALAI+ALFF S+A ADDVVVLTEENF+KE+G DRAALVEFYAPWCGHCKKLA
Sbjct  1    MGRSQICSALAILALFFFSSALADDVVVLTEENFDKEIGHDRAALVEFYAPWCGHCKKLA  60

Query  265  PEYEQLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTA  444
            PEYE+LGASFKKAKSVLIGK+DCDEHKS+CSKYGV GYPTIQWFPKGSLEPKKYEGAR+A
Sbjct  61   PEYEKLGASFKKAKSVLIGKIDCDEHKSICSKYGVQGYPTIQWFPKGSLEPKKYEGARSA  120

Query  445  EALTEFVNTEAGTNVKVAAIPS  510
            E L E+VN+EAGTNVK+A+IPS
Sbjct  121  EGLAEYVNSEAGTNVKIASIPS  142


 Score =   122 bits (305),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 53/116 (46%), Positives = 79/116 (68%), Gaps = 1/116 (1%)
 Frame = +1

Query  142  AAFADDVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLI  318
            A+    VVVL+ +NF++ V  + +  LVEFYAPWCGHCK LAP YE++  +F++ + V+I
Sbjct  138  ASIPSSVVVLSSDNFDEIVLDETKDVLVEFYAPWCGHCKSLAPIYEKVATAFRQEEDVVI  197

Query  319  GKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
              +D D HK +  KYGVSGYPT+++FPKG+   + Y+G R  +    F+N + GT+
Sbjct  198  ANLDADNHKDLAEKYGVSGYPTLKFFPKGNKAGEDYDGGRDTDDFVNFINEKCGTS  253



>emb|CAA72092.1| protein disulfide-isomerase precursor [Nicotiana tabacum]
Length=359

 Score =   263 bits (672),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 122/142 (86%), Positives = 132/142 (93%), Gaps = 1/142 (1%)
 Frame = +1

Query  88   MSRSRICTALAIVALF-FSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLA  264
            M RSRIC  LAI+ALF FS+A A+DVVVLTEENFEKE+GQDRAALVEFYAPWCGHCKKLA
Sbjct  1    MGRSRICNTLAILALFLFSSALAEDVVVLTEENFEKEIGQDRAALVEFYAPWCGHCKKLA  60

Query  265  PEYEQLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTA  444
            PEYE+LGASF+KAKS+LIGKVDCDEHKSVCSKYGV GYPTIQWFPKGSLEPKKYEG RTA
Sbjct  61   PEYEKLGASFRKAKSILIGKVDCDEHKSVCSKYGVQGYPTIQWFPKGSLEPKKYEGGRTA  120

Query  445  EALTEFVNTEAGTNVKVAAIPS  510
            EAL EFVN+E GTNVK+A+ PS
Sbjct  121  EALAEFVNSEGGTNVKIASTPS  142


 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 78/110 (71%), Gaps = 1/110 (1%)
 Frame = +1

Query  160  VVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDCD  336
            VVVL+ +NF++ V  + +  LVEFYAPWCGHCK LAP YE++  SFK+ + V+I  +D D
Sbjct  144  VVVLSPDNFDEIVLDETKDVLVEFYAPWCGHCKSLAPIYEKVATSFKQEEDVVIANLDAD  203

Query  337  EHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
            +H+ +  KYGVSG+PT+++FPKG+   + Y+G R       F+N ++GT+
Sbjct  204  KHRDLGEKYGVSGFPTLKFFPKGNKAGEHYDGGRHLYDFVNFINEKSGTS  253



>emb|CDP18230.1| unnamed protein product [Coffea canephora]
Length=360

 Score =   258 bits (660),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 122/143 (85%), Positives = 132/143 (92%), Gaps = 2/143 (1%)
 Frame = +1

Query  88   MSRSRICTALAIVAL--FFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKL  261
            MSR RI  AL  +AL  FF++A ADDVVVLTEENFEKEVGQDR ALVEFYAPWCGHCKKL
Sbjct  1    MSRPRISIALVTLALLFFFASALADDVVVLTEENFEKEVGQDRGALVEFYAPWCGHCKKL  60

Query  262  APEYEQLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGART  441
            APEYE+LGASFKKAK+VLIGKVDCDEHKS+CSKYGVSGYPTIQWFPKGSLEPKKYEGAR+
Sbjct  61   APEYEKLGASFKKAKAVLIGKVDCDEHKSLCSKYGVSGYPTIQWFPKGSLEPKKYEGARS  120

Query  442  AEALTEFVNTEAGTNVKVAAIPS  510
            AEAL EFVN+E GTNVK+AA+PS
Sbjct  121  AEALAEFVNSEGGTNVKIAAVPS  143


 Score =   123 bits (308),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 57/116 (49%), Positives = 78/116 (67%), Gaps = 1/116 (1%)
 Frame = +1

Query  142  AAFADDVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLI  318
            AA   +VVVLT ENF++ V  + +  LVEFYAPWCGHCK LAP YE++  +FK    V+I
Sbjct  139  AAVPSNVVVLTPENFDEIVLDEKKDVLVEFYAPWCGHCKSLAPTYEKVATAFKLEDHVVI  198

Query  319  GKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
              VD D++K +  KYGVSGYPT+++FPKG+   + Y+G R  +    F+N   GT+
Sbjct  199  ANVDADKYKDLAEKYGVSGYPTLKFFPKGNKAGEDYDGGRDLDDFVTFINERTGTS  254



>gb|EYU38104.1| hypothetical protein MIMGU_mgv1a0087951mg, partial [Erythranthe 
guttata]
Length=210

 Score =   252 bits (644),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 121/142 (85%), Positives = 127/142 (89%), Gaps = 1/142 (1%)
 Frame = +1

Query  88   MSRSRICTALAIVALFFSA-AFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLA  264
            MSRSRIC     + L F A AFADDVVVLTEENF+KEVGQDR ALVEFYAPWCGHCKKLA
Sbjct  1    MSRSRICLVFVTLTLLFVASAFADDVVVLTEENFDKEVGQDRGALVEFYAPWCGHCKKLA  60

Query  265  PEYEQLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTA  444
            PEYE LGASFKKAKSV+I KVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGAR A
Sbjct  61   PEYETLGASFKKAKSVVIAKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARNA  120

Query  445  EALTEFVNTEAGTNVKVAAIPS  510
            EAL E+VNTEAGTNVK+A+ PS
Sbjct  121  EALAEYVNTEAGTNVKIASAPS  142


 Score = 79.7 bits (195),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 50/66 (76%), Gaps = 1/66 (2%)
 Frame = +1

Query  157  DVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDC  333
            +VVVLT ENFE+ V  +++  LVEFYAPWCGHCK LAP YE++ A+FK  + V+I  VD 
Sbjct  143  NVVVLTPENFEEIVLDENKDVLVEFYAPWCGHCKNLAPVYEKVAAAFKLDQHVVIANVDA  202

Query  334  DEHKSV  351
            D++K +
Sbjct  203  DKYKDI  208



>ref|XP_008451506.1| PREDICTED: probable protein disulfide-isomerase A6 [Cucumis melo]
Length=361

 Score =   252 bits (643),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 117/141 (83%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = +1

Query  88   MSRSRICTALAIVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAP  267
            M++ +I  A+A +A F S+A ADDVVVLTEENFEKEVGQD+ ALVEFYAPWCGHCKKLAP
Sbjct  1    MAKHQIWFAVAALAFFLSSAVADDVVVLTEENFEKEVGQDKGALVEFYAPWCGHCKKLAP  60

Query  268  EYEQLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAE  447
            EYE+LG SFKKAKSVLIGKVDCDEHK VCSKYGVSGYPTIQWFPKGSLEPKKYEG RTAE
Sbjct  61   EYEKLGGSFKKAKSVLIGKVDCDEHKGVCSKYGVSGYPTIQWFPKGSLEPKKYEGQRTAE  120

Query  448  ALTEFVNTEAGTNVKVAAIPS  510
            AL EFVN+E GTNVK+A+IPS
Sbjct  121  ALAEFVNSEGGTNVKIASIPS  141


 Score =   117 bits (293),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 51/116 (44%), Positives = 78/116 (67%), Gaps = 1/116 (1%)
 Frame = +1

Query  142  AAFADDVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLI  318
            A+    VVVL+ +NF + V    +  LVEFYAPWCGHCK LAP YE++  +FK  + V+I
Sbjct  137  ASIPSSVVVLSADNFNEVVLDSSKDVLVEFYAPWCGHCKNLAPIYEKVATAFKLEEDVVI  196

Query  319  GKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
              +D D+++ +  KYG+SG+PT++ FPKG+ + + Y+G R  +    F+N ++GTN
Sbjct  197  ANLDADKYRDLAEKYGISGFPTLKVFPKGNKDGEDYDGGRDVDDFVSFINEKSGTN  252



>ref|XP_006444457.1| hypothetical protein CICLE_v10020618mg [Citrus clementina]
 gb|ESR57697.1| hypothetical protein CICLE_v10020618mg [Citrus clementina]
Length=379

 Score =   252 bits (644),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   KMSRSRICTALAIVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLA  264
            +M R +I  AL  + LFF +A ADDVVVLTE+NFEKEVGQDR ALVEFYAPWCGHCKKLA
Sbjct  21   EMERYQIWLALGTLTLFFVSALADDVVVLTEDNFEKEVGQDRGALVEFYAPWCGHCKKLA  80

Query  265  PEYEQLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTA  444
            PEYE+LGASFKKAKSVLIGKVDCDEHKS+CSKYGV GYPTIQWFPKGSLEPKKYEG R+A
Sbjct  81   PEYEKLGASFKKAKSVLIGKVDCDEHKSLCSKYGVQGYPTIQWFPKGSLEPKKYEGPRSA  140

Query  445  EALTEFVNTEAGTNVKVAAIPS  510
            EAL E+VN E GTNVK+AA+PS
Sbjct  141  EALAEYVNNEGGTNVKIAAVPS  162


 Score =   119 bits (299),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 80/116 (69%), Gaps = 1/116 (1%)
 Frame = +1

Query  142  AAFADDVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLI  318
            AA   +VVVLT +NF++ V  + +  LVEFYAPWCGHCK LAP YE++ A+F     V++
Sbjct  158  AAVPSNVVVLTADNFDEIVLDKSKDVLVEFYAPWCGHCKNLAPTYEKVAAAFTLEDDVVV  217

Query  319  GKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
              +D D++K +  KYGVSG+PT+++FPKG+ + ++Y G R  E    F+N + GT+
Sbjct  218  ANLDADKYKDLAEKYGVSGFPTLKFFPKGNKDGEEYGGGRDLEDFVSFINEKCGTS  273



>ref|XP_004136003.1| PREDICTED: probable protein disulfide-isomerase A6-like [Cucumis 
sativus]
 gb|KGN44999.1| hypothetical protein Csa_7G407520 [Cucumis sativus]
Length=361

 Score =   251 bits (640),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 116/141 (82%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = +1

Query  88   MSRSRICTALAIVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAP  267
            M++ +I  A+A +ALF S+A ADDVVVLTE+NFEKEVGQD+ ALVEFYAPWCGHCKKLAP
Sbjct  1    MAKHQIWFAVAALALFLSSAVADDVVVLTEDNFEKEVGQDKGALVEFYAPWCGHCKKLAP  60

Query  268  EYEQLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAE  447
            EYE+LG SFKKAKSVLIGKVDCDEHK VCSKYGVSGYPTIQWFPKGSLEPKKYEG RTA+
Sbjct  61   EYEKLGGSFKKAKSVLIGKVDCDEHKGVCSKYGVSGYPTIQWFPKGSLEPKKYEGQRTAD  120

Query  448  ALTEFVNTEAGTNVKVAAIPS  510
            AL EFVN+E GTNVK+A+IPS
Sbjct  121  ALAEFVNSEGGTNVKIASIPS  141


 Score =   119 bits (299),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 51/116 (44%), Positives = 80/116 (69%), Gaps = 1/116 (1%)
 Frame = +1

Query  142  AAFADDVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLI  318
            A+    VVVL+ +NF++ V    +  LVEFYAPWCGHCK LAP YE++  +FK  + V+I
Sbjct  137  ASIPSSVVVLSADNFDEVVLDSSKDVLVEFYAPWCGHCKNLAPIYEKVATAFKLEEDVVI  196

Query  319  GKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
              +D D+++ +  KYG+SG+PT+++FPKG+ + + Y+G R  +    F+N ++GTN
Sbjct  197  ANLDADKYRDLAEKYGISGFPTLKFFPKGNKDGEDYDGGRDVDDFVSFINEKSGTN  252



>ref|XP_011087481.1| PREDICTED: protein disulfide-isomerase like 2-1-like [Sesamum 
indicum]
Length=363

 Score =   250 bits (639),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 116/131 (89%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = +1

Query  118  AIVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFK  297
            A+V L F++AFADDVVVLTE+NFEKEVGQDR ALVEFYAPWCGHCKKLAPEYE+LGASFK
Sbjct  13   ALVVLLFASAFADDVVVLTEDNFEKEVGQDRGALVEFYAPWCGHCKKLAPEYEKLGASFK  72

Query  298  KAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEA  477
            KAKSVLIGKVDCDEHKS+CSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEA+ E+VN E 
Sbjct  73   KAKSVLIGKVDCDEHKSLCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEAIAEYVNNEG  132

Query  478  GTNVKVAAIPS  510
            GTNVK+AAIPS
Sbjct  133  GTNVKIAAIPS  143


 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 53/116 (46%), Positives = 80/116 (69%), Gaps = 1/116 (1%)
 Frame = +1

Query  142  AAFADDVVVLTEENFEK-EVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLI  318
            AA   +VVVLT ENF++  + + +  LVEFYAPWCGHCK LAP YE++  +FK+ + V+I
Sbjct  139  AAIPSNVVVLTPENFDEIALDEKKDVLVEFYAPWCGHCKNLAPTYEKVATAFKQEEDVVI  198

Query  319  GKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
              VD D+++ +  KYGVSG+PT+++FPK +   + Y+G R  +    F+N + GT+
Sbjct  199  ANVDADKYRDLGEKYGVSGFPTLKFFPKNNKAGEDYDGGRDLDDFVTFINEKCGTS  254



>gb|KDO87057.1| hypothetical protein CISIN_1g018270mg [Citrus sinensis]
Length=358

 Score =   250 bits (638),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 115/141 (82%), Positives = 125/141 (89%), Gaps = 0/141 (0%)
 Frame = +1

Query  88   MSRSRICTALAIVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAP  267
            M R +I  AL  + LFF +A ADDVVVLTE+NFEKEVGQDR ALVEFYAPWCGHCKKLAP
Sbjct  1    MERYQIWLALGTLTLFFVSALADDVVVLTEDNFEKEVGQDRGALVEFYAPWCGHCKKLAP  60

Query  268  EYEQLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAE  447
            EYE+LGASFKKAKSVLIGKVDCDEHKS+CSKYGV GYPTIQWFPKGSLEPKKYEG R+ E
Sbjct  61   EYEKLGASFKKAKSVLIGKVDCDEHKSLCSKYGVQGYPTIQWFPKGSLEPKKYEGPRSTE  120

Query  448  ALTEFVNTEAGTNVKVAAIPS  510
            AL E+VN E GTNVK+AA+PS
Sbjct  121  ALAEYVNNEGGTNVKIAAVPS  141


 Score =   119 bits (298),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 80/116 (69%), Gaps = 1/116 (1%)
 Frame = +1

Query  142  AAFADDVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLI  318
            AA   +VVVLT +NF++ V  + +  LVEFYAPWCGHCK LAP YE++ A+F     V++
Sbjct  137  AAVPSNVVVLTADNFDEIVLDKSKDVLVEFYAPWCGHCKNLAPTYEKVAAAFTLEDDVVV  196

Query  319  GKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
              +D D++K +  KYGVSG+PT+++FPKG+ + ++Y G R  E    F+N + GT+
Sbjct  197  ANLDADKYKDLAEKYGVSGFPTLKFFPKGNKDGEEYGGGRDLEDFVSFINEKCGTS  252



>ref|XP_006480049.1| PREDICTED: probable protein disulfide-isomerase A6-like [Citrus 
sinensis]
Length=385

 Score =   251 bits (640),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   KMSRSRICTALAIVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLA  264
            +M R +I  AL  + LFF +A ADDVVVLTE+NFEKEVGQDR ALVEFYAPWCGHCKKLA
Sbjct  27   EMERYQIWLALGTLTLFFVSALADDVVVLTEDNFEKEVGQDRGALVEFYAPWCGHCKKLA  86

Query  265  PEYEQLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTA  444
            PEYE+LGASFKKAKSVLIGKVDCDEHKS+CSKYGV GYPTIQWFPKGSLEPKKYEG R+ 
Sbjct  87   PEYEKLGASFKKAKSVLIGKVDCDEHKSLCSKYGVQGYPTIQWFPKGSLEPKKYEGPRST  146

Query  445  EALTEFVNTEAGTNVKVAAIPS  510
            EAL E+VN E GTNVK+AA+PS
Sbjct  147  EALAEYVNNEGGTNVKIAAVPS  168


 Score =   119 bits (298),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 80/116 (69%), Gaps = 1/116 (1%)
 Frame = +1

Query  142  AAFADDVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLI  318
            AA   +VVVLT +NF++ V  + +  LVEFYAPWCGHCK LAP YE++ A+F     V++
Sbjct  164  AAVPSNVVVLTADNFDEIVLDKSKDVLVEFYAPWCGHCKNLAPTYEKVAAAFALEDDVVV  223

Query  319  GKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
              +D D++K +  KYGVSG+PT+++FPKG+ + ++Y G R  E    F+N + GT+
Sbjct  224  ANLDADKYKDLAEKYGVSGFPTLKFFPKGNKDGEEYGGGRDLEDFVSFINEKCGTS  279



>gb|KJB24398.1| hypothetical protein B456_004G143300 [Gossypium raimondii]
Length=276

 Score =   246 bits (627),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   KMSRSRICTALAIVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLA  264
            KM +S+I  A   +AL  ++A ADDVVVLTE+ FEKEVGQDR ALVEFYAPWCGHCKKLA
Sbjct  23   KMEKSQIWLAFGAMALLLASATADDVVVLTEDIFEKEVGQDRGALVEFYAPWCGHCKKLA  82

Query  265  PEYEQLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTA  444
            PEYE+LG+SFKKAKSVLIGKVDCDEHKSVCSKYGV GYPTIQWFPKGSLEPKKYEG RTA
Sbjct  83   PEYEKLGSSFKKAKSVLIGKVDCDEHKSVCSKYGVQGYPTIQWFPKGSLEPKKYEGPRTA  142

Query  445  EALTEFVNTEAGTNVKVAAIPS  510
            EAL EFVNTE GTNVK+A +PS
Sbjct  143  EALAEFVNTEGGTNVKIATLPS  164


 Score =   112 bits (279),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 71/110 (65%), Gaps = 1/110 (1%)
 Frame = +1

Query  142  AAFADDVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLI  318
            A     VVVL  +NF++ V  + +  LVEFYAPWCGHCK LAP YE++  +FK  + V+I
Sbjct  160  ATLPSSVVVLNADNFDEVVLDETKDVLVEFYAPWCGHCKNLAPTYEKVALAFKMEEDVVI  219

Query  319  GKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVN  468
              +D D+HK +  KYGVSGYPT+++FPK +   + Y G R  +    F+N
Sbjct  220  ANLDADKHKDLAEKYGVSGYPTLKFFPKTNKAGEDYNGGRGLDDFVSFIN  269



>ref|XP_010268045.1| PREDICTED: probable protein disulfide-isomerase A6 [Nelumbo nucifera]
Length=358

 Score =   248 bits (633),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 115/141 (82%), Positives = 126/141 (89%), Gaps = 0/141 (0%)
 Frame = +1

Query  88   MSRSRICTALAIVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAP  267
            M+  +I  A A +AL F++AFADDV VLTE NFEKEVGQDR ALVEFYAPWCGHCKKLAP
Sbjct  1    MASFQIWFAFATLALLFASAFADDVTVLTEANFEKEVGQDRGALVEFYAPWCGHCKKLAP  60

Query  268  EYEQLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAE  447
            EYE+LG SFKKAK+VLIGKVDCDEHKS+CSKYGVSGYPTIQWFPKGSLEPKKYEG RTAE
Sbjct  61   EYEKLGTSFKKAKTVLIGKVDCDEHKSLCSKYGVSGYPTIQWFPKGSLEPKKYEGPRTAE  120

Query  448  ALTEFVNTEAGTNVKVAAIPS  510
            +L EFVNTE GTNVK+A +PS
Sbjct  121  SLAEFVNTEGGTNVKIATVPS  141


 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/116 (44%), Positives = 79/116 (68%), Gaps = 1/116 (1%)
 Frame = +1

Query  142  AAFADDVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLI  318
            A    +V+VLT +NF++ V  + +  LVEFYAPWCGHCK LAP YE++  ++K  + V+I
Sbjct  137  ATVPSNVIVLTADNFDEVVMDETKDVLVEFYAPWCGHCKNLAPTYEKVATAYKLEEDVVI  196

Query  319  GKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
              +D D++K +  KYGVSG+PT+++FPKG+   + Y+G R  +    F+N + GT+
Sbjct  197  ANLDADKYKDLAEKYGVSGFPTLKFFPKGNKAGEDYDGGRDLDDFVTFINEKCGTS  252



>gb|KJB24396.1| hypothetical protein B456_004G143300 [Gossypium raimondii]
 gb|KJB24397.1| hypothetical protein B456_004G143300 [Gossypium raimondii]
Length=344

 Score =   247 bits (631),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   KMSRSRICTALAIVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLA  264
            KM +S+I  A   +AL  ++A ADDVVVLTE+ FEKEVGQDR ALVEFYAPWCGHCKKLA
Sbjct  23   KMEKSQIWLAFGAMALLLASATADDVVVLTEDIFEKEVGQDRGALVEFYAPWCGHCKKLA  82

Query  265  PEYEQLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTA  444
            PEYE+LG+SFKKAKSVLIGKVDCDEHKSVCSKYGV GYPTIQWFPKGSLEPKKYEG RTA
Sbjct  83   PEYEKLGSSFKKAKSVLIGKVDCDEHKSVCSKYGVQGYPTIQWFPKGSLEPKKYEGPRTA  142

Query  445  EALTEFVNTEAGTNVKVAAIPS  510
            EAL EFVNTE GTNVK+A +PS
Sbjct  143  EALAEFVNTEGGTNVKIATLPS  164


 Score =   116 bits (291),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 53/116 (46%), Positives = 75/116 (65%), Gaps = 1/116 (1%)
 Frame = +1

Query  142  AAFADDVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLI  318
            A     VVVL  +NF++ V  + +  LVEFYAPWCGHCK LAP YE++  +FK  + V+I
Sbjct  160  ATLPSSVVVLNADNFDEVVLDETKDVLVEFYAPWCGHCKNLAPTYEKVALAFKMEEDVVI  219

Query  319  GKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
              +D D+HK +  KYGVSGYPT+++FPK +   + Y G R  +    F+N + GT+
Sbjct  220  ANLDADKHKDLAEKYGVSGYPTLKFFPKTNKAGEDYNGGRGLDDFVSFINEKCGTS  275



>gb|KJB24395.1| hypothetical protein B456_004G143300 [Gossypium raimondii]
Length=381

 Score =   248 bits (633),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   KMSRSRICTALAIVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLA  264
            KM +S+I  A   +AL  ++A ADDVVVLTE+ FEKEVGQDR ALVEFYAPWCGHCKKLA
Sbjct  23   KMEKSQIWLAFGAMALLLASATADDVVVLTEDIFEKEVGQDRGALVEFYAPWCGHCKKLA  82

Query  265  PEYEQLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTA  444
            PEYE+LG+SFKKAKSVLIGKVDCDEHKSVCSKYGV GYPTIQWFPKGSLEPKKYEG RTA
Sbjct  83   PEYEKLGSSFKKAKSVLIGKVDCDEHKSVCSKYGVQGYPTIQWFPKGSLEPKKYEGPRTA  142

Query  445  EALTEFVNTEAGTNVKVAAIPS  510
            EAL EFVNTE GTNVK+A +PS
Sbjct  143  EALAEFVNTEGGTNVKIATLPS  164


 Score =   116 bits (291),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/116 (46%), Positives = 75/116 (65%), Gaps = 1/116 (1%)
 Frame = +1

Query  142  AAFADDVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLI  318
            A     VVVL  +NF++ V  + +  LVEFYAPWCGHCK LAP YE++  +FK  + V+I
Sbjct  160  ATLPSSVVVLNADNFDEVVLDETKDVLVEFYAPWCGHCKNLAPTYEKVALAFKMEEDVVI  219

Query  319  GKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
              +D D+HK +  KYGVSGYPT+++FPK +   + Y G R  +    F+N + GT+
Sbjct  220  ANLDADKHKDLAEKYGVSGYPTLKFFPKTNKAGEDYNGGRGLDDFVSFINEKCGTS  275



>ref|XP_008370389.1| PREDICTED: probable protein disulfide-isomerase A6 [Malus domestica]
Length=361

 Score =   246 bits (629),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 115/141 (82%), Positives = 124/141 (88%), Gaps = 0/141 (0%)
 Frame = +1

Query  88   MSRSRICTALAIVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAP  267
            M+ S+   A   +AL  S+AFADDVVVLTE+NFEKEVGQDRAALVEFYAPWCGHCKKLAP
Sbjct  1    MASSKTLFAFGALALLASSAFADDVVVLTEDNFEKEVGQDRAALVEFYAPWCGHCKKLAP  60

Query  268  EYEQLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAE  447
            EYE+LG+SFKKAKS+LI KVDCDEHK VC KYGVSGYPTIQWFPKGSLEPKKYEGAR AE
Sbjct  61   EYEKLGSSFKKAKSILIAKVDCDEHKGVCGKYGVSGYPTIQWFPKGSLEPKKYEGARNAE  120

Query  448  ALTEFVNTEAGTNVKVAAIPS  510
            AL EFVN E GTNVK+AA PS
Sbjct  121  ALAEFVNKEGGTNVKIAAAPS  141


 Score =   120 bits (300),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 80/116 (69%), Gaps = 1/116 (1%)
 Frame = +1

Query  142  AAFADDVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLI  318
            AA    VVVLT++NF + V  + +  LVEFYAPWCGHCK LAP YE++ ++FK    V+I
Sbjct  137  AAAPSHVVVLTQDNFNEVVLDETKDVLVEFYAPWCGHCKSLAPTYEKVASAFKLEDGVVI  196

Query  319  GKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
              +D D++K +  KYGVSGYPT+++FPK   E ++Y G R  E   +F+N ++G++
Sbjct  197  ANLDADKYKDLAEKYGVSGYPTLKFFPKNKKEGEEYGGGRDLEDFVDFINEKSGSS  252



>ref|XP_004302250.1| PREDICTED: probable protein disulfide-isomerase A6 [Fragaria 
vesca subsp. vesca]
Length=362

 Score =   246 bits (627),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 128/142 (90%), Gaps = 1/142 (1%)
 Frame = +1

Query  88   MSRSRICTALAIVALFF-SAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLA  264
            MS ++   A+  +AL F S+ FADDVVVLT++NFEKEVGQDR ALVEFYAPWCGHCKKLA
Sbjct  1    MSSNKTLFAIGALALLFVSSVFADDVVVLTDDNFEKEVGQDRPALVEFYAPWCGHCKKLA  60

Query  265  PEYEQLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTA  444
            PEYE+LGASFKKAKSVLI KVDCDEHKSVC K+GVSGYPTIQWFPKGSLEPKKYEGART+
Sbjct  61   PEYEKLGASFKKAKSVLIAKVDCDEHKSVCGKFGVSGYPTIQWFPKGSLEPKKYEGARTS  120

Query  445  EALTEFVNTEAGTNVKVAAIPS  510
            EAL E+VN EAGTNVK+AAIPS
Sbjct  121  EALVEYVNKEAGTNVKIAAIPS  142


 Score =   124 bits (312),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 57/116 (49%), Positives = 81/116 (70%), Gaps = 1/116 (1%)
 Frame = +1

Query  142  AAFADDVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLI  318
            AA    VVVLT++NF++ V  + +  LVEFYAPWCGHCK LAP YE++ A+FK    V+I
Sbjct  138  AAIPSSVVVLTQDNFDEVVLDKTKDVLVEFYAPWCGHCKSLAPTYEKVAAAFKLDGDVVI  197

Query  319  GKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
              +D D++K +  KYGVSGYPT+++FPKG+ + ++Y G R  E    F+N + GT+
Sbjct  198  ANLDADKYKDIAEKYGVSGYPTLKFFPKGNKDGEEYGGGRDLEDFVNFINEKCGTS  253



>ref|XP_009338195.1| PREDICTED: probable protein disulfide-isomerase A6 [Pyrus x bretschneideri]
Length=362

 Score =   246 bits (627),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 126/142 (89%), Gaps = 1/142 (1%)
 Frame = +1

Query  88   MSRSRICTALAIVALFF-SAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLA  264
            M+ S+   A   +AL F S+AFADDVVVLTE+NFEKEVGQDRAALVEFYAPWCGHCKKLA
Sbjct  1    MASSKTLIAFGALALLFASSAFADDVVVLTEDNFEKEVGQDRAALVEFYAPWCGHCKKLA  60

Query  265  PEYEQLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTA  444
            PEYE+LG+SFKKAKS+LI KVDCDEHK VC K+GVSGYPTIQWFPKGSLEPKKYEGARTA
Sbjct  61   PEYEKLGSSFKKAKSILIAKVDCDEHKGVCGKFGVSGYPTIQWFPKGSLEPKKYEGARTA  120

Query  445  EALTEFVNTEAGTNVKVAAIPS  510
            EAL EFVN E GTNVK+AA PS
Sbjct  121  EALAEFVNKEGGTNVKIAADPS  142


 Score =   119 bits (298),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 56/116 (48%), Positives = 79/116 (68%), Gaps = 1/116 (1%)
 Frame = +1

Query  142  AAFADDVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLI  318
            AA    VVVLT++NF + V  + +  LVEFYAPWCGHCK LAP YE++ ++FK    V+I
Sbjct  138  AADPSHVVVLTQDNFNEVVLDETKDVLVEFYAPWCGHCKSLAPTYEKVASAFKLEDGVVI  197

Query  319  GKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
              +D D++K +  KYGVSGYPT+++FPK   E ++Y G R  E    F+N ++GT+
Sbjct  198  ANLDADKYKDLAEKYGVSGYPTLKFFPKNKKEGEEYGGGRDLEDFVVFINEKSGTS  253



>ref|XP_011042212.1| PREDICTED: probable protein disulfide-isomerase A6 [Populus euphratica]
Length=379

 Score =   246 bits (628),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 117/152 (77%), Positives = 130/152 (86%), Gaps = 1/152 (1%)
 Frame = +1

Query  58   EERNFPN*EKMSR-SRICTALAIVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYA  234
            ++R     +KM R ++I  A   VAL   +A ADDVVVLTE+NFEKEVGQDR ALVEFYA
Sbjct  11   KQRKIETRKKMERYNQIWYAFGTVALLVVSALADDVVVLTEDNFEKEVGQDRGALVEFYA  70

Query  235  PWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLE  414
            PWCGHCKKLAPEYE+LG+SFKKAK+VLIGKVDCDEHK VCSKYGVSGYPTIQWFPKGSLE
Sbjct  71   PWCGHCKKLAPEYEKLGSSFKKAKAVLIGKVDCDEHKGVCSKYGVSGYPTIQWFPKGSLE  130

Query  415  PKKYEGARTAEALTEFVNTEAGTNVKVAAIPS  510
            PKKYEG RTAEAL EFVN E G+NVK+AA+PS
Sbjct  131  PKKYEGPRTAEALAEFVNNEGGSNVKIAAVPS  162


 Score =   124 bits (310),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 56/116 (48%), Positives = 81/116 (70%), Gaps = 1/116 (1%)
 Frame = +1

Query  142  AAFADDVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLI  318
            AA    VVVLT +NF   V  +++  LVEFYAPWCGHCK LAP YE++ A+FK  K V++
Sbjct  158  AAVPSSVVVLTADNFNDIVLDENKDVLVEFYAPWCGHCKNLAPTYEKVAAAFKSEKDVVV  217

Query  319  GKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
              +D D+++ +  KYGVSG+PT+++FPKG+   ++YEG R  +    F+N +AGT+
Sbjct  218  ANLDADKYRDLAEKYGVSGFPTLKFFPKGNKAGEEYEGGRDLDDFVAFINEKAGTS  273



>gb|KDP28233.1| hypothetical protein JCGZ_14004 [Jatropha curcas]
Length=359

 Score =   245 bits (626),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 113/138 (82%), Positives = 126/138 (91%), Gaps = 0/138 (0%)
 Frame = +1

Query  97   SRICTALAIVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYE  276
            ++I  AL  +ALF  +A ADDV+VLTE+NFEKEVGQDR ALVEFYAPWCGHCKKLAPEYE
Sbjct  5    TQIWLALGTLALFAVSALADDVLVLTEDNFEKEVGQDRGALVEFYAPWCGHCKKLAPEYE  64

Query  277  QLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALT  456
            +LG+SFKK+KSVLIGKVDCDEHKS+CSKYGVSGYPTIQWFPKGSLEPKKYEG RTAE+L 
Sbjct  65   KLGSSFKKSKSVLIGKVDCDEHKSLCSKYGVSGYPTIQWFPKGSLEPKKYEGPRTAESLA  124

Query  457  EFVNTEAGTNVKVAAIPS  510
            EFVN E GTNVK+AA+PS
Sbjct  125  EFVNNEGGTNVKIAAVPS  142


 Score =   121 bits (303),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 80/116 (69%), Gaps = 1/116 (1%)
 Frame = +1

Query  142  AAFADDVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLI  318
            AA   +VVVLT +NF++ V  + +  LVEFYAPWCGHCK LAP YE++  +FK  + V+I
Sbjct  138  AAVPSNVVVLTADNFDEVVLDETKDVLVEFYAPWCGHCKSLAPTYEKVATAFKLEEDVVI  197

Query  319  GKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
              +D D+++ +  KYGVSGYPT+++FPKG+   + YE  R  E    F+N ++GT+
Sbjct  198  ANLDADKYRDIAEKYGVSGYPTLKFFPKGNKAGEDYEAGRDLEDFVSFINEKSGTS  253



>gb|KCW50094.1| hypothetical protein EUGRSUZ_K03531 [Eucalyptus grandis]
Length=291

 Score =   243 bits (620),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 117/141 (83%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = +1

Query  88   MSRSRICTALAIVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAP  267
            M+ S+I    A +AL   +AFADDV+VLTEENF+KEVGQDRAALVEFYAPWCGHCKKLAP
Sbjct  1    MASSQIWIGAAALALLLVSAFADDVLVLTEENFDKEVGQDRAALVEFYAPWCGHCKKLAP  60

Query  268  EYEQLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAE  447
            EYE+LG+SFKKAKS+LIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEG RTAE
Sbjct  61   EYEKLGSSFKKAKSILIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGPRTAE  120

Query  448  ALTEFVNTEAGTNVKVAAIPS  510
            AL EFVN E GTNVK+AA+PS
Sbjct  121  ALAEFVNNEGGTNVKIAAVPS  141


 Score =   116 bits (290),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 53/116 (46%), Positives = 78/116 (67%), Gaps = 1/116 (1%)
 Frame = +1

Query  142  AAFADDVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLI  318
            AA    V VLT +NF + V  + +  LVEFYAPWCGHCK LAP YE++ A+FK    V+I
Sbjct  137  AAVPSSVAVLTSDNFNEIVLDKTKDVLVEFYAPWCGHCKALAPTYEKVAAAFKSEDGVVI  196

Query  319  GKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
              +D D++K +  KYGVSG+PT+++FPK + + ++Y+G R  +    F+N + GT+
Sbjct  197  ANLDADKYKDLGEKYGVSGFPTLKFFPKNNKDGEEYDGGRDLDDFVNFINEKCGTS  252



>gb|KCW50095.1| hypothetical protein EUGRSUZ_K03531 [Eucalyptus grandis]
Length=304

 Score =   243 bits (619),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 117/141 (83%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = +1

Query  88   MSRSRICTALAIVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAP  267
            M+ S+I    A +AL   +AFADDV+VLTEENF+KEVGQDRAALVEFYAPWCGHCKKLAP
Sbjct  1    MASSQIWIGAAALALLLVSAFADDVLVLTEENFDKEVGQDRAALVEFYAPWCGHCKKLAP  60

Query  268  EYEQLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAE  447
            EYE+LG+SFKKAKS+LIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEG RTAE
Sbjct  61   EYEKLGSSFKKAKSILIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGPRTAE  120

Query  448  ALTEFVNTEAGTNVKVAAIPS  510
            AL EFVN E GTNVK+AA+PS
Sbjct  121  ALAEFVNNEGGTNVKIAAVPS  141


 Score =   115 bits (289),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/116 (46%), Positives = 78/116 (67%), Gaps = 1/116 (1%)
 Frame = +1

Query  142  AAFADDVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLI  318
            AA    V VLT +NF + V  + +  LVEFYAPWCGHCK LAP YE++ A+FK    V+I
Sbjct  137  AAVPSSVAVLTSDNFNEIVLDKTKDVLVEFYAPWCGHCKALAPTYEKVAAAFKSEDGVVI  196

Query  319  GKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
              +D D++K +  KYGVSG+PT+++FPK + + ++Y+G R  +    F+N + GT+
Sbjct  197  ANLDADKYKDLGEKYGVSGFPTLKFFPKNNKDGEEYDGGRDLDDFVNFINEKCGTS  252



>ref|XP_010038272.1| PREDICTED: protein disulfide-isomerase like 2-1 [Eucalyptus grandis]
 gb|KCW50093.1| hypothetical protein EUGRSUZ_K03531 [Eucalyptus grandis]
Length=358

 Score =   244 bits (622),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 117/141 (83%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = +1

Query  88   MSRSRICTALAIVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAP  267
            M+ S+I    A +AL   +AFADDV+VLTEENF+KEVGQDRAALVEFYAPWCGHCKKLAP
Sbjct  1    MASSQIWIGAAALALLLVSAFADDVLVLTEENFDKEVGQDRAALVEFYAPWCGHCKKLAP  60

Query  268  EYEQLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAE  447
            EYE+LG+SFKKAKS+LIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEG RTAE
Sbjct  61   EYEKLGSSFKKAKSILIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGPRTAE  120

Query  448  ALTEFVNTEAGTNVKVAAIPS  510
            AL EFVN E GTNVK+AA+PS
Sbjct  121  ALAEFVNNEGGTNVKIAAVPS  141


 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/116 (46%), Positives = 78/116 (67%), Gaps = 1/116 (1%)
 Frame = +1

Query  142  AAFADDVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLI  318
            AA    V VLT +NF + V  + +  LVEFYAPWCGHCK LAP YE++ A+FK    V+I
Sbjct  137  AAVPSSVAVLTSDNFNEIVLDKTKDVLVEFYAPWCGHCKALAPTYEKVAAAFKSEDGVVI  196

Query  319  GKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
              +D D++K +  KYGVSG+PT+++FPK + + ++Y+G R  +    F+N + GT+
Sbjct  197  ANLDADKYKDLGEKYGVSGFPTLKFFPKNNKDGEEYDGGRDLDDFVNFINEKCGTS  252



>ref|NP_001236300.1| protein disulfide isomerase-like protein precursor [Glycine max]
 dbj|BAD24714.2| protein disulfide isomerase-like protein [Glycine max]
Length=364

 Score =   243 bits (621),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 116/140 (83%), Positives = 125/140 (89%), Gaps = 1/140 (1%)
 Frame = +1

Query  91   SRSRICTALAIVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPE  270
            SR     ALA V LF SA+ ADDVVVL+E+NFEKEVGQDR ALVEFYAPWCGHCKKLAPE
Sbjct  8    SRRIALGALAFVLLFLSAS-ADDVVVLSEDNFEKEVGQDRGALVEFYAPWCGHCKKLAPE  66

Query  271  YEQLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEA  450
            YE+LG+SFKKAKSVLIGKVDCDEHKS+CSKYGVSGYPTIQWFPKGSLEPKKYEG RTA++
Sbjct  67   YEKLGSSFKKAKSVLIGKVDCDEHKSLCSKYGVSGYPTIQWFPKGSLEPKKYEGPRTADS  126

Query  451  LTEFVNTEAGTNVKVAAIPS  510
            L EFVNTE GTNVK+A  PS
Sbjct  127  LAEFVNTEGGTNVKIATAPS  146


 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 78/114 (68%), Gaps = 1/114 (1%)
 Frame = +1

Query  157  DVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDC  333
            +VVVLT ENF + V  + +  LVEFYAPWCGHCK LAP YE++  +FK  + V+I  +D 
Sbjct  147  NVVVLTSENFNEVVLDETKDVLVEFYAPWCGHCKSLAPTYEKVATAFKLEEDVVIANLDA  206

Query  334  DEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTNVKV  495
            D++K +  KY VSG+PT+++FPKG+   ++Y G R  +    F+N ++GT+  V
Sbjct  207  DKYKDLAEKYDVSGFPTLKFFPKGNKAGEEYGGGRDLDDFVAFINEKSGTSRDV  260



>gb|ACU18460.1| unknown [Glycine max]
Length=276

 Score =   240 bits (613),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 115/140 (82%), Positives = 124/140 (89%), Gaps = 1/140 (1%)
 Frame = +1

Query  91   SRSRICTALAIVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPE  270
            SR     A A V LF SA+ ADDVVVL+E+NFEKEVGQDR ALVEFYAPWCGHCKKLAPE
Sbjct  8    SRRIALGAFAFVLLFLSAS-ADDVVVLSEDNFEKEVGQDRGALVEFYAPWCGHCKKLAPE  66

Query  271  YEQLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEA  450
            YE+LG+SFKKAKSVLIGKVDCDEHKS+CSKYGVSGYPTIQWFPKGSLEPKKYEG RTA++
Sbjct  67   YEKLGSSFKKAKSVLIGKVDCDEHKSLCSKYGVSGYPTIQWFPKGSLEPKKYEGPRTADS  126

Query  451  LTEFVNTEAGTNVKVAAIPS  510
            L EFVNTE GTNVK+A  PS
Sbjct  127  LAEFVNTEGGTNVKIATAPS  146


 Score =   115 bits (288),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 78/114 (68%), Gaps = 1/114 (1%)
 Frame = +1

Query  157  DVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDC  333
            +VVVLT ENF + V  + +  LVEFYAPWCGHCK LAP YE++  +FK  + V+I  +D 
Sbjct  147  NVVVLTSENFNEVVLDETKDVLVEFYAPWCGHCKSLAPTYEKVATAFKLEEDVVIANLDA  206

Query  334  DEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTNVKV  495
            D++K +  KY VSG+PT+++FPKG+   ++Y G R  +    F+N ++GT+  V
Sbjct  207  DKYKDLAEKYDVSGFPTLKFFPKGNKAGEEYGGGRDLDDFVAFINEKSGTSRDV  260



>ref|XP_009383733.1| PREDICTED: protein disulfide isomerase-like 2-2 [Musa acuminata 
subsp. malaccensis]
Length=362

 Score =   243 bits (620),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 117/144 (81%), Positives = 127/144 (88%), Gaps = 3/144 (2%)
 Frame = +1

Query  88   MSRSRICTALAIV--ALFFSAAFAD-DVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKK  258
            M RS+I  A+  +   L F++A AD DVVVLTE NFEKEVGQDR ALVEFYAPWCGHCKK
Sbjct  1    MERSQIWFAVGTLTMGLLFASALADGDVVVLTEANFEKEVGQDRGALVEFYAPWCGHCKK  60

Query  259  LAPEYEQLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGAR  438
            LAPEYE+LG+SFKKAKSVLIGKVDCDEHKS+CSKYGVSGYPTIQWFPKGSLEPKKYEG R
Sbjct  61   LAPEYEKLGSSFKKAKSVLIGKVDCDEHKSLCSKYGVSGYPTIQWFPKGSLEPKKYEGPR  120

Query  439  TAEALTEFVNTEAGTNVKVAAIPS  510
            TAEAL EFVNTE GTNVK+A +PS
Sbjct  121  TAEALVEFVNTEGGTNVKLATVPS  144


 Score =   115 bits (288),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/116 (46%), Positives = 78/116 (67%), Gaps = 1/116 (1%)
 Frame = +1

Query  142  AAFADDVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLI  318
            A    +VVVLT E F++ V  + +  LVEFYAPWCGHCK LAP YE++  ++K  + V+I
Sbjct  140  ATVPSNVVVLTSETFDQIVLDETKDVLVEFYAPWCGHCKHLAPTYEKVANAYKLEEEVII  199

Query  319  GKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
              +D D++K +  KYGVSGYPT+++FPK +   + YEG R  +   +F+N + GT+
Sbjct  200  ANLDADKYKDLAEKYGVSGYPTLKFFPKSNKGGEDYEGGRDLDDFVKFLNEKCGTS  255



>gb|KCW50096.1| hypothetical protein EUGRSUZ_K03531 [Eucalyptus grandis]
Length=282

 Score =   240 bits (613),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 117/141 (83%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = +1

Query  88   MSRSRICTALAIVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAP  267
            M+ S+I    A +AL   +AFADDV+VLTEENF+KEVGQDRAALVEFYAPWCGHCKKLAP
Sbjct  1    MASSQIWIGAAALALLLVSAFADDVLVLTEENFDKEVGQDRAALVEFYAPWCGHCKKLAP  60

Query  268  EYEQLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAE  447
            EYE+LG+SFKKAKS+LIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEG RTAE
Sbjct  61   EYEKLGSSFKKAKSILIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGPRTAE  120

Query  448  ALTEFVNTEAGTNVKVAAIPS  510
            AL EFVN E GTNVK+AA+PS
Sbjct  121  ALAEFVNNEGGTNVKIAAVPS  141


 Score =   114 bits (286),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/116 (46%), Positives = 78/116 (67%), Gaps = 1/116 (1%)
 Frame = +1

Query  142  AAFADDVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLI  318
            AA    V VLT +NF + V  + +  LVEFYAPWCGHCK LAP YE++ A+FK    V+I
Sbjct  137  AAVPSSVAVLTSDNFNEIVLDKTKDVLVEFYAPWCGHCKALAPTYEKVAAAFKSEDGVVI  196

Query  319  GKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
              +D D++K +  KYGVSG+PT+++FPK + + ++Y+G R  +    F+N + GT+
Sbjct  197  ANLDADKYKDLGEKYGVSGFPTLKFFPKNNKDGEEYDGGRDLDDFVNFINEKCGTS  252



>gb|ACU23175.1| unknown [Glycine max]
Length=364

 Score =   241 bits (616),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 115/140 (82%), Positives = 124/140 (89%), Gaps = 1/140 (1%)
 Frame = +1

Query  91   SRSRICTALAIVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPE  270
            SR     A A V LF SA+ ADDVVVL+E+NFEKEVGQDR ALVEFYAPWCGHCKKLAPE
Sbjct  8    SRRIALGAFAFVLLFLSAS-ADDVVVLSEDNFEKEVGQDRGALVEFYAPWCGHCKKLAPE  66

Query  271  YEQLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEA  450
            YE+LG+SFKKAKSVLIGKVDCDEHKS+CSKYGVSGYPTIQWFPKGSLEPKKYEG RTA++
Sbjct  67   YEKLGSSFKKAKSVLIGKVDCDEHKSLCSKYGVSGYPTIQWFPKGSLEPKKYEGPRTADS  126

Query  451  LTEFVNTEAGTNVKVAAIPS  510
            L EFVNTE GTNVK+A  PS
Sbjct  127  LAEFVNTEGGTNVKIATAPS  146


 Score =   115 bits (289),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 78/114 (68%), Gaps = 1/114 (1%)
 Frame = +1

Query  157  DVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDC  333
            +VVVLT ENF + V  + +  LVEFYAPWCGHCK LAP YE++  +FK  + V+I  +D 
Sbjct  147  NVVVLTSENFNEVVLDETKDVLVEFYAPWCGHCKSLAPTYEKVATAFKLEEDVVIANLDA  206

Query  334  DEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTNVKV  495
            D++K +  KY VSG+PT+++FPKG+   ++Y G R  +    F+N ++GT+  V
Sbjct  207  DKYKDLAEKYDVSGFPTLKFFPKGNKAGEEYGGGRDLDDFVAFINEKSGTSRDV  260



>ref|XP_008797434.1| PREDICTED: protein disulfide isomerase-like 2-2 [Phoenix dactylifera]
Length=363

 Score =   241 bits (615),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 110/134 (82%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = +1

Query  109  TALAIVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGA  288
            T   I++L F +A ADDV+VLT+ NFEKEVGQDR ALVEFYAPWCGHCKKLAPEYE+LG+
Sbjct  12   TLTIILSLLFVSALADDVIVLTDANFEKEVGQDRGALVEFYAPWCGHCKKLAPEYEKLGS  71

Query  289  SFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVN  468
            SFKKAKS+LIGKVDCDEHKS+C KYGVSGYPTIQWFPKGSLEPKKYEG RTAEAL EFVN
Sbjct  72   SFKKAKSILIGKVDCDEHKSLCGKYGVSGYPTIQWFPKGSLEPKKYEGPRTAEALVEFVN  131

Query  469  TEAGTNVKVAAIPS  510
             E GTN+KVA IPS
Sbjct  132  NEGGTNIKVATIPS  145


 Score =   119 bits (299),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 78/116 (67%), Gaps = 1/116 (1%)
 Frame = +1

Query  142  AAFADDVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLI  318
            A     VVVLT +NF + V  + +  LVEFYAPWCGHCK LAP YE++  ++K  + V+I
Sbjct  141  ATIPSSVVVLTSDNFNQVVLDETKDVLVEFYAPWCGHCKNLAPTYEKVATAYKLEEDVVI  200

Query  319  GKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
              +D D++K +  KYGVSGYPT+++FPKG+   + Y+G R   A  +F+N + GT+
Sbjct  201  ANIDADKYKDLAEKYGVSGYPTLKFFPKGNKAGEDYDGGRDLGAFVKFINEKCGTS  256



>ref|XP_008797191.1| PREDICTED: probable protein disulfide-isomerase A6 [Phoenix dactylifera]
Length=363

 Score =   241 bits (615),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 114/145 (79%), Positives = 124/145 (86%), Gaps = 4/145 (3%)
 Frame = +1

Query  88   MSRSRICT----ALAIVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCK  255
            M RS+I       L +  LF SA   DDV+VLTE NFE+EVGQDR ALVEFYAPWCGHCK
Sbjct  1    MERSQISVLFFGTLTLALLFVSALADDDVIVLTEANFEEEVGQDRGALVEFYAPWCGHCK  60

Query  256  KLAPEYEQLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGA  435
            KLAPEYE+LG++FKKAKS+LIGKVDCDEHKS+CSKYGVSGYPTIQWFPKGSLEPKKYEG 
Sbjct  61   KLAPEYEKLGSNFKKAKSILIGKVDCDEHKSLCSKYGVSGYPTIQWFPKGSLEPKKYEGP  120

Query  436  RTAEALTEFVNTEAGTNVKVAAIPS  510
            RTAEAL EFVN E GTNVKVAA+PS
Sbjct  121  RTAEALAEFVNNEGGTNVKVAALPS  145


 Score =   120 bits (300),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 52/116 (45%), Positives = 79/116 (68%), Gaps = 1/116 (1%)
 Frame = +1

Query  142  AAFADDVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLI  318
            AA    VVVLT +NF++ V  + +  +VEFYAPWCGHCK LAP YE++  ++K  + V+I
Sbjct  141  AALPSSVVVLTPDNFDQVVLDETKDVIVEFYAPWCGHCKNLAPTYEKVATAYKLEEDVVI  200

Query  319  GKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
              +D D+++ +  KYGVSG+PT+++FPKG+   + Y+G R  +    F+N + GTN
Sbjct  201  ANIDADKYRDLAEKYGVSGFPTLKFFPKGNKAGEDYDGGRDLDDFVMFINEKCGTN  256



>gb|KHG01519.1| Protein disulfide-isomerase like 2-1 [Gossypium arboreum]
Length=358

 Score =   241 bits (614),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 116/141 (82%), Positives = 127/141 (90%), Gaps = 0/141 (0%)
 Frame = +1

Query  88   MSRSRICTALAIVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAP  267
            M +S+I  A  ++AL  ++A ADDVVVLTE+NFEKEVGQDR ALVEFYAPWCGHCKKLAP
Sbjct  1    MEKSQIWLAFGVLALLLASATADDVVVLTEDNFEKEVGQDRGALVEFYAPWCGHCKKLAP  60

Query  268  EYEQLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAE  447
            EYE+LG+SFKKAKSVLIGKVDCDEHKSVCSKYGV GYPTIQWFPKGSLEPKKYEG RTAE
Sbjct  61   EYEKLGSSFKKAKSVLIGKVDCDEHKSVCSKYGVQGYPTIQWFPKGSLEPKKYEGPRTAE  120

Query  448  ALTEFVNTEAGTNVKVAAIPS  510
            AL EFVNTE GTNVK+A +PS
Sbjct  121  ALAEFVNTEGGTNVKIATLPS  141


 Score =   117 bits (292),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 53/116 (46%), Positives = 75/116 (65%), Gaps = 1/116 (1%)
 Frame = +1

Query  142  AAFADDVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLI  318
            A     VVVL  +NF++ V  + +  LVEFYAPWCGHCK LAP YE++  +FK  + V+I
Sbjct  137  ATLPSSVVVLNADNFDEVVLDETKDVLVEFYAPWCGHCKNLAPTYEKVALAFKMEEDVVI  196

Query  319  GKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
              +D D+HK +  KYGVSGYPT+++FPK +   + Y G R  +    F+N + GT+
Sbjct  197  ANLDADKHKDLAEKYGVSGYPTLKFFPKNNKAGEDYNGGRGLDDFVSFINEKCGTS  252



>ref|XP_009381750.1| PREDICTED: protein disulfide isomerase-like 2-2 [Musa acuminata 
subsp. malaccensis]
Length=362

 Score =   240 bits (613),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 116/144 (81%), Positives = 126/144 (88%), Gaps = 3/144 (2%)
 Frame = +1

Query  88   MSRSRICTALA--IVALFFSAAFADD-VVVLTEENFEKEVGQDRAALVEFYAPWCGHCKK  258
            M RS+I  AL   I+AL F+   ADD V VLTE NFEKEVGQDR ALVEFYAPWCGHCKK
Sbjct  1    MERSQIWFALGTVILALLFACVLADDDVFVLTEANFEKEVGQDRGALVEFYAPWCGHCKK  60

Query  259  LAPEYEQLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGAR  438
            LAPEYE+LG+SFKKAKSVLIGKVDCDEHK +CSKYGVSGYPTIQWFPKGSLEPK+YEG R
Sbjct  61   LAPEYEKLGSSFKKAKSVLIGKVDCDEHKGLCSKYGVSGYPTIQWFPKGSLEPKRYEGPR  120

Query  439  TAEALTEFVNTEAGTNVKVAAIPS  510
            TAE+L EFVNTE GTNVK+A+IPS
Sbjct  121  TAESLAEFVNTEGGTNVKLASIPS  144


 Score =   113 bits (282),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 82/116 (71%), Gaps = 1/116 (1%)
 Frame = +1

Query  142  AAFADDVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLI  318
            A+   +VVVLT E F++ V  + +  LVEFYAPWCGHCK LAP YE++G+++K  + V+I
Sbjct  140  ASIPSNVVVLTSETFDQIVLDETKDVLVEFYAPWCGHCKHLAPTYEKVGSAYKLEEDVII  199

Query  319  GKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
              +D D+HK +  KYGVSGYPT+++FPKG+   + Y+G R  +   +F+N + GT+
Sbjct  200  ANLDADKHKDLAEKYGVSGYPTLKFFPKGNKGGEDYDGDRDLDDFVKFLNEKCGTS  255



>ref|XP_002282603.1| PREDICTED: probable protein disulfide-isomerase A6 [Vitis vinifera]
 emb|CBI39577.3| unnamed protein product [Vitis vinifera]
Length=357

 Score =   240 bits (612),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 114/135 (84%), Positives = 124/135 (92%), Gaps = 2/135 (1%)
 Frame = +1

Query  112  ALAIVALF--FSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLG  285
            AL  +AL   F+A  ADDVVVLTE NFE+E+G+DR+ALVEFYAPWCGHCKKLAPEYE+LG
Sbjct  6    ALQTLALLLVFTAVSADDVVVLTEANFEQEIGKDRSALVEFYAPWCGHCKKLAPEYEKLG  65

Query  286  ASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFV  465
            ASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGAR+AEAL EFV
Sbjct  66   ASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARSAEALAEFV  125

Query  466  NTEAGTNVKVAAIPS  510
            N E GTNVK+AA+PS
Sbjct  126  NNEGGTNVKIAAVPS  140


 Score =   119 bits (298),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 79/116 (68%), Gaps = 1/116 (1%)
 Frame = +1

Query  142  AAFADDVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLI  318
            AA   +VVVLT ++F++ V  + +  LVEFYAPWCGHCK LAP YE++  +FK    V+I
Sbjct  136  AAVPSNVVVLTSDSFDEVVLNEKKDVLVEFYAPWCGHCKSLAPIYEKVATAFKSEGDVVI  195

Query  319  GKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
              +D D++K +  KYGVSGYPT+++FPKG+   + Y+G R  E    F+N + GT+
Sbjct  196  ANLDADKYKDLAEKYGVSGYPTLKFFPKGNKAGEDYDGGRDLEDFVTFINDKCGTS  251



>emb|CAN70962.1| hypothetical protein VITISV_038267 [Vitis vinifera]
Length=357

 Score =   240 bits (612),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 114/135 (84%), Positives = 124/135 (92%), Gaps = 2/135 (1%)
 Frame = +1

Query  112  ALAIVALF--FSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLG  285
            AL  +AL   F+A  ADDVVVLTE NFE+E+G+DR+ALVEFYAPWCGHCKKLAPEYE+LG
Sbjct  6    ALQTLALLLVFTAVSADDVVVLTEANFEQEIGKDRSALVEFYAPWCGHCKKLAPEYEKLG  65

Query  286  ASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFV  465
            ASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGAR+AEAL EFV
Sbjct  66   ASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARSAEALAEFV  125

Query  466  NTEAGTNVKVAAIPS  510
            N E GTNVK+AA+PS
Sbjct  126  NNEGGTNVKIAAVPS  140


 Score =   119 bits (298),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 56/116 (48%), Positives = 79/116 (68%), Gaps = 1/116 (1%)
 Frame = +1

Query  142  AAFADDVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLI  318
            AA   +VVVLT ++F++ V  + +  LVEFYAPWCGHCK LAP YE++  +FK    V+I
Sbjct  136  AAVPSNVVVLTSDSFDEVVLNEKKDVLVEFYAPWCGHCKSLAPIYEKVATAFKSEGDVVI  195

Query  319  GKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
              +D D++K +  KYGVSGYPT+++FPKG+   + Y+G R  E    FVN + GT+
Sbjct  196  ANLDADKYKDLAEKYGVSGYPTLKFFPKGNKAGEDYDGGRDLEDFVTFVNEKCGTS  251



>ref|XP_010259370.1| PREDICTED: protein disulfide-isomerase like 2-1-like [Nelumbo 
nucifera]
Length=366

 Score =   239 bits (611),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 121/141 (86%), Gaps = 0/141 (0%)
 Frame = +1

Query  88   MSRSRICTALAIVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAP  267
            M+ S+I      +AL   + FADDV VLT +NFEKEVGQDR ALVEFYAPWCGHCKKLAP
Sbjct  1    MATSQIWFTFGTIALLIISVFADDVTVLTVKNFEKEVGQDRGALVEFYAPWCGHCKKLAP  60

Query  268  EYEQLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAE  447
            EYE+LG SFKKAK+VLIGKVDCDEHKS+CSKYGVSGYPTIQWFPKGSLEPKKYEG RTAE
Sbjct  61   EYEKLGTSFKKAKTVLIGKVDCDEHKSLCSKYGVSGYPTIQWFPKGSLEPKKYEGPRTAE  120

Query  448  ALTEFVNTEAGTNVKVAAIPS  510
            +L EFVNTE GTNVK+  +PS
Sbjct  121  SLAEFVNTEGGTNVKITTVPS  141


 Score =   114 bits (285),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 51/111 (46%), Positives = 76/111 (68%), Gaps = 1/111 (1%)
 Frame = +1

Query  157  DVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDC  333
            +VVVLT +NF + V  + +  LVEFYAPWCGHCK LAP YE++  ++K  + V+I  +D 
Sbjct  142  NVVVLTPDNFNEVVLDETKDVLVEFYAPWCGHCKHLAPTYEKVATAYKLEEDVVIANLDA  201

Query  334  DEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
            D++K +  KYGVSGYPT+++FPK +   + Y+G R  +    F+N + GT+
Sbjct  202  DKYKDLAEKYGVSGYPTLKFFPKSNKAGEDYDGGRELDDFVTFINEKCGTS  252



>ref|XP_008245854.1| PREDICTED: probable protein disulfide-isomerase A6 [Prunus mume]
Length=362

 Score =   239 bits (610),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 122/142 (86%), Gaps = 1/142 (1%)
 Frame = +1

Query  88   MSRSRICTALAIVALFFSAA-FADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLA  264
            M  S+   A   +AL F A+ FADDVVVLTEENFE  VGQDRAALVEFYAPWCGHCKKLA
Sbjct  1    MVSSKTFFAFGALALLFVASVFADDVVVLTEENFENHVGQDRAALVEFYAPWCGHCKKLA  60

Query  265  PEYEQLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTA  444
            PEYE+LG+SFKKAKS+LIGKVDCDEHK VC KYGVSGYPTIQWFPKGSLEPKKYEG RTA
Sbjct  61   PEYEKLGSSFKKAKSILIGKVDCDEHKGVCGKYGVSGYPTIQWFPKGSLEPKKYEGGRTA  120

Query  445  EALTEFVNTEAGTNVKVAAIPS  510
            EAL EFVN E GTNVK++A PS
Sbjct  121  EALAEFVNKEGGTNVKISAAPS  142


 Score =   119 bits (299),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 80/111 (72%), Gaps = 1/111 (1%)
 Frame = +1

Query  157  DVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDC  333
            +VVVLT++NF + V  + +  LVEFYAPWCGHCK LAP YE++  +FK  + V+I  +D 
Sbjct  143  NVVVLTQDNFNEVVLDETKDVLVEFYAPWCGHCKSLAPTYEKVATAFKLEEGVVIANLDA  202

Query  334  DEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
            D++K +  KYGVSG+PT+++FPK + E ++Y G R  E   +F+N ++GT+
Sbjct  203  DKYKDLAEKYGVSGFPTLKFFPKNNKEGEEYGGGRDLEDFVDFINEKSGTS  253



>ref|XP_002515309.1| protein disulfide isomerase, putative [Ricinus communis]
 gb|EEF47293.1| protein disulfide isomerase, putative [Ricinus communis]
Length=359

 Score =   239 bits (610),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 112/137 (82%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = +1

Query  100  RICTALAIVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQ  279
            +I  A+  VAL   +A ADDVVVLTE+NFEKEVGQDR AL+EFYAPWCGHCKKLAPEYE+
Sbjct  6    QIWIAICSVALLAVSASADDVVVLTEDNFEKEVGQDRGALIEFYAPWCGHCKKLAPEYEK  65

Query  280  LGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTE  459
            LG SFKKAKSVLIGKVDCDEHKS+CSKYGVSGYPT+QWFPKGSLEPKKYEG RTAE+L E
Sbjct  66   LGTSFKKAKSVLIGKVDCDEHKSLCSKYGVSGYPTVQWFPKGSLEPKKYEGPRTAESLAE  125

Query  460  FVNTEAGTNVKVAAIPS  510
            FVN+E GTNVK+AA PS
Sbjct  126  FVNSEGGTNVKIAAAPS  142


 Score =   121 bits (303),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/116 (48%), Positives = 79/116 (68%), Gaps = 1/116 (1%)
 Frame = +1

Query  142  AAFADDVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLI  318
            AA    VVVLT +NF + V  + +  LVEFYAPWCGHCK LAP YE++ A+FK    V+I
Sbjct  138  AAAPSSVVVLTADNFNEVVLDESKDVLVEFYAPWCGHCKNLAPTYEKVAAAFKSEDDVVI  197

Query  319  GKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
              +D D+++ +  KYGVSG+PT+++FPKG+   + YEG R  E    F+N ++GT+
Sbjct  198  ANLDADKYRDIGEKYGVSGFPTLKFFPKGNKAGEDYEGGRDLEDFVTFINEKSGTS  253



>ref|XP_008388480.1| PREDICTED: probable protein disulfide-isomerase A6 [Malus domestica]
Length=362

 Score =   239 bits (610),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 123/142 (87%), Gaps = 1/142 (1%)
 Frame = +1

Query  88   MSRSRICTALAIVALFF-SAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLA  264
            M+ S+   A   +AL F S+ +ADDVVVLTE+NFEKEVGQDRAALVEFYAPWCGHCKKLA
Sbjct  1    MASSKTLFAFGALALLFASSVYADDVVVLTEDNFEKEVGQDRAALVEFYAPWCGHCKKLA  60

Query  265  PEYEQLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTA  444
            PEYE+LG+SFKKAKS+LI KVDCDEHK VC KYGVSGYPTIQWFPKGSLEPKKYEG RTA
Sbjct  61   PEYEKLGSSFKKAKSILIAKVDCDEHKGVCGKYGVSGYPTIQWFPKGSLEPKKYEGGRTA  120

Query  445  EALTEFVNTEAGTNVKVAAIPS  510
            EAL EFVN E GTNVK+A  PS
Sbjct  121  EALAEFVNKEGGTNVKLAVAPS  142


 Score =   115 bits (289),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 77/110 (70%), Gaps = 1/110 (1%)
 Frame = +1

Query  160  VVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDCD  336
            VVVLT++NF + V  + +  LVEFYAPWCGHCK LAP YE++ ++F     V+I  +D D
Sbjct  144  VVVLTQDNFNEVVLDETKDVLVEFYAPWCGHCKSLAPTYEKVASAFNLEDGVVIANLDAD  203

Query  337  EHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
            ++K +  KYGVSG+PT+++FPK + E ++Y G R  E    F+N ++GT+
Sbjct  204  KYKDLAEKYGVSGFPTLKFFPKNNKEGEEYGGGRDLEDFVGFINEKSGTS  253



>ref|XP_010523977.1| PREDICTED: protein disulfide-isomerase like 2-1-like [Tarenaya 
hassleriana]
Length=360

 Score =   238 bits (608),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 117/141 (83%), Positives = 127/141 (90%), Gaps = 0/141 (0%)
 Frame = +1

Query  88   MSRSRICTALAIVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAP  267
            M  S+IC     +AL F +A ADDVVVLTE+NFEKEVGQDRAALVEFYAPWCGHCKKLAP
Sbjct  1    MVTSQICLGFGFLALLFVSAVADDVVVLTEDNFEKEVGQDRAALVEFYAPWCGHCKKLAP  60

Query  268  EYEQLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAE  447
            EYE+LGA+FKKAKSVLIGKVDCDE KS+CSKYGV+GYPTIQWFPKGSLEPKKYEGARTAE
Sbjct  61   EYEKLGATFKKAKSVLIGKVDCDEQKSICSKYGVAGYPTIQWFPKGSLEPKKYEGARTAE  120

Query  448  ALTEFVNTEAGTNVKVAAIPS  510
            AL EFVN E GTNVK+AA+PS
Sbjct  121  ALAEFVNNEGGTNVKIAAVPS  141


 Score =   121 bits (303),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 80/116 (69%), Gaps = 1/116 (1%)
 Frame = +1

Query  142  AAFADDVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLI  318
            AA   +VVVLT +NF++ V  +++  LVEFYAPWCGHCK LAP YE++   FK+ + V+I
Sbjct  137  AAVPSNVVVLTSDNFDEIVLDENKDVLVEFYAPWCGHCKSLAPTYEKVATVFKQEEDVVI  196

Query  319  GKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
              VD D+H+ +  KYGVSG+PT+++FPK +   + Y+G R  +    F+N + GT+
Sbjct  197  ANVDADKHRDLGEKYGVSGFPTLKFFPKNNKAGEDYDGGRDLDDFIGFINEKVGTS  252



>ref|XP_007145165.1| hypothetical protein PHAVU_007G215900g [Phaseolus vulgaris]
 gb|ESW17159.1| hypothetical protein PHAVU_007G215900g [Phaseolus vulgaris]
Length=363

 Score =   238 bits (608),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 113/138 (82%), Positives = 121/138 (88%), Gaps = 0/138 (0%)
 Frame = +1

Query  97   SRICTALAIVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYE  276
            SRI       AL F +A ADDVVVL+EENFEKEVG +R ALVEFYAPWCGHCKKLAPEYE
Sbjct  9    SRIALGAFAFALLFLSASADDVVVLSEENFEKEVGLERGALVEFYAPWCGHCKKLAPEYE  68

Query  277  QLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALT  456
            +LG+SFKKAKSVLIGKVDCDEHKS+CSKYGVSGYPTIQWFPKGSLEPKKYEG RTAE+L 
Sbjct  69   KLGSSFKKAKSVLIGKVDCDEHKSLCSKYGVSGYPTIQWFPKGSLEPKKYEGPRTAESLA  128

Query  457  EFVNTEAGTNVKVAAIPS  510
            EFVNTE GTNVK+A  PS
Sbjct  129  EFVNTETGTNVKIATAPS  146


 Score =   109 bits (272),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 76/111 (68%), Gaps = 1/111 (1%)
 Frame = +1

Query  157  DVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDC  333
            +VVVLT ENF + V  + +  LVEFYAPWCGHCK LAP YE++  +FK  ++V+I  +D 
Sbjct  147  NVVVLTPENFNEVVLDETKDVLVEFYAPWCGHCKSLAPTYEKVATAFKLEENVVIANLDA  206

Query  334  DEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
            D+++ +  KY VSG+PT+++FPK +   ++Y   R  +    F+N ++GT+
Sbjct  207  DKYRDLAEKYDVSGFPTLKFFPKSNKAGEEYGAGRDLDDFVAFINEKSGTS  257



>ref|XP_010095297.1| putative protein disulfide-isomerase A6 [Morus notabilis]
 gb|EXB59326.1| putative protein disulfide-isomerase A6 [Morus notabilis]
Length=360

 Score =   238 bits (606),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 108/133 (81%), Positives = 121/133 (91%), Gaps = 0/133 (0%)
 Frame = +1

Query  112  ALAIVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGAS  291
            A  I+A+  S+A ADDVVVL+E+NFEKEVGQDR ALVEFYAPWCGHCKKLAPEYE+LG +
Sbjct  11   AFGILAVLLSSAVADDVVVLSEDNFEKEVGQDRGALVEFYAPWCGHCKKLAPEYEKLGTT  70

Query  292  FKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNT  471
            FKK+KSVLIGKVDCDEHKS+CSKYGVSGYPTIQWF KGSLEPKKYEG RTAE+L EFVNT
Sbjct  71   FKKSKSVLIGKVDCDEHKSLCSKYGVSGYPTIQWFAKGSLEPKKYEGPRTAESLAEFVNT  130

Query  472  EAGTNVKVAAIPS  510
            E GTN+K+A +PS
Sbjct  131  EGGTNIKIATVPS  143


 Score =   111 bits (278),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 74/110 (67%), Gaps = 1/110 (1%)
 Frame = +1

Query  160  VVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDCD  336
            VV LT  NF++ V  + +  LVEFYAPWCGHCK LAP YE++  +FK  + V+I  +D D
Sbjct  145  VVELTAYNFDEVVLDETKDVLVEFYAPWCGHCKNLAPTYEKVATAFKLEEDVVIANLDAD  204

Query  337  EHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
            ++K    KY VSG+PT+++FPK +   ++YEG R  E    F+N ++GTN
Sbjct  205  KYKDPAEKYDVSGFPTLKFFPKNNKGGEEYEGGRDLEDFVNFINEKSGTN  254



>ref|XP_010931733.1| PREDICTED: probable protein disulfide-isomerase A6 [Elaeis guineensis]
Length=363

 Score =   238 bits (606),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 113/145 (78%), Positives = 124/145 (86%), Gaps = 4/145 (3%)
 Frame = +1

Query  88   MSRSRI----CTALAIVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCK  255
            M RS+I     T   I++L F +A ADDV VLTE NFE+EVGQDR ALVEFYAPWCGHCK
Sbjct  1    MERSQIWFSFGTLTLILSLLFVSAVADDVFVLTEANFEEEVGQDRGALVEFYAPWCGHCK  60

Query  256  KLAPEYEQLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGA  435
            KLAPEYE+LG+S+KKAKS+LIGKVDCDEHKS+CSKYGVSGYPTIQWF KGSLEPKKYEG 
Sbjct  61   KLAPEYEKLGSSYKKAKSILIGKVDCDEHKSLCSKYGVSGYPTIQWFAKGSLEPKKYEGP  120

Query  436  RTAEALTEFVNTEAGTNVKVAAIPS  510
            RTAEAL EFVN E GTNVKVA +PS
Sbjct  121  RTAEALAEFVNNEGGTNVKVATVPS  145


 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 77/110 (70%), Gaps = 1/110 (1%)
 Frame = +1

Query  160  VVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDCD  336
            VVVLT +NF + V  + +  LVEFYAPWCGHCK LAP YE++  ++K  + V+I  +D D
Sbjct  147  VVVLTADNFNEVVLDETKDVLVEFYAPWCGHCKNLAPTYEKVATAYKLEEDVVIANIDAD  206

Query  337  EHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
            ++K +  KYGVSGYPT+++FPKG+   + Y+G R  +   +F+N + GT+
Sbjct  207  KYKDLAEKYGVSGYPTLKFFPKGNKAGEDYDGGRDLDEFVKFINEKCGTS  256



>ref|XP_004163154.1| PREDICTED: protein disulfide isomerase-like 2-1-like [Cucumis 
sativus]
Length=154

 Score =   230 bits (586),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 123/141 (87%), Gaps = 0/141 (0%)
 Frame = +1

Query  88   MSRSRICTALAIVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAP  267
            M++ +I  A+A +ALF S+A ADDVVVLTE+NFEKEVGQD+ ALVEFYAPWCGHCKKLAP
Sbjct  1    MAKHQIWFAVAALALFLSSAVADDVVVLTEDNFEKEVGQDKGALVEFYAPWCGHCKKLAP  60

Query  268  EYEQLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAE  447
            EYE+LG SFKKAKSVLIGKVDCDEHK VCSKYGVSGYPTIQWFPKGSLEPKKYEG RTA+
Sbjct  61   EYEKLGGSFKKAKSVLIGKVDCDEHKGVCSKYGVSGYPTIQWFPKGSLEPKKYEGQRTAD  120

Query  448  ALTEFVNTEAGTNVKVAAIPS  510
            AL EFVN+E    + V ++ S
Sbjct  121  ALAEFVNSEGDDILHVNSVES  141



>gb|KJB49807.1| hypothetical protein B456_008G141100 [Gossypium raimondii]
Length=359

 Score =   237 bits (604),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 125/139 (90%), Gaps = 0/139 (0%)
 Frame = +1

Query  94   RSRICTALAIVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEY  273
            +S+IC A   +AL  ++A ADDVVVLTE NF+KEVGQDR AL+EFYAPWCGHCKKLAPEY
Sbjct  2    KSQICLAFGTLALLLASALADDVVVLTEANFDKEVGQDRGALIEFYAPWCGHCKKLAPEY  61

Query  274  EQLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEAL  453
            E+LGASFKKAKSVLIGKVDCDEHKS+CSKYGV GYPT+QWFPKGSLEPKKYEG RTAEAL
Sbjct  62   EKLGASFKKAKSVLIGKVDCDEHKSLCSKYGVQGYPTVQWFPKGSLEPKKYEGPRTAEAL  121

Query  454  TEFVNTEAGTNVKVAAIPS  510
             EFVNTE GTNVK+A +PS
Sbjct  122  AEFVNTEGGTNVKIATLPS  140


 Score =   114 bits (286),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 77/116 (66%), Gaps = 1/116 (1%)
 Frame = +1

Query  142  AAFADDVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLI  318
            A    +V VL  +NF++ V  + +  LVEFYAPWCGHCK LAP YE++  +FK  + V+I
Sbjct  136  ATLPSNVAVLNADNFDEIVLDETKDVLVEFYAPWCGHCKNLAPTYEKVATAFKSEEDVVI  195

Query  319  GKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
              +D D+++ +  KYG+SG+PT+++FPKG+   + Y+G R  +    F+N + GT+
Sbjct  196  ANLDADKYRDLAEKYGISGFPTLKFFPKGNKAGEDYDGGRDLDDFVSFINEKCGTS  251



>ref|XP_007051067.1| Thioredoxin family protein [Theobroma cacao]
 gb|EOX95224.1| Thioredoxin family protein [Theobroma cacao]
Length=358

 Score =   236 bits (602),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/141 (79%), Positives = 126/141 (89%), Gaps = 0/141 (0%)
 Frame = +1

Query  88   MSRSRICTALAIVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAP  267
            M +S+I  A   +AL  ++A ADDVVVLTEENF+KE+GQDR ALVEFYAPWCGHCKKLAP
Sbjct  1    MEKSQIWVAFGTLALLLASALADDVVVLTEENFDKELGQDRGALVEFYAPWCGHCKKLAP  60

Query  268  EYEQLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAE  447
            EYE+LGASFKKAKS+LIGKVDCDEHKS+CSKYGV GYPTIQWFPKGSLEPKKYEG RTAE
Sbjct  61   EYEKLGASFKKAKSILIGKVDCDEHKSLCSKYGVQGYPTIQWFPKGSLEPKKYEGPRTAE  120

Query  448  ALTEFVNTEAGTNVKVAAIPS  510
            +L E+VNTE GTNVK+A +PS
Sbjct  121  SLAEYVNTEGGTNVKIATLPS  141


 Score =   120 bits (300),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 53/116 (46%), Positives = 77/116 (66%), Gaps = 1/116 (1%)
 Frame = +1

Query  142  AAFADDVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLI  318
            A    +V VL  +NF++ V  + +  LVEFYAPWCGHCK LAP YE++  +FK  + V+I
Sbjct  137  ATLPSNVAVLNADNFDEIVLDESKDVLVEFYAPWCGHCKNLAPTYEKVATAFKMEEDVVI  196

Query  319  GKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
              +D D+HK +  KYGVSGYPT+++FPKG+   + Y G R  +    F+N ++GT+
Sbjct  197  ANLDADKHKDLAEKYGVSGYPTLKFFPKGNKAGEDYNGGRDLDDFVTFINEKSGTS  252



>gb|ABK93392.1| unknown [Populus trichocarpa]
Length=318

 Score =   234 bits (598),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 124/142 (87%), Gaps = 1/142 (1%)
 Frame = +1

Query  88   MSR-SRICTALAIVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLA  264
            M R ++I  A   +AL   +A ADDVVVLTE+NFEKEVGQD+ ALVEFYAPWCGHCKKLA
Sbjct  1    MERCNQIWYAFGTMALLAVSALADDVVVLTEDNFEKEVGQDKGALVEFYAPWCGHCKKLA  60

Query  265  PEYEQLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTA  444
            PEYE+LG+SFKKAK+VLIGKVDCDEHK VCSKYGVSGYPT+QWFPKGSLEPKKYEG RTA
Sbjct  61   PEYEKLGSSFKKAKAVLIGKVDCDEHKGVCSKYGVSGYPTLQWFPKGSLEPKKYEGPRTA  120

Query  445  EALTEFVNTEAGTNVKVAAIPS  510
            EAL EFVN E G+NVK+AA+ S
Sbjct  121  EALAEFVNNEGGSNVKIAAVTS  142


 Score =   118 bits (296),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 53/116 (46%), Positives = 80/116 (69%), Gaps = 1/116 (1%)
 Frame = +1

Query  142  AAFADDVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLI  318
            AA    VVVLT +NF   V  +++  LVEFYAPWCGHCK LAP YE++  +FK  + V++
Sbjct  138  AAVTSSVVVLTADNFNDIVLDENKDVLVEFYAPWCGHCKNLAPIYEKVATAFKSGEDVVV  197

Query  319  GKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
              ++ D+++ +  KYGVSG+PT+++FPKG+   ++YEG R  +    F+N +AGT+
Sbjct  198  ANLEADKYRDLAEKYGVSGFPTLKFFPKGNKAGEEYEGGRDLDDFVAFINEKAGTS  253



>gb|KDP23408.1| hypothetical protein JCGZ_23241 [Jatropha curcas]
Length=362

 Score =   236 bits (602),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 125/144 (87%), Gaps = 3/144 (2%)
 Frame = +1

Query  88   MSRSR---ICTALAIVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKK  258
            MS S+   + +A   + +F S+ FADDVVVLTE+NFEKEVGQDR ALVEFYAPWCGHCKK
Sbjct  1    MSGSKFILVISATVALLVFASSVFADDVVVLTEDNFEKEVGQDRGALVEFYAPWCGHCKK  60

Query  259  LAPEYEQLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGAR  438
            LAPEYE+L +SFKK KSVLIGKVDCDEH S+CSKYGV+GYP I+WFPKGSLEPKKYEGAR
Sbjct  61   LAPEYERLASSFKKTKSVLIGKVDCDEHTSICSKYGVAGYPAIKWFPKGSLEPKKYEGAR  120

Query  439  TAEALTEFVNTEAGTNVKVAAIPS  510
            TAE LTEFVN E GTNVK+AAIPS
Sbjct  121  TAEELTEFVNFEGGTNVKMAAIPS  144


 Score =   111 bits (278),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 51/116 (44%), Positives = 74/116 (64%), Gaps = 1/116 (1%)
 Frame = +1

Query  142  AAFADDVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLI  318
            AA   +VVVLT+ NF + V  + +  LVEFYAPWCGHCK+LA  YE +  +FK  + V+I
Sbjct  140  AAIPSNVVVLTQRNFNQVVLDETKDVLVEFYAPWCGHCKQLALTYENVATAFKLEEGVVI  199

Query  319  GKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
              +D D ++ +  KYGV+ YPT+++FPK +   + Y G R  +    F+N + GTN
Sbjct  200  ANLDADRYRDLAEKYGVNSYPTLKFFPKSNKGGEDYGGGRDLDDFVTFINDKCGTN  255



>gb|KJB49808.1| hypothetical protein B456_008G141100 [Gossypium raimondii]
Length=355

 Score =   236 bits (601),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 125/139 (90%), Gaps = 0/139 (0%)
 Frame = +1

Query  94   RSRICTALAIVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEY  273
            +S+IC A   +AL  ++A ADDVVVLTE NF+KEVGQDR AL+EFYAPWCGHCKKLAPEY
Sbjct  2    KSQICLAFGTLALLLASALADDVVVLTEANFDKEVGQDRGALIEFYAPWCGHCKKLAPEY  61

Query  274  EQLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEAL  453
            E+LGASFKKAKSVLIGKVDCDEHKS+CSKYGV GYPT+QWFPKGSLEPKKYEG RTAEAL
Sbjct  62   EKLGASFKKAKSVLIGKVDCDEHKSLCSKYGVQGYPTVQWFPKGSLEPKKYEGPRTAEAL  121

Query  454  TEFVNTEAGTNVKVAAIPS  510
             EFVNTE GTNVK+A +PS
Sbjct  122  AEFVNTEGGTNVKIATLPS  140


 Score =   114 bits (284),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 77/116 (66%), Gaps = 1/116 (1%)
 Frame = +1

Query  142  AAFADDVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLI  318
            A    +V VL  +NF++ V  + +  LVEFYAPWCGHCK LAP YE++  +FK  + V+I
Sbjct  136  ATLPSNVAVLNADNFDEIVLDETKDVLVEFYAPWCGHCKNLAPTYEKVATAFKSEEDVVI  195

Query  319  GKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
              +D D+++ +  KYG+SG+PT+++FPKG+   + Y+G R  +    F+N + GT+
Sbjct  196  ANLDADKYRDLAEKYGISGFPTLKFFPKGNKAGEDYDGGRDLDDFVSFINEKCGTS  251



>ref|XP_002512495.1| protein disulfide isomerase, putative [Ricinus communis]
 gb|EEF49947.1| protein disulfide isomerase, putative [Ricinus communis]
Length=362

 Score =   236 bits (601),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 108/136 (79%), Positives = 122/136 (90%), Gaps = 0/136 (0%)
 Frame = +1

Query  103  ICTALAIVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQL  282
            I  +LA + LF S+  ADDVVVLT++NFEKEVG+DR AL+EFYAPWCGHCKKLAPEYE L
Sbjct  10   ISISLAALLLFASSVLADDVVVLTDDNFEKEVGKDRGALIEFYAPWCGHCKKLAPEYEIL  69

Query  283  GASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEF  462
            G SF+KAKSVLIGKVDCD HKS+CSKY VSGYPTI+WFP+GSLEPKKYEGARTAEAL EF
Sbjct  70   GTSFRKAKSVLIGKVDCDAHKSLCSKYDVSGYPTIKWFPRGSLEPKKYEGARTAEALAEF  129

Query  463  VNTEAGTNVKVAAIPS  510
            VN+E GTNVK+AA+PS
Sbjct  130  VNSEGGTNVKIAAVPS  145


 Score =   114 bits (285),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 53/116 (46%), Positives = 76/116 (66%), Gaps = 1/116 (1%)
 Frame = +1

Query  142  AAFADDVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLI  318
            AA   +V+VLT +NF + V  + +  LVEFYAPWCGHCK+LAP YE++ A+FK  + V+I
Sbjct  141  AAVPSNVLVLTPDNFNQVVLDETKDVLVEFYAPWCGHCKQLAPTYEKVAAAFKLEEDVVI  200

Query  319  GKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
              VD D+++ +  KYGVSGYPT+++FPK +   + Y G R       F+N    T+
Sbjct  201  ANVDADKYRELAEKYGVSGYPTLKFFPKSNKAGEDYGGGRDLNDFVTFINDRCATS  256



>ref|XP_002302750.1| thioredoxin family protein [Populus trichocarpa]
 gb|EEE82023.1| thioredoxin family protein [Populus trichocarpa]
Length=359

 Score =   235 bits (600),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 124/142 (87%), Gaps = 1/142 (1%)
 Frame = +1

Query  88   MSR-SRICTALAIVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLA  264
            M R ++I  A   +AL   +A ADDVVVLTE+NFEKEVGQD+ ALVEFYAPWCGHCKKLA
Sbjct  1    MERCNQIWYAFGTMALLAVSALADDVVVLTEDNFEKEVGQDKGALVEFYAPWCGHCKKLA  60

Query  265  PEYEQLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTA  444
            PEYE+LG+SFKKAK+VLIGKVDCDEHK VCSKYGVSGYPT+QWFPKGSLEPKKYEG RTA
Sbjct  61   PEYEKLGSSFKKAKAVLIGKVDCDEHKGVCSKYGVSGYPTLQWFPKGSLEPKKYEGPRTA  120

Query  445  EALTEFVNTEAGTNVKVAAIPS  510
            EAL EFVN E G+NVK+AA+ S
Sbjct  121  EALAEFVNNEGGSNVKIAAVTS  142


 Score =   118 bits (295),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 53/116 (46%), Positives = 80/116 (69%), Gaps = 1/116 (1%)
 Frame = +1

Query  142  AAFADDVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLI  318
            AA    VVVLT +NF   V  +++  LVEFYAPWCGHCK LAP YE++  +FK  + V++
Sbjct  138  AAVTSSVVVLTADNFNDIVLDENKDVLVEFYAPWCGHCKNLAPIYEKVATAFKSEEDVVV  197

Query  319  GKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
              ++ D+++ +  KYGVSG+PT+++FPKG+   ++YEG R  +    F+N +AGT+
Sbjct  198  ANLEADKYRDLAEKYGVSGFPTLKFFPKGNKAGEEYEGGRDLDDFVAFINEKAGTS  253



>ref|XP_011041511.1| PREDICTED: probable protein disulfide-isomerase A6 [Populus euphratica]
Length=359

 Score =   235 bits (600),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 107/119 (90%), Positives = 115/119 (97%), Gaps = 0/119 (0%)
 Frame = +1

Query  154  DDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDC  333
            DDVVVLTE+NFEKEVGQDR ALVEFYAPWCGHCKKLAPEYE+LG+SF+KAKS+LIGKVDC
Sbjct  24   DDVVVLTEDNFEKEVGQDRGALVEFYAPWCGHCKKLAPEYEKLGSSFRKAKSILIGKVDC  83

Query  334  DEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTNVKVAAIPS  510
            DEHK VCSKYGVSGYPTIQWFPKGSLEPKKYEG RTAEALTE+VNTE GTNVK+AA+PS
Sbjct  84   DEHKGVCSKYGVSGYPTIQWFPKGSLEPKKYEGPRTAEALTEYVNTEGGTNVKIAAVPS  142


 Score =   122 bits (306),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 80/116 (69%), Gaps = 1/116 (1%)
 Frame = +1

Query  142  AAFADDVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLI  318
            AA   +VVVLT +NF   V  + +  LVEFYAPWCGHCK LAP YE++  +FK  + V++
Sbjct  138  AAVPSNVVVLTADNFNDIVLDETKDVLVEFYAPWCGHCKNLAPTYEKVATAFKSEEDVVV  197

Query  319  GKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
              +D D+HK +  KYGVSGYPT+++FPKG+   ++YEG R  +    F+N ++G++
Sbjct  198  ANLDADKHKDLAEKYGVSGYPTLKFFPKGNKAGEEYEGGRDLDDFVAFINEKSGSS  253



>ref|XP_006397941.1| hypothetical protein EUTSA_v10001515mg [Eutrema salsugineum]
 gb|ESQ39394.1| hypothetical protein EUTSA_v10001515mg [Eutrema salsugineum]
Length=361

 Score =   235 bits (600),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 107/140 (76%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = +1

Query  88   MSRSRICTALAIVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAP  267
            M++S+I    A +AL   +A ADDVVVLT+++FEKEVG+D+ ALVEFYAPWCGHCKKLAP
Sbjct  1    MAKSQIWFGFAFLALLLVSAIADDVVVLTDDSFEKEVGKDKGALVEFYAPWCGHCKKLAP  60

Query  268  EYEQLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAE  447
            EYE+LGASFKKAKSVLI KVDCDEHK+VC+KYGVSGYPTIQWFPKGSLEP+KYEG R AE
Sbjct  61   EYEKLGASFKKAKSVLIAKVDCDEHKTVCTKYGVSGYPTIQWFPKGSLEPQKYEGPRNAE  120

Query  448  ALTEFVNTEAGTNVKVAAIP  507
            AL E+VN E GTNVK+AA+P
Sbjct  121  ALAEYVNKEGGTNVKLAAVP  140


 Score =   122 bits (306),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 80/116 (69%), Gaps = 1/116 (1%)
 Frame = +1

Query  142  AAFADDVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLI  318
            AA   +VVVLT +NF++ V  +++  LVEFYAPWCGHCK LAP YE++   FK+ + V+I
Sbjct  137  AAVPQNVVVLTPDNFDEIVLNENKDVLVEFYAPWCGHCKSLAPTYEKVATVFKQEEGVVI  196

Query  319  GKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
              +D D HKS+  KYGVSG+PT+++FPK +   + Y+G R  +    F+N + GT+
Sbjct  197  ANLDADAHKSLGEKYGVSGFPTLKFFPKDNKAGQDYDGGRDLDDFVSFINEKVGTS  252



>ref|XP_010107024.1| Protein disulfide isomerase-like 2-2 [Morus notabilis]
 gb|EXC13336.1| Protein disulfide isomerase-like 2-2 [Morus notabilis]
Length=339

 Score =   234 bits (597),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 110/130 (85%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = +1

Query  121  IVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKK  300
            +  LF S+ FADDVVVLTE NF+KEVGQDR ALVEFYAPWCGHCKKLAPEYE+LGASFKK
Sbjct  13   LALLFVSSVFADDVVVLTESNFDKEVGQDRGALVEFYAPWCGHCKKLAPEYEKLGASFKK  72

Query  301  AKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAG  480
            AKSVLIGKVDCDEHKS+CSKYGVSGYPTIQWFPKG LEPKKYEGAR AEAL EFV  E  
Sbjct  73   AKSVLIGKVDCDEHKSLCSKYGVSGYPTIQWFPKGFLEPKKYEGARGAEALAEFVKKEGR  132

Query  481  TNVKVAAIPS  510
            TNVK+AA+PS
Sbjct  133  TNVKIAAVPS  142


 Score =   107 bits (268),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/116 (44%), Positives = 75/116 (65%), Gaps = 10/116 (9%)
 Frame = +1

Query  142  AAFADDVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLI  318
            AA   +VVVLT  +F++ V   ++  LVEFYAPWCGHCK LAP YE++ ++FK       
Sbjct  138  AAVPSNVVVLTPHDFDEIVLNNEKDVLVEFYAPWCGHCKSLAPIYEKVASAFK-------  190

Query  319  GKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
              +D D+H+ +  KYGVSGYPT+++FPK +   + Y+G R  +    F+N + GT+
Sbjct  191  --LDADKHRDLAEKYGVSGYPTLKFFPKSNKAREDYDGGRDLDDFVTFINEKCGTS  244



>ref|XP_011092133.1| PREDICTED: protein disulfide-isomerase like 2-1-like [Sesamum 
indicum]
Length=362

 Score =   234 bits (598),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 128/142 (90%), Gaps = 1/142 (1%)
 Frame = +1

Query  88   MSRSRICTALAIVALFFSAA-FADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLA  264
            MSRSRIC A+A +AL   A+ FADDVVVLTEENFEKEVG+DR ALVEFYAPWCGHCKKLA
Sbjct  1    MSRSRICLAVATLALLLVASAFADDVVVLTEENFEKEVGKDRGALVEFYAPWCGHCKKLA  60

Query  265  PEYEQLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTA  444
            PEYE+LGASFKKAKSVLIGKVDCDEHKS+CSKYGVSGYPTI+WFP GS+EPKKY+GARTA
Sbjct  61   PEYEKLGASFKKAKSVLIGKVDCDEHKSLCSKYGVSGYPTIKWFPAGSVEPKKYDGARTA  120

Query  445  EALTEFVNTEAGTNVKVAAIPS  510
            EAL  +VN E GTNVK+ A PS
Sbjct  121  EALAAYVNLEGGTNVKIVAPPS  142


 Score =   119 bits (298),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 77/111 (69%), Gaps = 1/111 (1%)
 Frame = +1

Query  157  DVVVLTEENFEKEVGQD-RAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDC  333
            +VVVLT +NF++ V  + +  LVEFYAPWCGHCK LAP YE++  +FK  + V+I  +D 
Sbjct  143  NVVVLTSDNFDEIVNDETKNVLVEFYAPWCGHCKNLAPTYEKVATAFKLEEDVVIANLDA  202

Query  334  DEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
            D++K +  K+GVSGYPT+++FPK +   + Y+G R  +    F+N + GTN
Sbjct  203  DQYKDLAEKHGVSGYPTLKFFPKNNKAGEDYDGGRDLDDFVTFINEKCGTN  253



>ref|XP_002320314.1| thioredoxin family protein [Populus trichocarpa]
 gb|EEE98629.1| thioredoxin family protein [Populus trichocarpa]
Length=358

 Score =   234 bits (596),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 106/119 (89%), Positives = 115/119 (97%), Gaps = 0/119 (0%)
 Frame = +1

Query  154  DDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDC  333
            DDVVVLTE+NFEKEVGQDR ALVEFYAPWCGHCKKLAPEYE+LG+SF+KAK+VLIGKVDC
Sbjct  24   DDVVVLTEDNFEKEVGQDRGALVEFYAPWCGHCKKLAPEYEKLGSSFRKAKTVLIGKVDC  83

Query  334  DEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTNVKVAAIPS  510
            DEHK VCSKYGVSGYPT+QWFPKGSLEPKKYEG RTAEALTE+VNTE GTNVK+AA+PS
Sbjct  84   DEHKGVCSKYGVSGYPTLQWFPKGSLEPKKYEGPRTAEALTEYVNTEGGTNVKIAAVPS  142


 Score =   119 bits (297),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 53/116 (46%), Positives = 78/116 (67%), Gaps = 1/116 (1%)
 Frame = +1

Query  142  AAFADDVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLI  318
            AA   +V VLT +NF   V  + +  LVEFYAPWCGHCK LAP YE++  +FK  + V++
Sbjct  138  AAVPSNVAVLTADNFNNIVLDETKDVLVEFYAPWCGHCKNLAPTYEKVATAFKSEEDVVV  197

Query  319  GKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
              +D D+HK +  KYGVSG+PT+++FPKG+   + YEG R  +    F+N ++G++
Sbjct  198  ANLDADKHKDLAEKYGVSGFPTLKFFPKGNKAGEDYEGGRDLDDFVAFINEKSGSS  253



>gb|KHN08651.1| Hypothetical protein glysoja_024560 [Glycine soja]
Length=400

 Score =   235 bits (599),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 114/141 (81%), Positives = 123/141 (87%), Gaps = 2/141 (1%)
 Frame = +1

Query  91   SRSRICTALAIVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPE  270
            SR     A A V LF SA+ ADDVVVL+E+NFEKEVGQDR ALVEFYAPWCGHCKKLAPE
Sbjct  8    SRRIALGAFAFVLLFLSAS-ADDVVVLSEDNFEKEVGQDRGALVEFYAPWCGHCKKLAPE  66

Query  271  YEQLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEA  450
            YE+LG+SFKKAKSVLIGKVDCDEHKS+CSKYGVSGYPTIQWFPKGSLEPKKYEG RTA++
Sbjct  67   YEKLGSSFKKAKSVLIGKVDCDEHKSLCSKYGVSGYPTIQWFPKGSLEPKKYEGPRTADS  126

Query  451  LTEFVNTEAGTN-VKVAAIPS  510
            L EFVNTE G N VK+A  PS
Sbjct  127  LAEFVNTEGGINTVKIATAPS  147


 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 53/149 (36%), Positives = 78/149 (52%), Gaps = 36/149 (24%)
 Frame = +1

Query  157  DVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAP----------------------  267
            +VVVLT ENF + V  + +  LVEFYAPWCGHCK LAP                      
Sbjct  148  NVVVLTSENFNEVVLDETKDVLVEFYAPWCGHCKSLAPISISLRISYYHFKVRVVNFCKT  207

Query  268  -------------EYEQLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGS  408
                          YE++  +FK  + V+I  +D D++K +  KY VSG+PT+++FPKG+
Sbjct  208  NNVKPDYALFFLQTYEKVATAFKLEEDVVIANLDADKYKDLAEKYDVSGFPTLKFFPKGN  267

Query  409  LEPKKYEGARTAEALTEFVNTEAGTNVKV  495
               ++Y G R  +    F+N ++GT+  V
Sbjct  268  KAGEEYGGGRDLDDFVAFINEKSGTSRDV  296



>ref|XP_010914538.1| PREDICTED: probable protein disulfide-isomerase A6 [Elaeis guineensis]
Length=363

 Score =   233 bits (595),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 113/145 (78%), Positives = 120/145 (83%), Gaps = 4/145 (3%)
 Frame = +1

Query  88   MSRSRICT----ALAIVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCK  255
            M RS+I      AL +  LF S    DDV VLTE NFEKEVGQD  ALVEFYAPWCGHCK
Sbjct  1    MERSQISVLFFGALTLAFLFVSTFADDDVFVLTETNFEKEVGQDSGALVEFYAPWCGHCK  60

Query  256  KLAPEYEQLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGA  435
            KLAPEYE+LG+SFKKAKS+LIGKVDCDEHKS+CSKYGVSGYPTIQWF KGSLEPKKYEG 
Sbjct  61   KLAPEYEKLGSSFKKAKSILIGKVDCDEHKSLCSKYGVSGYPTIQWFAKGSLEPKKYEGP  120

Query  436  RTAEALTEFVNTEAGTNVKVAAIPS  510
            RTAEAL EFVN E GTNVKVA +PS
Sbjct  121  RTAEALAEFVNNEGGTNVKVATLPS  145


 Score =   119 bits (299),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 51/116 (44%), Positives = 79/116 (68%), Gaps = 1/116 (1%)
 Frame = +1

Query  142  AAFADDVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLI  318
            A     V+VLT +NF++ V  + +  LVEFYAPWCGHCK LAP YE++  ++K  + V+I
Sbjct  141  ATLPSSVIVLTPDNFDQVVLDETKDVLVEFYAPWCGHCKNLAPTYEKVATAYKLEEDVVI  200

Query  319  GKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
              +D D+++ +  KYGVSG+PT+++FPKG+   + Y+G R  +   +F+N + GTN
Sbjct  201  ANIDADKYRDLAEKYGVSGFPTLKFFPKGNKAGEDYDGGRDLDDFVKFINEKCGTN  256



>gb|AFK44605.1| unknown [Lotus japonicus]
Length=360

 Score =   233 bits (594),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 113/143 (79%), Positives = 121/143 (85%), Gaps = 2/143 (1%)
 Frame = +1

Query  88   MSRSRICTALAI--VALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKL  261
            M + +I  A     VAL    A ADDVVVL+E+NFEKEVGQD+ ALVEFYAPWCGHCKKL
Sbjct  1    MEKYQIWIAFGALAVALLSVTASADDVVVLSEDNFEKEVGQDKGALVEFYAPWCGHCKKL  60

Query  262  APEYEQLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGART  441
            APEYE+LG SFKKAKSVLI KVDCDEHKSVCSKYGVSGYPT+QWFPKGSLEPKKYEG RT
Sbjct  61   APEYEKLGGSFKKAKSVLIAKVDCDEHKSVCSKYGVSGYPTLQWFPKGSLEPKKYEGPRT  120

Query  442  AEALTEFVNTEAGTNVKVAAIPS  510
            AEAL EFVNTE GTNVK+A  PS
Sbjct  121  AEALAEFVNTEGGTNVKIATAPS  143


 Score =   112 bits (281),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 76/110 (69%), Gaps = 1/110 (1%)
 Frame = +1

Query  160  VVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDCD  336
            VVVLT ENF + V  + +  LVEFYAPWCGHCK LAP YE++ A+FK    V+I  +D D
Sbjct  145  VVVLTAENFNEVVLDETKDVLVEFYAPWCGHCKSLAPTYEKVAAAFKLDGDVVIANLDAD  204

Query  337  EHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
            +++ +  KY VSG+PT+++FPKG+   ++Y G R  +    F+N ++GT+
Sbjct  205  KYRDLAEKYEVSGFPTLKFFPKGNKAGEEYGGGRDLDDFVAFINEKSGTS  254



>ref|NP_001236289.1| protein disufide isomerase-like protein precursor [Glycine max]
 dbj|BAD24713.1| protein disufide isomerase-like protein [Glycine max]
Length=364

 Score =   233 bits (594),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 113/137 (82%), Positives = 122/137 (89%), Gaps = 0/137 (0%)
 Frame = +1

Query  100  RICTALAIVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQ  279
            RI  A    AL F +A ADDVVVL+E+NFEKEVGQDR ALVEFYAPWCGHCKKLAPEYE+
Sbjct  10   RIALAAFAFALLFQSASADDVVVLSEDNFEKEVGQDRGALVEFYAPWCGHCKKLAPEYEK  69

Query  280  LGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTE  459
            LG+SFKKAKSVLIGKVDCDEHKS+CSKYGVSGYPTIQWFPKGSLE KKYEG RTAE+L E
Sbjct  70   LGSSFKKAKSVLIGKVDCDEHKSLCSKYGVSGYPTIQWFPKGSLEAKKYEGPRTAESLVE  129

Query  460  FVNTEAGTNVKVAAIPS  510
            FVNTE GTNVK+A +PS
Sbjct  130  FVNTEGGTNVKIATVPS  146


 Score =   110 bits (276),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 54/117 (46%), Positives = 76/117 (65%), Gaps = 3/117 (3%)
 Frame = +1

Query  142  AAFADDVVVLTEENFEKEVGQDRA--ALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVL  315
            A    +VVVLT ENF  EV  D A   LVEFYAPWCGHCK LAP YE++  +FK  + V+
Sbjct  142  ATVPSNVVVLTPENF-NEVVLDEAKDVLVEFYAPWCGHCKSLAPTYEKVATAFKLEEDVV  200

Query  316  IGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
            I  +D D+++ +  KY VSG+PT+++FPKG+   + Y G R  +    F+N ++G +
Sbjct  201  IANLDADKYRDLAEKYDVSGFPTLKFFPKGNKAGEDYGGGRDLDDFVAFINEKSGAS  257



>gb|KHN30654.1| Hypothetical protein glysoja_037686 [Glycine soja]
Length=364

 Score =   233 bits (594),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 113/137 (82%), Positives = 122/137 (89%), Gaps = 0/137 (0%)
 Frame = +1

Query  100  RICTALAIVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQ  279
            RI  A    AL F +A ADDVVVL+E+NFEKEVGQDR ALVEFYAPWCGHCKKLAPEYE+
Sbjct  10   RIALAAFAFALLFQSASADDVVVLSEDNFEKEVGQDRGALVEFYAPWCGHCKKLAPEYEK  69

Query  280  LGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTE  459
            LG+SFKKAKSVLIGKVDCDEHKS+CSKYGVSGYPTIQWFPKGSLE KKYEG RTAE+L E
Sbjct  70   LGSSFKKAKSVLIGKVDCDEHKSLCSKYGVSGYPTIQWFPKGSLEAKKYEGPRTAESLVE  129

Query  460  FVNTEAGTNVKVAAIPS  510
            FVNTE GTNVK+A +PS
Sbjct  130  FVNTEGGTNVKIATVPS  146


 Score =   111 bits (277),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 54/117 (46%), Positives = 77/117 (66%), Gaps = 3/117 (3%)
 Frame = +1

Query  142  AAFADDVVVLTEENFEKEVGQDRA--ALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVL  315
            A    +VVVLT ENF  EV  D A   LVEFYAPWCGHCK LAP YE++  +FK  + V+
Sbjct  142  ATVPSNVVVLTPENF-NEVVLDEAKDVLVEFYAPWCGHCKSLAPTYEKVATAFKLEEDVV  200

Query  316  IGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
            I  +D D+++ +  KY VSG+PT+++FPKG+   ++Y G R  +    F+N ++G +
Sbjct  201  IANLDADKYRDLAEKYDVSGFPTLKFFPKGNKAGEEYGGGRDLDDFVAFINEKSGAS  257



>gb|EPS61150.1| protein disulfide-isomerase, partial [Genlisea aurea]
Length=342

 Score =   232 bits (592),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 113/143 (79%), Positives = 126/143 (88%), Gaps = 1/143 (1%)
 Frame = +1

Query  85   KMSRSRICTALAIVALF-FSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKL  261
            +MSRS IC   A +AL   ++A A++VVVLTE NFE EVG+DR ALVEFYAPWCGHCKKL
Sbjct  4    RMSRSWICLLFASLALLSIASASAEEVVVLTEANFEDEVGKDRGALVEFYAPWCGHCKKL  63

Query  262  APEYEQLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGART  441
            APEYE+LG SFKKAKSVLIGKVDCDEHK++C+KYGVSGYPTIQWFPKGSLEPKKYEGART
Sbjct  64   APEYEKLGGSFKKAKSVLIGKVDCDEHKALCTKYGVSGYPTIQWFPKGSLEPKKYEGART  123

Query  442  AEALTEFVNTEAGTNVKVAAIPS  510
            AEAL EFVN E GTNVK+A +PS
Sbjct  124  AEALAEFVNNEGGTNVKIATLPS  146


 Score =   123 bits (308),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 78/116 (67%), Gaps = 1/116 (1%)
 Frame = +1

Query  142  AAFADDVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLI  318
            A     VVVLT ENF + V  Q +  L+EFYAPWCGHCK LAP YE++  +FK+ + V+I
Sbjct  142  ATLPSSVVVLTPENFNEVVLDQTKDVLIEFYAPWCGHCKNLAPVYEKVATAFKQEEGVVI  201

Query  319  GKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
              VD D HK +  KYGVSG+PT+++FPK + + + Y+G R  +    F+N ++GT+
Sbjct  202  ANVDADNHKDLAEKYGVSGFPTLKFFPKNNKDGEDYDGGRDLDDFVTFINEKSGTS  257



>ref|XP_010674165.1| PREDICTED: protein disulfide-isomerase like 2-1 [Beta vulgaris 
subsp. vulgaris]
Length=358

 Score =   233 bits (593),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 106/141 (75%), Positives = 124/141 (88%), Gaps = 0/141 (0%)
 Frame = +1

Query  88   MSRSRICTALAIVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAP  267
            M++S+I     +  L  ++AFADDVVVLT+ENF+KEVGQDRAAL+EFYAPWCGHCKKLAP
Sbjct  1    MAKSQIWFVGTLALLLVASAFADDVVVLTQENFDKEVGQDRAALIEFYAPWCGHCKKLAP  60

Query  268  EYEQLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAE  447
            EYE+LGASFKKAKSVLIGKVDCD+ K +C K+ V GYPTI+WFPKGSLEPKKYEGARTAE
Sbjct  61   EYEKLGASFKKAKSVLIGKVDCDDQKDLCGKFEVQGYPTIKWFPKGSLEPKKYEGARTAE  120

Query  448  ALTEFVNTEAGTNVKVAAIPS  510
            AL E++NTE GTNVK++A PS
Sbjct  121  ALAEYINTEGGTNVKISAPPS  141


 Score =   113 bits (283),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 78/112 (70%), Gaps = 4/112 (4%)
 Frame = +1

Query  157  DVVVLTEENFEKEVGQDRA--ALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVD  330
            +VV+LT +NF+ EV  D++   LVEFYAPWCGHCK LAP YE++  +FK +  V+I  +D
Sbjct  142  NVVILTPDNFD-EVVMDKSKDVLVEFYAPWCGHCKSLAPIYEKVATAFK-SDDVVIASLD  199

Query  331  CDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
             D +K +  KYG+SG+PT+++FPK + + + YEG R  +    F+N + GT+
Sbjct  200  ADNYKDLAEKYGISGFPTLKFFPKNNKDGEDYEGGRDLDEFVSFINEKCGTS  251



>ref|NP_001236313.1| protein disulfide isomerase-like protein precursor [Glycine max]
 dbj|BAD24715.1| protein disulfide isomerase-like protein [Glycine max]
 dbj|BAJ33522.1| protein disulfide isomerase S-2 [Glycine max]
Length=362

 Score =   232 bits (592),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 111/137 (81%), Positives = 120/137 (88%), Gaps = 2/137 (1%)
 Frame = +1

Query  91   SRSRICTALAIVAL--FFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLA  264
            S++ +  A+A +AL  F S+A ADDVV LTEE FE EVG+DRAALVEFYAPWCGHCK+LA
Sbjct  4    SKTTMMLAIAAIALMMFLSSASADDVVALTEETFENEVGKDRAALVEFYAPWCGHCKRLA  63

Query  265  PEYEQLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTA  444
            PEYEQLGASFKK KSVLI KVDCDEHKSVC KYGVSGYPTIQWFPKGSLEPKKYEGARTA
Sbjct  64   PEYEQLGASFKKTKSVLIAKVDCDEHKSVCGKYGVSGYPTIQWFPKGSLEPKKYEGARTA  123

Query  445  EALTEFVNTEAGTNVKV  495
            EAL  FVN EAGTNVK+
Sbjct  124  EALAAFVNIEAGTNVKI  140


 Score =   109 bits (272),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 69/102 (68%), Gaps = 1/102 (1%)
 Frame = +1

Query  181  NFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDCDEHKSVCS  357
            NF++ V  + +  LVEFYAPWCGHCK LAP YE++ A+F   K V+I  VD D++K +  
Sbjct  154  NFDEVVFDETKDVLVEFYAPWCGHCKALAPIYEKVAAAFNLDKDVVIANVDADKYKDLAE  213

Query  358  KYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGT  483
            KYGVSGYPT+++FPK +   + Y+G R  +    F+N + GT
Sbjct  214  KYGVSGYPTLKFFPKSNKAGENYDGGRDLDDFVAFINEKCGT  255



>ref|XP_006644146.1| PREDICTED: protein disulfide isomerase-like 2-2-like [Oryza brachyantha]
Length=371

 Score =   233 bits (593),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 112/120 (93%), Gaps = 0/120 (0%)
 Frame = +1

Query  151  ADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVD  330
             DDVV LTE  FEKEVGQDR ALVEFYAPWCGHCKKLAPEYE+LGASFKKAKSVLI KVD
Sbjct  34   GDDVVALTESTFEKEVGQDRGALVEFYAPWCGHCKKLAPEYEKLGASFKKAKSVLIAKVD  93

Query  331  CDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTNVKVAAIPS  510
            C+EHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEG RTAEALTEFVNTE GTNVK+AA+PS
Sbjct  94   CNEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGQRTAEALTEFVNTEGGTNVKLAAVPS  153


 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/116 (46%), Positives = 77/116 (66%), Gaps = 1/116 (1%)
 Frame = +1

Query  142  AAFADDVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLI  318
            AA    VVVL ++NF+  V  + +  LVEFYAPWCGHCK LAP YE+L + +K  + V+I
Sbjct  149  AAVPSSVVVLGQDNFDSVVLDESKDVLVEFYAPWCGHCKHLAPTYEKLASVYKMDEGVVI  208

Query  319  GKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
              +D D+HK +  KY VSGYPT+++FPK +   + Y+G R  +   +F+N + GT+
Sbjct  209  ANLDADKHKDLAQKYEVSGYPTLKFFPKANKAGEDYDGGRELDDFVKFINEKCGTS  264



>ref|XP_009373270.1| PREDICTED: probable protein disulfide-isomerase A6 [Pyrus x bretschneideri]
Length=362

 Score =   232 bits (592),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 107/124 (86%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = +1

Query  139  SAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLI  318
            S+ +ADDVVVLTE+NFEKEVGQDRAALVEFYAPWCGHCKKLAPEYE+LG+SFKKAKS+LI
Sbjct  19   SSVYADDVVVLTEDNFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEKLGSSFKKAKSILI  78

Query  319  GKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTNVKVA  498
             KVDCDEHK VC KYGVSGYPTIQWFPKGSLEPKKYEG RTAEAL EFVN E GTNVK+A
Sbjct  79   AKVDCDEHKGVCGKYGVSGYPTIQWFPKGSLEPKKYEGGRTAEALAEFVNKEGGTNVKLA  138

Query  499  AIPS  510
              PS
Sbjct  139  VAPS  142


 Score =   111 bits (277),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 77/110 (70%), Gaps = 1/110 (1%)
 Frame = +1

Query  160  VVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDCD  336
            VVVLT++NF + V  + +  LVEFYAPW GHCK LAP YE++ ++F     V+I  +D D
Sbjct  144  VVVLTQDNFNEVVLDETKDVLVEFYAPWGGHCKSLAPTYEKVASAFNLEDGVVIANLDAD  203

Query  337  EHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
            ++K +  KYGVSG+PT+++FPK + E ++Y G R  +   +F+N ++GT+
Sbjct  204  KYKDLAEKYGVSGFPTLKFFPKNNKEGEEYGGGRDLDDFVKFINEKSGTS  253



>ref|XP_004977081.1| PREDICTED: protein disulfide isomerase-like 2-1-like [Setaria 
italica]
Length=366

 Score =   232 bits (592),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 108/119 (91%), Positives = 114/119 (96%), Gaps = 0/119 (0%)
 Frame = +1

Query  154  DDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDC  333
            DDVV LTE +FEKEVGQDRAALVEFYAPWCGHCKKLAPEYE+LGASFKKAKSVLI KVDC
Sbjct  30   DDVVALTEADFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEKLGASFKKAKSVLIAKVDC  89

Query  334  DEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTNVKVAAIPS  510
            DEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEG R+AEAL EFVN+EAGTNVK+AA+PS
Sbjct  90   DEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGQRSAEALAEFVNSEAGTNVKIAAVPS  148


 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 78/116 (67%), Gaps = 1/116 (1%)
 Frame = +1

Query  142  AAFADDVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLI  318
            AA    VVVLT E F+  V  + +  LVEFYAPWCGHCK LAP YE+L + FK+ + V+I
Sbjct  144  AAVPSSVVVLTPETFDSVVLDETKDVLVEFYAPWCGHCKHLAPVYEKLASVFKQDEGVVI  203

Query  319  GKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
              +D D+H  +  KYGVSG+PT+++FPKG+   + Y+G R  +   +F+N + GT+
Sbjct  204  ANLDADKHADLAEKYGVSGFPTLKFFPKGNKAGEDYDGGRDLDDFVKFINEKCGTS  259



>gb|KHN43339.1| Hypothetical protein glysoja_001922 [Glycine soja]
Length=362

 Score =   231 bits (589),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 110/137 (80%), Positives = 119/137 (87%), Gaps = 2/137 (1%)
 Frame = +1

Query  91   SRSRICTALAIVAL--FFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLA  264
            S++ +   +A +AL  F S+A ADDVV LTEE FE EVG+DRAALVEFYAPWCGHCK+LA
Sbjct  4    SKTTMMLGIAAIALMMFLSSASADDVVALTEETFENEVGKDRAALVEFYAPWCGHCKRLA  63

Query  265  PEYEQLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTA  444
            PEYEQLGASFKK KSVLI KVDCDEHKSVC KYGVSGYPTIQWFPKGSLEPKKYEGARTA
Sbjct  64   PEYEQLGASFKKTKSVLIAKVDCDEHKSVCGKYGVSGYPTIQWFPKGSLEPKKYEGARTA  123

Query  445  EALTEFVNTEAGTNVKV  495
            EAL  FVN EAGTNVK+
Sbjct  124  EALAAFVNIEAGTNVKI  140


 Score =   109 bits (272),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 69/102 (68%), Gaps = 1/102 (1%)
 Frame = +1

Query  181  NFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDCDEHKSVCS  357
            NF++ V  + +  LVEFYAPWCGHCK LAP YE++ A+F   K V+I  VD D++K +  
Sbjct  154  NFDEVVFDETKDVLVEFYAPWCGHCKALAPIYEKVAAAFNLDKDVVIANVDADKYKDLAE  213

Query  358  KYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGT  483
            KYGVSGYPT+++FPK +   + Y+G R  +    F+N + GT
Sbjct  214  KYGVSGYPTLKFFPKSNKAGENYDGGRDLDDFVAFINEKCGT  255



>ref|XP_007163329.1| hypothetical protein PHAVU_001G225600g [Phaseolus vulgaris]
 gb|ESW35323.1| hypothetical protein PHAVU_001G225600g [Phaseolus vulgaris]
Length=363

 Score =   231 bits (588),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 123/142 (87%), Gaps = 2/142 (1%)
 Frame = +1

Query  91   SRSRICTALAIVAL--FFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLA  264
            S +R+  A A + L  F S+A ADDVV LTE+ FEKEVGQDR ALVEFYAPWCGHCK+LA
Sbjct  4    STTRMVVAAAAITLMIFLSSASADDVVALTEDTFEKEVGQDRGALVEFYAPWCGHCKRLA  63

Query  265  PEYEQLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTA  444
            PEYEQLG +F+KAKSVLI KVDCDEHKSVC+KYGVSGYPTI+WFPKGSLEP+KYEGAR+A
Sbjct  64   PEYEQLGTTFRKAKSVLIAKVDCDEHKSVCTKYGVSGYPTIKWFPKGSLEPRKYEGARSA  123

Query  445  EALTEFVNTEAGTNVKVAAIPS  510
            EAL  FVN EAGT+VK+A+ PS
Sbjct  124  EALAAFVNVEAGTSVKIASAPS  145


 Score =   115 bits (289),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/109 (48%), Positives = 75/109 (69%), Gaps = 1/109 (1%)
 Frame = +1

Query  160  VVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDCD  336
            VV+L+ ENF++ V  + +  LVEFYAPWCGHCK LAP YE++ A+F   + V+I  VD D
Sbjct  147  VVILSPENFDEVVLDETKDVLVEFYAPWCGHCKALAPTYEKVAAAFNLDEEVVIANVDAD  206

Query  337  EHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGT  483
            ++K++  KYGVSGYPT+++FPK +   + Y G R  +    F+N + GT
Sbjct  207  KYKNLAEKYGVSGYPTLKFFPKSNKAGEDYNGGRDLDDFVAFINEKCGT  255



>ref|NP_001105759.1| protein disulfide isomerase7 precursor [Zea mays]
 gb|AAX09965.1| protein disulfide isomerase [Zea mays]
 gb|AFW77263.1| putative protein disulfide isomerase family protein [Zea mays]
Length=366

 Score =   231 bits (588),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 109/124 (88%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = +1

Query  139  SAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLI  318
            S A AD+VV LTE +FEKEVGQDR ALVEFYAPWCGHCKKLAPEYE+LGASFKKAKSVLI
Sbjct  25   SPATADEVVALTEADFEKEVGQDRGALVEFYAPWCGHCKKLAPEYEKLGASFKKAKSVLI  84

Query  319  GKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTNVKVA  498
             KVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEG R+ EAL EFVN+EAGTNVK+A
Sbjct  85   AKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGQRSVEALAEFVNSEAGTNVKIA  144

Query  499  AIPS  510
            AIPS
Sbjct  145  AIPS  148


 Score =   119 bits (299),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 77/116 (66%), Gaps = 1/116 (1%)
 Frame = +1

Query  142  AAFADDVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLI  318
            AA    VVVLT E F+  V  + +  LVEFYAPWCGHCK LAP YE+L + FK+   V+I
Sbjct  144  AAIPSSVVVLTSETFDSIVLDETKDVLVEFYAPWCGHCKHLAPIYEKLASVFKQDDGVVI  203

Query  319  GKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
              +D D+H  +  KYGVSG+PT+++FPKG+   + Y+G R  +   +F+N + GT+
Sbjct  204  ANIDADKHTDLAEKYGVSGFPTLKFFPKGNKAGEDYDGGRDLDDFVKFINEKCGTS  259



>ref|XP_004968698.1| PREDICTED: protein disulfide isomerase-like 2-2-like [Setaria 
italica]
Length=366

 Score =   231 bits (588),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 107/120 (89%), Positives = 110/120 (92%), Gaps = 0/120 (0%)
 Frame = +1

Query  151  ADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVD  330
             D+VV LTE  FEKEVGQDR ALVEFYAPWCGHCKKLAPEYE+LGASFKKAKSVLI KVD
Sbjct  29   GDEVVALTESTFEKEVGQDRGALVEFYAPWCGHCKKLAPEYERLGASFKKAKSVLIAKVD  88

Query  331  CDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTNVKVAAIPS  510
            CDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEG RTAEAL EFVNTE GTNVK+A IPS
Sbjct  89   CDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGQRTAEALAEFVNTEGGTNVKLATIPS  148


 Score =   117 bits (292),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 52/116 (45%), Positives = 78/116 (67%), Gaps = 1/116 (1%)
 Frame = +1

Query  142  AAFADDVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLI  318
            A     VVVLT E F+  V  + +  LVEFYAPWCGHCK LAP YE++ ++FK  + V+I
Sbjct  144  ATIPSSVVVLTPETFDSVVLDETKDVLVEFYAPWCGHCKSLAPTYEKVASAFKLDEGVVI  203

Query  319  GKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
              +D D+H+ +  KYGV+G+PT+++FPKG+   + Y+G R      +F+N ++GT+
Sbjct  204  ANLDADKHRDLAEKYGVTGFPTLKFFPKGNKAGEDYDGGRDLGDFVKFINEKSGTS  259



>ref|XP_002455594.1| hypothetical protein SORBIDRAFT_03g013630 [Sorghum bicolor]
 gb|EES00714.1| hypothetical protein SORBIDRAFT_03g013630 [Sorghum bicolor]
Length=368

 Score =   231 bits (588),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 106/120 (88%), Positives = 110/120 (92%), Gaps = 0/120 (0%)
 Frame = +1

Query  151  ADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVD  330
             DDVV LTE  FEKEVGQDR ALVEFYAPWCGHCKKLAPEYE+LGASFKKAKSVLI K+D
Sbjct  31   GDDVVALTESTFEKEVGQDRGALVEFYAPWCGHCKKLAPEYERLGASFKKAKSVLIAKID  90

Query  331  CDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTNVKVAAIPS  510
            CDEHKS+CSKYGVSGYPTIQWFPKGSLEPKKYEG RTAEAL EFVNTE GTNVK+A IPS
Sbjct  91   CDEHKSLCSKYGVSGYPTIQWFPKGSLEPKKYEGQRTAEALAEFVNTEGGTNVKLATIPS  150


 Score =   112 bits (281),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/116 (44%), Positives = 77/116 (66%), Gaps = 1/116 (1%)
 Frame = +1

Query  142  AAFADDVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLI  318
            A     VVVLT E F+  V  + +  LVEFYAPWCGHCK LAP YE++ + FK  + V+I
Sbjct  146  ATIPSSVVVLTPETFDSIVLDEAKDVLVEFYAPWCGHCKSLAPTYEKVASVFKLDEGVVI  205

Query  319  GKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
              +D D+++ +  KYGV+G+PT+++FPKG+   + Y+G R      +F+N ++GT+
Sbjct  206  ANLDADKYRDLAEKYGVTGFPTLKFFPKGNKAGEDYDGGRDLGDFVKFINEKSGTS  261



>gb|AEK80406.1| protein disulfide isomerase [Gossypium hirsutum]
Length=359

 Score =   229 bits (585),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 109/139 (78%), Positives = 122/139 (88%), Gaps = 0/139 (0%)
 Frame = +1

Query  94   RSRICTALAIVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEY  273
            +S+IC A   +AL  ++A ADDVVVLTE NF+KEVGQDR  L+EFYAPWCGHCKKLAPEY
Sbjct  2    KSQICLAFGTLALLLASALADDVVVLTEANFDKEVGQDRGVLIEFYAPWCGHCKKLAPEY  61

Query  274  EQLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEAL  453
            E+LGA+FKKAKSVLIGKVDCDEHKS+CSKYGV GYPT+QWFPKGSLEPKKYEG  TAEA 
Sbjct  62   EKLGATFKKAKSVLIGKVDCDEHKSLCSKYGVQGYPTVQWFPKGSLEPKKYEGTSTAEAP  121

Query  454  TEFVNTEAGTNVKVAAIPS  510
             EFVNTE GTNVK+A +PS
Sbjct  122  VEFVNTEGGTNVKIATLPS  140


 Score =   114 bits (286),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 77/116 (66%), Gaps = 1/116 (1%)
 Frame = +1

Query  142  AAFADDVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLI  318
            A    +V VL  +NF++ V  + +  LVEFYAPWCGHCK LAP YE++  +FK  + V+I
Sbjct  136  ATLPSNVAVLNADNFDEIVLDETKDVLVEFYAPWCGHCKNLAPTYEKVATAFKSEEDVVI  195

Query  319  GKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
              +D D+++ +  KYG+SG+PT+++FPKG+   + Y+G R  +    F+N + GT+
Sbjct  196  ANLDADKYRDLAEKYGISGFPTLKFFPKGNKAGEDYDGGRDLDDFVSFINEKCGTS  251



>dbj|BAG94075.1| unnamed protein product [Oryza sativa Japonica Group]
Length=367

 Score =   229 bits (585),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 106/119 (89%), Positives = 112/119 (94%), Gaps = 0/119 (0%)
 Frame = +1

Query  154  DDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDC  333
            DDV+ LTE  FEKEVGQDRAALVEFYAPWCGHCKKLAPEYE+LGASFKKAKSVLI KVDC
Sbjct  30   DDVLALTESTFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEKLGASFKKAKSVLIAKVDC  89

Query  334  DEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTNVKVAAIPS  510
            DEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEG RTAEAL E+VN+EA TNVK+AA+PS
Sbjct  90   DEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGQRTAEALAEYVNSEAATNVKIAAVPS  148


 Score =   117 bits (294),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 79/116 (68%), Gaps = 1/116 (1%)
 Frame = +1

Query  142  AAFADDVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLI  318
            AA    VVVLT E F+  V  + +  LVEFYAPWCGHCK LAP YE+L + +K+ + V+I
Sbjct  144  AAVPSSVVVLTPETFDSVVLDETKDVLVEFYAPWCGHCKHLAPIYEKLASVYKQDEGVVI  203

Query  319  GKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
              +D D+H ++  KYGVSG+PT+++FPKG+   + Y+G R  +   +F+N + GT+
Sbjct  204  ANLDADKHTALAEKYGVSGFPTLKFFPKGNKAGEDYDGGRELDDFVKFINEKCGTS  259



>ref|NP_001054696.1| Os05g0156300 [Oryza sativa Japonica Group]
 sp|Q75M08.2|PDI21_ORYSJ RecName: Full=Protein disulfide isomerase-like 2-1; Short=OsPDIL2-1; 
AltName: Full=Protein disulfide isomerase-like 4-1; 
Short=OsPDIL4-1; Flags: Precursor [Oryza sativa Japonica Group]
 gb|AAV32227.1| putative disulfide-isomerase [Oryza sativa Japonica Group]
 gb|AAS55771.2| putative disulfide-isomerase [Oryza sativa Japonica Group]
 dbj|BAF16610.1| Os05g0156300 [Oryza sativa Japonica Group]
 dbj|BAG96336.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG88199.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93817.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC78557.1| hypothetical protein OsI_18529 [Oryza sativa Indica Group]
 gb|EEE62391.1| hypothetical protein OsJ_17181 [Oryza sativa Japonica Group]
 gb|AFR23067.1| hypothetical protein [Oryza sativa]
 gb|AGW30403.1| disulfide-isomerase [Oryza sativa]
Length=366

 Score =   229 bits (585),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 106/119 (89%), Positives = 112/119 (94%), Gaps = 0/119 (0%)
 Frame = +1

Query  154  DDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDC  333
            DDV+ LTE  FEKEVGQDRAALVEFYAPWCGHCKKLAPEYE+LGASFKKAKSVLI KVDC
Sbjct  30   DDVLALTESTFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEKLGASFKKAKSVLIAKVDC  89

Query  334  DEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTNVKVAAIPS  510
            DEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEG RTAEAL E+VN+EA TNVK+AA+PS
Sbjct  90   DEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGQRTAEALAEYVNSEAATNVKIAAVPS  148


 Score =   117 bits (294),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 79/116 (68%), Gaps = 1/116 (1%)
 Frame = +1

Query  142  AAFADDVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLI  318
            AA    VVVLT E F+  V  + +  LVEFYAPWCGHCK LAP YE+L + +K+ + V+I
Sbjct  144  AAVPSSVVVLTPETFDSVVLDETKDVLVEFYAPWCGHCKHLAPIYEKLASVYKQDEGVVI  203

Query  319  GKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
              +D D+H ++  KYGVSG+PT+++FPKG+   + Y+G R  +   +F+N + GT+
Sbjct  204  ANLDADKHTALAEKYGVSGFPTLKFFPKGNKAGEDYDGGRELDDFVKFINEKCGTS  259



>gb|KJB09452.1| hypothetical protein B456_001G143100 [Gossypium raimondii]
Length=340

 Score =   228 bits (582),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 102/127 (80%), Positives = 117/127 (92%), Gaps = 0/127 (0%)
 Frame = +1

Query  130  LFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKS  309
            LF S+A ADDV+VLT++NF+KEVG DR ALVEFYAPWCGHCKKLAPE+E+LGA+FK+AKS
Sbjct  13   LFASSALADDVLVLTQQNFDKEVGHDRGALVEFYAPWCGHCKKLAPEFEKLGANFKRAKS  72

Query  310  VLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTNV  489
            VLIGKVDCDEHKSVC+KY V GYPTIQWFPKGSLEPKKY G RTAE+L+EFVN+E GTNV
Sbjct  73   VLIGKVDCDEHKSVCNKYDVQGYPTIQWFPKGSLEPKKYVGPRTAESLSEFVNSEGGTNV  132

Query  490  KVAAIPS  510
            K+A +PS
Sbjct  133  KIATLPS  139


 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 38/116 (33%), Positives = 59/116 (51%), Gaps = 17/116 (15%)
 Frame = +1

Query  142  AAFADDVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLI  318
            A     VVVL  +NF + V  + +  L+                YE++  +FK  + V+I
Sbjct  135  ATLPSSVVVLNADNFNEIVLDETKDVLI----------------YEKVATAFKLEEDVVI  178

Query  319  GKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
              +D D++  V  KYGVSGYPT++ FPKG+   + Y G R  +    F+N + GT+
Sbjct  179  SNLDVDKYTDVAEKYGVSGYPTLKLFPKGNKAGEDYRGERELDDFVSFINEKCGTS  234



>ref|XP_004495918.1| PREDICTED: probable protein disulfide-isomerase A6-like [Cicer 
arietinum]
Length=366

 Score =   229 bits (584),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 105/120 (88%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = +1

Query  151  ADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVD  330
            ADDVVVL+E+NFEKEVGQD+ ALVEFYAPWCGHCKKLAPEYE+LG SFKKAKSVLIGKVD
Sbjct  30   ADDVVVLSEDNFEKEVGQDKGALVEFYAPWCGHCKKLAPEYEKLGNSFKKAKSVLIGKVD  89

Query  331  CDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTNVKVAAIPS  510
            CDEHKS+CSKYGVSGYPTIQWFPKGSLEPKK+EG RTAE+L EFVNTE GTNVK+A  PS
Sbjct  90   CDEHKSLCSKYGVSGYPTIQWFPKGSLEPKKFEGPRTAESLAEFVNTEGGTNVKIATAPS  149


 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 74/110 (67%), Gaps = 1/110 (1%)
 Frame = +1

Query  160  VVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDCD  336
            VVVLT ENF + V  + +  LVEFYAPWCGHCK LAP YE++ ++FK    V+I  +D D
Sbjct  151  VVVLTPENFNEVVLDETKDVLVEFYAPWCGHCKSLAPVYEKVASAFKSEDDVVIANLDAD  210

Query  337  EHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
            +++ +  KY VSG+PT+++FPK +   + Y G R  +    F+N ++GT+
Sbjct  211  KYRDLAEKYDVSGFPTLKFFPKSNKAGEDYGGGRDLDDFVAFINEKSGTS  260



>ref|XP_003567659.1| PREDICTED: protein disulfide isomerase-like 2-2 [Brachypodium 
distachyon]
Length=367

 Score =   229 bits (583),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 106/120 (88%), Positives = 110/120 (92%), Gaps = 0/120 (0%)
 Frame = +1

Query  151  ADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVD  330
             DDVVVLTE  FEKEVGQDR ALVEFYAPWCGHCKKLAPEYE+LGASFKKA+SV+I KVD
Sbjct  30   GDDVVVLTEGTFEKEVGQDRGALVEFYAPWCGHCKKLAPEYEKLGASFKKARSVMIAKVD  89

Query  331  CDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTNVKVAAIPS  510
            CDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEG RTAEAL EFVN E GTNVK+A IPS
Sbjct  90   CDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGQRTAEALAEFVNKEGGTNVKLATIPS  149


 Score =   117 bits (292),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 77/116 (66%), Gaps = 1/116 (1%)
 Frame = +1

Query  142  AAFADDVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLI  318
            A     VVVLT E F+  V  + +  LVEFYAPWCGHCK LAP YE+L ++FK    V+I
Sbjct  145  ATIPSSVVVLTPETFDSVVLDETKDVLVEFYAPWCGHCKHLAPIYEKLASAFKLDDGVVI  204

Query  319  GKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
              VD D++K +  KYGV+G+PT+++FPKG+   + Y+G R     T+F+N + GT+
Sbjct  205  ANVDADKYKDLGEKYGVTGFPTLKFFPKGNKAGEDYDGGRDLGDFTKFINEKCGTS  260



>gb|KHG01186.1| putative disulfide-isomerase A6 [Gossypium arboreum]
Length=359

 Score =   228 bits (582),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 107/136 (79%), Positives = 117/136 (86%), Gaps = 1/136 (1%)
 Frame = +1

Query  88   MSRSRICTALAIVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAP  267
            M +S+I      ++L  ++A A DV+VLTEENF KEVGQD+ ALVEFYAPWCGHCKKLAP
Sbjct  1    MEKSQIWLTFGTLSLLVASAMAADVIVLTEENFHKEVGQDKGALVEFYAPWCGHCKKLAP  60

Query  268  EYEQLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAE  447
            EYE+LG SFKKAKSVLIGKVDCDEHKSVCSKYGV GYPTIQWFPKGSLEPKKYEG RTAE
Sbjct  61   EYEKLGESFKKAKSVLIGKVDCDEHKSVCSKYGVQGYPTIQWFPKGSLEPKKYEGPRTAE  120

Query  448  ALTEFVNTEAGTNVKV  495
            ALTEFVN   GTNVK+
Sbjct  121  ALTEFVN-RGGTNVKI  135


 Score =   108 bits (270),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 50/117 (43%), Positives = 73/117 (62%), Gaps = 1/117 (1%)
 Frame = +1

Query  139  SAAFADDVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVL  315
            S + A +VVVL  +NF+  V  + +  LVEFYAPWCGHCK LAP YE++   FK  + ++
Sbjct  137  SGSVASNVVVLNADNFDAVVLDKTKDVLVEFYAPWCGHCKSLAPTYEKVATVFKMEEDII  196

Query  316  IGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
            I  +D D+++ +  KY V G PT++ F KG+   + Y G R  + L  F+N + GTN
Sbjct  197  IADLDVDKNRGIGEKYEVGGLPTLKLFSKGNKAGEDYNGDRDLDDLVNFINEKCGTN  253



>ref|XP_010544982.1| PREDICTED: protein disulfide-isomerase like 2-1 [Tarenaya hassleriana]
Length=360

 Score =   228 bits (582),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 117/141 (83%), Positives = 127/141 (90%), Gaps = 0/141 (0%)
 Frame = +1

Query  88   MSRSRICTALAIVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAP  267
            M+RS+I     ++ L F +A ADDVVVLTE+NFEKEVGQDR ALVEFYAPWCGHCKKLAP
Sbjct  1    MARSQIYLGFGLLVLLFVSAVADDVVVLTEDNFEKEVGQDRGALVEFYAPWCGHCKKLAP  60

Query  268  EYEQLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAE  447
            EYE+LGASFKKAKSVLIGKVDCDEHKS+CSKYGVSGYPTIQWF KGSLEPKKYEGARTAE
Sbjct  61   EYEKLGASFKKAKSVLIGKVDCDEHKSICSKYGVSGYPTIQWFTKGSLEPKKYEGARTAE  120

Query  448  ALTEFVNTEAGTNVKVAAIPS  510
            AL EFVN E GTNVK+A+IPS
Sbjct  121  ALAEFVNNEGGTNVKIASIPS  141


 Score =   122 bits (305),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 80/114 (70%), Gaps = 1/114 (1%)
 Frame = +1

Query  142  AAFADDVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLI  318
            A+   +VVVLT +NF++ V  +++  LVEFYAPWCGHCK LAP YE++ A FK+ + V+I
Sbjct  137  ASIPSNVVVLTPDNFDEIVLDENKDVLVEFYAPWCGHCKSLAPTYEKVAAVFKQEEGVVI  196

Query  319  GKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAG  480
              VD D+H+ +  KYGVSG+PT+++FPK +   + Y+G R  +    F+N +AG
Sbjct  197  ANVDADKHRDLGEKYGVSGFPTLKFFPKNNKAGEDYDGGRDLDDFVSFINEKAG  250



>ref|XP_003521666.1| PREDICTED: probable protein disulfide-isomerase A6-like isoform 
1 [Glycine max]
 gb|KHN03939.1| Hypothetical protein glysoja_022625 [Glycine soja]
Length=362

 Score =   228 bits (581),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 109/138 (79%), Positives = 119/138 (86%), Gaps = 2/138 (1%)
 Frame = +1

Query  91   SRSRICTALAIVAL--FFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLA  264
            S++ +   +A +AL  F S+A ADDVV LTEE FE EVG+DRAALVEFYAPWCGHCK+LA
Sbjct  4    SKTTLMFGVAAIALMMFLSSASADDVVALTEETFENEVGKDRAALVEFYAPWCGHCKRLA  63

Query  265  PEYEQLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTA  444
            PEYEQLG +FKK KSVLI KVDCDE KSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTA
Sbjct  64   PEYEQLGTTFKKTKSVLIAKVDCDEQKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTA  123

Query  445  EALTEFVNTEAGTNVKVA  498
            EAL  FVN EAGTNVK+A
Sbjct  124  EALAAFVNIEAGTNVKIA  141


 Score =   108 bits (269),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 69/103 (67%), Gaps = 1/103 (1%)
 Frame = +1

Query  178  ENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDCDEHKSVC  354
            +NF++ V  + +  LVEFYAPWCGHCK LAP YE++ A+F   K V++  VD D++K + 
Sbjct  153  DNFDEVVLDETKDVLVEFYAPWCGHCKALAPIYEKVAAAFNLDKDVVMANVDADKYKDLA  212

Query  355  SKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGT  483
             KYGVSGYPT+++FPK +   + Y G R  +    F+N + GT
Sbjct  213  EKYGVSGYPTLKFFPKSNKAGEDYNGGRDLDDFVAFINEKCGT  255



>ref|XP_010507889.1| PREDICTED: protein disulfide-isomerase like 2-1 isoform X2 [Camelina 
sativa]
Length=327

 Score =   227 bits (578),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 124/142 (87%), Gaps = 2/142 (1%)
 Frame = +1

Query  88   MSRSRICTALAIVA--LFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKL  261
            M++S+I   +A+VA  +  SA   DDVVVLT+++F+KEVG+DR ALVEFYAPWCGHCKKL
Sbjct  1    MAKSQIWFGIAVVAALVLVSAVAEDDVVVLTDDSFDKEVGKDRGALVEFYAPWCGHCKKL  60

Query  262  APEYEQLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGART  441
            APEYE+LGASFKKAKS+LI KVDCDEHK+VC+KYGVSGYPTIQWFPKGSLEP+KYEG R 
Sbjct  61   APEYEKLGASFKKAKSILIAKVDCDEHKAVCTKYGVSGYPTIQWFPKGSLEPQKYEGPRN  120

Query  442  AEALTEFVNTEAGTNVKVAAIP  507
            AEAL E+VN E GTNVK+AA P
Sbjct  121  AEALAEYVNKEGGTNVKLAAAP  142


 Score =   120 bits (300),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 80/116 (69%), Gaps = 1/116 (1%)
 Frame = +1

Query  142  AAFADDVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLI  318
            AA   +VVVL+ +NF++ V  Q++  LVEFYAPWCGHCK LAP YE++   FK+ + V+I
Sbjct  139  AAAPQNVVVLSPDNFDEIVLDQNKDVLVEFYAPWCGHCKSLAPTYEKVATVFKQEEGVVI  198

Query  319  GKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
              +D D HK++  KYGVSG+PT+++FPK +     Y+G R  +    F+N ++GT+
Sbjct  199  ANLDADAHKALGEKYGVSGFPTLKFFPKDNKAGHDYDGGRDLDDFVSFINDKSGTS  254



>ref|XP_010507887.1| PREDICTED: protein disulfide-isomerase like 2-1 isoform X1 [Camelina 
sativa]
Length=363

 Score =   228 bits (581),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 124/142 (87%), Gaps = 2/142 (1%)
 Frame = +1

Query  88   MSRSRICTALAIVA--LFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKL  261
            M++S+I   +A+VA  +  SA   DDVVVLT+++F+KEVG+DR ALVEFYAPWCGHCKKL
Sbjct  1    MAKSQIWFGIAVVAALVLVSAVAEDDVVVLTDDSFDKEVGKDRGALVEFYAPWCGHCKKL  60

Query  262  APEYEQLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGART  441
            APEYE+LGASFKKAKS+LI KVDCDEHK+VC+KYGVSGYPTIQWFPKGSLEP+KYEG R 
Sbjct  61   APEYEKLGASFKKAKSILIAKVDCDEHKAVCTKYGVSGYPTIQWFPKGSLEPQKYEGPRN  120

Query  442  AEALTEFVNTEAGTNVKVAAIP  507
            AEAL E+VN E GTNVK+AA P
Sbjct  121  AEALAEYVNKEGGTNVKLAAAP  142


 Score =   120 bits (301),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 80/116 (69%), Gaps = 1/116 (1%)
 Frame = +1

Query  142  AAFADDVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLI  318
            AA   +VVVL+ +NF++ V  Q++  LVEFYAPWCGHCK LAP YE++   FK+ + V+I
Sbjct  139  AAAPQNVVVLSPDNFDEIVLDQNKDVLVEFYAPWCGHCKSLAPTYEKVATVFKQEEGVVI  198

Query  319  GKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
              +D D HK++  KYGVSG+PT+++FPK +     Y+G R  +    F+N ++GT+
Sbjct  199  ANLDADAHKALGEKYGVSGFPTLKFFPKDNKAGHDYDGGRDLDDFVSFINDKSGTS  254



>gb|ACU18972.1| unknown [Glycine max]
Length=362

 Score =   228 bits (581),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 109/138 (79%), Positives = 119/138 (86%), Gaps = 2/138 (1%)
 Frame = +1

Query  91   SRSRICTALAIVAL--FFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLA  264
            S++ +   +A +AL  F S+A ADDVV LTEE FE EVG+DRAALVEFYAPWCGHCK+LA
Sbjct  4    SKTTLMFGVAAIALMIFLSSASADDVVALTEETFENEVGKDRAALVEFYAPWCGHCKRLA  63

Query  265  PEYEQLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTA  444
            PEYEQLG +FKK KSVLI KVDCDE KSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTA
Sbjct  64   PEYEQLGTTFKKTKSVLIAKVDCDEQKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTA  123

Query  445  EALTEFVNTEAGTNVKVA  498
            EAL  FVN EAGTNVK+A
Sbjct  124  EALAAFVNIEAGTNVKIA  141


 Score =   108 bits (269),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 69/103 (67%), Gaps = 1/103 (1%)
 Frame = +1

Query  178  ENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDCDEHKSVC  354
            +NF++ V  + +  LVEFYAPWCGHCK LAP YE++ A+F   K V++  VD D++K + 
Sbjct  153  DNFDEVVLDETKDVLVEFYAPWCGHCKALAPIYEKVAAAFNLDKDVVMANVDADKYKDLA  212

Query  355  SKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGT  483
             KYGVSGYPT+++FPK +   + Y G R  +    F+N + GT
Sbjct  213  EKYGVSGYPTLKFFPKSNKAGEDYNGGRDLDDFVAFINEKCGT  255



>ref|XP_010518448.1| PREDICTED: protein disulfide-isomerase like 2-1-like isoform 
X2 [Camelina sativa]
Length=327

 Score =   226 bits (577),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 107/142 (75%), Positives = 123/142 (87%), Gaps = 2/142 (1%)
 Frame = +1

Query  88   MSRSRICTALAIVA--LFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKL  261
            M++S+I   +A+VA  +  SA   DDVVVLT+++F+KEVG+DR ALVEFYAPWCGHCKKL
Sbjct  1    MAKSQIWFGIAVVAALVLVSAVAEDDVVVLTDDSFDKEVGKDRGALVEFYAPWCGHCKKL  60

Query  262  APEYEQLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGART  441
            APEYE+LGASFKKAKSVLI KVDCDEHK+VC+KYGVSGYPTIQWFPKGSLEP KYEG R 
Sbjct  61   APEYEKLGASFKKAKSVLIAKVDCDEHKAVCTKYGVSGYPTIQWFPKGSLEPHKYEGPRN  120

Query  442  AEALTEFVNTEAGTNVKVAAIP  507
            AEAL E+VN E GTNVK+AA P
Sbjct  121  AEALAEYVNKEGGTNVKLAAAP  142


 Score =   121 bits (303),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 80/116 (69%), Gaps = 1/116 (1%)
 Frame = +1

Query  142  AAFADDVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLI  318
            AA   +VVVLT +NF++ V  Q++  LVEFYAPWCGHCK LAP YE++   FK+ + V+I
Sbjct  139  AAAPQNVVVLTPDNFDEIVLDQNKDVLVEFYAPWCGHCKSLAPTYEKVATVFKQEEGVVI  198

Query  319  GKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
              +D D HK++  KYGVSG+PT+++FPK +     Y+G R  +    F+N ++GT+
Sbjct  199  ANLDADAHKALGEKYGVSGFPTLKFFPKDNKAGHDYDGGRDLDDFVSFINDKSGTS  254



>gb|ACG38245.1| PDIL2-2 - Zea mays protein disulfide isomerase [Zea mays]
Length=367

 Score =   228 bits (581),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 105/120 (88%), Positives = 110/120 (92%), Gaps = 0/120 (0%)
 Frame = +1

Query  151  ADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVD  330
             DDVV LTE  FEKEVG+DR ALVEFYAPWCGHCKKLAPEYE+LGASFKKAKSVLI KVD
Sbjct  30   GDDVVALTESTFEKEVGKDRGALVEFYAPWCGHCKKLAPEYERLGASFKKAKSVLIAKVD  89

Query  331  CDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTNVKVAAIPS  510
            CDEHKS+CSKYGVSGYPTIQWFPKGSLEPKKYEG RTAEAL EF+NTE GTNVK+A IPS
Sbjct  90   CDEHKSLCSKYGVSGYPTIQWFPKGSLEPKKYEGQRTAEALAEFLNTEGGTNVKLATIPS  149


 Score =   115 bits (288),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/116 (46%), Positives = 77/116 (66%), Gaps = 1/116 (1%)
 Frame = +1

Query  142  AAFADDVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLI  318
            A     VVVLT E F+  V  + +  LVEFYAPWCGHCK LAP YE++ + FK  + V+I
Sbjct  145  ATIPSSVVVLTPETFDSIVLDETKDVLVEFYAPWCGHCKSLAPTYEKVASVFKLDEGVVI  204

Query  319  GKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
              +D D+H+ +  KYGVSG+PT+++FPKG+   + Y+G R      +F+N ++GT+
Sbjct  205  ANLDADKHRDLAEKYGVSGFPTLKFFPKGNKAGEDYDGDRDLVDFVKFINEKSGTS  260



>ref|XP_010518447.1| PREDICTED: protein disulfide-isomerase like 2-1-like isoform 
X1 [Camelina sativa]
Length=363

 Score =   228 bits (580),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 107/142 (75%), Positives = 123/142 (87%), Gaps = 2/142 (1%)
 Frame = +1

Query  88   MSRSRICTALAIVA--LFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKL  261
            M++S+I   +A+VA  +  SA   DDVVVLT+++F+KEVG+DR ALVEFYAPWCGHCKKL
Sbjct  1    MAKSQIWFGIAVVAALVLVSAVAEDDVVVLTDDSFDKEVGKDRGALVEFYAPWCGHCKKL  60

Query  262  APEYEQLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGART  441
            APEYE+LGASFKKAKSVLI KVDCDEHK+VC+KYGVSGYPTIQWFPKGSLEP KYEG R 
Sbjct  61   APEYEKLGASFKKAKSVLIAKVDCDEHKAVCTKYGVSGYPTIQWFPKGSLEPHKYEGPRN  120

Query  442  AEALTEFVNTEAGTNVKVAAIP  507
            AEAL E+VN E GTNVK+AA P
Sbjct  121  AEALAEYVNKEGGTNVKLAAAP  142


 Score =   121 bits (304),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 80/116 (69%), Gaps = 1/116 (1%)
 Frame = +1

Query  142  AAFADDVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLI  318
            AA   +VVVLT +NF++ V  Q++  LVEFYAPWCGHCK LAP YE++   FK+ + V+I
Sbjct  139  AAAPQNVVVLTPDNFDEIVLDQNKDVLVEFYAPWCGHCKSLAPTYEKVATVFKQEEGVVI  198

Query  319  GKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
              +D D HK++  KYGVSG+PT+++FPK +     Y+G R  +    F+N ++GT+
Sbjct  199  ANLDADAHKALGEKYGVSGFPTLKFFPKDNKAGHDYDGGRDLDDFVSFINDKSGTS  254



>ref|NP_001105758.1| protein disulfide isomerase6 precursor [Zea mays]
 gb|AAX09964.1| protein disulfide isomerase [Zea mays]
 gb|ACN28267.1| unknown [Zea mays]
 tpg|DAA54511.1| TPA: putative protein disulfide isomerase family protein [Zea 
mays]
Length=367

 Score =   228 bits (580),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 105/120 (88%), Positives = 110/120 (92%), Gaps = 0/120 (0%)
 Frame = +1

Query  151  ADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVD  330
             DDVV LTE  FEKEVG+DR ALVEFYAPWCGHCKKLAPEYE+LGASFKKAKSVLI KVD
Sbjct  30   GDDVVALTESTFEKEVGKDRGALVEFYAPWCGHCKKLAPEYERLGASFKKAKSVLIAKVD  89

Query  331  CDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTNVKVAAIPS  510
            CDEHKS+CSKYGVSGYPTIQWFPKGSLEPKKYEG RTAEAL EF+NTE GTNVK+A IPS
Sbjct  90   CDEHKSLCSKYGVSGYPTIQWFPKGSLEPKKYEGQRTAEALAEFLNTEGGTNVKLATIPS  149


 Score =   115 bits (288),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/116 (46%), Positives = 77/116 (66%), Gaps = 1/116 (1%)
 Frame = +1

Query  142  AAFADDVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLI  318
            A     VVVLT E F+  V  + +  LVEFYAPWCGHCK LAP YE++ + FK  + V+I
Sbjct  145  ATIPSSVVVLTPETFDSIVLDETKDVLVEFYAPWCGHCKSLAPTYEKVASVFKLDEGVVI  204

Query  319  GKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
              +D D+H+ +  KYGVSG+PT+++FPKG+   + Y+G R      +F+N ++GT+
Sbjct  205  ANLDADKHRDLAEKYGVSGFPTLKFFPKGNKAGEDYDGDRDLVDFVKFINEKSGTS  260



>gb|KJB09450.1| hypothetical protein B456_001G143100 [Gossypium raimondii]
Length=356

 Score =   227 bits (579),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 102/127 (80%), Positives = 117/127 (92%), Gaps = 0/127 (0%)
 Frame = +1

Query  130  LFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKS  309
            LF S+A ADDV+VLT++NF+KEVG DR ALVEFYAPWCGHCKKLAPE+E+LGA+FK+AKS
Sbjct  13   LFASSALADDVLVLTQQNFDKEVGHDRGALVEFYAPWCGHCKKLAPEFEKLGANFKRAKS  72

Query  310  VLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTNV  489
            VLIGKVDCDEHKSVC+KY V GYPTIQWFPKGSLEPKKY G RTAE+L+EFVN+E GTNV
Sbjct  73   VLIGKVDCDEHKSVCNKYDVQGYPTIQWFPKGSLEPKKYVGPRTAESLSEFVNSEGGTNV  132

Query  490  KVAAIPS  510
            K+A +PS
Sbjct  133  KIATLPS  139


 Score =   112 bits (281),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/116 (46%), Positives = 73/116 (63%), Gaps = 1/116 (1%)
 Frame = +1

Query  142  AAFADDVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLI  318
            A     VVVL  +NF + V  + +  LVEFYAPWCGHCK LAP YE++  +FK  + V+I
Sbjct  135  ATLPSSVVVLNADNFNEIVLDETKDVLVEFYAPWCGHCKSLAPIYEKVATAFKLEEDVVI  194

Query  319  GKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
              +D D++  V  KYGVSGYPT++ FPKG+   + Y G R  +    F+N + GT+
Sbjct  195  SNLDVDKYTDVAEKYGVSGYPTLKLFPKGNKAGEDYRGERELDDFVSFINEKCGTS  250



>tpg|DAA54512.1| TPA: putative protein disulfide isomerase family protein [Zea 
mays]
Length=368

 Score =   227 bits (579),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 105/120 (88%), Positives = 110/120 (92%), Gaps = 0/120 (0%)
 Frame = +1

Query  151  ADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVD  330
             DDVV LTE  FEKEVG+DR ALVEFYAPWCGHCKKLAPEYE+LGASFKKAKSVLI KVD
Sbjct  30   GDDVVALTESTFEKEVGKDRGALVEFYAPWCGHCKKLAPEYERLGASFKKAKSVLIAKVD  89

Query  331  CDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTNVKVAAIPS  510
            CDEHKS+CSKYGVSGYPTIQWFPKGSLEPKKYEG RTAEAL EF+NTE GTNVK+A IPS
Sbjct  90   CDEHKSLCSKYGVSGYPTIQWFPKGSLEPKKYEGQRTAEALAEFLNTEGGTNVKLATIPS  149


 Score =   115 bits (288),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/116 (46%), Positives = 77/116 (66%), Gaps = 1/116 (1%)
 Frame = +1

Query  142  AAFADDVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLI  318
            A     VVVLT E F+  V  + +  LVEFYAPWCGHCK LAP YE++ + FK  + V+I
Sbjct  145  ATIPSSVVVLTPETFDSIVLDETKDVLVEFYAPWCGHCKSLAPTYEKVASVFKLDEGVVI  204

Query  319  GKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
              +D D+H+ +  KYGVSG+PT+++FPKG+   + Y+G R      +F+N ++GT+
Sbjct  205  ANLDADKHRDLAEKYGVSGFPTLKFFPKGNKAGEDYDGDRDLVDFVKFINEKSGTS  260



>ref|NP_001042949.1| Os01g0339900 [Oryza sativa Japonica Group]
 sp|Q942L2.1|PDI22_ORYSJ RecName: Full=Protein disulfide isomerase-like 2-2; Short=OsPDIL2-2; 
AltName: Full=Protein disulfide isomerase-like 4-2; 
Short=OsPDIL4-2; Flags: Precursor [Oryza sativa Japonica Group]
 dbj|BAB67990.1| putative protein disulfide-isomerase TIGA precursor [Oryza sativa 
Japonica Group]
 dbj|BAF04863.1| Os01g0339900 [Oryza sativa Japonica Group]
 gb|EAY73875.1| hypothetical protein OsI_01755 [Oryza sativa Indica Group]
 gb|EAZ11750.1| hypothetical protein OsJ_01619 [Oryza sativa Japonica Group]
 dbj|BAG89827.1| unnamed protein product [Oryza sativa Japonica Group]
Length=371

 Score =   227 bits (579),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 106/120 (88%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = +1

Query  151  ADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVD  330
             DDVV LTE  FEKEVGQDR ALVEFYAPWCGHCKKLAPEYE+LGASFKKAKSV I KVD
Sbjct  34   GDDVVALTESTFEKEVGQDRGALVEFYAPWCGHCKKLAPEYEKLGASFKKAKSVFIAKVD  93

Query  331  CDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTNVKVAAIPS  510
            CDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEG R+AEAL EFVNTE GTNVK+A IPS
Sbjct  94   CDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGQRSAEALAEFVNTEGGTNVKLATIPS  153


 Score =   117 bits (293),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 77/116 (66%), Gaps = 1/116 (1%)
 Frame = +1

Query  142  AAFADDVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLI  318
            A     VVVL  +NF+  V  +++  LVEFYAPWCGHCK LAP YE+L + +K    V+I
Sbjct  149  ATIPSSVVVLGPDNFDSIVLDENKDILVEFYAPWCGHCKHLAPIYEKLASVYKLDDGVVI  208

Query  319  GKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
              +D D+HK +  KYGVSGYPT+++FPKG+   + Y+G R  +   +F+N + GT+
Sbjct  209  ANLDADKHKDLAEKYGVSGYPTLKFFPKGNKAGEDYDGGRELDDFVKFINEKCGTS  264



>gb|KJB41848.1| hypothetical protein B456_007G124200 [Gossypium raimondii]
Length=356

 Score =   226 bits (575),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 102/119 (86%), Positives = 112/119 (94%), Gaps = 0/119 (0%)
 Frame = +1

Query  154  DDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDC  333
            DDV+VLTEENFEKEVGQDR A+VEFYAPWCGHC+KLAPEYE+LGASFKKAKSVLIGKVDC
Sbjct  22   DDVLVLTEENFEKEVGQDRGAVVEFYAPWCGHCQKLAPEYEKLGASFKKAKSVLIGKVDC  81

Query  334  DEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTNVKVAAIPS  510
            DEHKSVC KYGV GYPTI+WFPKGSL+PK+YEG RTAE+L EFVNTE GTNVK+A +PS
Sbjct  82   DEHKSVCGKYGVEGYPTIKWFPKGSLDPKQYEGPRTAESLAEFVNTEGGTNVKIATLPS  140


 Score =   117 bits (292),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 51/116 (44%), Positives = 78/116 (67%), Gaps = 1/116 (1%)
 Frame = +1

Query  142  AAFADDVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLI  318
            A    +VVVL  +NF++ V  + +   VEFYAPWCG+CK LAP YE++  +FK  + V+I
Sbjct  136  ATLPSNVVVLNADNFDEVVLDETKNMFVEFYAPWCGYCKNLAPTYEKVATAFKMEEDVVI  195

Query  319  GKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
              +D D++K +  KYGVSGYPT+++FPKG+   + Y+G ++ +    F+N + GTN
Sbjct  196  ANIDTDKYKDLAEKYGVSGYPTLKFFPKGNKAGEDYDGGQSLDEFVAFINVQCGTN  251



>emb|CBG91907.1| putative PDI-like protein [Triticum aestivum]
 dbj|BAO79453.1| protein disulfide isomerase family protein 4-1 [Triticum aestivum]
Length=367

 Score =   226 bits (576),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 104/119 (87%), Positives = 111/119 (93%), Gaps = 0/119 (0%)
 Frame = +1

Query  154  DDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDC  333
            D+V+ LTE  FEKEVGQDR ALVEFYAPWCGHCKKLAPEYE+L ASFKKAKSVLI KVDC
Sbjct  31   DEVLALTESTFEKEVGQDRGALVEFYAPWCGHCKKLAPEYEKLAASFKKAKSVLIAKVDC  90

Query  334  DEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTNVKVAAIPS  510
            DEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEG RTAEALTE+VN+EA TNVK+AA+PS
Sbjct  91   DEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGQRTAEALTEYVNSEAATNVKIAAVPS  149


 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 81/116 (70%), Gaps = 1/116 (1%)
 Frame = +1

Query  142  AAFADDVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLI  318
            AA    VVVLTEE F+  V  + +  LVEFYAPWCGHCK LAP YE++ + FK+ + V+I
Sbjct  145  AAVPSSVVVLTEETFDSVVLDETKDVLVEFYAPWCGHCKSLAPIYEKVASVFKQDEGVVI  204

Query  319  GKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
              +D D++ S+  KYGVSG+PT+++FPKG+   ++YE  R  +   +F+N ++GT+
Sbjct  205  ANLDADKYTSLAEKYGVSGFPTLKFFPKGNKAGEEYESGRELDDFVKFINEKSGTS  260



>gb|KFK37496.1| hypothetical protein AALP_AA4G265000 [Arabis alpina]
Length=361

 Score =   226 bits (575),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 107/140 (76%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = +1

Query  88   MSRSRICTALAIVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAP  267
            M++S+I     ++AL   +  ADDVVVLT+++FEKEVG+D+ ALVEFYAPWCGHCKKLAP
Sbjct  1    MAKSQIWFGFVLLALLLVSVIADDVVVLTDDSFEKEVGKDKGALVEFYAPWCGHCKKLAP  60

Query  268  EYEQLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAE  447
            EYE+LGASFKKAKSVLI KVDCDEHKSVCSK+GVSGYPTIQWFPKGSLEP KYEGAR AE
Sbjct  61   EYEKLGASFKKAKSVLIAKVDCDEHKSVCSKFGVSGYPTIQWFPKGSLEPVKYEGARNAE  120

Query  448  ALTEFVNTEAGTNVKVAAIP  507
            AL E+VN E GTNVK+AA+P
Sbjct  121  ALAEYVNKEGGTNVKLAAVP  140


 Score =   122 bits (305),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 81/116 (70%), Gaps = 1/116 (1%)
 Frame = +1

Query  142  AAFADDVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLI  318
            AA   +VVVLT +NF++ V  Q++  LVEFYAPWCGHCK LAP YE++   FK+ + V+I
Sbjct  137  AAVPQNVVVLTPDNFDEIVLDQNKDVLVEFYAPWCGHCKSLAPTYEKVATVFKQEEGVVI  196

Query  319  GKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
              +D D HKS+  K+GVSG+PT+++FPK +   + Y+G R  +    F+N ++GT+
Sbjct  197  ANLDADAHKSLGEKFGVSGFPTLKFFPKDNKAGQDYDGGRDLDDFVTFINEKSGTS  252



>gb|KHG23389.1| Protein disulfide isomerase-like 2-2 [Gossypium arboreum]
Length=336

 Score =   225 bits (573),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 102/127 (80%), Positives = 116/127 (91%), Gaps = 0/127 (0%)
 Frame = +1

Query  130  LFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKS  309
            LF S+A ADDV+VLT++NF+KEVG DR ALVEFYAPWCGHCKKLAPE+E+LGA+FK+AKS
Sbjct  13   LFASSALADDVLVLTQQNFDKEVGHDRGALVEFYAPWCGHCKKLAPEFEKLGANFKRAKS  72

Query  310  VLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTNV  489
            VLIGKVDCDEHKSVC+KY V GYPTIQWFPKGSLEPKKY G RTAE+L EFVN+E GTNV
Sbjct  73   VLIGKVDCDEHKSVCTKYDVQGYPTIQWFPKGSLEPKKYVGPRTAESLAEFVNSEGGTNV  132

Query  490  KVAAIPS  510
            K+A +PS
Sbjct  133  KIANLPS  139


 Score =   114 bits (284),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 53/116 (46%), Positives = 74/116 (64%), Gaps = 1/116 (1%)
 Frame = +1

Query  142  AAFADDVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLI  318
            A     VVVL ++NF + V  + +  LVEFYAPWCGHCK L P YE+L  +FK  + V+I
Sbjct  135  ANLPSSVVVLNDDNFNEIVLDETKDVLVEFYAPWCGHCKSLTPIYEKLATAFKLEEDVVI  194

Query  319  GKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
              +D D++  V   YGVSGYPT+Q+FPKG+   + Y G R  + +  F+N + GT+
Sbjct  195  ANLDVDKYTDVAENYGVSGYPTLQFFPKGNKAGEDYHGERELDDVVSFINEKCGTS  250



>gb|EMT22855.1| Putative protein disulfide-isomerase A6 [Aegilops tauschii]
Length=365

 Score =   225 bits (574),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 104/120 (87%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = +1

Query  151  ADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVD  330
             D+V+ LTE  FEKEVGQDR ALVEFYAPWCGHCKKLAPEYE+L ASFKKAKSVLI KVD
Sbjct  30   GDEVLALTESTFEKEVGQDRGALVEFYAPWCGHCKKLAPEYEKLAASFKKAKSVLIAKVD  89

Query  331  CDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTNVKVAAIPS  510
            CDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEG RTAEALTE+VN+EA TNVK+AA+PS
Sbjct  90   CDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGQRTAEALTEYVNSEAATNVKIAAVPS  149


 Score =   118 bits (295),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 81/116 (70%), Gaps = 1/116 (1%)
 Frame = +1

Query  142  AAFADDVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLI  318
            AA    VVVLTEE F+  V  + +  LVEFYAPWCGHCK LAP YE++ + FK+ + V+I
Sbjct  145  AAVPSSVVVLTEETFDSVVLDETKDVLVEFYAPWCGHCKSLAPIYEKVASVFKQDEGVVI  204

Query  319  GKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
              +D D++ S+  KYGVSG+PT+++FPKG+   ++YE  R  +   +F+N ++GT+
Sbjct  205  ANLDADKYTSLAEKYGVSGFPTLKFFPKGNKAGEEYESGRELDDFVKFINEKSGTS  260



>emb|CBG91906.1| putative PDI-like protein [Triticum aestivum]
Length=367

 Score =   226 bits (575),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 103/119 (87%), Positives = 111/119 (93%), Gaps = 0/119 (0%)
 Frame = +1

Query  154  DDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDC  333
            D+V+ LTE  FEKEVGQDR ALVEFYAPWCGHCKKLAPEYE+L ASFKKAKSVLI KVDC
Sbjct  31   DEVLALTESTFEKEVGQDRGALVEFYAPWCGHCKKLAPEYEKLAASFKKAKSVLIAKVDC  90

Query  334  DEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTNVKVAAIPS  510
            DEHKSVCSKYG+SGYPTIQWFPKGSLEPKKYEG RTAEALTE+VN+EA TNVK+AA+PS
Sbjct  91   DEHKSVCSKYGISGYPTIQWFPKGSLEPKKYEGQRTAEALTEYVNSEAATNVKIAAVPS  149


 Score =   118 bits (295),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 81/116 (70%), Gaps = 1/116 (1%)
 Frame = +1

Query  142  AAFADDVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLI  318
            AA    VVVLTEE F+  V  + +  LVEFYAPWCGHCK LAP YE++ + FK+ + V+I
Sbjct  145  AAVPSSVVVLTEETFDSVVLDETKDVLVEFYAPWCGHCKSLAPIYEKVASVFKQDEGVVI  204

Query  319  GKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
              +D D++ S+  KYGVSG+PT+++FPKG+   ++YE  R  +   +F+N ++GT+
Sbjct  205  ANLDADKYTSLAEKYGVSGFPTLKFFPKGNKAGEEYESGRELDDFVKFINEKSGTS  260



>emb|CBG91898.1| putative PDI-like protein [Triticum aestivum]
Length=367

 Score =   225 bits (574),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 104/119 (87%), Positives = 111/119 (93%), Gaps = 0/119 (0%)
 Frame = +1

Query  154  DDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDC  333
            D+V+ LTE  FEKEVGQDR ALVEFYAPWCGHCKKLAPEYE+L ASFKKAKSVLI KVDC
Sbjct  31   DEVLALTESTFEKEVGQDRGALVEFYAPWCGHCKKLAPEYEKLAASFKKAKSVLIAKVDC  90

Query  334  DEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTNVKVAAIPS  510
            DEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEG RTAEALTE+VN+EA TNVK+AA+PS
Sbjct  91   DEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGQRTAEALTEYVNSEAATNVKIAAVPS  149


 Score =   116 bits (291),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 81/116 (70%), Gaps = 1/116 (1%)
 Frame = +1

Query  142  AAFADDVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLI  318
            AA    VVVLTEE F+  V  + +  LVEFYAPWCGHCK LAP YE++ + FK+ + V+I
Sbjct  145  AAVPSSVVVLTEETFDSVVLDETKDVLVEFYAPWCGHCKSLAPIYEKVASVFKQDEGVVI  204

Query  319  GKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
              +D D++ S+  +YGVSG+PT+++FPKG+   ++YE  R  +   +F+N ++GT+
Sbjct  205  ANLDADKYTSLAEEYGVSGFPTLKFFPKGNKAGEEYESGRELDDFVKFINEKSGTS  260



>ref|XP_002880305.1| hypothetical protein ARALYDRAFT_904222 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56564.1| hypothetical protein ARALYDRAFT_904222 [Arabidopsis lyrata subsp. 
lyrata]
Length=361

 Score =   225 bits (573),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 107/140 (76%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = +1

Query  88   MSRSRICTALAIVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAP  267
            M++S+I    A++AL   +A ADDVVVLT+++FEKEVG+D+ ALVEFYAPWCGHCKKLAP
Sbjct  1    MAKSQIWFGFALLALLLVSAIADDVVVLTDDSFEKEVGKDKGALVEFYAPWCGHCKKLAP  60

Query  268  EYEQLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAE  447
            EYE+LGASFKKAKSVLI KVDCDE KSVC+KYGVSGYPTIQWFPKGSLEP+KYEG R AE
Sbjct  61   EYEKLGASFKKAKSVLIAKVDCDEQKSVCTKYGVSGYPTIQWFPKGSLEPQKYEGPRNAE  120

Query  448  ALTEFVNTEAGTNVKVAAIP  507
            AL E+VN E GTNVK+AA+P
Sbjct  121  ALAEYVNKEGGTNVKLAAVP  140


 Score =   122 bits (305),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 80/116 (69%), Gaps = 1/116 (1%)
 Frame = +1

Query  142  AAFADDVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLI  318
            AA   +VVVLT +NF++ V  Q++  LVEFYAPWCGHCK LAP YE++   FK+ + V+I
Sbjct  137  AAVPQNVVVLTPDNFDEIVLDQNKDVLVEFYAPWCGHCKSLAPTYEKVATVFKQEEGVVI  196

Query  319  GKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
              +D D HK++  KYGVSG+PT+++FPK +     Y+G R  +    F+N ++GT+
Sbjct  197  ANLDADAHKALGEKYGVSGFPTLKFFPKDNKAGHDYDGGRDLDDFVSFINEKSGTS  252



>ref|XP_003568890.1| PREDICTED: protein disulfide isomerase-like 2-1 [Brachypodium 
distachyon]
Length=369

 Score =   224 bits (572),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 103/119 (87%), Positives = 111/119 (93%), Gaps = 0/119 (0%)
 Frame = +1

Query  154  DDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDC  333
            D+V+ LTE  F+KEVGQDRAALVEFYAPWCGHCKKLAPEYE+L ASFKKAKSVLI KVDC
Sbjct  33   DEVLALTESTFDKEVGQDRAALVEFYAPWCGHCKKLAPEYEKLAASFKKAKSVLIAKVDC  92

Query  334  DEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTNVKVAAIPS  510
            DEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEG RTAEAL E+VN+EA TNVK+AA+PS
Sbjct  93   DEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGQRTAEALAEYVNSEAATNVKIAAVPS  151


 Score =   124 bits (312),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 81/116 (70%), Gaps = 1/116 (1%)
 Frame = +1

Query  142  AAFADDVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLI  318
            AA    VVVLTEE F+  V  + +  LVEFYAPWCGHCK LAP YE++ ++FK    V+I
Sbjct  147  AAVPSSVVVLTEETFDSVVLDETKDVLVEFYAPWCGHCKSLAPVYEKVASAFKLEDGVVI  206

Query  319  GKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
              +D D+H S+  KYGVSG+PT+++FPKG+   ++YEG R  E   +F+N ++GT+
Sbjct  207  ANLDADKHTSLAEKYGVSGFPTLKFFPKGNKAGEEYEGGRDLEDFVKFINEKSGTS  262



>gb|KJB41847.1| hypothetical protein B456_007G124200 [Gossypium raimondii]
Length=282

 Score =   222 bits (565),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 102/119 (86%), Positives = 112/119 (94%), Gaps = 0/119 (0%)
 Frame = +1

Query  154  DDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDC  333
            DDV+VLTEENFEKEVGQDR A+VEFYAPWCGHC+KLAPEYE+LGASFKKAKSVLIGKVDC
Sbjct  22   DDVLVLTEENFEKEVGQDRGAVVEFYAPWCGHCQKLAPEYEKLGASFKKAKSVLIGKVDC  81

Query  334  DEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTNVKVAAIPS  510
            DEHKSVC KYGV GYPTI+WFPKGSL+PK+YEG RTAE+L EFVNTE GTNVK+A +PS
Sbjct  82   DEHKSVCGKYGVEGYPTIKWFPKGSLDPKQYEGPRTAESLAEFVNTEGGTNVKIATLPS  140


 Score =   115 bits (287),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/116 (44%), Positives = 78/116 (67%), Gaps = 1/116 (1%)
 Frame = +1

Query  142  AAFADDVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLI  318
            A    +VVVL  +NF++ V  + +   VEFYAPWCG+CK LAP YE++  +FK  + V+I
Sbjct  136  ATLPSNVVVLNADNFDEVVLDETKNMFVEFYAPWCGYCKNLAPTYEKVATAFKMEEDVVI  195

Query  319  GKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
              +D D++K +  KYGVSGYPT+++FPKG+   + Y+G ++ +    F+N + GTN
Sbjct  196  ANIDTDKYKDLAEKYGVSGYPTLKFFPKGNKAGEDYDGGQSLDEFVAFINVQCGTN  251



>ref|XP_002440636.1| hypothetical protein SORBIDRAFT_09g004370 [Sorghum bicolor]
 gb|EES19066.1| hypothetical protein SORBIDRAFT_09g004370 [Sorghum bicolor]
Length=367

 Score =   224 bits (572),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 103/119 (87%), Positives = 110/119 (92%), Gaps = 0/119 (0%)
 Frame = +1

Query  154  DDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDC  333
            DDVV LTE +FEKEVGQDR ALVEFYAPWCGHCKKLAPEYE+LGASFKKAKSVLI KVDC
Sbjct  31   DDVVALTEADFEKEVGQDRGALVEFYAPWCGHCKKLAPEYEKLGASFKKAKSVLIAKVDC  90

Query  334  DEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTNVKVAAIPS  510
            DEHK +CSKYGVSGYPTIQWFPKGSLEPKKYEG R+ EAL E+VN+EAGTNVK+ AIPS
Sbjct  91   DEHKGLCSKYGVSGYPTIQWFPKGSLEPKKYEGQRSVEALAEYVNSEAGTNVKIVAIPS  149


 Score =   117 bits (293),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 54/115 (47%), Positives = 76/115 (66%), Gaps = 1/115 (1%)
 Frame = +1

Query  145  AFADDVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIG  321
            A    VVVLT E F+  V  + +  LVEFYAPWCGHCK LAP YE+L + FK+   V+I 
Sbjct  146  AIPSSVVVLTPETFDSIVLDETKDVLVEFYAPWCGHCKHLAPVYEKLASVFKQDDGVVIA  205

Query  322  KVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
             +D D+H  +  KYGVSG+PT+++FPKG+   + Y+G R  +   +F+N + GT+
Sbjct  206  NLDADKHTDLAEKYGVSGFPTLKFFPKGNKAGEDYDGGRDLDDFVKFINEKCGTS  260



>ref|XP_003591444.1| Protein disulfide-isomerase [Medicago truncatula]
Length=372

 Score =   223 bits (568),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 119/138 (86%), Gaps = 0/138 (0%)
 Frame = +1

Query  97   SRICTALAIVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYE  276
            SRI  A    A+ F +  ADDVVVLTEENFEKEVGQD+ ALVEFYAPWCGHCKKLAPEYE
Sbjct  8    SRIALASFAFAILFVSVSADDVVVLTEENFEKEVGQDKGALVEFYAPWCGHCKKLAPEYE  67

Query  277  QLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALT  456
            +LG SFKKAKSVLI KVDCDEHK VCSKYGVSGYPTIQWFPKGSLEPKK+EG RTAE+L 
Sbjct  68   KLGNSFKKAKSVLIAKVDCDEHKGVCSKYGVSGYPTIQWFPKGSLEPKKFEGPRTAESLA  127

Query  457  EFVNTEAGTNVKVAAIPS  510
            EFVNTE GTNVK+A  PS
Sbjct  128  EFVNTEGGTNVKIATAPS  145


 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 73/110 (66%), Gaps = 1/110 (1%)
 Frame = +1

Query  160  VVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDCD  336
            VVVLT E F + V  + +  LVEFYAPWCGHCK LAP YE++ A FK    V+I  +D D
Sbjct  147  VVVLTPETFNEVVLDETKDVLVEFYAPWCGHCKSLAPIYEKVAAVFKSEDDVVIANLDAD  206

Query  337  EHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
            +++ +  KY VSG+PT+++FPKG+   + Y G R  +    F+N ++GT+
Sbjct  207  KYRDLAEKYDVSGFPTLKFFPKGNKAGEDYGGGRDLDDFVAFINEKSGTS  256



>gb|ACJ84687.1| unknown [Medicago truncatula]
 gb|AFK34984.1| unknown [Medicago truncatula]
Length=323

 Score =   221 bits (564),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 111/136 (82%), Positives = 118/136 (87%), Gaps = 0/136 (0%)
 Frame = +1

Query  97   SRICTALAIVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYE  276
            SRI  A    A+ F +  ADDVVVLTEENFEKEVGQD+ ALVEFYAPWCGHCKKLAPEYE
Sbjct  10   SRIALASFAFAILFVSVSADDVVVLTEENFEKEVGQDKGALVEFYAPWCGHCKKLAPEYE  69

Query  277  QLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALT  456
            +LG SFKKAKSVLI KVDCDEHK VCSKYGVSGYPTIQWFPKGSLEPKK+EG RTAE+L 
Sbjct  70   KLGNSFKKAKSVLIAKVDCDEHKGVCSKYGVSGYPTIQWFPKGSLEPKKFEGPRTAESLA  129

Query  457  EFVNTEAGTNVKVAAI  504
            EFVNTE GTNVK+A I
Sbjct  130  EFVNTEGGTNVKIAPI  145


 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 55/91 (60%), Gaps = 0/91 (0%)
 Frame = +1

Query  214  ALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQW  393
            +L EF     G   K+AP YE++ A FK    V+I  +D D+++ +  KY VSG+PT+++
Sbjct  127  SLAEFVNTEGGTNVKIAPIYEKVAAVFKSEDDVVIANLDADKYRDLAEKYDVSGFPTLKF  186

Query  394  FPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
            FPKG+   + Y G R  +    F+N ++GT+
Sbjct  187  FPKGNKAGEDYGGGRDLDDFVAFINEKSGTS  217



>gb|AES61695.2| protein disulfide isomerase-like protein [Medicago truncatula]
Length=364

 Score =   223 bits (567),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 119/138 (86%), Gaps = 0/138 (0%)
 Frame = +1

Query  97   SRICTALAIVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYE  276
            SRI  A    A+ F +  ADDVVVLTEENFEKEVGQD+ ALVEFYAPWCGHCKKLAPEYE
Sbjct  10   SRIALASFAFAILFVSVSADDVVVLTEENFEKEVGQDKGALVEFYAPWCGHCKKLAPEYE  69

Query  277  QLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALT  456
            +LG SFKKAKSVLI KVDCDEHK VCSKYGVSGYPTIQWFPKGSLEPKK+EG RTAE+L 
Sbjct  70   KLGNSFKKAKSVLIAKVDCDEHKGVCSKYGVSGYPTIQWFPKGSLEPKKFEGPRTAESLA  129

Query  457  EFVNTEAGTNVKVAAIPS  510
            EFVNTE GTNVK+A  PS
Sbjct  130  EFVNTEGGTNVKIATAPS  147


 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 73/110 (66%), Gaps = 1/110 (1%)
 Frame = +1

Query  160  VVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDCD  336
            VVVLT E F + V  + +  LVEFYAPWCGHCK LAP YE++ A FK    V+I  +D D
Sbjct  149  VVVLTPETFNEVVLDETKDVLVEFYAPWCGHCKSLAPIYEKVAAVFKSEDDVVIANLDAD  208

Query  337  EHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
            +++ +  KY VSG+PT+++FPKG+   + Y G R  +    F+N ++GT+
Sbjct  209  KYRDLAEKYDVSGFPTLKFFPKGNKAGEDYGGGRDLDDFVAFINEKSGTS  258



>ref|XP_004494539.1| PREDICTED: probable protein disulfide-isomerase A6-like isoform 
X2 [Cicer arietinum]
Length=343

 Score =   221 bits (564),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 99/136 (73%), Positives = 114/136 (84%), Gaps = 0/136 (0%)
 Frame = +1

Query  103  ICTALAIVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQL  282
            +C     +    S A A+DVVVLTE+NFEKEVG+DR ALVEFYAPWCGHCKKLAPEYE+L
Sbjct  11   LCVGSIAIIFLISTASANDVVVLTEDNFEKEVGKDRGALVEFYAPWCGHCKKLAPEYEKL  70

Query  283  GASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEF  462
              SFKK  ++LIGKVDCDEHKSVC+KYGVSGYPT+QWFPK SL+PKK+EGARTAEAL  F
Sbjct  71   ATSFKKTNTILIGKVDCDEHKSVCTKYGVSGYPTVQWFPKASLKPKKFEGARTAEALAAF  130

Query  463  VNTEAGTNVKVAAIPS  510
            VN E GTNVK+ ++PS
Sbjct  131  VNIEGGTNVKIPSVPS  146


 Score =   106 bits (264),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 72/110 (65%), Gaps = 1/110 (1%)
 Frame = +1

Query  160  VVVLTEENFEK-EVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDCD  336
            VVVLT +NF++  + + +  LVEFYAPWCGHCK LA  YE++ A F+  + V+I  VD D
Sbjct  148  VVVLTPDNFDEIALDETKDVLVEFYAPWCGHCKALAYTYEKIAAVFRMEEEVVIANVDAD  207

Query  337  EHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
            E+K +  KYGV+ YP++++FPK +   + + G    +    F+N + GTN
Sbjct  208  EYKDLAEKYGVAAYPSLKFFPKNNKAGEDFVGGHDLDDFVAFINEKCGTN  257



>ref|XP_004494538.1| PREDICTED: probable protein disulfide-isomerase A6-like isoform 
X1 [Cicer arietinum]
Length=363

 Score =   222 bits (565),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 99/136 (73%), Positives = 114/136 (84%), Gaps = 0/136 (0%)
 Frame = +1

Query  103  ICTALAIVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQL  282
            +C     +    S A A+DVVVLTE+NFEKEVG+DR ALVEFYAPWCGHCKKLAPEYE+L
Sbjct  11   LCVGSIAIIFLISTASANDVVVLTEDNFEKEVGKDRGALVEFYAPWCGHCKKLAPEYEKL  70

Query  283  GASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEF  462
              SFKK  ++LIGKVDCDEHKSVC+KYGVSGYPT+QWFPK SL+PKK+EGARTAEAL  F
Sbjct  71   ATSFKKTNTILIGKVDCDEHKSVCTKYGVSGYPTVQWFPKASLKPKKFEGARTAEALAAF  130

Query  463  VNTEAGTNVKVAAIPS  510
            VN E GTNVK+ ++PS
Sbjct  131  VNIEGGTNVKIPSVPS  146


 Score =   106 bits (264),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 72/110 (65%), Gaps = 1/110 (1%)
 Frame = +1

Query  160  VVVLTEENFEK-EVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDCD  336
            VVVLT +NF++  + + +  LVEFYAPWCGHCK LA  YE++ A F+  + V+I  VD D
Sbjct  148  VVVLTPDNFDEIALDETKDVLVEFYAPWCGHCKALAYTYEKIAAVFRMEEEVVIANVDAD  207

Query  337  EHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
            E+K +  KYGV+ YP++++FPK +   + + G    +    F+N + GTN
Sbjct  208  EYKDLAEKYGVAAYPSLKFFPKNNKAGEDFVGGHDLDDFVAFINEKCGTN  257



>gb|AAS68180.1| putative protein disulphide isomerase [Brassica napus var. napus]
Length=235

 Score =   217 bits (552),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 126/142 (89%), Gaps = 1/142 (1%)
 Frame = +1

Query  88   MSRSRICTALA-IVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLA  264
            M++S+I   LA +VAL   +A ADDVVVLT+++FEKEVG+DR ALVEFYAPWCGHCKKLA
Sbjct  1    MAKSQIWFGLASLVALLVVSAVADDVVVLTDDSFEKEVGKDRGALVEFYAPWCGHCKKLA  60

Query  265  PEYEQLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTA  444
            PEYE+LGASFKKAKS+LI KVDCDEHKSVC+KYGVSGYPTIQWFPKGSLEP+KYEGAR A
Sbjct  61   PEYEKLGASFKKAKSILIAKVDCDEHKSVCTKYGVSGYPTIQWFPKGSLEPQKYEGARNA  120

Query  445  EALTEFVNTEAGTNVKVAAIPS  510
            EAL E+VN E GTNVK+AA P 
Sbjct  121  EALAEYVNKEGGTNVKLAAAPQ  142


 Score =   105 bits (262),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/88 (56%), Positives = 66/88 (75%), Gaps = 1/88 (1%)
 Frame = +1

Query  142  AAFADDVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLI  318
            AA   +VVVLT +NF++ V  Q++  LVEFYAPWCGHCK LAP YE++   FK+ + V+I
Sbjct  138  AAAPQNVVVLTPDNFDEIVLDQNKDVLVEFYAPWCGHCKSLAPVYEKVATVFKQEEGVVI  197

Query  319  GKVDCDEHKSVCSKYGVSGYPTIQWFPK  402
              +D D HKS+  KYGVSG+PT+++FPK
Sbjct  198  ANLDADAHKSLGEKYGVSGFPTLKFFPK  225



>gb|KJB49809.1| hypothetical protein B456_008G141100 [Gossypium raimondii]
Length=345

 Score =   219 bits (559),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 116/131 (89%), Gaps = 0/131 (0%)
 Frame = +1

Query  94   RSRICTALAIVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEY  273
            +S+IC A   +AL  ++A ADDVVVLTE NF+KEVGQDR AL+EFYAPWCGHCKKLAPEY
Sbjct  2    KSQICLAFGTLALLLASALADDVVVLTEANFDKEVGQDRGALIEFYAPWCGHCKKLAPEY  61

Query  274  EQLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEAL  453
            E+LGASFKKAKSVLIGKVDCDEHKS+CSKYGV GYPT+QWFPKGSLEPKKYEG RTAEAL
Sbjct  62   EKLGASFKKAKSVLIGKVDCDEHKSLCSKYGVQGYPTVQWFPKGSLEPKKYEGPRTAEAL  121

Query  454  TEFVNTEAGTN  486
             EFVNTE   N
Sbjct  122  AEFVNTEGVLN  132


 Score =   112 bits (281),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 77/116 (66%), Gaps = 1/116 (1%)
 Frame = +1

Query  142  AAFADDVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLI  318
            A F +   VL  +NF++ V  + +  LVEFYAPWCGHCK LAP YE++  +FK  + V+I
Sbjct  122  AEFVNTEGVLNADNFDEIVLDETKDVLVEFYAPWCGHCKNLAPTYEKVATAFKSEEDVVI  181

Query  319  GKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
              +D D+++ +  KYG+SG+PT+++FPKG+   + Y+G R  +    F+N + GT+
Sbjct  182  ANLDADKYRDLAEKYGISGFPTLKFFPKGNKAGEDYDGGRDLDDFVSFINEKCGTS  237



>ref|XP_009133817.1| PREDICTED: protein disulfide-isomerase like 2-1 [Brassica rapa]
Length=362

 Score =   220 bits (560),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 126/141 (89%), Gaps = 1/141 (1%)
 Frame = +1

Query  88   MSRSRICTALA-IVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLA  264
            M++S+I   LA +VAL   +A ADDVVVLT+++FEKEVG+DR ALVEFYAPWCGHCKKLA
Sbjct  1    MAKSQIWFGLASLVALLVVSAVADDVVVLTDDSFEKEVGKDRGALVEFYAPWCGHCKKLA  60

Query  265  PEYEQLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTA  444
            PEYE+LGASFKKAKS+LI KVDCDEHKSVC+KYGVSGYPTIQWFPKGSLEP+KYEGAR A
Sbjct  61   PEYEKLGASFKKAKSILIAKVDCDEHKSVCTKYGVSGYPTIQWFPKGSLEPQKYEGARNA  120

Query  445  EALTEFVNTEAGTNVKVAAIP  507
            EAL E+VN E GTNVK+AA P
Sbjct  121  EALAEYVNKEGGTNVKLAAAP  141


 Score =   122 bits (306),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 57/116 (49%), Positives = 80/116 (69%), Gaps = 1/116 (1%)
 Frame = +1

Query  142  AAFADDVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLI  318
            AA   +VVVLT +NF++ V  Q++  LVEFYAPWCGHCK LAP YE++   FK+ + V+I
Sbjct  138  AAAPQNVVVLTPDNFDEIVLDQNKDVLVEFYAPWCGHCKSLAPVYEKVATVFKQEEGVVI  197

Query  319  GKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
              +D D HKS+  KYGVSG+PT+++FPK +   + YEG R  +    F+N + GT+
Sbjct  198  ANLDADAHKSLGEKYGVSGFPTLKFFPKDNKAGQDYEGGRDLDDFVGFINEKVGTS  253



>emb|CDX83326.1| BnaA03g21800D [Brassica napus]
Length=362

 Score =   220 bits (560),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 126/141 (89%), Gaps = 1/141 (1%)
 Frame = +1

Query  88   MSRSRICTALA-IVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLA  264
            M++S+I   LA +VAL   +A ADDVVVLT+++FEKEVG+DR ALVEFYAPWCGHCKKLA
Sbjct  1    MAKSQIWFGLASLVALLVVSAVADDVVVLTDDSFEKEVGKDRGALVEFYAPWCGHCKKLA  60

Query  265  PEYEQLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTA  444
            PEYE+LGASFKKAKS+LI KVDCDEHKSVC+KYGVSGYPTIQWFPKGSLEP+KYEGAR A
Sbjct  61   PEYEKLGASFKKAKSILIAKVDCDEHKSVCTKYGVSGYPTIQWFPKGSLEPQKYEGARNA  120

Query  445  EALTEFVNTEAGTNVKVAAIP  507
            EAL E+VN E GTNVK+AA P
Sbjct  121  EALAEYVNKEGGTNVKLAAAP  141


 Score =   122 bits (306),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 57/116 (49%), Positives = 80/116 (69%), Gaps = 1/116 (1%)
 Frame = +1

Query  142  AAFADDVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLI  318
            AA   +VVVLT +NF++ V  Q++  LVEFYAPWCGHCK LAP YE++   FK+ + V+I
Sbjct  138  AAAPQNVVVLTPDNFDEIVLDQNKDVLVEFYAPWCGHCKSLAPVYEKVATVFKQEEGVVI  197

Query  319  GKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
              +D D HKS+  KYGVSG+PT+++FPK +   + YEG R  +    F+N + GT+
Sbjct  198  ANLDADAHKSLGEKYGVSGFPTLKFFPKDNKAGQDYEGGRDLDDFVGFINEKVGTS  253



>ref|XP_006654072.1| PREDICTED: protein disulfide isomerase-like 2-1-like [Oryza brachyantha]
Length=364

 Score =   219 bits (559),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 101/114 (89%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = +1

Query  169  LTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDCDEHKS  348
            LTE  FEKEVGQDR ALVEFYAPWCGHCKKLAPEYE+LGASFKKAKSVLI KVDCDEHKS
Sbjct  33   LTESTFEKEVGQDRGALVEFYAPWCGHCKKLAPEYEKLGASFKKAKSVLIAKVDCDEHKS  92

Query  349  VCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTNVKVAAIPS  510
            +CSKYGVSGYPTIQWFPKGSLEPKKYEG RTAEAL E+VN+EA TNVK+AA+PS
Sbjct  93   LCSKYGVSGYPTIQWFPKGSLEPKKYEGQRTAEALAEYVNSEAATNVKIAAVPS  146


 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 78/116 (67%), Gaps = 1/116 (1%)
 Frame = +1

Query  142  AAFADDVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLI  318
            AA    VVVLT E F+  V  + +  LVEFYAPWCGHCK LAP YE++ + FK  + V+I
Sbjct  142  AAVPSSVVVLTPETFDSVVLDETKDVLVEFYAPWCGHCKHLAPIYEKVASVFKLDEGVVI  201

Query  319  GKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
              +D D+H ++  KYGVSG+PT+++FPKG+   + Y+G R  +   +F+N + GT+
Sbjct  202  ANLDADKHTALAEKYGVSGFPTLKFFPKGNKAGEDYDGGRDLDDFVKFINEKCGTS  257



>sp|P38661.1|PDIA6_MEDSA RecName: Full=Probable protein disulfide-isomerase A6; AltName: 
Full=P5; Flags: Precursor [Medicago sativa]
 gb|AAB46930.1| glucose-regulated endoplasmic reticular protein precursor [Medicago 
sativa]
Length=364

 Score =   219 bits (558),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 111/138 (80%), Positives = 118/138 (86%), Gaps = 0/138 (0%)
 Frame = +1

Query  97   SRICTALAIVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYE  276
            SRI  A    A+ F +  ADDVVVLTEENFEKEVG D+ ALVEFYAPWCGHCKKLAPEYE
Sbjct  10   SRIALASFAFAILFVSVSADDVVVLTEENFEKEVGHDKGALVEFYAPWCGHCKKLAPEYE  69

Query  277  QLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALT  456
            +L  SFKKAKSVLI KVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKK+EG RTAE+L 
Sbjct  70   KLPNSFKKAKSVLIAKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKFEGPRTAESLA  129

Query  457  EFVNTEAGTNVKVAAIPS  510
            EFVNTE GTNVK+A  PS
Sbjct  130  EFVNTEGGTNVKIATAPS  147


 Score =   108 bits (271),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 73/111 (66%), Gaps = 3/111 (3%)
 Frame = +1

Query  160  VVVLTEENFEKEVGQD--RAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDC  333
            VVVLT E F  EV  D  +  LVEFYAPWCGHCK LAP YE++ A FK    V+I  +D 
Sbjct  149  VVVLTPETF-NEVVLDGTKDVLVEFYAPWCGHCKSLAPIYEKVAAVFKSEDDVVIANLDA  207

Query  334  DEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
            D+++ +  KY VSG+PT+++FPKG+   + Y G R  +    F+N ++GT+
Sbjct  208  DKYRDLAEKYDVSGFPTLKFFPKGNKAGEDYGGGRDLDDFVAFINEKSGTS  258



>ref|XP_006855312.1| hypothetical protein AMTR_s00057p00073380 [Amborella trichopoda]
 gb|ERN16779.1| hypothetical protein AMTR_s00057p00073380 [Amborella trichopoda]
Length=365

 Score =   219 bits (558),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 99/118 (84%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = +1

Query  157  DVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDCD  336
            DV VLT +NFE+EVG+DR ALVEFYAPWCGHCKKLAPEYE+LG SFKKAKS+LIGKVDCD
Sbjct  27   DVTVLTADNFEQEVGKDRGALVEFYAPWCGHCKKLAPEYEKLGTSFKKAKSILIGKVDCD  86

Query  337  EHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTNVKVAAIPS  510
            EHK +CSKYGV+GYPTI+WFPKGSLEP+ YEGARTAEAL EFVNTE GTNVKV A PS
Sbjct  87   EHKDLCSKYGVTGYPTIKWFPKGSLEPRSYEGARTAEALAEFVNTEGGTNVKVLAFPS  144


 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/115 (47%), Positives = 77/115 (67%), Gaps = 1/115 (1%)
 Frame = +1

Query  145  AFADDVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIG  321
            AF  +VV+LTEE F + V  + +  LVEFYAPWCGHCK LAP YE++  +FK    V+I 
Sbjct  141  AFPSNVVILTEETFNEVVLDETKDVLVEFYAPWCGHCKNLAPTYEKVATAFKLEDDVVIA  200

Query  322  KVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
             +D D++K +  KYGVSGYPT+++FPK +   + Y+G R  +    F+N + GT+
Sbjct  201  NLDADKYKDLAEKYGVSGYPTLKFFPKSNKAGEDYDGDRDLDNFVAFINEKCGTS  255



>gb|ACF83353.1| unknown [Zea mays]
 tpg|DAA54513.1| TPA: putative protein disulfide isomerase family protein isoform 
1 [Zea mays]
 tpg|DAA54514.1| TPA: putative protein disulfide isomerase family protein isoform 
2 [Zea mays]
Length=146

 Score =   211 bits (537),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 98/113 (87%), Positives = 103/113 (91%), Gaps = 0/113 (0%)
 Frame = +1

Query  151  ADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVD  330
             DDVV LTE  FEKEVG+DR ALVEFYAPWCGHCKKLAPEYE+LGASFKKAKSVLI KVD
Sbjct  30   GDDVVALTESTFEKEVGKDRGALVEFYAPWCGHCKKLAPEYERLGASFKKAKSVLIAKVD  89

Query  331  CDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTNV  489
            CDEHKS+CSKYGVSGYPTIQWFPKGSLEPKKYEG RTAEAL EF+NTE G N+
Sbjct  90   CDEHKSLCSKYGVSGYPTIQWFPKGSLEPKKYEGQRTAEALAEFLNTEGGGNL  142



>ref|XP_010105665.1| Protein disulfide isomerase-like 2-2 [Morus notabilis]
 gb|EXC05646.1| Protein disulfide isomerase-like 2-2 [Morus notabilis]
Length=374

 Score =   218 bits (556),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 115/143 (80%), Gaps = 13/143 (9%)
 Frame = +1

Query  121  IVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYA-------------PWCGHCKKL  261
            +  LF S+ FADDVVVLTE NF+KEVGQDR ALVEFYA               CGHCKKL
Sbjct  13   LALLFVSSVFADDVVVLTESNFDKEVGQDRGALVEFYALPDLFNESIVEPLKLCGHCKKL  72

Query  262  APEYEQLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGART  441
            APEYE+LGASFKKAKSVLIGKVDCDEHKS+CSKYGVSGYPTIQWFPKG LEPKKYEGA  
Sbjct  73   APEYEKLGASFKKAKSVLIGKVDCDEHKSLCSKYGVSGYPTIQWFPKGFLEPKKYEGAHG  132

Query  442  AEALTEFVNTEAGTNVKVAAIPS  510
            AEAL EFVN E  TNVK+AA+PS
Sbjct  133  AEALAEFVNKEGRTNVKIAAVPS  155


 Score =   113 bits (283),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 53/116 (46%), Positives = 78/116 (67%), Gaps = 2/116 (2%)
 Frame = +1

Query  142  AAFADDVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLI  318
            AA   +VVVLT  +F++ V   ++  LVEFYAPWC HCK LAP YE++ ++FK  + V+I
Sbjct  151  AAVPSNVVVLTPHDFDEIVLNNEKDVLVEFYAPWCSHCKSLAPIYEKVASAFK-LEDVVI  209

Query  319  GKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
              VD D+H+ +  KYGVSGYPT+++FPK +   + Y+G R  +    F+N + GT+
Sbjct  210  ANVDADKHRDLAEKYGVSGYPTLKFFPKSNKAREDYDGGRDLDDFVTFINEKCGTS  265



>emb|CDY57723.1| BnaC04g51940D [Brassica napus]
Length=361

 Score =   218 bits (554),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 108/140 (77%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = +1

Query  88   MSRSRICTALAIVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAP  267
            M++S+I   LA+VAL   +A ADDVVVLTE++FEKEVG+D+ ALVEFYAPWCGHCKKLAP
Sbjct  1    MAKSQIWFGLALVALLVVSAVADDVVVLTEDSFEKEVGKDKGALVEFYAPWCGHCKKLAP  60

Query  268  EYEQLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAE  447
            EYE+L ASFKKAKSVLI KVDCDEHK+VC+KY VSGYPTI+WFPKGSLEP+KYEG R AE
Sbjct  61   EYEKLAASFKKAKSVLIAKVDCDEHKTVCTKYDVSGYPTIKWFPKGSLEPQKYEGPRNAE  120

Query  448  ALTEFVNTEAGTNVKVAAIP  507
            AL EFVN E GTNVK+AA+P
Sbjct  121  ALAEFVNKEGGTNVKLAAVP  140


 Score =   122 bits (307),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 56/116 (48%), Positives = 80/116 (69%), Gaps = 1/116 (1%)
 Frame = +1

Query  142  AAFADDVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLI  318
            AA   +VVVLT +NF++ V  Q++  LVEFYAPWCGHCK LAP YE++   FK+ + V+I
Sbjct  137  AAVPQNVVVLTPDNFDEIVLDQNKDVLVEFYAPWCGHCKSLAPVYEKVATVFKQEEGVVI  196

Query  319  GKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
              +D D HKS+  KYGVSG+PT+++FPK +   + Y+G R  +    F+N + GT+
Sbjct  197  ANLDADAHKSLGEKYGVSGFPTLKFFPKDNKAGQDYDGGRDLDDFVSFINEKVGTS  252



>ref|XP_009142530.1| PREDICTED: protein disulfide-isomerase like 2-1 isoform X1 [Brassica 
rapa]
 ref|XP_009142531.1| PREDICTED: protein disulfide-isomerase like 2-1 isoform X2 [Brassica 
rapa]
 ref|XP_009142533.1| PREDICTED: protein disulfide-isomerase like 2-1 isoform X3 [Brassica 
rapa]
 emb|CDX80106.1| BnaA05g00500D [Brassica napus]
Length=361

 Score =   217 bits (552),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 108/140 (77%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = +1

Query  88   MSRSRICTALAIVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAP  267
            M++S+I   LA+VAL   +A ADDVVVLTE++FEKEVG+D+ ALVEFYAPWCGHCKKLAP
Sbjct  1    MAKSQIWFGLALVALLVVSAVADDVVVLTEDSFEKEVGKDKGALVEFYAPWCGHCKKLAP  60

Query  268  EYEQLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAE  447
            EYE+L ASFKKAKSVLI KVDCDEHK VC+KY VSGYPTI+WFPKGSLEP+KYEG R AE
Sbjct  61   EYEKLAASFKKAKSVLIAKVDCDEHKGVCTKYDVSGYPTIKWFPKGSLEPQKYEGPRNAE  120

Query  448  ALTEFVNTEAGTNVKVAAIP  507
            AL EFVN E GTNVK+AA+P
Sbjct  121  ALAEFVNKEGGTNVKLAAVP  140


 Score =   122 bits (306),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 56/116 (48%), Positives = 79/116 (68%), Gaps = 1/116 (1%)
 Frame = +1

Query  142  AAFADDVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLI  318
            AA   +VVVLT +NF++ V  Q++  LVEFYAPWCGHCK LAP YE++   FK+   V+I
Sbjct  137  AAVPQNVVVLTPDNFDEIVLDQNKDVLVEFYAPWCGHCKSLAPVYEKVATVFKQEDGVVI  196

Query  319  GKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
              +D D HKS+  KYGVSG+PT+++FPK +   + Y+G R  +    F+N + GT+
Sbjct  197  ANLDADAHKSLGEKYGVSGFPTLKFFPKDNKAGQDYDGGRDLDDFVTFINEKVGTS  252



>emb|CDX95726.1| BnaC03g26070D [Brassica napus]
Length=362

 Score =   215 bits (548),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 125/141 (89%), Gaps = 1/141 (1%)
 Frame = +1

Query  88   MSRSRICTALA-IVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLA  264
            M++S+I   LA ++AL   +A ADDVVVLT+++FEKEVG+DR  LV+FYAPWCGHCKKLA
Sbjct  1    MAKSQIWFGLASLLALIVVSAVADDVVVLTDDSFEKEVGKDRGVLVKFYAPWCGHCKKLA  60

Query  265  PEYEQLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTA  444
            PEYE+LGASFKKAKS+LI KVDCDEHKSVC+KYGVSGYPTIQWFPKGSLEP+KYEGAR A
Sbjct  61   PEYEKLGASFKKAKSILIAKVDCDEHKSVCTKYGVSGYPTIQWFPKGSLEPQKYEGARNA  120

Query  445  EALTEFVNTEAGTNVKVAAIP  507
            EAL E+VN E GTNVK+AA P
Sbjct  121  EALAEYVNKEGGTNVKLAAAP  141


 Score =   122 bits (306),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 57/116 (49%), Positives = 80/116 (69%), Gaps = 1/116 (1%)
 Frame = +1

Query  142  AAFADDVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLI  318
            AA   +VVVLT +NF++ V  Q++  LVEFYAPWCGHCK LAP YE++   FK+ + V+I
Sbjct  138  AAAPQNVVVLTPDNFDEIVLDQNKDVLVEFYAPWCGHCKSLAPVYEKVATVFKQEEGVVI  197

Query  319  GKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
              +D D HKS+  KYGVSG+PT+++FPK +   + YEG R  +    F+N + GT+
Sbjct  198  ANLDADAHKSLGEKYGVSGFPTLKFFPKDNKAGQDYEGGRDLDDFVGFINEKVGTS  253



>gb|KEH24481.1| protein disulfide isomerase-like protein [Medicago truncatula]
Length=359

 Score =   214 bits (544),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 98/141 (70%), Positives = 117/141 (83%), Gaps = 1/141 (1%)
 Frame = +1

Query  88   MSRSRICTALAIVALFF-SAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLA  264
            M  SR+    A+  +F  S A A+DVVVLT++ FE+EVG+DR ALVEFYAPWCGHCKKLA
Sbjct  1    MWISRMLGVGAMTFVFLISTALANDVVVLTKDTFEEEVGKDRGALVEFYAPWCGHCKKLA  60

Query  265  PEYEQLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTA  444
            PEYE+L  SF+K  ++LIGKVDCDEHKSVC+KYGVSGYPTI+WFPKGSL PKK+EGARTA
Sbjct  61   PEYEKLATSFRKTNTILIGKVDCDEHKSVCTKYGVSGYPTIKWFPKGSLNPKKFEGARTA  120

Query  445  EALTEFVNTEAGTNVKVAAIP  507
            EAL  F+N E GTNVK+ ++P
Sbjct  121  EALAAFLNIEGGTNVKIPSLP  141


 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/110 (45%), Positives = 70/110 (64%), Gaps = 1/110 (1%)
 Frame = +1

Query  160  VVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDCD  336
            VV+L+ +NF+K V  + +  LVEFYAPWCGHCK LA  YE++ A+F+  + V+I  +D D
Sbjct  144  VVILSPDNFDKVVLDETKDVLVEFYAPWCGHCKALAYTYEKVAAAFRLEEDVVIANLDAD  203

Query  337  EHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
            E+K +  KY V  YPT ++FPK +   + Y G R  +    F+N   GTN
Sbjct  204  EYKDLAEKYDVHSYPTFKFFPKNNKTGEDYVGGRDMDDFVFFINARCGTN  253



>gb|ABK25411.1| unknown [Picea sitchensis]
Length=359

 Score =   212 bits (540),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 101/141 (72%), Positives = 112/141 (79%), Gaps = 2/141 (1%)
 Frame = +1

Query  88   MSRSRICTALAIVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAP  267
            M R  I    A   L   A  +DDV VLT +NFE EVG+DR ALVEFYAPWCGHCKKLAP
Sbjct  1    MGRGWILAVFAFTFLLV-AVRSDDVTVLTPDNFENEVGKDRGALVEFYAPWCGHCKKLAP  59

Query  268  EYEQLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAE  447
            EYE+LGASFKK KSVLI KVDCDEHK++CSKYGVSG+PT++WFPKGSLEPK Y G RTAE
Sbjct  60   EYEKLGASFKKIKSVLIAKVDCDEHKTICSKYGVSGFPTLKWFPKGSLEPKDYNGGRTAE  119

Query  448  ALTEFVNTEAGTNVKVAAIPS  510
             LT FVNTE GTNVKV  +P+
Sbjct  120  DLTNFVNTEGGTNVKV-TVPT  139


 Score =   121 bits (304),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 77/111 (69%), Gaps = 1/111 (1%)
 Frame = +1

Query  157  DVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDC  333
            +VVVLT ENF+  V  + +  LVEFYAPWCGHCK LAP YE++  +FK  K V+I  VD 
Sbjct  141  EVVVLTSENFDSVVLDESKDVLVEFYAPWCGHCKNLAPTYEKVATAFKSEKDVVIANVDA  200

Query  334  DEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
            D++K +  KYGVSG+PT+++FPK +   + Y+G R  +A   F+N +A TN
Sbjct  201  DKYKDLGEKYGVSGFPTLKFFPKTNKAGEDYDGGRDLDAFVAFINEKAHTN  251



>gb|ACN40539.1| unknown [Picea sitchensis]
Length=359

 Score =   210 bits (535),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 100/141 (71%), Positives = 111/141 (79%), Gaps = 2/141 (1%)
 Frame = +1

Query  88   MSRSRICTALAIVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAP  267
            M R  I    A   L   A  +DDV VLT +NFE EVG+DR ALVEFYAPWCGHCKKLAP
Sbjct  1    MGRGWILAVFAFTFLLV-AVRSDDVTVLTPDNFENEVGKDRGALVEFYAPWCGHCKKLAP  59

Query  268  EYEQLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAE  447
            EYE+LGASFKK KSVLI KVDCDEHK++CSKYGVSG+PT++WFPKGSLEPK Y G RTAE
Sbjct  60   EYEKLGASFKKIKSVLIAKVDCDEHKTICSKYGVSGFPTLKWFPKGSLEPKDYNGGRTAE  119

Query  448  ALTEFVNTEAGTNVKVAAIPS  510
             LT FVNTE G NVKV  +P+
Sbjct  120  DLTNFVNTEGGINVKV-TVPT  139


 Score =   121 bits (304),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 77/111 (69%), Gaps = 1/111 (1%)
 Frame = +1

Query  157  DVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDC  333
            +VVVLT ENF+  V  + +  LVEFYAPWCGHCK LAP YE++  +FK  K V+I  VD 
Sbjct  141  EVVVLTSENFDSVVLDESKDVLVEFYAPWCGHCKNLAPTYEKVATAFKSEKDVVIANVDA  200

Query  334  DEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
            D++K +  KYGVSG+PT+++FPK +   + Y+G R  +A   F+N +A TN
Sbjct  201  DKYKDLGEKYGVSGFPTLKFFPKTNKAGEDYDGGRDLDAFVAFINEKAHTN  251



>ref|NP_973708.1| protein disulfide-isomerase like 2-1 [Arabidopsis thaliana]
 gb|AEC10844.1| protein disulfide-isomerase like 2-1 [Arabidopsis thaliana]
Length=266

 Score =   206 bits (525),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 107/141 (76%), Positives = 124/141 (88%), Gaps = 0/141 (0%)
 Frame = +1

Query  88   MSRSRICTALAIVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAP  267
            M++S+I    A++AL   +A ADDVVVLT+++FEKEVG+D+ ALVEFYAPWCGHCKKLAP
Sbjct  1    MAKSQIWFGFALLALLLVSAVADDVVVLTDDSFEKEVGKDKGALVEFYAPWCGHCKKLAP  60

Query  268  EYEQLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAE  447
            EYE+LGASFKKAKSVLI KVDCDE KSVC+KYGVSGYPTIQWFPKGSLEP+KYEG R AE
Sbjct  61   EYEKLGASFKKAKSVLIAKVDCDEQKSVCTKYGVSGYPTIQWFPKGSLEPQKYEGPRNAE  120

Query  448  ALTEFVNTEAGTNVKVAAIPS  510
            AL E+VN E GTNVK+AA+P 
Sbjct  121  ALAEYVNKEGGTNVKLAAVPQ  141


 Score =   120 bits (301),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 80/116 (69%), Gaps = 1/116 (1%)
 Frame = +1

Query  142  AAFADDVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLI  318
            AA   +VVVLT +NF++ V  Q++  LVEFYAPWCGHCK LAP YE++   FK+ + V+I
Sbjct  137  AAVPQNVVVLTPDNFDEIVLDQNKDVLVEFYAPWCGHCKSLAPTYEKVATVFKQEEGVVI  196

Query  319  GKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
              +D D HK++  KYGVSG+PT+++FPK +     Y+G R  +    F+N ++GT+
Sbjct  197  ANLDADAHKALGEKYGVSGFPTLKFFPKDNKAGHDYDGGRDLDDFVSFINEKSGTS  252



>ref|NP_001078074.1| protein disulfide-isomerase like 2-1 [Arabidopsis thaliana]
 dbj|BAH19606.1| AT2G47470 [Arabidopsis thaliana]
 gb|AEC10847.1| protein disulfide-isomerase like 2-1 [Arabidopsis thaliana]
Length=335

 Score =   208 bits (529),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 94/113 (83%), Positives = 105/113 (93%), Gaps = 0/113 (0%)
 Frame = +1

Query  169  LTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDCDEHKS  348
            LT+++FEKEVG+D+ ALVEFYAPWCGHCKKLAPEYE+LGASFKKAKSVLI KVDCDE KS
Sbjct  28   LTDDSFEKEVGKDKGALVEFYAPWCGHCKKLAPEYEKLGASFKKAKSVLIAKVDCDEQKS  87

Query  349  VCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTNVKVAAIP  507
            VC+KYGVSGYPTIQWFPKGSLEP+KYEG R AEAL E+VN E GTNVK+AA+P
Sbjct  88   VCTKYGVSGYPTIQWFPKGSLEPQKYEGPRNAEALAEYVNKEGGTNVKLAAVP  140


 Score =   121 bits (304),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 80/116 (69%), Gaps = 1/116 (1%)
 Frame = +1

Query  142  AAFADDVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLI  318
            AA   +VVVLT +NF++ V  Q++  LVEFYAPWCGHCK LAP YE++   FK+ + V+I
Sbjct  137  AAVPQNVVVLTPDNFDEIVLDQNKDVLVEFYAPWCGHCKSLAPTYEKVATVFKQEEGVVI  196

Query  319  GKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
              +D D HK++  KYGVSG+PT+++FPK +     Y+G R  +    F+N ++GT+
Sbjct  197  ANLDADAHKALGEKYGVSGFPTLKFFPKDNKAGHDYDGGRDLDDFVSFINEKSGTS  252



>ref|XP_006294808.1| hypothetical protein CARUB_v10023860mg [Capsella rubella]
 gb|EOA27706.1| hypothetical protein CARUB_v10023860mg [Capsella rubella]
Length=264

 Score =   206 bits (524),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 94/114 (82%), Positives = 105/114 (92%), Gaps = 0/114 (0%)
 Frame = +1

Query  169  LTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDCDEHKS  348
            LT+++FEKEVG+D+ ALVEFYAPWCGHCKKLAPEYE+LGASFKKAKSVLI KVDCDEHK+
Sbjct  28   LTDDSFEKEVGKDKGALVEFYAPWCGHCKKLAPEYEKLGASFKKAKSVLIAKVDCDEHKA  87

Query  349  VCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTNVKVAAIPS  510
            VC+KYGVSGYPTIQWFPKGSLEP+KYEG R AEAL E+VN E GTNVK+AA P 
Sbjct  88   VCTKYGVSGYPTIQWFPKGSLEPQKYEGPRNAEALAEYVNKEGGTNVKLAAAPQ  141


 Score =   119 bits (299),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 80/116 (69%), Gaps = 1/116 (1%)
 Frame = +1

Query  142  AAFADDVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLI  318
            AA   +VVVLT +NF++ V  Q++  LVEFYAPWCGHCK LAP YE++   FK+ + V+I
Sbjct  137  AAAPQNVVVLTPDNFDEIVLDQNKDVLVEFYAPWCGHCKSLAPTYEKVATVFKQEEGVVI  196

Query  319  GKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
              +D D HK++  KYGVSG+PT+++FPK +     Y+G R  +    F+N ++GT+
Sbjct  197  ANLDADAHKALGEKYGVSGFPTLKFFPKDNKAGHDYDGGRDLDDFVSFINDKSGTS  252



>ref|NP_182269.1| protein disulfide-isomerase like 2-1 [Arabidopsis thaliana]
 sp|O22263.1|PDI21_ARATH RecName: Full=Protein disulfide-isomerase like 2-1; Short=AtPDIL2-1; 
AltName: Full=P5; AltName: Full=Protein MATERNAL EFFECT 
EMBRYO ARREST 30; AltName: Full=Protein UNFERTILIZED EMBRYO 
SAC 5; AltName: Full=Protein disulfide isomerase 11; Short=AtPDI11; 
AltName: Full=Protein disulfide-isomerase A6; AltName: 
Full=Protein disulfide-isomerase like 4-1; Short=AtPDIL4-1; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAC62863.1| putative protein disulfide-isomerase [Arabidopsis thaliana]
 gb|AAL67044.1| putative protein disulfide-isomerase [Arabidopsis thaliana]
 gb|AAM14327.1| putative protein disulfide-isomerase [Arabidopsis thaliana]
 gb|AAN60247.1| unknown [Arabidopsis thaliana]
 emb|CAC81060.1| PDI-like protein [Arabidopsis thaliana]
 gb|AEC10845.1| protein disulfide-isomerase like 2-1 [Arabidopsis thaliana]
Length=361

 Score =   209 bits (531),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 94/113 (83%), Positives = 105/113 (93%), Gaps = 0/113 (0%)
 Frame = +1

Query  169  LTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDCDEHKS  348
            LT+++FEKEVG+D+ ALVEFYAPWCGHCKKLAPEYE+LGASFKKAKSVLI KVDCDE KS
Sbjct  28   LTDDSFEKEVGKDKGALVEFYAPWCGHCKKLAPEYEKLGASFKKAKSVLIAKVDCDEQKS  87

Query  349  VCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTNVKVAAIP  507
            VC+KYGVSGYPTIQWFPKGSLEP+KYEG R AEAL E+VN E GTNVK+AA+P
Sbjct  88   VCTKYGVSGYPTIQWFPKGSLEPQKYEGPRNAEALAEYVNKEGGTNVKLAAVP  140


 Score =   121 bits (304),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 80/116 (69%), Gaps = 1/116 (1%)
 Frame = +1

Query  142  AAFADDVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLI  318
            AA   +VVVLT +NF++ V  Q++  LVEFYAPWCGHCK LAP YE++   FK+ + V+I
Sbjct  137  AAVPQNVVVLTPDNFDEIVLDQNKDVLVEFYAPWCGHCKSLAPTYEKVATVFKQEEGVVI  196

Query  319  GKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
              +D D HK++  KYGVSG+PT+++FPK +     Y+G R  +    F+N ++GT+
Sbjct  197  ANLDADAHKALGEKYGVSGFPTLKFFPKDNKAGHDYDGGRDLDDFVSFINEKSGTS  252



>ref|NP_001031555.1| protein disulfide-isomerase like 2-1 [Arabidopsis thaliana]
 gb|AEC10846.1| protein disulfide-isomerase like 2-1 [Arabidopsis thaliana]
Length=323

 Score =   207 bits (527),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 94/113 (83%), Positives = 105/113 (93%), Gaps = 0/113 (0%)
 Frame = +1

Query  169  LTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDCDEHKS  348
            LT+++FEKEVG+D+ ALVEFYAPWCGHCKKLAPEYE+LGASFKKAKSVLI KVDCDE KS
Sbjct  28   LTDDSFEKEVGKDKGALVEFYAPWCGHCKKLAPEYEKLGASFKKAKSVLIAKVDCDEQKS  87

Query  349  VCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTNVKVAAIP  507
            VC+KYGVSGYPTIQWFPKGSLEP+KYEG R AEAL E+VN E GTNVK+AA+P
Sbjct  88   VCTKYGVSGYPTIQWFPKGSLEPQKYEGPRNAEALAEYVNKEGGTNVKLAAVP  140


 Score =   120 bits (302),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 80/116 (69%), Gaps = 1/116 (1%)
 Frame = +1

Query  142  AAFADDVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLI  318
            AA   +VVVLT +NF++ V  Q++  LVEFYAPWCGHCK LAP YE++   FK+ + V+I
Sbjct  137  AAVPQNVVVLTPDNFDEIVLDQNKDVLVEFYAPWCGHCKSLAPTYEKVATVFKQEEGVVI  196

Query  319  GKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
              +D D HK++  KYGVSG+PT+++FPK +     Y+G R  +    F+N ++GT+
Sbjct  197  ANLDADAHKALGEKYGVSGFPTLKFFPKDNKAGHDYDGGRDLDDFVSFINEKSGTS  252



>ref|XP_001776169.1| predicted protein [Physcomitrella patens]
 gb|EDQ59080.1| predicted protein [Physcomitrella patens]
Length=362

 Score =   191 bits (486),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 99/125 (79%), Gaps = 0/125 (0%)
 Frame = +1

Query  136  FSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVL  315
            FS A  + V VLTE NFE+ VG D+ ALVEFYAPWCGHCKKLAPEYE+LG +    KSVL
Sbjct  18   FSQAADEHVTVLTESNFEQHVGGDKGALVEFYAPWCGHCKKLAPEYEKLGEALTGQKSVL  77

Query  316  IGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTNVKV  495
            I KVDCD+HKSVCSKYG+ G+PTI+WFPKGSLEPK Y G RT +AL EFVN EAGT  KV
Sbjct  78   IAKVDCDDHKSVCSKYGIQGFPTIKWFPKGSLEPKDYNGGRTTDALLEFVNNEAGTKGKV  137

Query  496  AAIPS  510
            +  PS
Sbjct  138  STPPS  142


 Score =   117 bits (294),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 77/110 (70%), Gaps = 1/110 (1%)
 Frame = +1

Query  157  DVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDC  333
            +VVVL   NF+K V    +  LVEFYAPWCGHCK LAP YE++ A+FK    V++  V+ 
Sbjct  143  EVVVLDPTNFDKIVMDTTKDVLVEFYAPWCGHCKSLAPVYEKVAAAFKLENDVVVANVNA  202

Query  334  DEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGT  483
            D H+++ S++GVSGYPT+++FPK + + + Y+G R  +A   F+N +AGT
Sbjct  203  DAHRALGSRFGVSGYPTLKFFPKNNKDGEDYDGGRDVDAFVTFLNKKAGT  252



>gb|ACJ84386.1| unknown [Medicago truncatula]
Length=131

 Score =   177 bits (450),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 91/112 (81%), Positives = 96/112 (86%), Gaps = 0/112 (0%)
 Frame = +1

Query  97   SRICTALAIVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYE  276
            SRI  A    A+ F +  ADDVVVLTEENFEKEVGQD+ ALVEFYAPWCGHCKKLAPEYE
Sbjct  10   SRIALASFAFAILFVSVSADDVVVLTEENFEKEVGQDKGALVEFYAPWCGHCKKLAPEYE  69

Query  277  QLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEG  432
            +LG SFKKAKSVLI KVDCDEHK VCSKYGVSGYPTIQWFPKGSLEPK  +G
Sbjct  70   KLGNSFKKAKSVLIAKVDCDEHKGVCSKYGVSGYPTIQWFPKGSLEPKSLKG  121



>gb|KHG25232.1| putative disulfide-isomerase A6 [Gossypium arboreum]
Length=311

 Score =   175 bits (443),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 79/90 (88%), Positives = 85/90 (94%), Gaps = 0/90 (0%)
 Frame = +1

Query  241  CGHCKKLAPEYEQLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPK  420
            CGHCKKLAPEYE+LGA+FKKAKSVLIGKVDCDEHKS+CSKYGV GYPT+QWFPKGSLEPK
Sbjct  3    CGHCKKLAPEYEKLGATFKKAKSVLIGKVDCDEHKSLCSKYGVQGYPTVQWFPKGSLEPK  62

Query  421  KYEGARTAEALTEFVNTEAGTNVKVAAIPS  510
            KYEG RTAEAL EFVNTE GTNVK+A +PS
Sbjct  63   KYEGPRTAEALAEFVNTEGGTNVKIATLPS  92


 Score =   114 bits (286),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 77/116 (66%), Gaps = 1/116 (1%)
 Frame = +1

Query  142  AAFADDVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLI  318
            A    +V VL  +NF++ V  + +  LVEFYAPWCGHCK LAP YE++  +FK  + V+I
Sbjct  88   ATLPSNVAVLNADNFDEIVLDETKDVLVEFYAPWCGHCKNLAPTYEKVATAFKSEEDVVI  147

Query  319  GKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
              +D D+++ +  KYG+SG+PT+++FPKG+   + Y+G R  +    F+N + GT+
Sbjct  148  ANLDADKYRDLAEKYGISGFPTLKFFPKGNKAGEDYDGGRDLDDFVSFINEKCGTS  203



>gb|EMS64693.1| Protein disulfide isomerase-like 2-1 [Triticum urartu]
Length=396

 Score =   176 bits (445),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/90 (90%), Positives = 86/90 (96%), Gaps = 0/90 (0%)
 Frame = +1

Query  241  CGHCKKLAPEYEQLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPK  420
            CGHCKKLAPEYE+L ASFKKAKSVLI KVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPK
Sbjct  89   CGHCKKLAPEYEKLAASFKKAKSVLIAKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPK  148

Query  421  KYEGARTAEALTEFVNTEAGTNVKVAAIPS  510
            KYEG RTAEALTE+VN+EA TNVK+AA+PS
Sbjct  149  KYEGQRTAEALTEYVNSEAATNVKIAAVPS  178


 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 81/116 (70%), Gaps = 1/116 (1%)
 Frame = +1

Query  142  AAFADDVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLI  318
            AA    VVVLTEE F+  V  + +  LVEFYAPWCGHCK LAP YE++ + FK+ + V+I
Sbjct  174  AAVPSSVVVLTEETFDSVVLDETKDVLVEFYAPWCGHCKSLAPIYEKVASVFKQDEGVVI  233

Query  319  GKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
              +D D++ S+  KYGVSG+PT+++FPKG+   ++YE  R  +   +F+N ++GT+
Sbjct  234  ANLDADKYTSLAEKYGVSGFPTLKFFPKGNKAGEEYESGRELDDFVKFINEKSGTS  289



>ref|XP_002988430.1| hypothetical protein SELMODRAFT_269397 [Selaginella moellendorffii]
 gb|EFJ10520.1| hypothetical protein SELMODRAFT_269397 [Selaginella moellendorffii]
Length=367

 Score =   175 bits (443),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 79/125 (63%), Positives = 96/125 (77%), Gaps = 7/125 (6%)
 Frame = +1

Query  157  DVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGK----  324
            DV+VLT +NF+ EVG +RAALVEFYAPWCGHCKKLAPEYE++G++F+K K + I K    
Sbjct  25   DVLVLTPDNFDHEVGHERAALVEFYAPWCGHCKKLAPEYEKVGSAFRKVKHLSIAKASFF  84

Query  325  ---VDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTNVKV  495
               +DCD HKS+CSK+ VSGYPT++WFPKGSL PK Y G RTAE L  FVNTE G N K+
Sbjct  85   LTYIDCDAHKSLCSKFDVSGYPTLKWFPKGSLTPKDYSGGRTAEDLVAFVNTEGGANAKL  144

Query  496  AAIPS  510
            +   S
Sbjct  145  SVAAS  149


 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 76/112 (68%), Gaps = 2/112 (2%)
 Frame = +1

Query  151  ADDVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKV  327
            A +VVVLT  NF++ V    +  LVEFYAPWCGHCK LAP YE +  ++K  K+V++ K+
Sbjct  148  ASEVVVLTPANFDEIVLDPTKDVLVEFYAPWCGHCKSLAPAYESVATAYKAEKNVIVAKL  207

Query  328  DCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGT  483
            D D HK + +KY VSGYPT+++FPK +   +  + AR+ +   EF+N + GT
Sbjct  208  DADAHKDLATKYDVSGYPTLKFFPKANKAGEDCD-ARSVDEFVEFLNEKCGT  258



>ref|XP_002979862.1| hypothetical protein SELMODRAFT_268311 [Selaginella moellendorffii]
 gb|EFJ19264.1| hypothetical protein SELMODRAFT_268311 [Selaginella moellendorffii]
Length=367

 Score =   174 bits (442),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 79/125 (63%), Positives = 96/125 (77%), Gaps = 7/125 (6%)
 Frame = +1

Query  157  DVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGK----  324
            DV+VLT +NF+ EVG +RAALVEFYAPWCGHCKKLAPEYE++G++F+K K + I K    
Sbjct  25   DVLVLTPDNFDHEVGHERAALVEFYAPWCGHCKKLAPEYEKVGSAFRKVKHLSIAKASFF  84

Query  325  ---VDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTNVKV  495
               +DCD HKS+CSK+ VSGYPT++WFPKGSL PK Y G RTAE L  FVNTE G N K+
Sbjct  85   LTFIDCDAHKSLCSKFDVSGYPTLKWFPKGSLTPKDYSGGRTAEDLVAFVNTEGGANAKL  144

Query  496  AAIPS  510
            +   S
Sbjct  145  SVAAS  149


 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 76/112 (68%), Gaps = 2/112 (2%)
 Frame = +1

Query  151  ADDVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKV  327
            A +VVVLT  NF++ V    +  LVEFYAPWCGHCK LAP YE +  ++K  K+V++ K+
Sbjct  148  ASEVVVLTPANFDEIVLDPTKDVLVEFYAPWCGHCKSLAPAYESVATAYKAEKNVIVAKL  207

Query  328  DCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGT  483
            D D HK + +KY VSGYPT+++FPK +   +  + AR+ +   EF+N + GT
Sbjct  208  DADAHKDLATKYDVSGYPTLKFFPKANKAGEDCD-ARSVDEFVEFLNEKCGT  258



>gb|KDO87059.1| hypothetical protein CISIN_1g018270mg [Citrus sinensis]
Length=319

 Score =   172 bits (436),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 78/90 (87%), Positives = 84/90 (93%), Gaps = 0/90 (0%)
 Frame = +1

Query  241  CGHCKKLAPEYEQLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPK  420
            CGHCKKLAPEYE+LGASFKKAKSVLIGKVDCDEHKS+CSKYGV GYPTIQWFPKGSLEPK
Sbjct  13   CGHCKKLAPEYEKLGASFKKAKSVLIGKVDCDEHKSLCSKYGVQGYPTIQWFPKGSLEPK  72

Query  421  KYEGARTAEALTEFVNTEAGTNVKVAAIPS  510
            KYEG R+ EAL E+VN E GTNVK+AA+PS
Sbjct  73   KYEGPRSTEALAEYVNNEGGTNVKIAAVPS  102


 Score =   118 bits (296),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 80/116 (69%), Gaps = 1/116 (1%)
 Frame = +1

Query  142  AAFADDVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLI  318
            AA   +VVVLT +NF++ V  + +  LVEFYAPWCGHCK LAP YE++ A+F     V++
Sbjct  98   AAVPSNVVVLTADNFDEIVLDKSKDVLVEFYAPWCGHCKNLAPTYEKVAAAFTLEDDVVV  157

Query  319  GKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
              +D D++K +  KYGVSG+PT+++FPKG+ + ++Y G R  E    F+N + GT+
Sbjct  158  ANLDADKYKDLAEKYGVSGFPTLKFFPKGNKDGEEYGGGRDLEDFVSFINEKCGTS  213



>ref|XP_008807783.1| PREDICTED: protein disulfide-isomerase like 2-1-like isoform 
X1 [Phoenix dactylifera]
 ref|XP_008807784.1| PREDICTED: protein disulfide-isomerase like 2-1-like isoform 
X1 [Phoenix dactylifera]
Length=368

 Score =   172 bits (437),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 85/150 (57%), Positives = 108/150 (72%), Gaps = 9/150 (6%)
 Frame = +1

Query  88   MSRSRICTALAIVALFFS---------AAFADDVVVLTEENFEKEVGQDRAALVEFYAPW  240
            M+RSRI  +L  + L  S              DVVVLT++NF++E+GQDR A V FY PW
Sbjct  1    MARSRIRFSLRTLTLALSPVFVVAAVAGGGGGDVVVLTDDNFDEEIGQDRGAFVMFYTPW  60

Query  241  CGHCKKLAPEYEQLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPK  420
            CG CKK+APEYE+LG+SF + KSVLIGKVDCD++KS+CS+Y VS YPTI W+PKGSL+P 
Sbjct  61   CGRCKKIAPEYEKLGSSFNQEKSVLIGKVDCDKYKSLCSEYRVSKYPTIHWYPKGSLKPL  120

Query  421  KYEGARTAEALTEFVNTEAGTNVKVAAIPS  510
            +Y+G  TA+   EFVN EAGTN ++   PS
Sbjct  121  EYDGPYTAQVFVEFVNAEAGTNAELVPSPS  150


 Score =   112 bits (279),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 51/111 (46%), Positives = 72/111 (65%), Gaps = 1/111 (1%)
 Frame = +1

Query  157  DVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDC  333
            D+VVLT ENF + V  + +  LVEFYAPWC HCK LAP YE++  ++K  + V+I  +D 
Sbjct  151  DIVVLTSENFNQVVLDETKNVLVEFYAPWCAHCKLLAPTYEKVATAYKLEEDVVIANLDA  210

Query  334  DEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
            D +K +  KY V+GYPTI +FPK +   + YEG R  +    F+N + GT+
Sbjct  211  DRYKDLAEKYEVNGYPTIIFFPKSNKAGETYEGGRDLDDFINFINEKCGTS  261



>ref|XP_008807785.1| PREDICTED: protein disulfide-isomerase like 2-1-like isoform 
X2 [Phoenix dactylifera]
Length=361

 Score =   172 bits (437),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 85/150 (57%), Positives = 108/150 (72%), Gaps = 9/150 (6%)
 Frame = +1

Query  88   MSRSRICTALAIVALFFS---------AAFADDVVVLTEENFEKEVGQDRAALVEFYAPW  240
            M+RSRI  +L  + L  S              DVVVLT++NF++E+GQDR A V FY PW
Sbjct  1    MARSRIRFSLRTLTLALSPVFVVAAVAGGGGGDVVVLTDDNFDEEIGQDRGAFVMFYTPW  60

Query  241  CGHCKKLAPEYEQLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPK  420
            CG CKK+APEYE+LG+SF + KSVLIGKVDCD++KS+CS+Y VS YPTI W+PKGSL+P 
Sbjct  61   CGRCKKIAPEYEKLGSSFNQEKSVLIGKVDCDKYKSLCSEYRVSKYPTIHWYPKGSLKPL  120

Query  421  KYEGARTAEALTEFVNTEAGTNVKVAAIPS  510
            +Y+G  TA+   EFVN EAGTN ++   PS
Sbjct  121  EYDGPYTAQVFVEFVNAEAGTNAELVPSPS  150


 Score =   111 bits (278),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 51/111 (46%), Positives = 72/111 (65%), Gaps = 1/111 (1%)
 Frame = +1

Query  157  DVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDC  333
            D+VVLT ENF + V  + +  LVEFYAPWC HCK LAP YE++  ++K  + V+I  +D 
Sbjct  151  DIVVLTSENFNQVVLDETKNVLVEFYAPWCAHCKLLAPTYEKVATAYKLEEDVVIANLDA  210

Query  334  DEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
            D +K +  KY V+GYPTI +FPK +   + YEG R  +    F+N + GT+
Sbjct  211  DRYKDLAEKYEVNGYPTIIFFPKSNKAGETYEGGRDLDDFINFINEKCGTS  261



>ref|XP_010921537.1| PREDICTED: protein disulfide-isomerase like 2-1-like [Elaeis 
guineensis]
 ref|XP_010921538.1| PREDICTED: protein disulfide-isomerase like 2-1-like [Elaeis 
guineensis]
Length=366

 Score =   172 bits (437),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 88/148 (59%), Positives = 109/148 (74%), Gaps = 7/148 (5%)
 Frame = +1

Query  88   MSRSRICTALAIVALFFS-------AAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCG  246
            M+RS I  +L  +AL  S        A A DVVVLT++NF++EVGQDR A V FY PWCG
Sbjct  1    MARSPIRFSLRTLALTLSPVFVVAAVAAAGDVVVLTDDNFDEEVGQDRGAFVMFYTPWCG  60

Query  247  HCKKLAPEYEQLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKY  426
             CKK+APEYE+LG SF + KSVLIGKVDCD++KS+CS+Y VS YPTI W+PKGSL+P +Y
Sbjct  61   RCKKIAPEYEKLGPSFNREKSVLIGKVDCDKYKSLCSEYQVSKYPTIHWYPKGSLKPLEY  120

Query  427  EGARTAEALTEFVNTEAGTNVKVAAIPS  510
            +G  TA+   EFVN EAGTN ++   PS
Sbjct  121  DGPYTAQVFVEFVNAEAGTNAELVPTPS  148


 Score =   105 bits (263),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 71/111 (64%), Gaps = 1/111 (1%)
 Frame = +1

Query  157  DVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDC  333
            D+VVLT ENF + V  + +  LVEFYAPWC HCK LAP YE++  ++K  + V+I  +D 
Sbjct  149  DIVVLTPENFNQVVLDETKNVLVEFYAPWCTHCKLLAPTYEKVATAYKLEEDVVIANLDA  208

Query  334  DEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
            D +K +  KY V+GYP I++FPK +   + Y+  R  +    F+N + GT+
Sbjct  209  DRYKDLAEKYEVNGYPKIKFFPKSNKAGEAYKSGRDLDDFINFINEKCGTS  259



>gb|KDO87058.1| hypothetical protein CISIN_1g018270mg [Citrus sinensis]
Length=239

 Score =   166 bits (420),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 73/133 (55%), Positives = 97/133 (73%), Gaps = 0/133 (0%)
 Frame = +1

Query  88   MSRSRICTALAIVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAP  267
            M R +I  AL  + LFF +A ADDVVVLTE+NFEKEVGQDR ALVEFYAPWCGHCK LAP
Sbjct  1    MERYQIWLALGTLTLFFVSALADDVVVLTEDNFEKEVGQDRGALVEFYAPWCGHCKNLAP  60

Query  268  EYEQLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAE  447
             YE++ A+F     V++  +D D++K +  KYGVSG+PT+++FPKG+ + ++Y G R  E
Sbjct  61   TYEKVAAAFTLEDDVVVANLDADKYKDLAEKYGVSGFPTLKFFPKGNKDGEEYGGGRDLE  120

Query  448  ALTEFVNTEAGTN  486
                F+N + GT+
Sbjct  121  DFVSFINEKCGTS  133



>gb|KHG10177.1| Protein disulfide-isomerase like 2-1 [Gossypium arboreum]
Length=220

 Score =   159 bits (402),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 76/132 (58%), Positives = 95/132 (72%), Gaps = 19/132 (14%)
 Frame = +1

Query  148  FADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGK-  324
            +ADDV+VLTEENFEKEVGQDR ALVEFYAPWCGHC+KLAPE E+LGASFKKAKSVLIGK 
Sbjct  4    WADDVLVLTEENFEKEVGQDRGALVEFYAPWCGHCQKLAPENEKLGASFKKAKSVLIGKT  63

Query  325  ------------------VDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEA  450
                              +D D++K +  KYGVSGYPT+++FPKG+   + Y+G ++ + 
Sbjct  64   YENVATAFKMEEDVVIANIDADKYKDLAEKYGVSGYPTLKFFPKGNKAGEDYDGGQSLDE  123

Query  451  LTEFVNTEAGTN  486
               F+N + GTN
Sbjct  124  FVAFINEQCGTN  135



>ref|XP_008372639.1| PREDICTED: protein disulfide-isomerase A3-like [Malus domestica]
Length=209

 Score =   152 bits (384),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 81/112 (72%), Gaps = 13/112 (12%)
 Frame = +1

Query  88   MSRSRICTALAIVALFF-SAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLA  264
            M+ S+   A    AL   S+AF DDVV LT +NFEKEVGQDRA LVEFYAPWCGHCKKLA
Sbjct  1    MASSKTLFAFGAQALLLASSAFTDDVVALTXDNFEKEVGQDRATLVEFYAPWCGHCKKLA  60

Query  265  PEYEQLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPK  420
            P YE+L             KVDCD+HK +C KYGVSGYPTIQWFPKGSLEP+
Sbjct  61   PXYEKL------------AKVDCDKHKGICGKYGVSGYPTIQWFPKGSLEPR  100



>ref|XP_009519313.1| hypothetical protein PHYSODRAFT_353904 [Phytophthora sojae]
 gb|EGZ24025.1| hypothetical protein PHYSODRAFT_353904 [Phytophthora sojae]
Length=362

 Score =   145 bits (365),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 86/118 (73%), Gaps = 0/118 (0%)
 Frame = +1

Query  157  DVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDCD  336
            DV VLT +NF+  V   +  LV+FYAPWCGHCK LAP YE +  +FKK  SV++ +VD D
Sbjct  22   DVTVLTPDNFDDVVDGSKHVLVKFYAPWCGHCKNLAPAYETVATAFKKTDSVVVAEVDAD  81

Query  337  EHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTNVKVAAIPS  510
            EHK + SK+GV+G+PT+++FP GS EP+ Y+G R+ +    F+N +AGTNV+VA  PS
Sbjct  82   EHKDLGSKFGVTGFPTLKYFPVGSTEPEDYKGGRSEDDFVSFLNGKAGTNVRVAKAPS  139


 Score =   117 bits (292),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 54/109 (50%), Positives = 72/109 (66%), Gaps = 1/109 (1%)
 Frame = +1

Query  160  VVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDCD  336
            V  LTE +F+ EV    + A+VEFYAPWCGHCKKLAP YE++GA ++   +VLI KVD  
Sbjct  141  VAALTESDFDAEVIHSKKHAIVEFYAPWCGHCKKLAPTYEEVGAIYEGEDNVLIAKVDAT  200

Query  337  EHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGT  483
            E+  +  +Y V GYPT+ +FP G+ EP+ Y   R   +  EF+N  AGT
Sbjct  201  ENAELAKRYNVKGYPTLFYFPPGADEPEDYSNGRDKASFVEFINEHAGT  249



>gb|ETP47794.1| protein disulfide-isomerase domain [Phytophthora parasitica P10297]
Length=362

 Score =   144 bits (364),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 62/133 (47%), Positives = 95/133 (71%), Gaps = 0/133 (0%)
 Frame = +1

Query  112  ALAIVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGAS  291
            A+++ A+      A DV VLT +NF++ V   +  L++FYAPWCGHCK +AP YE +  +
Sbjct  7    AVSMAAMALGVVTAGDVKVLTPDNFDEVVDGSKHVLIKFYAPWCGHCKSMAPTYETVATA  66

Query  292  FKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNT  471
            FKKA +V++ +VD D +K + SKYGV+G+PT+++FP+GS EP+ Y+G R+ +    F+N 
Sbjct  67   FKKADNVVVAEVDADNYKDLGSKYGVTGFPTLKYFPEGSTEPEDYKGGRSEDDFVNFLNE  126

Query  472  EAGTNVKVAAIPS  510
            +AGT+V+VA  PS
Sbjct  127  KAGTHVRVAKAPS  139


 Score =   118 bits (295),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 56/113 (50%), Positives = 73/113 (65%), Gaps = 1/113 (1%)
 Frame = +1

Query  160  VVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDCD  336
            V  LTE +F+ EV    + A+VEFYAPWCGHCK+LAP YE++GA F+    VLI KVD  
Sbjct  141  VAALTEADFDAEVIHSKKHAIVEFYAPWCGHCKQLAPTYEEVGAIFEGEDDVLIAKVDAT  200

Query  337  EHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTNVKV  495
             +  + S+Y V GYPT+ +FP GS EP+ Y   R   +  EF+N  AGT+  V
Sbjct  201  ANSELASRYNVKGYPTLFYFPPGSDEPEDYSNGRDKASFVEFINEHAGTHRTV  253



>gb|ETI50084.1| protein disulfide-isomerase domain [Phytophthora parasitica P1569]
 gb|ETL43376.1| protein disulfide-isomerase domain [Phytophthora parasitica]
 gb|ETP19875.1| protein disulfide-isomerase domain [Phytophthora parasitica CJ01A1]
Length=362

 Score =   144 bits (363),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 62/133 (47%), Positives = 95/133 (71%), Gaps = 0/133 (0%)
 Frame = +1

Query  112  ALAIVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGAS  291
            A+++ A+      A DV VLT +NF++ V   +  L++FYAPWCGHCK +AP YE +  +
Sbjct  7    AVSMAAMALGVVTAGDVKVLTPDNFDEVVDGSKHVLIKFYAPWCGHCKSMAPTYETVATA  66

Query  292  FKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNT  471
            FKKA +V++ +VD D +K + SKYGV+G+PT+++FP+GS EP+ Y+G R+ +    F+N 
Sbjct  67   FKKADNVVVAEVDADNYKDLGSKYGVTGFPTLKYFPEGSTEPEDYKGGRSEDDFVNFLNE  126

Query  472  EAGTNVKVAAIPS  510
            +AGT+V+VA  PS
Sbjct  127  KAGTHVRVAKAPS  139


 Score =   118 bits (295),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 56/113 (50%), Positives = 73/113 (65%), Gaps = 1/113 (1%)
 Frame = +1

Query  160  VVVLTEENFEKEVGQDRA-ALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDCD  336
            V  LTE +F+ EV   +  A+VEFYAPWCGHCK+LAP YE++GA F+    VLI KVD  
Sbjct  141  VAALTEADFDAEVIHSKKHAIVEFYAPWCGHCKQLAPTYEEVGAIFEGEDDVLIAKVDAT  200

Query  337  EHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTNVKV  495
             +  + S+Y V GYPT+ +FP GS EP+ Y   R   +  EF+N  AGT+  V
Sbjct  201  ANSELASRYNVKGYPTLFYFPPGSDEPEDYSNGRDKASFVEFINEHAGTHRTV  253



>ref|XP_002901765.1| thioredoxin-like protein [Phytophthora infestans T30-4]
 gb|EEY57155.1| thioredoxin-like protein [Phytophthora infestans T30-4]
Length=362

 Score =   144 bits (363),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 63/133 (47%), Positives = 93/133 (70%), Gaps = 0/133 (0%)
 Frame = +1

Query  112  ALAIVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGAS  291
            A+++ A+      A DV VLT +NF++ V   +  L++FYAPWCGHCK +AP YE +  +
Sbjct  7    AVSMAAMALGVVTAGDVKVLTPDNFDEVVDGSKHVLIKFYAPWCGHCKSMAPTYETVATA  66

Query  292  FKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNT  471
            FKKA +V++ +VD D HK + SKYGV+G+PT+++F KGS EP+ Y+G R+ +    F+N 
Sbjct  67   FKKADNVVVAEVDADSHKELGSKYGVTGFPTLKYFAKGSTEPEDYKGGRSEDDFVNFLNE  126

Query  472  EAGTNVKVAAIPS  510
            +A TNV+VA  PS
Sbjct  127  KADTNVRVAKAPS  139


 Score =   119 bits (299),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 57/113 (50%), Positives = 74/113 (65%), Gaps = 1/113 (1%)
 Frame = +1

Query  160  VVVLTEENFEKEVGQDRA-ALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDCD  336
            V  LTE +F+ EV   +  A+VEFYAPWCGHCK+LAP YE++GA F+   +VLI KVD  
Sbjct  141  VAALTEADFDAEVIHSKKHAIVEFYAPWCGHCKQLAPTYEEVGAIFEGEDNVLIAKVDAT  200

Query  337  EHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTNVKV  495
             +  V S+Y V GYPT+ +FP GS EP+ Y   R   +  EF+N  AGT+  V
Sbjct  201  ANAEVASRYNVKGYPTLFYFPPGSDEPEDYSNGRDKASFVEFINEHAGTHRTV  253



>ref|XP_008891720.1| protein disulfide-isomerase domain [Phytophthora parasitica INRA-310]
 gb|ETN22471.1| protein disulfide-isomerase domain [Phytophthora parasitica INRA-310]
Length=353

 Score =   142 bits (357),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 61/130 (47%), Positives = 92/130 (71%), Gaps = 0/130 (0%)
 Frame = +1

Query  121  IVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKK  300
            + A+      A DV VLT +NF++ V   +  L++FYAPWCGHCK +AP YE +  +FKK
Sbjct  1    MAAMALGVVTAGDVKVLTPDNFDEVVDGSKHVLIKFYAPWCGHCKSMAPTYETVATAFKK  60

Query  301  AKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAG  480
            A +V++ +VD D +K + SKYGV+G+PT+++FP+GS EP+ Y+G R+ +    F+N +AG
Sbjct  61   ADNVVVAEVDADNYKDLGSKYGVTGFPTLKYFPEGSTEPEDYKGGRSEDDFVNFLNEKAG  120

Query  481  TNVKVAAIPS  510
            T+V+VA  PS
Sbjct  121  THVRVAKAPS  130


 Score =   118 bits (295),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/113 (50%), Positives = 73/113 (65%), Gaps = 1/113 (1%)
 Frame = +1

Query  160  VVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDCD  336
            V  LTE +F+ EV    + A+VEFYAPWCGHCK+LAP YE++GA F+    VLI KVD  
Sbjct  132  VAALTEADFDAEVIHSKKHAIVEFYAPWCGHCKQLAPTYEEVGAIFEGEDDVLIAKVDAT  191

Query  337  EHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTNVKV  495
             +  + S+Y V GYPT+ +FP GS EP+ Y   R   +  EF+N  AGT+  V
Sbjct  192  ANSELASRYNVKGYPTLFYFPPGSDEPEDYSNGRDKASFVEFINEHAGTHRTV  244



>gb|ETM49714.1| protein disulfide-isomerase domain [Phytophthora parasitica]
Length=353

 Score =   142 bits (357),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 61/130 (47%), Positives = 92/130 (71%), Gaps = 0/130 (0%)
 Frame = +1

Query  121  IVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKK  300
            + A+      A DV VLT +NF++ V   +  L++FYAPWCGHCK +AP YE +  +FKK
Sbjct  1    MAAMALGVVTAGDVKVLTPDNFDEVVDGSKHVLIKFYAPWCGHCKSMAPTYETVATAFKK  60

Query  301  AKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAG  480
            A +V++ +VD D +K + SKYGV+G+PT+++FP+GS EP+ Y+G R+ +    F+N +AG
Sbjct  61   ADNVVVAEVDADNYKDLGSKYGVTGFPTLKYFPEGSTEPEDYKGGRSEDDFVNFLNEKAG  120

Query  481  TNVKVAAIPS  510
            T+V+VA  PS
Sbjct  121  THVRVAKAPS  130


 Score =   118 bits (295),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/113 (50%), Positives = 73/113 (65%), Gaps = 1/113 (1%)
 Frame = +1

Query  160  VVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDCD  336
            V  LTE +F+ EV    + A+VEFYAPWCGHCK+LAP YE++GA F+    VLI KVD  
Sbjct  132  VAALTEADFDAEVIHSKKHAIVEFYAPWCGHCKQLAPTYEEVGAIFEGEDDVLIAKVDAT  191

Query  337  EHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTNVKV  495
             +  + S+Y V GYPT+ +FP GS EP+ Y   R   +  EF+N  AGT+  V
Sbjct  192  ANSELASRYNVKGYPTLFYFPPGSDEPEDYSNGRDKASFVEFINEHAGTHRTV  244



>gb|ETK89975.1| protein disulfide-isomerase domain [Phytophthora parasitica]
 gb|ETL96560.1| protein disulfide-isomerase domain [Phytophthora parasitica]
 gb|ETO78818.1| protein disulfide-isomerase domain [Phytophthora parasitica P1976]
Length=353

 Score =   142 bits (357),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 61/130 (47%), Positives = 92/130 (71%), Gaps = 0/130 (0%)
 Frame = +1

Query  121  IVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKK  300
            + A+      A DV VLT +NF++ V   +  L++FYAPWCGHCK +AP YE +  +FKK
Sbjct  1    MAAMALGVVTAGDVKVLTPDNFDEVVDGSKHVLIKFYAPWCGHCKSMAPTYETVATAFKK  60

Query  301  AKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAG  480
            A +V++ +VD D +K + SKYGV+G+PT+++FP+GS EP+ Y+G R+ +    F+N +AG
Sbjct  61   ADNVVVAEVDADNYKDLGSKYGVTGFPTLKYFPEGSTEPEDYKGGRSEDDFVNFLNEKAG  120

Query  481  TNVKVAAIPS  510
            T+V+VA  PS
Sbjct  121  THVRVAKAPS  130


 Score =   118 bits (295),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/113 (50%), Positives = 73/113 (65%), Gaps = 1/113 (1%)
 Frame = +1

Query  160  VVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDCD  336
            V  LTE +F+ EV    + A+VEFYAPWCGHCK+LAP YE++GA F+    VLI KVD  
Sbjct  132  VAALTEADFDAEVIHSKKHAIVEFYAPWCGHCKQLAPTYEEVGAIFEGEDDVLIAKVDAT  191

Query  337  EHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTNVKV  495
             +  + S+Y V GYPT+ +FP GS EP+ Y   R   +  EF+N  AGT+  V
Sbjct  192  ANSELASRYNVKGYPTLFYFPPGSDEPEDYSNGRDKASFVEFINEHAGTHRTV  244



>ref|XP_003293769.1| hypothetical protein DICPUDRAFT_51128 [Dictyostelium purpureum]
 gb|EGC29704.1| hypothetical protein DICPUDRAFT_51128 [Dictyostelium purpureum]
Length=362

 Score =   142 bits (357),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 71/140 (51%), Positives = 91/140 (65%), Gaps = 4/140 (3%)
 Frame = +1

Query  100  RICTALAIVALFFSAAFADD--VVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEY  273
            RI   + ++A+   A  + D  VV LT ENF+K V   +   V+FYAPWCGHCKKLAP+Y
Sbjct  2    RILFYITLIAMALVALVSADGNVVTLTPENFDKVVDGSKTVFVKFYAPWCGHCKKLAPDY  61

Query  274  EQLGASFKKAKS-VLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEA  450
            E L  +F+KA   V I KV+CD+HK +CSKY VSGYPT++ F K S   K Y G R+ E 
Sbjct  62   EVLADTFQKASDKVAIAKVNCDDHKDLCSKYDVSGYPTLKIFDK-STTSKDYNGQRSIEE  120

Query  451  LTEFVNTEAGTNVKVAAIPS  510
            L  ++N  AGTN+KV   PS
Sbjct  121  LITYINNHAGTNMKVKKAPS  140


 Score =   121 bits (304),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 76/112 (68%), Gaps = 3/112 (3%)
 Frame = +1

Query  157  DVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDC  333
            +VV LT  NFE  V  + +  LVEF+APWCGHCKKLAP+YE LG ++   K V+I K+DC
Sbjct  141  NVVDLTPSNFESVVLDKSKHVLVEFFAPWCGHCKKLAPDYEILGNTYANEKDVVIAKMDC  200

Query  334  DE--HKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGT  483
            D   +K +CSKYG++G+PTI++F K + E  KYE  R  +    F+N  AG+
Sbjct  201  DNAANKDLCSKYGITGFPTIKFFSKDNKEGAKYEQGRELDTFINFINKNAGS  252



>ref|XP_001745181.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ89759.1| predicted protein [Monosiga brevicollis MX1]
Length=352

 Score =   142 bits (357),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 61/136 (45%), Positives = 91/136 (67%), Gaps = 0/136 (0%)
 Frame = +1

Query  88   MSRSRICTALAIVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAP  267
            M+  R   A  ++AL  +AA A DV+ LT + F+  +  DR ALVEF+APWCGHCK LAP
Sbjct  1    MTMIRSMLAAGVLALVMAAATASDVIDLTPDTFDDIINGDRPALVEFFAPWCGHCKSLAP  60

Query  268  EYEQLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAE  447
             +E+LG ++   K V+I KVD  EH+ + S++GV+G+PT+++FPKGS EP+ Y+G R   
Sbjct  61   TWEELGTAYASQKDVIIAKVDASEHRDLGSRFGVTGFPTLKFFPKGSTEPEDYKGGRALN  120

Query  448  ALTEFVNTEAGTNVKV  495
             L +F+  + G   ++
Sbjct  121  DLADFMLQKTGYRARI  136


 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 73/110 (66%), Gaps = 1/110 (1%)
 Frame = +1

Query  160  VVVLTEENFEK-EVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDCD  336
            V VL   NF+   +  D+  LVEFYAPWCGHCK +AP YE+ G +F   ++V++ KVD D
Sbjct  143  VKVLDPTNFDAIALDTDKDVLVEFYAPWCGHCKSVAPIYEKAGLAFANEENVVVAKVDAD  202

Query  337  EHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
            +H  + SK+GVSG+PT ++FPKGS E + Y   R  ++   F+N +AGT 
Sbjct  203  KHSELASKFGVSGFPTFKFFPKGSTEAEDYSSGRELQSFLTFLNEKAGTQ  252



>emb|CCA15328.1| SSP8 [Albugo laibachii Nc14]
Length=409

 Score =   142 bits (357),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 90/134 (67%), Gaps = 2/134 (1%)
 Frame = +1

Query  115  LAIVALFFSAAFA--DDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGA  288
            L +V LF    FA   DVV LT +NF+K V      LVEFYAPWCGHCKKL+P YE +G 
Sbjct  44   LQLVPLFCVVPFALASDVVDLTPDNFDKSVDGSSHVLVEFYAPWCGHCKKLSPLYEIVGT  103

Query  289  SFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVN  468
            SFK  + V++ KV+ D H  +  KYGVSG+PT+++FPKGS E ++Y G R+ +    F+N
Sbjct  104  SFKTVEDVVVAKVNADSHGELRDKYGVSGFPTLKYFPKGSTEAEEYSGGRSEDDFIAFLN  163

Query  469  TEAGTNVKVAAIPS  510
             ++G+NVK A  PS
Sbjct  164  DKSGSNVKAAKPPS  177


 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/109 (45%), Positives = 64/109 (59%), Gaps = 1/109 (1%)
 Frame = +1

Query  160  VVVLTEENFEKEVGQD-RAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDCD  336
            V  LT   FE +V +  R A+VEFYAPWCGHC  L P YE+L   F+   +VLI KVD  
Sbjct  179  VPALTASTFESQVFESGRHAVVEFYAPWCGHCMSLVPIYEKLAEVFQAEDNVLIAKVDAT  238

Query  337  EHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGT  483
              +S+ + Y V GYPTI++F   S  P+ Y   R   +   F+N +AGT
Sbjct  239  AEQSLGTAYDVKGYPTIKYFAPHSRTPEDYSEGRDLTSFVNFINEKAGT  287



>ref|XP_004354984.1| protein disulfide isomerase [Dictyostelium fasciculatum]
 gb|EGG16584.1| protein disulfide isomerase [Dictyostelium fasciculatum]
Length=377

 Score =   140 bits (354),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 79/112 (71%), Gaps = 1/112 (1%)
 Frame = +1

Query  151  ADDVVVLTEENFEK-EVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKV  327
            A +V+ L + NFEK  + +D+  LVEFYAPWCGHCKKLAP+YE L  +F   K V I KV
Sbjct  157  ASNVIDLDDSNFEKIALDEDKHVLVEFYAPWCGHCKKLAPDYEVLANTFANDKDVEITKV  216

Query  328  DCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGT  483
            DCD HK +CSKYG+SG+PT++WFPK + E +KYE  R  +    F+N  AGT
Sbjct  217  DCDAHKDLCSKYGISGFPTLKWFPKNNKEGEKYEQGREVDTFISFINKNAGT  268


 Score =   128 bits (321),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 60/137 (44%), Positives = 92/137 (67%), Gaps = 3/137 (2%)
 Frame = +1

Query  88   MSRSRICTALAIVALFFSAAFAD-DVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLA  264
            M+ ++I   LA+ A+  +   AD +VV L  + F+  V   ++  V+FYAPWCGHCKK+A
Sbjct  19   MNMNKIIL-LALFAVIVACVAADGNVVDLKPDTFDSVVDGSKSVFVKFYAPWCGHCKKMA  77

Query  265  PEYEQLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTA  444
            P+YE +  +F  +K V++ KV+CD+HK +CSK+GV+GYPT++ + K S   K Y G R+ 
Sbjct  78   PDYEIIADTFAGSKQVVVAKVNCDDHKELCSKHGVNGYPTLKMYAK-STTAKDYNGGRSI  136

Query  445  EALTEFVNTEAGTNVKV  495
            + +  F+N  AGTNV+V
Sbjct  137  DEIITFINGAAGTNVRV  153



>dbj|GAM25799.1| hypothetical protein SAMD00019534_089740, partial [Acytostelium 
subglobosum LB1]
Length=357

 Score =   138 bits (348),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 82/118 (69%), Gaps = 1/118 (1%)
 Frame = +1

Query  157  DVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDCD  336
            +V+VL+ ENF+  V   +   V+FYAPWCGHCKKLAP+YE +  +F  +KSV + K+DCD
Sbjct  23   NVIVLSPENFDTVVDGTKTVFVKFYAPWCGHCKKLAPDYEIIADTFAGSKSVAVAKLDCD  82

Query  337  EHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTNVKVAAIPS  510
             HK +C+KY VSGYPT++ F K S EPK Y G R+ + +  F+N  AGTN KV   PS
Sbjct  83   VHKDLCAKYDVSGYPTLKVFAK-STEPKDYNGMRSVDEIVTFINNNAGTNAKVKKAPS  139


 Score =   124 bits (312),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/110 (53%), Positives = 74/110 (67%), Gaps = 1/110 (1%)
 Frame = +1

Query  157  DVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDC  333
            +VV LT  NF++ V    +  LVEFYAPWCGHCKKLAP+YE L  +F    +V+I K+DC
Sbjct  140  NVVDLTPANFDQVVLDAKKDVLVEFYAPWCGHCKKLAPDYEILANTFANDANVVIAKIDC  199

Query  334  DEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGT  483
            D +K  C KY V+GYPTI++FPKG+   +KYE  R  E    F+N  AGT
Sbjct  200  DANKEQCQKYEVTGYPTIKFFPKGNKAGEKYEQGRDVETFVSFINKNAGT  249



>ref|XP_003384600.1| PREDICTED: protein disulfide isomerase-like 2-1 [Amphimedon queenslandica]
Length=353

 Score =   136 bits (343),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 84/117 (72%), Gaps = 0/117 (0%)
 Frame = +1

Query  160  VVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDCDE  339
            VV LT  NF++ V   +AA VEFYAPWCGHCK+LAPEYE+LGA+++ +  V+I KVD D 
Sbjct  22   VVDLTSSNFDQVVDGSKAAFVEFYAPWCGHCKRLAPEYEKLGAAYEGSNDVVIAKVDADA  81

Query  340  HKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTNVKVAAIPS  510
             +++  ++GV G+PT+++FPKGS  P+ Y G R+A+   +F+N + G+N  +   PS
Sbjct  82   DRTLGGRFGVRGFPTLKFFPKGSTTPEDYNGGRSADDFIKFINEKTGSNAGIKTPPS  138


 Score =   127 bits (318),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 78/111 (70%), Gaps = 1/111 (1%)
 Frame = +1

Query  157  DVVVLTEENFEK-EVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDC  333
            DVVVL   NF+   + +D+  LVEFYAPWCGHCK L P YE++  +FK  ++ ++  VD 
Sbjct  139  DVVVLDPSNFDSVALNKDKDVLVEFYAPWCGHCKALIPVYEEVATTFKNDENCIVANVDA  198

Query  334  DEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
            D H+S+ +KYGVSG+PTI++FPKGS EP+ Y G R  +   +F+N + GT+
Sbjct  199  DGHRSLGTKYGVSGFPTIKFFPKGSTEPEDYNGGRGVDDFIKFLNEKCGTH  249



>ref|XP_006681835.1| hypothetical protein BATDEDRAFT_91424 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF77760.1| hypothetical protein BATDEDRAFT_91424 [Batrachochytrium dendrobatidis 
JAM81]
Length=361

 Score =   136 bits (343),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 63/128 (49%), Positives = 89/128 (70%), Gaps = 3/128 (2%)
 Frame = +1

Query  121  IVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKK  300
            +VA+F     A DVV LT +NF++ VG D+  LVEF+APWCGHCK LAP YE++  SF K
Sbjct  9    VVAVFAGLVAASDVVELTPKNFKEVVGGDQDVLVEFFAPWCGHCKSLAPHYEEVATSFVK  68

Query  301  AK-SVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEA  477
             K SV+I KVD D H+S+  ++G+ G+PT++WFPK SL P  Y G R    +++F+ ++ 
Sbjct  69   HKSSVVIAKVDADAHRSLGDEFGIQGFPTLKWFPKKSLTPTDYTGDRDVAGISDFITSKT  128

Query  478  G--TNVKV  495
            G  +N+KV
Sbjct  129  GLKSNIKV  136


 Score =   108 bits (270),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 49/110 (45%), Positives = 71/110 (65%), Gaps = 1/110 (1%)
 Frame = +1

Query  160  VVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDCD  336
            V VLT  NF+++V    +  LVEFYAPWCGHCK LAP YE+L  +F    + +I  +D  
Sbjct  141  VKVLTSSNFKEQVLDSGKNVLVEFYAPWCGHCKSLAPIYEKLAQTFTLESNCIIANLDAT  200

Query  337  EHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
            + + V   Y V GYPTIQ+FP GS  P+ Y+G+R  ++  +++N + GT+
Sbjct  201  KAQDVADTYNVKGYPTIQFFPAGSETPELYDGSRDEDSFVKYLNQKCGTH  250



>ref|XP_007207338.1| hypothetical protein PRUPE_ppa008282mg [Prunus persica]
 gb|EMJ08537.1| hypothetical protein PRUPE_ppa008282mg [Prunus persica]
Length=338

 Score =   134 bits (337),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 66/92 (72%), Gaps = 0/92 (0%)
 Frame = +1

Query  235  PWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLE  414
            P     K L      L    +K    LIGKVDCDEHK VCSKYGVSGYPTIQWFPKGSLE
Sbjct  27   PGVAIVKSLLQSMRSLAQVLRKQNPFLIGKVDCDEHKGVCSKYGVSGYPTIQWFPKGSLE  86

Query  415  PKKYEGARTAEALTEFVNTEAGTNVKVAAIPS  510
            PKKYEG RTAEAL EFVN E GTNVK++A PS
Sbjct  87   PKKYEGGRTAEALAEFVNKEGGTNVKISAAPS  118


 Score =   118 bits (296),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 53/116 (46%), Positives = 81/116 (70%), Gaps = 1/116 (1%)
 Frame = +1

Query  142  AAFADDVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLI  318
            +A   +V VLT++NF + V  + +  LVEFYAPWCGHCK LAP YE++  +FK  + V+I
Sbjct  114  SAAPSNVAVLTQDNFNEVVLDETKDVLVEFYAPWCGHCKSLAPTYEKVATAFKLEEGVVI  173

Query  319  GKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
              +D D++K +  KYGVSG+PT+++FPK + E ++Y G R  E   +F+N ++GT+
Sbjct  174  ANLDADKYKDLAEKYGVSGFPTLKFFPKNNKEGEEYGGGRDLEDFVDFINEKSGTS  229



>gb|EFA84124.1| SNF2-related domain-containing protein [Polysphondylium pallidum 
PN500]
Length=1905

 Score =   139 bits (351),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 68/132 (52%), Positives = 89/132 (67%), Gaps = 2/132 (2%)
 Frame = +1

Query  118   AIVALFFSAAFAD-DVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASF  294
             A++AL  +   AD +VVVL+ +NF+  V   +   V+FYAPWCGHCKKLAP+YE +  +F
Sbjct  1556  ALIALCVAFVAADGNVVVLSPDNFDTVVDGTKTVFVKFYAPWCGHCKKLAPDYEVIADTF  1615

Query  295   KKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTE  474
               +K V+I K+DCD HK +C KY VSGYPT++ F K S E K Y G R+ E +  FVN  
Sbjct  1616  AGSKQVVIAKLDCDVHKELCGKYDVSGYPTLKVFAK-SKEAKDYNGMRSIEEIVTFVNNA  1674

Query  475   AGTNVKVAAIPS  510
             AGTNV+V   PS
Sbjct  1675  AGTNVRVKKAPS  1686


 Score =   137 bits (345),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 61/111 (55%), Positives = 78/111 (70%), Gaps = 1/111 (1%)
 Frame = +1

Query  157   DVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDC  333
             +V+ LT ENF+ EV  +D+  LVEFYAPWCGHCKKLAP+YE L  ++   K V I KVDC
Sbjct  1687  NVIDLTPENFDAEVLNKDKDVLVEFYAPWCGHCKKLAPDYEILANTYAGDKHVGIAKVDC  1746

Query  334   DEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
             D HK +CSKY + G+PT++WFPK + E +KYE  R  E    F+N  AGT+
Sbjct  1747  DSHKELCSKYDIKGFPTLKWFPKDNKEGEKYEQGRELETFITFINKNAGTH  1797



>gb|AIG55436.1| secreted protein [Thraustotheca clavata]
Length=353

 Score =   134 bits (336),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 60/127 (47%), Positives = 87/127 (69%), Gaps = 0/127 (0%)
 Frame = +1

Query  118  AIVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFK  297
            A V++  + A A DVVVLT +NF+  V   +   V+FYAPWCGHCK LAP +E +  SFK
Sbjct  7    AAVSVLATTALASDVVVLTPDNFQDVVDGSKNVFVKFYAPWCGHCKSLAPVWETVATSFK  66

Query  298  KAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEA  477
            K   V+I +VD DEH+ +  ++ V+G+PT++++ KG+  P  Y G R+ + L EF+N +A
Sbjct  67   KENDVVIAEVDADEHRILGEEFEVTGFPTLKFWNKGAKHPDNYNGGRSEDDLVEFINEKA  126

Query  478  GTNVKVA  498
            GTNV+VA
Sbjct  127  GTNVRVA  133


 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 69/110 (63%), Gaps = 3/110 (3%)
 Frame = +1

Query  160  VVVLTEENFEKEVGQD--RAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDC  333
            V VLTE NF   + Q+  +  LVEFYAPWCGHCK+LAP ++ L   +   + V+I KVD 
Sbjct  139  VEVLTESNFAA-IAQNPKKHVLVEFYAPWCGHCKQLAPTWDVLAEIYAGEEDVVIAKVDA  197

Query  334  DEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGT  483
                 + SK+GV+GYPTI++F  G+ +P+ Y   R      +FVN +AGT
Sbjct  198  TATGDLASKFGVNGYPTIKYFGLGTSDPEDYGFGRELSEFVDFVNEKAGT  247



>ref|XP_004996279.1| hypothetical protein PTSG_02776 [Salpingoeca rosetta]
 gb|EGD82096.1| hypothetical protein PTSG_02776 [Salpingoeca rosetta]
Length=349

 Score =   132 bits (333),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 57/127 (45%), Positives = 86/127 (68%), Gaps = 0/127 (0%)
 Frame = +1

Query  130  LFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKS  309
            L F+A  +  V+ L  ++F+  V  DR   V+FYAPWCGHCK +AP YE++G +F     
Sbjct  11   LLFAAVTSAHVLELEPDSFDDIVNGDRFVFVKFYAPWCGHCKSMAPAYEEVGDAFSHISD  70

Query  310  VLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTNV  489
            V+I KVD D+H+ + S++GVSG+PT+++FPKG+ EP+ Y G R AE L +F+N ++G   
Sbjct  71   VVIAKVDADKHRELGSRFGVSGFPTLKYFPKGATEPEAYSGGRGAEDLVQFINEKSGFRG  130

Query  490  KVAAIPS  510
            ++   PS
Sbjct  131  RIKKQPS  137


 Score =   120 bits (301),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 76/109 (70%), Gaps = 1/109 (1%)
 Frame = +1

Query  157  DVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDC  333
            DVVVL E NF++ V  +++  LVEFYAPWCGHCK LAP YE++G  FK    ++I K+D 
Sbjct  138  DVVVLDESNFDQIVMDENKDVLVEFYAPWCGHCKSLAPTYEKVGNDFKNEDDIVIAKMDA  197

Query  334  DEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAG  480
            D+++ + S+Y V+G+PT++WFPK + + + Y   R+ +   EF+N + G
Sbjct  198  DKYRGIPSRYDVTGFPTLKWFPKSNKDGEDYSSGRSEKDFVEFINEKTG  246



>emb|CDO71019.1| hypothetical protein BN946_scf184844.g23 [Trametes cinnabarina]
Length=376

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 88/134 (66%), Gaps = 2/134 (1%)
 Frame = +1

Query  100  RICTALAIVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQ  279
            R+  AL    L   +AFA +V+ LT +NF++ VG+ + ALVEF+APWCGHCK LAP YEQ
Sbjct  2    RLSFALFATVLSVGSAFASNVLELTPDNFDEHVGKGKPALVEFFAPWCGHCKNLAPVYEQ  61

Query  280  LGASFKKAKS-VLIGKVDCDE-HKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEAL  453
            L  +F  AK  V+I KVD D   K +  KYGV+G+PT++WF     EP+KYEG R  EAL
Sbjct  62   LADAFAHAKDKVVIAKVDADGVGKPLGQKYGVTGFPTLKWFDADGGEPEKYEGGRDLEAL  121

Query  454  TEFVNTEAGTNVKV  495
              FV T++G    +
Sbjct  122  ANFVTTKSGVKSSI  135


 Score = 95.1 bits (235),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 64/106 (60%), Gaps = 3/106 (3%)
 Frame = +1

Query  196  VGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDCD--EHKSVCSKYGV  369
            +  ++  +V F APWCGHCK+L P YE++   F    + ++  VD D   +K +  KYG+
Sbjct  156  LNPEKDVIVAFTAPWCGHCKRLKPIYEEVAKDFSSESNCVVANVDADAKNNKPLAEKYGI  215

Query  370  SGYPTIQWFPKGSL-EPKKYEGARTAEALTEFVNTEAGTNVKVAAI  504
               PTI++FPKG+  EP  Y+GART EA  EF+N + GT   V  +
Sbjct  216  GSLPTIKFFPKGNKDEPIDYDGARTEEAFVEFLNEKCGTRRTVGGL  261



>emb|CBK23734.2| unnamed protein product [Blastocystis hominis]
Length=369

 Score =   132 bits (332),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/137 (47%), Positives = 92/137 (67%), Gaps = 2/137 (1%)
 Frame = +1

Query  88   MSRSRICTALAIVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAP  267
            MS ++I    AI  LF  A  A  VV LT ENF++ V  D+   V+FYAPWCGHC+ LAP
Sbjct  1    MSENKILIMFAITLLFIIALNAR-VVPLTHENFDEVVNGDKNVFVKFYAPWCGHCQHLAP  59

Query  268  EYEQLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLE-PKKYEGARTA  444
            EYE L  SF + K+V+I +V+ DE + + +++ + GYPT+++FP G  + P+ Y+G R+A
Sbjct  60   EYEILAESFARVKNVVIAEVNADEDRELANRFEIHGYPTLKFFPAGHPDAPEVYQGERSA  119

Query  445  EALTEFVNTEAGTNVKV  495
            EALT ++N + GT V V
Sbjct  120  EALTNWLNEKMGTRVTV  136


 Score =   103 bits (258),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 50/111 (45%), Positives = 74/111 (67%), Gaps = 3/111 (3%)
 Frame = +1

Query  154  DDVVVLTEENFEKEVGQD-RAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVD  330
            ++V VLT   F++ +G++ +   V+FYAPWCGHCKKLAP+Y++L   F + K+V+I +VD
Sbjct  141  NNVKVLTPGTFDQTIGEEGKTVFVKFYAPWCGHCKKLAPDYKKLADVFAEEKNVIIAEVD  200

Query  331  CDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGT  483
             D++K +   Y V+GYPT++ F  G  E   Y+ AR   +L  FVN  AGT
Sbjct  201  ADKYKDLARAYDVAGYPTLKLFKNG--EIVDYKEARDLASLVAFVNKHAGT  249



>ref|XP_004340793.1| Protein disulfideisomerase, putative [Acanthamoeba castellanii 
str. Neff]
 gb|ELR18741.1| Protein disulfideisomerase, putative [Acanthamoeba castellanii 
str. Neff]
Length=358

 Score =   132 bits (331),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/110 (54%), Positives = 79/110 (72%), Gaps = 2/110 (2%)
 Frame = +1

Query  160  VVVLTEENFEKEVGQ-DRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDCD  336
            V VL+E NF+ E+ + D  ALVEFYAPWCGHCKKL PEYE++ A++K    V + KVDCD
Sbjct  144  VTVLSESNFKSEIVESDTDALVEFYAPWCGHCKKLTPEYEKVAAAYKNEAGVKVAKVDCD  203

Query  337  EHKSVCSKYGVSGYPTIQWFPKG-SLEPKKYEGARTAEALTEFVNTEAGT  483
             + ++C +YGVSGYPT++WFPKG    P  Y+G R   +  +F+N +AGT
Sbjct  204  ANSALCQQYGVSGYPTLKWFPKGEKASPVDYDGGRDLASFVKFINEKAGT  253


 Score =   112 bits (279),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 74/119 (62%), Gaps = 2/119 (2%)
 Frame = +1

Query  157  DVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKS-VLIGKVDC  333
            +VV LT ENF+K +   + A VEFYAPWCGHCK L P YE    +F  AK  V+I KVD 
Sbjct  22   NVVDLTPENFDKVLDGSKPAFVEFYAPWCGHCKNLIPVYEVFADAFAHAKDKVVIAKVDA  81

Query  334  DEHKSVCSKYGVSGYPTIQWFPKGSL-EPKKYEGARTAEALTEFVNTEAGTNVKVAAIP  507
            D H ++ S++ V G+PT+++FP G+  E +KYEG R+ + L  F+    G   K A  P
Sbjct  82   DAHSALGSRFDVKGFPTLKFFPSGNPEESQKYEGGRSEDDLISFIEKNTGVKAKRAPAP  140



>ref|XP_566486.1| disulfide-isomerase precursor [Cryptococcus neoformans var. neoformans 
JEC21]
 ref|XP_778057.1| hypothetical protein CNBA0600 [Cryptococcus neoformans var. neoformans 
B-3501A]
 gb|EAL23410.1| hypothetical protein CNBA0600 [Cryptococcus neoformans var. neoformans 
B-3501A]
 gb|AAW40667.1| disulfide-isomerase precursor, putative [Cryptococcus neoformans 
var. neoformans JEC21]
Length=411

 Score =   132 bits (331),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 69/142 (49%), Positives = 92/142 (65%), Gaps = 5/142 (4%)
 Frame = +1

Query  94   RSRICTALAIVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEY  273
            R  I  + A++A F S   A +VV L   NF++ VGQD+ ALVEF+APWCGHCK LAP Y
Sbjct  2    RLSISISAALLA-FTSLVSASNVVDLDSTNFDQIVGQDKGALVEFFAPWCGHCKNLAPTY  60

Query  274  EQLGASFKKAKSVLIGKVDCDE-HKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEA  450
            E+L  +F   K V+I K D D   + + S++GVSG+PT++WFP GSLEP  Y GAR  E 
Sbjct  61   ERLADAFPTDK-VVIAKTDADGVGRELGSRFGVSGFPTLKWFPAGSLEPIPYSGARDLET  119

Query  451  LTEFVNTEAG--TNVKVAAIPS  510
            L  FV  ++G  +N+K    P+
Sbjct  120  LAAFVTKQSGVKSNIKPPPPPA  141


 Score =   103 bits (258),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 49/117 (42%), Positives = 72/117 (62%), Gaps = 3/117 (3%)
 Frame = +1

Query  169  LTEENFEK-EVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDCDE--  339
            L   NF++  + + +  LV F APWCGHCK + P YE++   F     V+I  +D DE  
Sbjct  145  LDASNFDEIALNESKNVLVAFTAPWCGHCKNMKPAYEKVAKVFSSEPDVVIALMDADEAE  204

Query  340  HKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTNVKVAAIPS  510
            +K V  +YGVS +PTI++FPKGS EP  Y+  RTAE    ++N ++GT+  V+ + S
Sbjct  205  NKPVAQRYGVSSFPTIKFFPKGSKEPVAYDSGRTAEQFVNWINEKSGTHRSVSGLLS  261



>gb|KFH67976.1| protein disulfide isomerase family A, member 6 [Mortierella verticillata 
NRRL 6337]
Length=370

 Score =   131 bits (329),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 65/135 (48%), Positives = 91/135 (67%), Gaps = 5/135 (4%)
 Frame = +1

Query  112  ALAIVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGAS  291
            A+A      S AFAD+V  L  E+F+  +G ++  LVEFYAPWCGHCK LAP YE+LG +
Sbjct  10   AIAAFIALASRAFADNVHALDSESFDSVIG-NKPTLVEFYAPWCGHCKNLAPIYEELGDA  68

Query  292  FKKAKS-VLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKG-SLEPKKYEGARTAEALTEFV  465
            F   K  VLI KVD DEH+++ S+YGV G+PT++WFP G + +P+ Y G R  ++L  FV
Sbjct  69   FSHKKDEVLIAKVDADEHRTLGSRYGVEGFPTLKWFPNGINSDPEDYSGGRDLDSLASFV  128

Query  466  NTEAG--TNVKVAAI  504
              ++G  +++K A I
Sbjct  129  TKKSGVRSSIKKAVI  143


 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 50/111 (45%), Positives = 70/111 (63%), Gaps = 4/111 (4%)
 Frame = +1

Query  160  VVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDCD  336
            V V+T+  F+ +V    +  LVEFYAPWCG+C+ LAP YE++G  F K K V+I K+D  
Sbjct  146  VEVVTDATFDSKVTNSKKNVLVEFYAPWCGYCQGLAPTYEKVGHDFAKEKDVIIAKIDAT  205

Query  337  EHKSVCSKYGVSGYPTIQWF-PKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
               +  SKYGVS YPTI++F   G++   +YEG R  +   +F+N  AGT 
Sbjct  206  VETASASKYGVSSYPTIKYFAADGTV--VEYEGDRDEQDFIDFINKRAGTQ  254



>gb|KFH68275.1| hypothetical protein MVEG_05093 [Mortierella verticillata NRRL 
6337]
Length=361

 Score =   130 bits (328),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 90/138 (65%), Gaps = 7/138 (5%)
 Frame = +1

Query  103  ICTALAIVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQL  282
            I T L++ AL      AD+V+ LT + F+KE+G     LVEFYAPWCGHCK LAP YE+L
Sbjct  11   IATVLSLAAL----VAADNVIALTPKTFDKEIGS-TPTLVEFYAPWCGHCKNLAPIYEEL  65

Query  283  GASFK-KAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKG-SLEPKKYEGARTAEALT  456
            G++F  K   VLI KVD D H+ + S++G+ G+PT++WFP+G    P+ Y G R  +AL+
Sbjct  66   GSAFAGKNDKVLIAKVDADAHRELGSRFGIKGFPTLKWFPRGIDGAPEDYSGGRDLDALS  125

Query  457  EFVNTEAGTNVKVAAIPS  510
             FV  ++G    +A + S
Sbjct  126  AFVTQKSGVKSSIAKVIS  143


 Score =   106 bits (265),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 53/117 (45%), Positives = 72/117 (62%), Gaps = 4/117 (3%)
 Frame = +1

Query  160  VVVLTEENFEKEVGQD-RAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDCD  336
            V VLT+ NF+ EV    +  LVEFYAPWCGHCK LAP YE +   F   K+V+I KVD  
Sbjct  145  VSVLTDANFDAEVVHSGKNVLVEFYAPWCGHCKNLAPTYESVAQDFLNEKNVVIAKVDAT  204

Query  337  EHKSVCSKYGVSGYPTIQWF-PKGSLEPKKYEGARTAEALTEFVNTEAGTNVKVAAI  504
            E K +  KY + G+PT+++F   GS+E   YEG R+ +   +F+N + GT   V  +
Sbjct  205  EEKGLGDKYEIQGFPTLKFFAADGSVE--NYEGGRSEQDFVDFINKKVGTARAVGGL  259



>gb|EJU04800.1| disulfide-isomerase precursor [Dacryopinax sp. DJM-731 SS1]
Length=389

 Score =   131 bits (329),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 60/135 (44%), Positives = 87/135 (64%), Gaps = 1/135 (1%)
 Frame = +1

Query  109  TALAIVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGA  288
            T +++ A F +   A +V+ L    F++ +G D  ALVEF+APWCGHCK LAP YEQL  
Sbjct  4    TYISLFAAFAATVLASNVLELESTTFDQHIGGDAPALVEFFAPWCGHCKNLAPVYEQLAD  63

Query  289  SFKKAKSVLIGKVDCD-EHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFV  465
            ++   + V+I KVD D   K   +++GV+G+PT++WFP GSLEP+ YEG R  +AL  FV
Sbjct  64   AYSHTQKVIIAKVDADGAGKEAGARFGVTGFPTLKWFPAGSLEPEPYEGQRDLDALISFV  123

Query  466  NTEAGTNVKVAAIPS  510
             +++G   K    P+
Sbjct  124  ESKSGVKAKGPPPPT  138


 Score = 79.3 bits (194),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 41/111 (37%), Positives = 63/111 (57%), Gaps = 6/111 (5%)
 Frame = +1

Query  166  VLTEENFEKEVGQD--RAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDCD-  336
            +L   +F+ EV  D  +  LV F APWCGHCK L P  E++   F+   + +I + D D 
Sbjct  141  ILQSHDFD-EVVMDPSKDVLVAFTAPWCGHCKNLKPTLEKVAQDFQSEPACVIAEFDADA  199

Query  337  -EHKSVCSKYGVSGYPTIQWFPKGSLE-PKKYEGARTAEALTEFVNTEAGT  483
              +K +  +Y V+ YPTI++FP+G+ +  + Y   R+ E   EF+N   GT
Sbjct  200  ATNKPIAGRYNVNSYPTIKFFPRGNDKVAEDYMQGRSEEQFVEFLNERCGT  250



>gb|AFR92209.2| protein disulfide-isomerase [Cryptococcus neoformans var. grubii 
H99]
Length=411

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 68/142 (48%), Positives = 90/142 (63%), Gaps = 5/142 (4%)
 Frame = +1

Query  94   RSRICTALAIVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEY  273
            R  +  + A++A F S   A  VV L   NF++ VGQD+ ALVEF+APWCGHCK LAP Y
Sbjct  2    RLSVSISAALIA-FTSLVSASKVVDLDNNNFDQIVGQDKGALVEFFAPWCGHCKNLAPTY  60

Query  274  EQLGASFKKAKSVLIGKVDCDE-HKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEA  450
            E L  +F   K V+I K D D   + + S++GVSG+PT++WFP GSLEP  Y GAR  E 
Sbjct  61   ELLADAFPSDK-VIIAKTDADGVGRELGSRFGVSGFPTLKWFPAGSLEPIPYSGARDLET  119

Query  451  LTEFVNTEAG--TNVKVAAIPS  510
            L  FV  ++G  +N+K    P+
Sbjct  120  LAAFVTKQSGVKSNIKPPPPPA  141


 Score =   103 bits (257),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 50/117 (43%), Positives = 71/117 (61%), Gaps = 3/117 (3%)
 Frame = +1

Query  169  LTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDCD--E  339
            L   NF+  V  + +  LV F APWCGHCK + P YE++   F     V+I  +D D  E
Sbjct  145  LDVSNFDDVVLNESKNVLVAFTAPWCGHCKNMKPAYEKVAKIFSSEPDVVIALMDADDAE  204

Query  340  HKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTNVKVAAIPS  510
            +K V  +YGVS +PTI++FPKGS EP  Y+  RTAE    ++N ++GT+  V+ + S
Sbjct  205  NKPVAQRYGVSSFPTIKFFPKGSKEPVAYDSGRTAEQFVNWINEKSGTHRSVSGLLS  261



>ref|XP_002985095.1| hypothetical protein SELMODRAFT_121347 [Selaginella moellendorffii]
 gb|EFJ13970.1| hypothetical protein SELMODRAFT_121347 [Selaginella moellendorffii]
Length=344

 Score =   130 bits (326),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 81/109 (74%), Gaps = 1/109 (1%)
 Frame = +1

Query  157  DVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDCD  336
            DVVVLT +NFE+ V Q R ALVEFYAPWCGHCKKLAPEYE++  +FK  K V+I K+D D
Sbjct  139  DVVVLTPDNFEQVVRQGRGALVEFYAPWCGHCKKLAPEYEKVATAFKGEKGVVIAKLDAD  198

Query  337  EHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGT  483
             HK + SKY +SGYPT+++F K + + +  +G R+ E L EF+N + GT
Sbjct  199  AHKDLASKYDISGYPTVKFFLKSNKDGEDCDG-RSLEELVEFLNEKCGT  246


 Score =   122 bits (305),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 77/121 (64%), Gaps = 1/121 (1%)
 Frame = +1

Query  103  ICTALAIVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQL  282
            +   L +V     A  AD VV LT ENF K VGQDR ALVEF+   CG CKKL PEYE++
Sbjct  1    MLAGLLLVLSVMPALAADHVVNLTPENFIKLVGQDRGALVEFFINSCGACKKLEPEYEKV  60

Query  283  GASFKKA-KSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTE  459
            G +F+K  K+VLI  V+C+ H  VC    +S YPTI+WFPKGS+  K Y G  T+  L +
Sbjct  61   GLAFRKVKKTVLIAHVNCEYHPLVCGYCNISNYPTIEWFPKGSMTAKIYSGTPTSRGLRK  120

Query  460  F  462
            F
Sbjct  121  F  121



>ref|XP_001639403.1| predicted protein [Nematostella vectensis]
 gb|EDO47340.1| predicted protein [Nematostella vectensis]
Length=363

 Score =   130 bits (326),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/136 (44%), Positives = 88/136 (65%), Gaps = 2/136 (1%)
 Frame = +1

Query  109  TALAIVALFFSAAFADD--VVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQL  282
            T L  + L FS +      V+ LT++NF++ V  ++ ALVEFYAPWCGHCK+LAP YEQL
Sbjct  5    TVLFKLFLLFSISSLTQGKVIDLTKDNFDEVVNGEKFALVEFYAPWCGHCKQLAPTYEQL  64

Query  283  GASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEF  462
            G ++ ++  V+I KVD D  + + S++ V G+PTI++FPKGS  P++Y G R      +F
Sbjct  65   GEAYTQSSDVIIAKVDADGDRDLGSRFDVKGFPTIKYFPKGSTTPEEYNGGRDINDFIKF  124

Query  463  VNTEAGTNVKVAAIPS  510
            +  + G   +V  IPS
Sbjct  125  IEEKTGVRGRVPVIPS  140


 Score =   111 bits (277),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 51/109 (47%), Positives = 72/109 (66%), Gaps = 1/109 (1%)
 Frame = +1

Query  160  VVVLTEENFEKEVGQ-DRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDCD  336
            V  L E NF+K V   D   LVEF+APWCGHCK LAP YE++G +FK   + +I KVD D
Sbjct  142  VADLDESNFDKIVKNPDNNVLVEFFAPWCGHCKNLAPVYEKVGEAFKNEPNCVIAKVDAD  201

Query  337  EHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGT  483
             H ++  KYGVSGYPT+++F K + + ++Y   R  ++  +F+N + GT
Sbjct  202  AHSALGQKYGVSGYPTLKFFSKTNKDGEEYSSGRDEQSFVDFMNEKCGT  250



>gb|EMD32246.1| hypothetical protein CERSUDRAFT_88243 [Ceriporiopsis subvermispora 
B]
Length=377

 Score =   130 bits (326),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/134 (47%), Positives = 90/134 (67%), Gaps = 2/134 (1%)
 Frame = +1

Query  100  RICTALAIVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQ  279
            ++   L + AL   +A+A +V+ LT +NF++ +GQ + ALVEF+APWCGHCK LAP YEQ
Sbjct  2    KMLAGLFVAALSLGSAWASNVLELTPDNFDEVIGQGKPALVEFFAPWCGHCKNLAPVYEQ  61

Query  280  LGASFKKAKS-VLIGKVDCD-EHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEAL  453
            L  +F  AK  V+I KVD D   K + +KYGV+G+PT++WF     EP+KYEG R  +AL
Sbjct  62   LADAFVHAKDKVIIAKVDADGAGKPLGAKYGVTGFPTLKWFGPEGGEPEKYEGGRDLDAL  121

Query  454  TEFVNTEAGTNVKV  495
              F+  ++G   K+
Sbjct  122  AGFITQKSGVKSKI  135


 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 54/122 (44%), Positives = 74/122 (61%), Gaps = 13/122 (11%)
 Frame = +1

Query  154  DDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDC  333
            DDV +    N EK+V      +V F APWCGHCK+L P Y+++   F    + ++  VD 
Sbjct  152  DDVAL----NPEKDV------IVAFTAPWCGHCKRLKPVYDEVAKDFANEPNCVVANVDA  201

Query  334  DE--HKSVCSKYGVSGYPTIQWFPKGSL-EPKKYEGARTAEALTEFVNTEAGTNVKVAAI  504
            D   +  + SKYGV+GYPTI++FPKG+  EP  Y+GART EA  E++N   GT+  V  I
Sbjct  202  DAQVNHPLKSKYGVAGYPTIKFFPKGNKEEPVDYDGARTEEAFVEYLNEHCGTHRSVGGI  261

Query  505  PS  510
             S
Sbjct  262  LS  263



>gb|ESA01709.1| hypothetical protein GLOINDRAFT_337817 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX61583.1| protein disulfide isomerase PDI1 [Rhizophagus irregularis DAOM 
197198w]
Length=367

 Score =   129 bits (325),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/127 (50%), Positives = 87/127 (69%), Gaps = 5/127 (4%)
 Frame = +1

Query  121  IVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKK  300
            IV+ F   A  ++V+ LT  NF++ VG+D+ ALVEF+APWCGHCKKLAP YEQL  SF  
Sbjct  13   IVSCF---ASENNVLDLTPTNFDQLVGKDKFALVEFFAPWCGHCKKLAPVYEQLADSFSH  69

Query  301  AKS-VLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLE-PKKYEGARTAEALTEFVNTE  474
            AK  V+I KVD D HK + +++GV GYPT++WF KG ++ P +Y+  R  E+L  FV  +
Sbjct  70   AKDQVIIAKVDADNHKDLGNRFGVGGYPTLKWFNKGVIDNPDEYDKGRDLESLISFVEEK  129

Query  475  AGTNVKV  495
             G   +V
Sbjct  130  TGVRSRV  136


 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 69/112 (62%), Gaps = 4/112 (4%)
 Frame = +1

Query  160  VVVLTEENFEKEVGQD--RAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDC  333
            V  LT  NF+ E+  D  + ALVEFYAPWCGHCK LAP YE++   + +    ++  +D 
Sbjct  143  VTELTSRNFD-EIALDPKKNALVEFYAPWCGHCKNLAPTYEKVAQDYAQESDCIVANMDA  201

Query  334  DEHKSVCSKYGVSGYPTIQWFPKGSLEPK-KYEGARTAEALTEFVNTEAGTN  486
             +++ V  +Y V G+PTI++FPKG  +    Y+G RT +   +F+N   GT+
Sbjct  202  TKNEPVAKRYDVRGFPTIKFFPKGENKTTIDYQGGRTEQDFIDFLNKNCGTH  253



>ref|XP_008042147.1| protein disulfide isomerase [Trametes versicolor FP-101664 SS1]
 gb|EIW54716.1| protein disulfide isomerase [Trametes versicolor FP-101664 SS1]
Length=382

 Score =   129 bits (323),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 62/134 (46%), Positives = 86/134 (64%), Gaps = 2/134 (1%)
 Frame = +1

Query  100  RICTALAIVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQ  279
            R   AL    L   +AFA +V+ LT +NF++ +G+ + ALVEF+APWCGHCK LAP YEQ
Sbjct  2    RFSFALFATVLSVGSAFASNVLELTPDNFDEHIGKGKPALVEFFAPWCGHCKNLAPTYEQ  61

Query  280  LGASFKKAKS-VLIGKVDCD-EHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEAL  453
            L  +F  +K  V+I KVD D   K +  KYGV+G+PT++WF     EP+KY+G R  +AL
Sbjct  62   LADAFANSKDKVIIAKVDADGAGKPLGQKYGVTGFPTLKWFGADGGEPQKYDGGRDLDAL  121

Query  454  TEFVNTEAGTNVKV  495
              FV  ++G    +
Sbjct  122  ANFVTAQSGVKSSI  135


 Score = 92.0 bits (227),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 45/117 (38%), Positives = 71/117 (61%), Gaps = 4/117 (3%)
 Frame = +1

Query  166  VLTEENFEK-EVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDCDEH  342
            +L    FE+  +  ++ A+V F APWCGHCK+L P YE++   F    + +I  VD D+ 
Sbjct  145  ILDAHTFEEVALNPEKDAIVAFTAPWCGHCKRLKPIYEEVAKDFASEPNCIIANVDADDK  204

Query  343  KS--VCSKYGVSGYPTIQWFPKGSLE-PKKYEGARTAEALTEFVNTEAGTNVKVAAI  504
            K+  +  KY +S +PTI ++PKG+ E P  Y+G RT EA  E++N + GT+  +  +
Sbjct  205  KNRALAEKYEISSFPTIIFYPKGNKEDPVDYDGPRTEEAFVEYLNEKCGTHRALGGL  261



>ref|XP_001470409.1| putative protein disulfide isomerase [Leishmania infantum JPCM5]
 ref|XP_003861651.1| protein disulfide isomerase, putative [Leishmania donovani]
 emb|CAM68783.1| putative protein disulfide isomerase [Leishmania infantum JPCM5]
 emb|CBZ34952.1| protein disulfide isomerase, putative [Leishmania donovani]
Length=377

 Score =   129 bits (323),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 92/138 (67%), Gaps = 12/138 (9%)
 Frame = +1

Query  94   RSRICTALAIVALFFSA--------AFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGH  249
            R  +  ALA+V    +         A    +V ++++NF++ VG+D+AALVEFYAPWCGH
Sbjct  4    RLSVVLALALVVFVLAGSCSSEDPGAVMPGIVQMSKDNFDQLVGKDKAALVEFYAPWCGH  63

Query  250  CKKLAPEYEQLGASFKKAKS----VLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEP  417
            CK +APEY  LGA+++ + +    +LIGKVD  E   +  ++GV+G+PTI +F  GSLEP
Sbjct  64   CKSMAPEYAALGAAYEASTNAKDLLLIGKVDATEDSDLGKRFGVTGFPTILYFASGSLEP  123

Query  418  KKYEGARTAEALTEFVNT  471
            +KY+G RTAE   +++++
Sbjct  124  EKYKGGRTAEDFAKYLSS  141


 Score = 95.1 bits (235),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 46/108 (43%), Positives = 65/108 (60%), Gaps = 4/108 (4%)
 Frame = +1

Query  169  LTEENFEKEVGQ-DRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDCDE--  339
            L   NF+  V    +A LV FYAPWCGHCK L P Y +L   F   K V+I +++ D+  
Sbjct  160  LVHTNFDAVVKDPSKAVLVMFYAPWCGHCKALKPIYNKLAKVFSNDKDVVIARINADDAA  219

Query  340  HKSVCSKYGVSGYPTIQWFPKGSLE-PKKYEGARTAEALTEFVNTEAG  480
            ++ + ++Y VSG+PT+ +FPKG+ E P +Y+  R  E    FVN  AG
Sbjct  220  NRKIATEYAVSGFPTLYFFPKGADEKPVEYKNGRNLEDFLTFVNENAG  267



>gb|AIG56094.1| secreted protein [Achlya hypogyna]
Length=353

 Score =   127 bits (320),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 77/114 (68%), Gaps = 0/114 (0%)
 Frame = +1

Query  157  DVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDCD  336
            DVVVLT +NF   V   +   VEFYAPWCGHCK LAP +E +  SFK    V++ KVD D
Sbjct  20   DVVVLTPDNFADVVDGSKNVFVEFYAPWCGHCKNLAPVWETVATSFKNEADVVVAKVDAD  79

Query  337  EHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTNVKVA  498
            EH+S+  ++ V G+PT++++ KG+  P  Y G R+ E L  F+N +AGTNV+VA
Sbjct  80   EHRSLGEQFEVQGFPTLKFWNKGAKHPDSYNGGRSEEDLVNFLNEKAGTNVRVA  133


 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 68/110 (62%), Gaps = 3/110 (3%)
 Frame = +1

Query  160  VVVLTEENFEKEVGQD--RAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDC  333
            V  LTE NF   + QD  +  LVEFYAPWCGHCK+LAP +E L   +   +SV+I KVD 
Sbjct  139  VETLTEANF-ASIAQDPKKHVLVEFYAPWCGHCKQLAPTWETLANIYAGEESVVIAKVDA  197

Query  334  DEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGT  483
                 +  K+GVSGYPTI++F  G+ EP+ Y   R      +F+N +AGT
Sbjct  198  TATGDLAGKFGVSGYPTIKYFGTGASEPEDYGFGRELSEFVDFLNEKAGT  247



>gb|KDO32944.1| hypothetical protein SPRG_02637 [Saprolegnia parasitica CBS 223.65]
Length=354

 Score =   126 bits (316),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 79/114 (69%), Gaps = 0/114 (0%)
 Frame = +1

Query  157  DVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDCD  336
            DVVVLT ENF++ +   +  LVEFYAPWCGHCK+LAP +E +  SFK    V++ K+D D
Sbjct  20   DVVVLTPENFDEVIDGSKNVLVEFYAPWCGHCKQLAPTWETVATSFKNVDDVVVAKIDAD  79

Query  337  EHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTNVKVA  498
            EH+ +  K+ V+G+PT++++ KG+  P  Y   R  + L  F+N +AGTNV+VA
Sbjct  80   EHRDLGEKFEVTGFPTLKFWNKGAKYPDTYTSGRGEDELVAFLNEKAGTNVRVA  133


 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/111 (46%), Positives = 68/111 (61%), Gaps = 3/111 (3%)
 Frame = +1

Query  160  VVVLTEENFEKEVGQD--RAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDC  333
            V  LTE +F   V QD  +  LVEFYAPWCGHCK+L P +E L   +   ++V+I KVD 
Sbjct  139  VAALTESDF-ASVAQDPTKHVLVEFYAPWCGHCKQLTPTWESLANIYAGEENVVIAKVDA  197

Query  334  DEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
                 + SK+GVSGYPTI++F  G+ E + Y   R  +   +FVN +AGT 
Sbjct  198  TATGDLASKFGVSGYPTIKYFGTGASEAEDYGFGRELQEFVDFVNEKAGTQ  248



>gb|KIX08267.1| protein disulfide-isomerase domain [Rhinocladiella mackenziei 
CBS 650.93]
Length=369

 Score =   126 bits (317),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/110 (54%), Positives = 78/110 (71%), Gaps = 2/110 (2%)
 Frame = +1

Query  160  VVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVD--C  333
            V +LT+  FE+EVG D+  LV F APWCGHCK LAP +E+L A F    +V+I KVD   
Sbjct  146  VEMLTDTTFEQEVGGDKDVLVAFTAPWCGHCKSLAPTWEKLAADFASEPNVIIAKVDAEA  205

Query  334  DEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGT  483
            +  K+     G++GYPTI++FPKGS EP+ Y GAR+ +AL EFVN++AGT
Sbjct  206  ENSKATAQAQGITGYPTIKFFPKGSTEPEPYSGARSEDALVEFVNSKAGT  255


 Score =   114 bits (286),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 62/138 (45%), Positives = 83/138 (60%), Gaps = 4/138 (3%)
 Frame = +1

Query  88   MSRSRICTALAIVALFFSAAFADDVVVLTEENFEKEVGQ-DRAALVEFYAPWCGHCKKLA  264
            M + R   +L  +AL    A A DVV L   NF+K V Q ++ ALVEF+APWCGHCK LA
Sbjct  1    MVQLRSLLSLTAIALPLVTA-ASDVVNLIPSNFDKVVFQSNKPALVEFFAPWCGHCKNLA  59

Query  265  PEYEQLGASFKKA-KSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFP-KGSLEPKKYEGAR  438
            P YE+L   F  +   V I  VD D+HK +  ++GV G+PT++WF      EP++Y G R
Sbjct  60   PIYEELATVFAASGDKVTIANVDADKHKDLGKRFGVQGFPTLKWFDGTPGAEPQEYSGGR  119

Query  439  TAEALTEFVNTEAGTNVK  492
              E+LT F+  + G  VK
Sbjct  120  DLESLTNFIVEKTGFKVK  137



>emb|CCC91291.1| putative protein disulfide isomerase [Trypanosoma congolense 
IL3000]
Length=378

 Score =   126 bits (316),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 79/112 (71%), Gaps = 2/112 (2%)
 Frame = +1

Query  160  VVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKS-VLIGKVDCD  336
            VV LT  +F+ +VG+D AALVEFYAPWCGHC+ L PEY +LG +   AK  VLIGKVD  
Sbjct  39   VVELTTSDFDAKVGKDVAALVEFYAPWCGHCQNLVPEYAKLGLAAASAKDKVLIGKVDAT  98

Query  337  EHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEA-GTNV  489
            E K + +++ VSGYPT+ +FP GS +P KYE AR A+A+  F+N    G N+
Sbjct  99   EQKELATRFDVSGYPTLLFFPAGSQKPDKYEEAREAKAMVSFLNNRIKGLNI  150


 Score = 95.9 bits (237),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/110 (41%), Positives = 67/110 (61%), Gaps = 3/110 (3%)
 Frame = +1

Query  160  VVVLTEENFEK-EVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDCD  336
            V+ L+  NF+   +   + A V FYAPWCGHCK+L P +EQL   ++  K ++I  VD D
Sbjct  159  VLELSASNFDNVALDAQKDAFVLFYAPWCGHCKRLHPFFEQLAKVYQNEKDLIIANVDAD  218

Query  337  E--HKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAG  480
            +  +  +  +Y V GYPT+ + PKG  E   YEG R+ +A+ +FVN + G
Sbjct  219  DTTNSELAKRYKVEGYPTLVFLPKGKKESVPYEGDRSLDAMLKFVNEKTG  268



>ref|XP_009313187.1| putative protein disulfide isomerase [Trypanosoma grayi]
 gb|KEG08580.1| putative protein disulfide isomerase [Trypanosoma grayi]
Length=377

 Score =   125 bits (315),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 64/134 (48%), Positives = 85/134 (63%), Gaps = 9/134 (7%)
 Frame = +1

Query  94   RSRICTALAIVALFF-SAAFADD-------VVVLTEENFEKEVGQDRAALVEFYAPWCGH  249
            R+ I  A+ +VA  F S A A+D       V  L    F+ +VG+D  ALVEFYAPWCGH
Sbjct  8    RAAIFLAVVLVAAAFPSVALAEDPSEPLEGVADLNAATFDAQVGKDIPALVEFYAPWCGH  67

Query  250  CKKLAPEYEQLGASFKKAKS-VLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKY  426
            CK L PE ++LG + K A   VL+GKVD  +H  +  ++GVSGYPTI +FP GS++P++Y
Sbjct  68   CKNLVPEMQKLGLAAKAASGKVLVGKVDATQHGDLAGRFGVSGYPTILFFPAGSVKPERY  127

Query  427  EGARTAEALTEFVN  468
             G R A A   F+N
Sbjct  128  SGQRDASAFVSFLN  141


 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/113 (35%), Positives = 63/113 (56%), Gaps = 4/113 (4%)
 Frame = +1

Query  160  VVVLTEENFEKEVGQD-RAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDCD  336
            V  L ++N++     D +   + FYAPWCGHCKKL P +E+L   +K    V+I  ++ D
Sbjct  158  VTQLDKDNYDAIALDDTKDTFIMFYAPWCGHCKKLHPIFERLAMVYKDEPDVVIASLNAD  217

Query  337  E--HKSVCSKYGVSGYPTIQWFPKGSLE-PKKYEGARTAEALTEFVNTEAGTN  486
            +  + +V S+Y + G+PT+ +  KG  + P  Y   R  +A  +F+N   G N
Sbjct  218  DSANAAVRSRYEIDGFPTLVFLSKGMKDKPIYYNKDRELDAFVKFLNAHTGKN  270



>gb|AAB86685.1| protein disulfide isomerase [Dictyostelium discoideum]
Length=363

 Score =   125 bits (315),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 55/113 (49%), Positives = 79/113 (70%), Gaps = 3/113 (3%)
 Frame = +1

Query  157  DVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDC  333
            +VV L+  NF+  V  + +  LVEFYAPWCGHCKKL P+YE LG ++   K V+I K+DC
Sbjct  143  NVVDLSPSNFDSVVLDKSKNVLVEFYAPWCGHCKKLMPDYEILGNTYANEKDVVIAKIDC  202

Query  334  D--EHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
            D  ++K++CSKYGV+G+PT++WF K S + +KYE  R  +    ++N +AG N
Sbjct  203  DAADNKAICSKYGVTGFPTLKWFGKQSKDGEKYEQGRDLDTFINYINKQAGVN  255


 Score =   125 bits (313),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 66/142 (46%), Positives = 92/142 (65%), Gaps = 6/142 (4%)
 Frame = +1

Query  100  RICTALAIVALFFSAAFA--DDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEY  273
            +I   + ++AL F A  +   +VVVL+ +NF+  V   +   V+FYAPWCGHCKKLAP++
Sbjct  2    KILLFVTLIALAFVALCSAEGNVVVLSPDNFDTVVDGSKTVFVKFYAPWCGHCKKLAPDF  61

Query  274  EQLGASFKK-AKSVLIGKVDCDE--HKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTA  444
            E L  +F   +  V+I KVDCD+  +K++CSKY VSGYPT++ F K S   K Y GAR+ 
Sbjct  62   EILADTFAPVSNKVVIAKVDCDQADNKALCSKYDVSGYPTLKIFDK-STTAKDYNGARSV  120

Query  445  EALTEFVNTEAGTNVKVAAIPS  510
            + L  ++N  A TNVKV   PS
Sbjct  121  DELLTYINNHAKTNVKVKKAPS  142



>emb|CCI44606.1| unnamed protein product [Albugo candida]
Length=377

 Score =   125 bits (315),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 54/122 (44%), Positives = 82/122 (67%), Gaps = 0/122 (0%)
 Frame = +1

Query  145  AFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGK  324
            A + DVV LT +NF++ V   +  LVE+YAPWCGHCKKL+P YE +  SF+K  SV++ K
Sbjct  16   ALSSDVVDLTPDNFDQIVDGTKHVLVEYYAPWCGHCKKLSPTYEIVATSFRKIDSVIVAK  75

Query  325  VDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTNVKVAAI  504
            VD + H  +  ++GV+G+PT+++F KGS E + Y G R+ +   +F+N ++G+  K    
Sbjct  76   VDAEAHTELRDRFGVTGFPTLKFFNKGSTEAEDYSGGRSEDEFIDFLNEKSGSEAKAVKP  135

Query  505  PS  510
            PS
Sbjct  136  PS  137


 Score =   106 bits (264),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 68/111 (61%), Gaps = 3/111 (3%)
 Frame = +1

Query  160  VVVLTEENFEKEVGQD-RAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVD--  330
            VV LT   FEKEV +  R ALVEFYAPWCGHC  L P YE L   F    +VLI KVD  
Sbjct  139  VVALTANTFEKEVFESGRHALVEFYAPWCGHCMNLMPVYENLAEIFGPESNVLIAKVDAT  198

Query  331  CDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGT  483
             + +K + + Y VSG+PTI++F  GS  P+ Y   R   +  +F+N +AGT
Sbjct  199  VETNKPLATTYDVSGFPTIKYFAPGSQTPEDYSEGRDLSSFVQFINEKAGT  249



>ref|XP_643357.1| protein disulfide isomerase [Dictyostelium discoideum AX4]
 sp|Q86IA3.2|PDI1_DICDI RecName: Full=Protein disulfide-isomerase 1; Short=PDI1; Flags: 
Precursor [Dictyostelium discoideum]
 gb|EAL69370.1| protein disulfide isomerase [Dictyostelium discoideum AX4]
Length=363

 Score =   125 bits (314),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 55/113 (49%), Positives = 79/113 (70%), Gaps = 3/113 (3%)
 Frame = +1

Query  157  DVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDC  333
            +VV L+  NF+  V  + +  LVEFYAPWCGHCKKL P+YE LG ++   K V+I K+DC
Sbjct  143  NVVDLSPSNFDSVVLDKSKNVLVEFYAPWCGHCKKLMPDYEILGNTYANEKDVVIAKIDC  202

Query  334  D--EHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
            D  ++K++CSKYGV+G+PT++WF K S + +KYE  R  +    ++N +AG N
Sbjct  203  DAADNKAICSKYGVTGFPTLKWFGKQSKDGEKYEQGRDLDTFINYINKQAGVN  255


 Score =   125 bits (313),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 66/142 (46%), Positives = 92/142 (65%), Gaps = 6/142 (4%)
 Frame = +1

Query  100  RICTALAIVALFFSAAFA--DDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEY  273
            +I   + ++AL F A  +   +VVVL+ +NF+  V   +   V+FYAPWCGHCKKLAP++
Sbjct  2    KILLFVTLIALAFVALCSAEGNVVVLSPDNFDTVVDGSKTVFVKFYAPWCGHCKKLAPDF  61

Query  274  EQLGASFKK-AKSVLIGKVDCDE--HKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTA  444
            E L  +F   +  V+I KVDCD+  +K++CSKY VSGYPT++ F K S   K Y GAR+ 
Sbjct  62   EILADTFAPVSNKVVIAKVDCDQADNKALCSKYDVSGYPTLKIFDK-STTAKDYNGARSV  120

Query  445  EALTEFVNTEAGTNVKVAAIPS  510
            + L  ++N  A TNVKV   PS
Sbjct  121  DELLTYINNHAKTNVKVKKAPS  142



>emb|CDS12432.1| hypothetical protein LRAMOSA04626 [Absidia idahoensis var. thermophila]
Length=459

 Score =   126 bits (317),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 58/143 (41%), Positives = 91/143 (64%), Gaps = 4/143 (3%)
 Frame = +1

Query  94   RSRICTALAIVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEY  273
            R+++  A+   A        D+V VL ++NF+K +   R ALVEFYAPWCGHCKKLAP Y
Sbjct  89   RAKVSGAVGGSADMGRIILEDNVFVLNDKNFDKVIDGSRPALVEFYAPWCGHCKKLAPTY  148

Query  274  EQLGASFKKAKS-VLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEP---KKYEGART  441
             +LG +F   +  V+I KV+ DE + + +++G+ G+PT++WFPKG   P   + Y G R 
Sbjct  149  AELGEAFSTVQDRVVIAKVNADEQRDLGARFGIQGFPTLKWFPKGVTTPDGIEDYRGGRD  208

Query  442  AEALTEFVNTEAGTNVKVAAIPS  510
             ++L++FV+ ++G   +V +  S
Sbjct  209  LDSLSKFVHEKSGVRPRVKSTKS  231


 Score =   106 bits (265),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 70/112 (63%), Gaps = 2/112 (2%)
 Frame = +1

Query  157  DVVVLTEENFEKEVGQDRA-ALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDC  333
            DVVVL  +NF   V   +   LVEFYAPWCGHCK LAP YE++  +F    +  + K+D 
Sbjct  232  DVVVLDSQNFNSIVKDPKTNVLVEFYAPWCGHCKNLAPTYEKVATAFANEPNCKVAKIDA  291

Query  334  DEHKSVCSKYGVSGYPTIQWFPKG-SLEPKKYEGARTAEALTEFVNTEAGTN  486
            D  +++ ++Y +SG+PTI++F  G   EP  YEG RT     EF+N + GT+
Sbjct  292  DSERAIGTEYEISGFPTIKFFAAGEDKEPVAYEGPRTEAGFIEFLNKQCGTH  343



>gb|EWM29745.1| protein disulfide isomerase [Nannochloropsis gaditana]
Length=363

 Score =   125 bits (314),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 76/114 (67%), Gaps = 0/114 (0%)
 Frame = +1

Query  169  LTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDCDEHKS  348
            LT  NF++ V   +  LVEFYAPWCGHCK LAPEYE  G  +K    V+I KVD D  +S
Sbjct  22   LTPANFDQVVDGSQNVLVEFYAPWCGHCKTLAPEYEIAGDVYKAGDGVVIAKVDADAERS  81

Query  349  VCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTNVKVAAIPS  510
            +  ++ V G+PT++WFPKGS  P++YEG RTA+ +  +VN + G + KV  + S
Sbjct  82   LGERFDVKGFPTLKWFPKGSTAPEEYEGGRTADTIVSWVNGKTGLSRKVKKMAS  135


 Score = 94.7 bits (234),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 69/114 (61%), Gaps = 2/114 (2%)
 Frame = +1

Query  148  FADDVVVLTEENFEK-EVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGK  324
             A  VV LT+ NF+   +   +  LV F APWCGHCK LAP+YE +   F   + V++ K
Sbjct  133  MASAVVELTDGNFDSLAMDPTKDVLVGFTAPWCGHCKTLAPKYEAVAKIFAGERDVVVAK  192

Query  325  VDCDEHKSVCSKYGVSGYPTIQWFPKG-SLEPKKYEGARTAEALTEFVNTEAGT  483
            VD  +++ + S++ VSGYPT+++FP+G   E + YE  R       F+N +AGT
Sbjct  193  VDATQYRDLASRFDVSGYPTLKFFPRGEGKEVEAYEHGRDVVDFVNFLNEKAGT  246



>ref|XP_009841234.1| protein disulfide-isomerase domain [Aphanomyces astaci]
 gb|ETV69377.1| protein disulfide-isomerase domain [Aphanomyces astaci]
Length=354

 Score =   125 bits (313),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 57/116 (49%), Positives = 77/116 (66%), Gaps = 0/116 (0%)
 Frame = +1

Query  151  ADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVD  330
            A DVV LT +NF+  V   +   VEFYAPWCGHCK L P +E L  SFK    V+I KVD
Sbjct  18   ASDVVTLTPDNFKSVVDGSKNVFVEFYAPWCGHCKNLEPIWETLATSFKHVDDVVIAKVD  77

Query  331  CDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTNVKVA  498
             D+HK + +++ V+G+PT++++ KG+  P  Y+G RT + L  FVN  AGTNV+ A
Sbjct  78   ADQHKDLSTEWEVNGFPTLKFWNKGAKYPDPYDGGRTEDELVAFVNKAAGTNVRAA  133


 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 74/114 (65%), Gaps = 3/114 (3%)
 Frame = +1

Query  160  VVVLTEENFEKEVGQD--RAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDC  333
            VV LTE +F   + QD  +  LVEFYAPWCGHCK LAP +++LGA +   ++V+I KVD 
Sbjct  139  VVALTESDFA-SIAQDPTKHVLVEFYAPWCGHCKSLAPIWDKLGAVYAGDENVVIAKVDA  197

Query  334  DEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTNVKV  495
                 + +K+GVSGYPTI++F  G+ + + Y   R   A  EF+N +AGT+  V
Sbjct  198  TATGDLANKFGVSGYPTIKYFGTGASDAEDYGFGRDLPAFVEFLNEKAGTHRTV  251



>gb|KIY03763.1| hypothetical protein Z520_00454 [Fonsecaea multimorphosa CBS 
102226]
Length=370

 Score =   125 bits (313),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 77/110 (70%), Gaps = 2/110 (2%)
 Frame = +1

Query  160  VVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVD--C  333
            V +LT+  F+ E+G D+  LV F APWCGHCK LAP +E+L A F    +VLI K+D   
Sbjct  146  VEMLTDTTFQSEIGGDKDVLVAFTAPWCGHCKSLAPTWEKLAADFVNEPNVLIAKIDAEA  205

Query  334  DEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGT  483
            +  K+     G++GYPTI++FPKGS EP+ Y GAR+ EAL +FVN++AGT
Sbjct  206  ENSKATAQSQGITGYPTIKFFPKGSTEPEPYSGARSEEALVDFVNSKAGT  255


 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 55/115 (48%), Positives = 72/115 (63%), Gaps = 3/115 (3%)
 Frame = +1

Query  157  DVVVLTEENFEKEVGQD-RAALVEFYAPWCGHCKKLAPEYEQLGASF-KKAKSVLIGKVD  330
            DVV L   NF+K V +  + ALVEF+APWCGHCK LAP YE+L  +F      V I  VD
Sbjct  23   DVVNLIPSNFDKVVFESGKPALVEFFAPWCGHCKNLAPVYEELATAFATSGNKVTIANVD  82

Query  331  CDEHKSVCSKYGVSGYPTIQWFP-KGSLEPKKYEGARTAEALTEFVNTEAGTNVK  492
             D+HK +  ++GV G+PT++WF  K   EP+ Y G R  E+LT FV  ++G   K
Sbjct  83   ADKHKDLGKRFGVQGFPTLKWFDGKPGSEPEDYNGGRDLESLTAFVTEKSGVKAK  137



>ref|XP_003031662.1| hypothetical protein SCHCODRAFT_67855 [Schizophyllum commune 
H4-8]
 gb|EFI96759.1| hypothetical protein SCHCODRAFT_67855 [Schizophyllum commune 
H4-8]
Length=377

 Score =   125 bits (313),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 82/122 (67%), Gaps = 4/122 (3%)
 Frame = +1

Query  136  FSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKS-V  312
            F+A  A +V+ LT ENF+  VGQ +  LVEF+APWCGHCKKLAP YE++  +F K+K  V
Sbjct  11   FTAVSASNVIDLTPENFDSVVGQGKPGLVEFFAPWCGHCKKLAPTYEEVADAFSKSKDKV  70

Query  313  LIGKVDCDEHKSVCSKYGVSGYPTIQWFPK-GSLEPKKYEGARTAEALTEFVNTEAGTNV  489
             + KVD D HK + SKYGV+G+PT++WF + G  EP  YE  R   +L  F+ T++G   
Sbjct  71   YVAKVDADAHKDLGSKYGVTGFPTLKWFNENGEAEP--YESGRDLTSLVSFIETKSGVKS  128

Query  490  KV  495
             +
Sbjct  129  SI  130


 Score = 93.6 bits (231),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/118 (42%), Positives = 71/118 (60%), Gaps = 14/118 (12%)
 Frame = +1

Query  157  DVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDCD  336
            DVVVL E       G+D   LV F APWCGHCK++ PE+E+   +F    + L+  VD D
Sbjct  147  DVVVLDE-------GKD--VLVAFTAPWCGHCKRMKPEFEKTAKTFASEPNCLVVNVDAD  197

Query  337  E--HKSVCSKYGVSGYPTIQWFPKGS---LEPKKYEGARTAEALTEFVNTEAGTNVKV  495
            +  ++ + +KYGVS YPT+++F +G+    EP+ Y G RT +   EF+N + GT   V
Sbjct  198  DAKNRDLATKYGVSSYPTLKFFGRGAEAKAEPEAYTGGRTEKDFVEFLNEKCGTQRAV  255



>gb|KIW33769.1| protein disulfide-isomerase domain [Cladophialophora immunda]
Length=370

 Score =   124 bits (312),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/110 (53%), Positives = 76/110 (69%), Gaps = 2/110 (2%)
 Frame = +1

Query  160  VVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVD--C  333
            V +LT+  F+ EVG D+  LV F APWCGHCK LAP +E+L   F    SVLI K+D   
Sbjct  146  VEMLTDTTFKSEVGGDKDVLVAFTAPWCGHCKSLAPTWEKLATDFASEPSVLIAKIDAEA  205

Query  334  DEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGT  483
            +  K+     G++GYPTI++FPKGS EP+ Y GAR+ EAL +FVN++AGT
Sbjct  206  ENSKATAQSQGITGYPTIKFFPKGSTEPEPYSGARSEEALVDFVNSKAGT  255


 Score =   111 bits (277),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 56/115 (49%), Positives = 74/115 (64%), Gaps = 3/115 (3%)
 Frame = +1

Query  157  DVVVLTEENFEKEVGQD-RAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKS-VLIGKVD  330
            DVV L   NF+K V +  + ALVEF+APWCGHCK LAP YE+L  +F  + S V I  VD
Sbjct  23   DVVNLIPSNFDKVVFESGKPALVEFFAPWCGHCKNLAPVYEELATAFAASGSKVTIANVD  82

Query  331  CDEHKSVCSKYGVSGYPTIQWFP-KGSLEPKKYEGARTAEALTEFVNTEAGTNVK  492
             D+HK +  ++GV G+PT++WF  K   EP+ Y G R  E+LT FV  ++G   K
Sbjct  83   ADKHKDLGKRFGVQGFPTLKWFDGKPGSEPEDYNGGRDLESLTAFVTEKSGVKAK  137



>ref|XP_002682926.1| predicted protein [Naegleria gruberi]
 gb|EFC50182.1| predicted protein [Naegleria gruberi]
Length=343

 Score =   124 bits (311),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 79/120 (66%), Gaps = 3/120 (3%)
 Frame = +1

Query  160  VVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKS--VLIGKVDC  333
            ++ LT  N    +   +  LVEFYAPWCGHCK LAPE  +LG +  KAK   V + K++C
Sbjct  4    IIDLTNANAASVLDGSKGVLVEFYAPWCGHCKNLAPEMVKLGQALIKAKPTIVAVAKINC  63

Query  334  DEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNT-EAGTNVKVAAIPS  510
            D  + VCSKYGV GYPT+++FP+GS EP +Y   RT EA+ +F+N  E  + +++A  P+
Sbjct  64   DNERDVCSKYGVQGYPTLKYFPRGSSEPIEYNSGRTVEAMVDFINQKEPSSRLRIAKEPT  123


 Score =   119 bits (297),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 80/111 (72%), Gaps = 2/111 (2%)
 Frame = +1

Query  169  LTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDCDEHK  345
            L+ + F+K V   ++  LV+FYAPWCGHCKK+AP+YE++  +F   KSV++  VDCD+++
Sbjct  128  LSPQTFDKIVLDSEKNVLVKFYAPWCGHCKKMAPDYEKVAKAFLNEKSVVVAHVDCDKYR  187

Query  346  SVCSKYGVSGYPTIQWFP-KGSLEPKKYEGARTAEALTEFVNTEAGTNVKV  495
             +CSKYGV GYPT+++FP K + E ++Y   R A A  EF+N +AGT+  +
Sbjct  188  DLCSKYGVQGYPTLKFFPAKENKEAEEYNSGREAPAFLEFLNNKAGTSRNI  238



>dbj|BAH20372.1| AT2G47470 [Arabidopsis thaliana]
Length=249

 Score =   122 bits (306),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 80/116 (69%), Gaps = 1/116 (1%)
 Frame = +1

Query  142  AAFADDVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLI  318
            AA   +VVVLT +NF++ V  Q++  LVEFYAPWCGHCK LAP YE++   FK+ + V+I
Sbjct  25   AAVPQNVVVLTPDNFDEIVLDQNKDVLVEFYAPWCGHCKSLAPTYEKVATVFKQEEGVVI  84

Query  319  GKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
              +D D HK++  KYGVSG+PT+++FPK +     Y+G R  +    F+N ++GT+
Sbjct  85   ANLDADAHKALGEKYGVSGFPTLKFFPKDNKAGHDYDGGRDLDDFVSFINEKSGTS  140



>ref|XP_007387800.1| protein disulfide isomerase [Punctularia strigosozonata HHB-11173 
SS5]
 gb|EIN04877.1| protein disulfide isomerase [Punctularia strigosozonata HHB-11173 
SS5]
Length=375

 Score =   124 bits (311),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 64/136 (47%), Positives = 86/136 (63%), Gaps = 4/136 (3%)
 Frame = +1

Query  115  LAIVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASF  294
             A  A   S   A +V+ LT +NF++ +G+ + ALVEF+APWCGHCK LAP YEQL  ++
Sbjct  6    FAFGAALLSGVLASNVIELTPDNFDEYIGKGKPALVEFFAPWCGHCKNLAPVYEQLADAY  65

Query  295  KKAKS-VLIGKVDCD-EHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVN  468
              AK  V+I KVD D E K +  KYGV+GYPT++WF     EP+KYEG R  E L   V 
Sbjct  66   AHAKDKVIIAKVDADGEGKPLGQKYGVTGYPTLKWFNADGGEPEKYEGGRDLENLVAHVT  125

Query  469  TEAG--TNVKVAAIPS  510
             ++G  +N+K    P+
Sbjct  126  AKSGVKSNIKPPPPPA  141


 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/109 (36%), Positives = 61/109 (56%), Gaps = 3/109 (3%)
 Frame = +1

Query  163  VVLTEENFEKEVGQ-DRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDCD-  336
             VL    F+  V    +  LV F APWCGHCK++ PE+E+    F   +  ++  VD D 
Sbjct  143  TVLDTHTFDNLVMDPTKNVLVAFTAPWCGHCKRMKPEFEKAAIDFLADEDCVVANVDADA  202

Query  337  -EHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAG  480
              +K +  KY +  +PT+++F K + EP++YEG RT     +F+N + G
Sbjct  203  APNKPLAQKYKIGSFPTLKFFSKDNKEPEEYEGGRTEADFVDFLNEKCG  251



>gb|EIE88364.1| hypothetical protein RO3G_13075 [Rhizopus delemar RA 99-880]
Length=379

 Score =   124 bits (310),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 57/119 (48%), Positives = 80/119 (67%), Gaps = 4/119 (3%)
 Frame = +1

Query  157  DVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAK-SVLIGKVDC  333
            +VVVLT++NF   +   + ALVEFYAPWCGHCKKLAP Y QLG +F   K +V+I K + 
Sbjct  99   NVVVLTDDNFHTVIDGSKPALVEFYAPWCGHCKKLAPTYAQLGDAFAHQKDNVIIAKFNA  158

Query  334  DEHKSVCSKYGVSGYPTIQWFPKGSLEP---KKYEGARTAEALTEFVNTEAGTNVKVAA  501
            DEH++  + YGV G+PT++WFPKG   P   ++Y+G R   +L  FV  ++G   ++ A
Sbjct  159  DEHRNTGAVYGVKGFPTLKWFPKGVKNPEEVEQYQGGRDLSSLASFVQEKSGVAPRIKA  217


 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 45/105 (43%), Positives = 67/105 (64%), Gaps = 1/105 (1%)
 Frame = +1

Query  157  DVVVLTEENFEK-EVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDC  333
            DVV LT +NF +  +   +  LVEFYA WCGHCK LAP YE +  ++   ++ ++ K+D 
Sbjct  221  DVVELTTKNFHQVALNPKKNVLVEFYASWCGHCKNLAPIYETIATAYSGVENCVVAKIDA  280

Query  334  DEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVN  468
            D+ + + +++ +SGYPTI++FP G  EP  YEG R      EF+N
Sbjct  281  DKERDIGAEFDISGYPTIKFFPAGESEPVAYEGGRNEAGFIEFLN  325



>ref|XP_002839804.1| hypothetical protein [Tuber melanosporum Mel28]
 emb|CAZ83995.1| unnamed protein product [Tuber melanosporum]
Length=353

 Score =   123 bits (309),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 82/115 (71%), Gaps = 5/115 (4%)
 Frame = +1

Query  157  DVVVLTEENFEKEVGQDRA-ALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDC  333
            +V+VL++ NF+K V  ++   LVEFYAPWCGHCK LAP YE+L  +F    +V++ K+D 
Sbjct  143  NVIVLSDANFDKIVHDEKKDVLVEFYAPWCGHCKNLAPIYEKLAKNFASETNVVVAKLDA  202

Query  334  DE--HKSVCSKYGVSGYPTIQWFPKGSL--EPKKYEGARTAEALTEFVNTEAGTN  486
            D    K+   KYG++G+PT++WFPKGS   EP  YE AR+ EALT+F+N  AGT+
Sbjct  203  DSPGGKASAEKYGITGFPTLKWFPKGSSAKEPILYESARSEEALTQFINKHAGTH  257


 Score =   121 bits (304),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 60/127 (47%), Positives = 81/127 (64%), Gaps = 3/127 (2%)
 Frame = +1

Query  106  CTALAIVALFFSAAFADDVVVLTEENFEKEVGQD-RAALVEFYAPWCGHCKKLAPEYEQL  282
            C+   + +L   A  A +V+ LT +NF+KE+ Q+ R ALVEF+APWCGHCK LAP YE+L
Sbjct  5    CSLFTLASLLLVAT-ASNVIDLTPDNFDKEILQNGRPALVEFFAPWCGHCKSLAPVYEEL  63

Query  283  GASFKKAKS-VLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTE  459
              S    K  V I KVD D HK++  ++GVSG+PT++WF   S +P  YE  R  EAL  
Sbjct  64   ADSLASQKDKVAIAKVDADNHKALGKRFGVSGFPTLKWFDGKSADPIPYESGRDLEALQA  123

Query  460  FVNTEAG  480
            F+  + G
Sbjct  124  FLKEKVG  130



>ref|XP_003876367.1| putative protein disulfide isomerase [Leishmania mexicana MHOM/GT/2001/U1103]
 emb|CBZ27886.1| putative protein disulfide isomerase [Leishmania mexicana MHOM/GT/2001/U1103]
Length=379

 Score =   123 bits (309),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 83/107 (78%), Gaps = 4/107 (4%)
 Frame = +1

Query  160  VVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKS----VLIGKV  327
            VV ++++NF++ VG+D+AALVEFYAPWCGHCK +APEY  LGA+++ + +    +LIGKV
Sbjct  36   VVQMSKDNFDQLVGKDKAALVEFYAPWCGHCKSMAPEYAVLGAAYEASTNAKDLLLIGKV  95

Query  328  DCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVN  468
            D  +   +  ++GV+G+PT+ +F  GSL+P+KY+G+RTAE   ++++
Sbjct  96   DATQESDLGKRFGVTGFPTLLYFAPGSLKPEKYQGSRTAEDFAKYLS  142


 Score = 94.0 bits (232),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 67/109 (61%), Gaps = 6/109 (6%)
 Frame = +1

Query  169  LTEENFEKEVGQD--RAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDCDE-  339
            L   NF+  V +D  ++ LV FYAPWCGHCK L P Y +L   F   K V+I +++ D+ 
Sbjct  162  LVHTNFD-AVAKDPSKSVLVMFYAPWCGHCKALKPTYNKLAKVFSNDKDVVIARINADDA  220

Query  340  -HKSVCSKYGVSGYPTIQWFPKGS-LEPKKYEGARTAEALTEFVNTEAG  480
             ++ + ++Y VSG+PT+ +FPKG+  +P +Y   R  E    FVN +AG
Sbjct  221  ANRKIATEYSVSGFPTLYFFPKGADTKPAEYRNGRNLEDFLTFVNEKAG  269



>emb|CDH59896.1| protein disulfide isomerase [Lichtheimia corymbifera JMRC:FSU:9682]
Length=459

 Score =   124 bits (311),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 57/138 (41%), Positives = 89/138 (64%), Gaps = 4/138 (3%)
 Frame = +1

Query  94   RSRICTALAIVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEY  273
            R+++  A+   A        D+V VL ++NF+K +   R ALVEFYAPWCGHCKKLAP Y
Sbjct  89   RAKVSGAVGGSADAGRIILEDNVFVLNDKNFDKVIDGSRPALVEFYAPWCGHCKKLAPTY  148

Query  274  EQLGASFKKAKS-VLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEP---KKYEGART  441
             +LG +F   +  V+I KV+ DE + + +++G+ G+PT++WFPKG   P   + Y G R 
Sbjct  149  AELGEAFATVQDRVVIAKVNADEQRDLGARFGIQGFPTLKWFPKGVTSPDGIEDYRGGRD  208

Query  442  AEALTEFVNTEAGTNVKV  495
             ++L++FV+ ++G   +V
Sbjct  209  LDSLSKFVHEKSGVRPRV  226


 Score =   105 bits (263),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 50/111 (45%), Positives = 70/111 (63%), Gaps = 2/111 (2%)
 Frame = +1

Query  157  DVVVLTEENFEKEVGQ-DRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDC  333
            DVVVL  +NF+  V       LVEFYAPWCGHCK LAP YE++  +F    +  + K+D 
Sbjct  232  DVVVLDSQNFDSIVKDPSTNVLVEFYAPWCGHCKNLAPIYEKVATAFANEPNCKVAKIDA  291

Query  334  DEHKSVCSKYGVSGYPTIQWFPKG-SLEPKKYEGARTAEALTEFVNTEAGT  483
            D  +++ ++Y +SG+PTI++F  G + EP  YEG RT     EF+N + GT
Sbjct  292  DSERTIGTEYEISGFPTIKFFAAGENKEPVAYEGPRTEAGFIEFLNKQCGT  342



>gb|KIW60351.1| protein disulfide-isomerase domain [Exophiala xenobiotica]
Length=369

 Score =   123 bits (309),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 77/110 (70%), Gaps = 2/110 (2%)
 Frame = +1

Query  160  VVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVD--C  333
            V +LT++ F+ E+G D+  LV F APWCGHCK LAP +E++ A F    SVLI K+D   
Sbjct  146  VEMLTDQTFKTEIGGDKDVLVAFTAPWCGHCKTLAPTWEKVAADFASEPSVLIAKIDAEA  205

Query  334  DEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGT  483
            +  K+     GV+GYPTI++FPKGS EP+ Y G R+ EAL +F+N++AGT
Sbjct  206  ENSKATAQAQGVTGYPTIKFFPKGSTEPETYSGGRSEEALVDFINSKAGT  255


 Score =   109 bits (273),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/115 (46%), Positives = 74/115 (64%), Gaps = 3/115 (3%)
 Frame = +1

Query  157  DVVVLTEENFEKEVGQ-DRAALVEFYAPWCGHCKKLAPEYEQLGASF-KKAKSVLIGKVD  330
            DV+ L   NF+  V + ++ ALVEF+APWCGHCK LAP YE+L  +F      V I  VD
Sbjct  23   DVINLIPSNFDSVVFESNKPALVEFFAPWCGHCKNLAPVYEELATAFASSGNKVTIANVD  82

Query  331  CDEHKSVCSKYGVSGYPTIQWFP-KGSLEPKKYEGARTAEALTEFVNTEAGTNVK  492
             D+HK +  ++GV G+PT++WF  K   +P+ Y G R  E+LT+FV  ++GT  K
Sbjct  83   ADKHKDLGKRFGVQGFPTLKWFDGKPGSQPEDYNGGRDLESLTKFVAEKSGTKAK  137



>gb|KHN45206.1| Hypothetical protein glysoja_044134 [Glycine soja]
Length=176

 Score =   119 bits (298),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 53/63 (84%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = +1

Query  322  KVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTNVKVAA  501
            +VDCDEHKS+CSKYGVSGYPTIQWFPKGSLEPKKYEG RTA++L EFVNTE GTNVK+A 
Sbjct  45   RVDCDEHKSLCSKYGVSGYPTIQWFPKGSLEPKKYEGPRTADSLAEFVNTEGGTNVKIAT  104

Query  502  IPS  510
             PS
Sbjct  105  APS  107


 Score = 76.3 bits (186),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 48/69 (70%), Gaps = 1/69 (1%)
 Frame = +1

Query  157  DVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDC  333
            +VVVLT ENF + V  + +  LVEFYAPWCGHCK LAP YE++  +FK  + V+I  +D 
Sbjct  108  NVVVLTSENFNEVVLDETKDVLVEFYAPWCGHCKSLAPTYEKVATTFKLEEDVVIANLDA  167

Query  334  DEHKSVCSK  360
            D++K +  K
Sbjct  168  DKYKDLAEK  176



>ref|XP_845754.1| protein disulfide isomerase [Trypanosoma brucei brucei TREU927]
 gb|AAX69979.1| protein disulfide isomerase, putative [Trypanosoma brucei]
 gb|AAZ12195.1| protein disulfide isomerase, putative [Trypanosoma brucei brucei 
TREU927]
Length=377

 Score =   123 bits (308),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 63/135 (47%), Positives = 86/135 (64%), Gaps = 8/135 (6%)
 Frame = +1

Query  94   RSRICTALAIVALFFSAAFADD-------VVVLTEENFEKEVGQDRAALVEFYAPWCGHC  252
            ++ +  A+ I A F SAA A++       VV LT  NF+  VG+D AALVEFYAPWCGHC
Sbjct  8    KTSLLKAICIFAYFASAAHANEPDAALEGVVDLTSNNFDSSVGKDVAALVEFYAPWCGHC  67

Query  253  KKLAPEYEQLGASFKKAKS-VLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYE  429
            K L PE+ +LG +   AK  VLI KVD    K + +++ V+GYPTI +FP GS +P+KY 
Sbjct  68   KNLVPEFAKLGRAAAGAKDKVLIAKVDATAQKDLATRFEVNGYPTILFFPAGSQKPEKYS  127

Query  430  GARTAEALTEFVNTE  474
              R A+A   ++N +
Sbjct  128  EGREAKAFVSYLNNQ  142


 Score = 97.4 bits (241),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 67/111 (60%), Gaps = 4/111 (4%)
 Frame = +1

Query  160  VVVLTEENFEK-EVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDCD  336
            V+ L + NF+K  + + + A V FYAPWCGHCK+L P +E L   ++  K ++I  VD D
Sbjct  157  VMALDQSNFDKVALDEGKDAFVLFYAPWCGHCKRLHPSFESLAKVYQNEKDLIIANVDAD  216

Query  337  E--HKSVCSKYGVSGYPTIQWFPKGSL-EPKKYEGARTAEALTEFVNTEAG  480
            +  +  V  +Y V GYPT+ +FPKG+   P  YE  RT + + +FVN   G
Sbjct  217  DKSNSEVTKRYKVEGYPTLVFFPKGNKGNPVNYEEGRTLDDMIKFVNERTG  267



>ref|NP_593584.1| protein disulfide isomerase [Schizosaccharomyces pombe 972h-]
 sp|O13811.1|PDI2_SCHPO RecName: Full=Protein disulfide-isomerase C17H9.14c; Flags: Precursor 
[Schizosaccharomyces pombe 972h-]
 emb|CAB11223.1| protein disulfide isomerase [Schizosaccharomyces pombe]
 gb|AAZ13768.1| protein disulfide isomerase [Schizosaccharomyces pombe]
Length=359

 Score =   123 bits (308),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/132 (44%), Positives = 79/132 (60%), Gaps = 2/132 (2%)
 Frame = +1

Query  121  IVALFFSAAFADDVVVLTEEN-FEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASF  294
            ++   F+  FA  VV L   N  E  +    + AL+EFYA WCGHCK LAP YE+LGA F
Sbjct  9    VIFALFALVFASGVVELQSLNELENTIRASKKGALIEFYATWCGHCKSLAPVYEELGALF  68

Query  295  KKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTE  474
            +    VLIGK+D D H  V  KY ++G+PT+ WFP    EP +Y  AR  ++LT+FV+ +
Sbjct  69   EDHNDVLIGKIDADTHSDVADKYHITGFPTLIWFPPDGSEPVQYSNARDVDSLTQFVSEK  128

Query  475  AGTNVKVAAIPS  510
             G   +   +PS
Sbjct  129  TGIKKRKIVLPS  140


 Score = 99.8 bits (247),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 50/111 (45%), Positives = 72/111 (65%), Gaps = 2/111 (2%)
 Frame = +1

Query  157  DVVVLTEENFEKEVGQDRA-ALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDC  333
            +VV L   NF+K V  D+   LVEFYA WCG+CK+LAP YE LG  FK   +V I K++ 
Sbjct  141  NVVELDSLNFDKVVMDDKKDVLVEFYADWCGYCKRLAPTYETLGKVFKNEPNVEIVKINA  200

Query  334  DEHKSVCSKYGVSGYPTIQWFPKGSLE-PKKYEGARTAEALTEFVNTEAGT  483
            D    +   + V+ +PTI++FPK   + P+ YEG R+ E+L E++N ++GT
Sbjct  201  DVFADIGRLHEVASFPTIKFFPKDDKDKPELYEGDRSLESLIEYINKKSGT  251



>gb|KIV87529.1| protein disulfide-isomerase domain [Exophiala sideris]
Length=366

 Score =   123 bits (308),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 58/110 (53%), Positives = 77/110 (70%), Gaps = 2/110 (2%)
 Frame = +1

Query  160  VVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDC--  333
            V +LT+  F++EVG D+  LV F APWCGHCK LAP +E+L   F    +VLI KVD   
Sbjct  142  VEMLTDTTFKQEVGGDKDVLVAFTAPWCGHCKTLAPVWEKLATDFASDPNVLIAKVDAEG  201

Query  334  DEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGT  483
            +  K+     G+SGYPTI++FPKGS EP+ Y GAR+ +AL +FVN++AGT
Sbjct  202  ENSKATAQSQGISGYPTIKFFPKGSSEPEPYSGARSEDALVDFVNSKAGT  251


 Score =   107 bits (266),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 52/115 (45%), Positives = 71/115 (62%), Gaps = 3/115 (3%)
 Frame = +1

Query  157  DVVVLTEENFEKEVGQD-RAALVEFYAPWCGHCKKLAPEYEQLGASF-KKAKSVLIGKVD  330
            DV+ L   NF+  V +  + ALVEF+APWCGHCK LAP YE+L  +F      V I  VD
Sbjct  19   DVLNLIPSNFDSVVFESGKPALVEFFAPWCGHCKNLAPIYEELATAFASSGNKVSIANVD  78

Query  331  CDEHKSVCSKYGVSGYPTIQWFP-KGSLEPKKYEGARTAEALTEFVNTEAGTNVK  492
             D+HK +  ++GV G+PT++WF  K   EP+ Y G R  E+LT F+  ++G   K
Sbjct  79   ADKHKDLGKRFGVQGFPTLKWFDGKPGSEPQDYNGGRDLESLTAFITEKSGVKAK  133



>gb|KIK41739.1| hypothetical protein CY34DRAFT_805685 [Suillus luteus UH-Slu-Lm8-n1]
Length=377

 Score =   123 bits (308),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 62/132 (47%), Positives = 85/132 (64%), Gaps = 5/132 (4%)
 Frame = +1

Query  121  IVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKK  300
            + A   +   A +VV LT +NF+ E+G+ +  LVEF+APWCGHCK LAP YEQLG +F  
Sbjct  8    LFAGLLAGVSASNVVELTPDNFDSEIGKGKPGLVEFFAPWCGHCKNLAPIYEQLGDAFAH  67

Query  301  AKS-VLIGKVDCDE-HKSVCSKYGVSGYPTIQWFP-KGSLEPKKYEGARTAEALTEFVNT  471
            AK  V++ KVD D   K +  KYGV+GYPT++WF  KG++EP  YEG R  +AL  F+  
Sbjct  68   AKGKVIVAKVDADGVGKPLGQKYGVTGYPTLKWFDEKGNIEP--YEGGRDLDALASFITA  125

Query  472  EAGTNVKVAAIP  507
            ++G    +   P
Sbjct  126  KSGVKSNIKPPP  137


 Score =   100 bits (250),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 47/118 (40%), Positives = 69/118 (58%), Gaps = 3/118 (3%)
 Frame = +1

Query  157  DVVVLTEENFEK-EVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDC  333
            + ++L   NF+   + + +  LV F APWCGHCK L P YEQ+   FK   + ++  +D 
Sbjct  140  EALILDVHNFDDIALDETKDVLVTFTAPWCGHCKNLKPIYEQVAIDFKPESNCVVANIDA  199

Query  334  DE--HKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTNVKVAA  501
            D   +K +  +YGVS YPTI++FP+G  E + YEG RT +A  +F+N   GT   V  
Sbjct  200  DAQPNKEIAGRYGVSSYPTIKFFPRGGKEVEAYEGPRTEQAFVDFLNERCGTQRAVGG  257



>ref|XP_001229051.1| hypothetical protein CHGG_02535 [Chaetomium globosum CBS 148.51]
 gb|EAQ90600.1| hypothetical protein CHGG_02535 [Chaetomium globosum CBS 148.51]
Length=373

 Score =   122 bits (307),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 58/122 (48%), Positives = 79/122 (65%), Gaps = 2/122 (2%)
 Frame = +1

Query  142  AAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIG  321
            AA    V +LT+ NF++++G D+  LV F APWCGHCK LAP +E +  +F    +VLI 
Sbjct  137  AAKPSSVTMLTDSNFKEQIGGDKNVLVAFTAPWCGHCKSLAPTWETIAENFATESNVLIA  196

Query  322  KVDCDEH--KSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTNVKV  495
            KVD D    K   ++YGV+GYPTI++FP GS  P+ Y G R+ EAL  F+N +AGT+  V
Sbjct  197  KVDADAETGKRTAAEYGVTGYPTIKFFPAGSTTPEDYNGGRSEEALVAFLNGKAGTHRAV  256

Query  496  AA  501
              
Sbjct  257  GG  258


 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 74/120 (62%), Gaps = 3/120 (3%)
 Frame = +1

Query  160  VVVLTEENFEKEVGQD-RAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKS-VLIGKVDC  333
            V+ L  +NF+  V +  +  LVEF+APWCGHCK LAP YE+L  +F+  K  V I KVD 
Sbjct  22   VLDLIPDNFDNVVLKSGKPTLVEFFAPWCGHCKTLAPVYEELALAFEHGKDKVQIAKVDA  81

Query  334  DEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTNV-KVAAIPS  510
            D  K++  ++GV G+PT+++F   S +P  Y G R  E+L+ F+  + G    K AA PS
Sbjct  82   DAEKALGKRFGVQGFPTLKFFDGKSDKPTDYNGGRDLESLSAFITEKTGVRSKKKAAKPS  141



>gb|KIW98029.1| protein disulfide-isomerase domain [Cladophialophora bantiana 
CBS 173.52]
Length=370

 Score =   122 bits (307),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 76/110 (69%), Gaps = 2/110 (2%)
 Frame = +1

Query  160  VVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVD--C  333
            V +LT+  F+ E+G D+  LV F APWCGHCK LAP +E+L   F    +VLI K+D   
Sbjct  146  VEMLTDTTFKSEIGGDKDVLVAFTAPWCGHCKSLAPTWEKLATDFANEPNVLIAKIDAEA  205

Query  334  DEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGT  483
            +  K+     G++GYPTI++FPKGS EP+ Y GAR+ EAL +FVN++AGT
Sbjct  206  ENSKATAQAQGITGYPTIKFFPKGSTEPEPYSGARSEEALVDFVNSKAGT  255


 Score =   108 bits (271),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 54/115 (47%), Positives = 72/115 (63%), Gaps = 3/115 (3%)
 Frame = +1

Query  157  DVVVLTEENFEKEVGQD-RAALVEFYAPWCGHCKKLAPEYEQLGASF-KKAKSVLIGKVD  330
            DV+ L   NF+K V +  + ALVEF+APWCGHCK LAP YE+L  +F      V I  VD
Sbjct  23   DVLNLIPSNFDKVVFESGKPALVEFFAPWCGHCKNLAPVYEELATAFAASGNKVTIANVD  82

Query  331  CDEHKSVCSKYGVSGYPTIQWFP-KGSLEPKKYEGARTAEALTEFVNTEAGTNVK  492
             D+HK +  ++GV G+PT++WF  K   EP+ Y G R  E+LT FV  ++G   K
Sbjct  83   ADKHKDLGKRFGVQGFPTLKWFDGKPGSEPEDYNGGRDLESLTAFVTEKSGVKAK  137



>gb|KIW40190.1| protein disulfide-isomerase domain [Exophiala oligosperma]
Length=369

 Score =   122 bits (307),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 78/110 (71%), Gaps = 2/110 (2%)
 Frame = +1

Query  160  VVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVD--C  333
            V +LT+ +F+ EVG D+  LV F APWCGHCK LAP +E++ + F    +VLI KVD   
Sbjct  146  VEMLTDSSFKTEVGGDKDVLVAFTAPWCGHCKSLAPTWEKVASDFASEPNVLIAKVDAEA  205

Query  334  DEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGT  483
            +  K+   + GV+GYPTI++FPKGS EP+ Y G R+ EAL +FVN++AGT
Sbjct  206  ENSKATAQEQGVTGYPTIKFFPKGSTEPEAYSGGRSEEALVDFVNSKAGT  255


 Score =   114 bits (284),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 84/138 (61%), Gaps = 4/138 (3%)
 Frame = +1

Query  88   MSRSRICTALAIVALFFSAAFADDVVVLTEENFEKEVGQ-DRAALVEFYAPWCGHCKKLA  264
            M + R   +LA  AL   A  A DV+ L   NF+  V + ++ ALVEF+APWCGHCK LA
Sbjct  1    MVQFRALLSLATFALPLVAT-ASDVINLIPSNFDSVVFESNKPALVEFFAPWCGHCKNLA  59

Query  265  PEYEQLGASFKKA-KSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFP-KGSLEPKKYEGAR  438
            P YE+L  +F  +   V I  VD D+HK +  ++GV G+PT++WF  K   EP+ Y G R
Sbjct  60   PVYEELATAFAASGNKVSIANVDADKHKDLGKRFGVQGFPTLKWFDGKPGSEPEDYNGGR  119

Query  439  TAEALTEFVNTEAGTNVK  492
              E+LT+FV  ++G   K
Sbjct  120  DLESLTKFVTEKSGVKSK  137



>ref|XP_007003322.1| hypothetical protein TREMEDRAFT_38433 [Tremella mesenterica DSM 
1558]
 gb|EIW70859.1| hypothetical protein TREMEDRAFT_38433 [Tremella mesenterica DSM 
1558]
Length=400

 Score =   122 bits (307),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 59/132 (45%), Positives = 80/132 (61%), Gaps = 2/132 (2%)
 Frame = +1

Query  103  ICTALAIVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQL  282
            + TAL           A  V+ L   NF++ VG  + ALVEF+APWCGHCK LAP YEQL
Sbjct  7    LRTALVGTVGLLKLVSASSVIDLDPSNFDQYVGGSKPALVEFFAPWCGHCKNLAPVYEQL  66

Query  283  GASFKKAKSVLIGKVDCD-EHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTE  459
              +F  +K V+I K D D E + +  +YGV G+PT++WFP GS EP  Y G R  ++L  
Sbjct  67   ADAFDPSK-VVIAKTDADGEGRDLGQRYGVQGFPTLKWFPAGSTEPVDYSGGRDLDSLAN  125

Query  460  FVNTEAGTNVKV  495
            FV+ E+G   ++
Sbjct  126  FVSKESGVKSRI  137


 Score = 90.5 bits (223),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 48/142 (34%), Positives = 78/142 (55%), Gaps = 12/142 (8%)
 Frame = +1

Query  67   NFPN*EKMSRSRICTALAIVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCG  246
            NF + E   +SRI      +A+   ++  DD+ +    +  K+V      LV F APWCG
Sbjct  125  NFVSKESGVKSRIKPPAPPIAVQLDSSNFDDIAL----DPTKDV------LVAFTAPWCG  174

Query  247  HCKKLAPEYEQLGASFKKAKSVLIGKVDCD--EHKSVCSKYGVSGYPTIQWFPKGSLEPK  420
            HCK + P YE++  +F    + ++ ++D D  ++K + +KY V  +PTI++FPKG+ EP 
Sbjct  175  HCKSMKPAYEKVAKAFAAETNCIVAQIDADAEDNKPIAAKYEVRSFPTIKFFPKGNGEPI  234

Query  421  KYEGARTAEALTEFVNTEAGTN  486
             Y   R+     EF+N   GT+
Sbjct  235  AYSSGRSEAQFVEFLNEHCGTS  256



>gb|KEF53112.1| protein disulfide-isomerase A6 [Exophiala aquamarina CBS 119918]
Length=369

 Score =   122 bits (306),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 77/113 (68%), Gaps = 2/113 (2%)
 Frame = +1

Query  151  ADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVD  330
            A  V +LT+  F++E+G D+  LV F APWCGHCK LAP +E++ A F    +VLI KVD
Sbjct  143  ASHVEMLTDTTFKQEIGGDKDVLVAFTAPWCGHCKTLAPVWEKVAADFASESNVLIAKVD  202

Query  331  --CDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGT  483
               +  K+     GV+GYPTI++FPKGS EP  Y G RT +AL +FVN++AGT
Sbjct  203  AEAENSKATAQAQGVTGYPTIKFFPKGSTEPVAYGGGRTEDALVDFVNSKAGT  255


 Score =   112 bits (281),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 84/138 (61%), Gaps = 4/138 (3%)
 Frame = +1

Query  88   MSRSRICTALAIVALFFSAAFADDVVVLTEENFEKEVGQD-RAALVEFYAPWCGHCKKLA  264
            M + +   ++A VAL   +A A DV+ L   NF+  V Q  + ALVEF+APWCGHCK LA
Sbjct  1    MVQLKSFVSIASVALPLVSA-ASDVLNLIPSNFDTVVFQSGKPALVEFFAPWCGHCKNLA  59

Query  265  PEYEQLGASFKKA-KSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKG-SLEPKKYEGAR  438
            P YE+L  +F  A   V I  VD D+HK +  ++GV G+PT++WF      EP+ Y G R
Sbjct  60   PVYEELATAFAAAGNKVSIANVDADKHKDLGKRFGVQGFPTLKWFDGTPGTEPEDYNGGR  119

Query  439  TAEALTEFVNTEAGTNVK  492
              E+LT+FV  ++G   K
Sbjct  120  DLESLTKFVTEKSGVKTK  137



>ref|XP_007740657.1| protein disulfide-isomerase A6 [Cladophialophora psammophila 
CBS 110553]
 gb|EXJ75155.1| protein disulfide-isomerase A6 [Cladophialophora psammophila 
CBS 110553]
Length=370

 Score =   122 bits (306),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 76/110 (69%), Gaps = 2/110 (2%)
 Frame = +1

Query  160  VVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVD--C  333
            V +LT+  F+ E+G D+  LV F APWCGHCK LAP +E+L   F    +VLI K+D   
Sbjct  146  VEMLTDTTFKSEIGGDKDVLVAFTAPWCGHCKSLAPTWEKLATDFVNEPNVLIAKIDAEA  205

Query  334  DEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGT  483
            +  K+     G++GYPTI++FPKGS EP+ Y GAR+ EAL +FVN++AGT
Sbjct  206  ENSKATAQAQGITGYPTIKFFPKGSTEPEPYSGARSEEALVDFVNSKAGT  255


 Score =   108 bits (269),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 54/115 (47%), Positives = 72/115 (63%), Gaps = 3/115 (3%)
 Frame = +1

Query  157  DVVVLTEENFEKEVGQD-RAALVEFYAPWCGHCKKLAPEYEQLGASF-KKAKSVLIGKVD  330
            DV+ L   NF+K V +  + ALVEF+APWCGHCK LAP YE+L  +F      V I  VD
Sbjct  23   DVLNLIPSNFDKVVFESGKPALVEFFAPWCGHCKNLAPVYEELATAFAASGNKVTIANVD  82

Query  331  CDEHKSVCSKYGVSGYPTIQWFP-KGSLEPKKYEGARTAEALTEFVNTEAGTNVK  492
             D+HK +  ++GV G+PT++WF  K   EP+ Y G R  E+LT FV  ++G   K
Sbjct  83   ADKHKDLGKRFGVQGFPTLKWFDGKPGSEPEDYNGGRDLESLTAFVMEKSGIKAK  137



>ref|XP_009153118.1| protein disulfide isomerase family A, member 6 [Exophiala dermatitidis 
NIH/UT8656]
 gb|EHY52657.1| protein disulfide isomerase family A, member 6 [Exophiala dermatitidis 
NIH/UT8656]
Length=369

 Score =   122 bits (306),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 77/111 (69%), Gaps = 2/111 (2%)
 Frame = +1

Query  157  DVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVD--  330
            +V +LT+  F++EVG D+  LV F APWCGHCK LAP +E+L   F    +V+I KVD  
Sbjct  145  NVEMLTDTTFKQEVGGDKDVLVAFTAPWCGHCKSLAPTWEKLADDFAAEPNVIIAKVDAE  204

Query  331  CDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGT  483
             +  K+     G++GYPTI++FPKGS EP+ Y G RT EAL +F+N++AGT
Sbjct  205  AENSKATAQSQGITGYPTIKFFPKGSTEPEPYTGPRTEEALVDFINSKAGT  255


 Score =   115 bits (288),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 84/138 (61%), Gaps = 4/138 (3%)
 Frame = +1

Query  88   MSRSRICTALAIVALFFSAAFADDVVVLTEENFEKEVGQ-DRAALVEFYAPWCGHCKKLA  264
            M + R   +LA + L    A A DV+ L   NF+K V + ++ ALVEF+APWCGHCK LA
Sbjct  1    MVQLRSFLSLAALTLPLVTA-ASDVINLIPSNFDKVVFESNKPALVEFFAPWCGHCKNLA  59

Query  265  PEYEQLGASF-KKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFP-KGSLEPKKYEGAR  438
            P YE+L  +F      V I  VD D+HK +  ++GV G+PT++WF  K   EP+ Y G R
Sbjct  60   PVYEELATAFANSGNKVTIANVDADKHKDLGKRFGVQGFPTLKWFDGKPGSEPEDYNGGR  119

Query  439  TAEALTEFVNTEAGTNVK  492
              E+LT+F+  + G  VK
Sbjct  120  DLESLTKFIVEKTGVKVK  137



>ref|XP_003661464.1| hypothetical protein MYCTH_2300901 [Myceliophthora thermophila 
ATCC 42464]
 gb|AEO56219.1| hypothetical protein MYCTH_2300901 [Myceliophthora thermophila 
ATCC 42464]
Length=369

 Score =   122 bits (306),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 78/117 (67%), Gaps = 2/117 (2%)
 Frame = +1

Query  142  AAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIG  321
            AA   +VV+LT+  F+ ++G D+  LV F APWCGHCK+LAP +E L  +F    +V+I 
Sbjct  137  AAKPSNVVMLTDSTFKNQIGGDKNVLVAFTAPWCGHCKRLAPTWESLADTFASESNVVIA  196

Query  322  KVDCDEH--KSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
            KVD D    K   ++YGVSGYPTI++FP GS  P+ Y GAR+ E+   F+N + GT+
Sbjct  197  KVDADAETGKRTAAEYGVSGYPTIKFFPAGSTTPEDYNGARSEESFVTFLNEKTGTH  253


 Score =   103 bits (256),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 56/139 (40%), Positives = 82/139 (59%), Gaps = 3/139 (2%)
 Frame = +1

Query  103  ICTALAIVALFFSAAFADDVVVLTEENFEKEVGQD-RAALVEFYAPWCGHCKKLAPEYEQ  279
            +  +  +  L   AA    V+ L  +NF+K V +  +  LVEF+APWCGHCK LAP YE+
Sbjct  3    LLKSFVLAGLTAVAAAKSAVLDLIPDNFDKVVLKSGKPTLVEFFAPWCGHCKNLAPVYEE  62

Query  280  LGASFKKAKS-VLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALT  456
            L  +F+ AK  V I KVD D  + +  ++GV G+PT+++F   S +P +Y G R  E+L+
Sbjct  63   LALAFEHAKDKVQIAKVDADAERDLGKRFGVQGFPTLKFFDGKSDKPTEYNGGRDLESLS  122

Query  457  EFVNTEAGTN-VKVAAIPS  510
             F+  + G    K AA PS
Sbjct  123  SFITEKTGIRPRKKAAKPS  141



>gb|KIP07233.1| hypothetical protein PHLGIDRAFT_105975 [Phlebiopsis gigantea 
11061_1 CR5-6]
Length=386

 Score =   122 bits (305),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/127 (48%), Positives = 85/127 (67%), Gaps = 4/127 (3%)
 Frame = +1

Query  121  IVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKK  300
            IV+L    A+A +V+ LT +NF++ VG+D+ ALVEF+APWCGHCK LAP+YE+L  +F  
Sbjct  11   IVSL--GGAWASNVLDLTPDNFDEIVGKDKGALVEFFAPWCGHCKNLAPKYEELADAFTH  68

Query  301  AKS-VLIGKVDCDE-HKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTE  474
            AK  V+I KVD D   K +  KYGV+G+PT++WFP    EP+ Y G R    L  F+  +
Sbjct  69   AKDKVVIAKVDADGVGKPLGQKYGVTGFPTLKWFPANGGEPETYNGGREVLDLAAFITEK  128

Query  475  AGTNVKV  495
            +G   K+
Sbjct  129  SGAKSKI  135


 Score = 95.9 bits (237),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 67/113 (59%), Gaps = 6/113 (5%)
 Frame = +1

Query  163  VVLTEENFEKEVGQD--RAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDCD  336
             VL    F+ EV  D  +  LV F APWCGHCK+L P YEQL   FK   +V+I  VD D
Sbjct  144  TVLDTHTFD-EVALDSSKDVLVTFTAPWCGHCKRLKPIYEQLALDFKNEPNVVIANVDAD  202

Query  337  E--HKSVCSKYGVSGYPTIQWFPKGSL-EPKKYEGARTAEALTEFVNTEAGTN  486
               ++ +  KYGV  +PTI++FPK S  EP  Y+G R+ EA   ++N   GT+
Sbjct  203  AAPNRPLAQKYGVGSFPTIKFFPKASKEEPLDYDGERSEEAFVSYLNEHCGTH  255



>ref|XP_006582592.1| PREDICTED: probable protein disulfide-isomerase A6-like [Glycine 
max]
Length=293

 Score =   120 bits (301),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +1

Query  325  VDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTNVKVAAI  504
            VDCDEHKS+CSKYGVSGYPTIQWFPKGSLEPKKYEG RTA++L EFVNTE GTNVK+A  
Sbjct  14   VDCDEHKSLCSKYGVSGYPTIQWFPKGSLEPKKYEGPRTADSLAEFVNTEGGTNVKIATA  73

Query  505  PS  510
            PS
Sbjct  74   PS  75


 Score =   114 bits (284),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 78/114 (68%), Gaps = 1/114 (1%)
 Frame = +1

Query  157  DVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDC  333
            +VVVLT ENF + V  + +  LVEFYAPWCGHCK LAP YE++  +FK  + V+I  +D 
Sbjct  76   NVVVLTSENFNEVVLDETKDVLVEFYAPWCGHCKSLAPIYEKVVTAFKLEEDVVIANLDA  135

Query  334  DEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTNVKV  495
            D++K +  KY VSG+PT+++FPKG+   ++Y G R  +    F+N ++GT+  V
Sbjct  136  DKYKDLAEKYDVSGFPTLKFFPKGNKAGEEYGGGRDLDDFVAFINEKSGTSRDV  189



>gb|KIV92919.1| protein disulfide-isomerase domain [Exophiala mesophila]
Length=369

 Score =   121 bits (303),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 76/110 (69%), Gaps = 2/110 (2%)
 Frame = +1

Query  160  VVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVD--C  333
            V +LT+  F +E+G D+  LV F APWCGHCK LAP +E++ A F     VLI KVD   
Sbjct  146  VEMLTDTTFPQEIGGDKDVLVAFTAPWCGHCKSLAPTWEKVAADFASEPQVLIAKVDAEA  205

Query  334  DEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGT  483
            +  KS+    G++GYPTI++FPKG+ EP+ Y G R+ +AL +F+N++AGT
Sbjct  206  ENSKSLAQSQGITGYPTIKFFPKGATEPETYSGGRSEDALVDFINSKAGT  255


 Score =   114 bits (286),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 61/135 (45%), Positives = 84/135 (62%), Gaps = 4/135 (3%)
 Frame = +1

Query  100  RICTALAIVALFFSA-AFADDVVVLTEENFEKEVGQD-RAALVEFYAPWCGHCKKLAPEY  273
            ++ T L + AL F     A DV+ L   NF+K V Q  + ALVEF+APWCGHCK LAP Y
Sbjct  3    QLNTFLPLAALAFPLLTSASDVLNLIPSNFDKVVFQSGKPALVEFFAPWCGHCKNLAPVY  62

Query  274  EQLGASFKKA-KSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFP-KGSLEPKKYEGARTAE  447
            E+L  +F  +   V I  V+ DEHKS+  ++GV G+PT++WF    + EP+ Y G R  E
Sbjct  63   EELATAFAASGNKVSIANVNADEHKSLGKRFGVQGFPTLKWFDGTPNAEPQDYNGGRDLE  122

Query  448  ALTEFVNTEAGTNVK  492
            +LT FV+ ++G   K
Sbjct  123  SLTAFVSEKSGVKAK  137



>ref|XP_003648981.1| hypothetical protein THITE_2107066 [Thielavia terrestris NRRL 
8126]
 gb|AEO62645.1| hypothetical protein THITE_2107066 [Thielavia terrestris NRRL 
8126]
Length=382

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 77/114 (68%), Gaps = 2/114 (2%)
 Frame = +1

Query  160  VVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDCDE  339
            VV+LT+  F++ +G D+  LV F APWCGHCK LAP +E+L  +F    +VL+ KVD D 
Sbjct  143  VVMLTDSTFKQHIGGDKNVLVAFTAPWCGHCKNLAPTWEKLAENFANEPNVLVAKVDADA  202

Query  340  H--KSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTNVKV  495
               K+  ++YGV GYPTI++FP GS  P+ Y GAR+ EA   F+N +AGT+  V
Sbjct  203  ETGKATAAEYGVKGYPTIKFFPAGSTTPEDYSGARSEEAFVTFLNEKAGTHRAV  256


 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 72/113 (64%), Gaps = 2/113 (2%)
 Frame = +1

Query  160  VVVLTEENFEKEVGQD-RAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKS-VLIGKVDC  333
            V+ L  +NF+K V +  +  LVEF+APWCGHCK LAP YE+L  +F+ AK  V I KVD 
Sbjct  22   VLDLIPDNFDKVVLKSGKPTLVEFFAPWCGHCKNLAPIYEELALAFEHAKDKVQIAKVDA  81

Query  334  DEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTNVK  492
            D  + +  ++GV G+PT+++F   S +P +Y G R  E+L+ F+  + G   +
Sbjct  82   DAERDLGKRFGVQGFPTLKFFDGKSDKPTEYNGGRDLESLSNFITEKTGVRAR  134



>emb|CBH12152.1| protein disulfide isomerase, putative [Trypanosoma brucei gambiense 
DAL972]
Length=377

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/135 (46%), Positives = 85/135 (63%), Gaps = 8/135 (6%)
 Frame = +1

Query  94   RSRICTALAIVALFFSAAFADD-------VVVLTEENFEKEVGQDRAALVEFYAPWCGHC  252
            ++ +  A+ I A F SAA A++       V  LT  NF+  VG+D AALVEFYAPWCGHC
Sbjct  8    KTSLLKAICIFAYFASAAHANEPDAALEGVADLTSSNFDSSVGKDVAALVEFYAPWCGHC  67

Query  253  KKLAPEYEQLGASFKKAKS-VLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYE  429
            K L PE+ +LG +   AK  VLI KVD    K + +++ V+GYPTI +FP GS +P+KY 
Sbjct  68   KNLVPEFAKLGRAAAGAKDKVLIAKVDATAQKDLATRFEVNGYPTILFFPAGSQKPEKYS  127

Query  430  GARTAEALTEFVNTE  474
              R A+A   ++N +
Sbjct  128  EGREAKAFVSYLNNQ  142


 Score = 97.4 bits (241),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 67/111 (60%), Gaps = 4/111 (4%)
 Frame = +1

Query  160  VVVLTEENFEK-EVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDCD  336
            V+ L + NF+K  + + + A V FYAPWCGHCK+L P +E L   ++  K ++I  VD D
Sbjct  157  VMALDQSNFDKVALDEGKDAFVLFYAPWCGHCKRLHPSFESLAKVYQNEKDLIIANVDAD  216

Query  337  E--HKSVCSKYGVSGYPTIQWFPKGSL-EPKKYEGARTAEALTEFVNTEAG  480
            +  +  V  +Y V GYPT+ +FPKG+   P  YE  RT + + +FVN   G
Sbjct  217  DKSNSEVTKRYKVEGYPTLVFFPKGNKGNPVNYEEGRTLDDMIKFVNERTG  267



>emb|CAJ77505.1| putative disulphide isomerase [Solanum tuberosum]
Length=250

 Score =   119 bits (297),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/113 (50%), Positives = 74/113 (65%), Gaps = 1/113 (1%)
 Frame = +1

Query  160  VVVLTEENFEKEVGQDRA-ALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDCD  336
            V  LTE +F+ EV   +  A+VEFYAPWCGHCK+LAP YE++GA F+   +VLI KVD  
Sbjct  119  VAALTEADFDAEVIHSKKHAIVEFYAPWCGHCKQLAPTYEEVGAIFEGEDNVLIAKVDAT  178

Query  337  EHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTNVKV  495
             +  V S+Y V GYPT+ +FP GS EP+ Y   R   +  EF+N  AGT+  V
Sbjct  179  ANAEVASRYNVKGYPTLFYFPPGSDEPEDYSNGRDKASFVEFINEHAGTHRTV  231


 Score =   118 bits (295),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 72/101 (71%), Gaps = 0/101 (0%)
 Frame = +1

Query  208  RAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTI  387
            +  L++FYAPWC HCK + P YE +  +FKKA +V++ +VD D HK + SKYGV+ +PT+
Sbjct  17   KHVLIKFYAPWCAHCKSMPPTYETVATAFKKADNVVVAEVDADSHKELGSKYGVTVFPTL  76

Query  388  QWFPKGSLEPKKYEGARTAEALTEFVNTEAGTNVKVAAIPS  510
            ++F KGS EP+ Y+G R+ +    F+N +A TNV+VA  PS
Sbjct  77   KYFAKGSTEPEDYKGGRSEDDFVNFLNEKADTNVRVAKAPS  117



>ref|XP_005100750.1| PREDICTED: protein disulfide-isomerase A3-like isoform X1 [Aplysia 
californica]
Length=496

 Score =   122 bits (305),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/118 (51%), Positives = 78/118 (66%), Gaps = 2/118 (2%)
 Frame = +1

Query  130  LFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAK-  306
            L F  AFADDV+V T+ NF  E+ +    LV+FYAPWCGHCK+LAPEYE+   + KK   
Sbjct  11   LCFCGAFADDVLVFTDANFGDEIAKYETILVKFYAPWCGHCKRLAPEYERAATTLKKQDP  70

Query  307  SVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAG  480
             V + KVDC    +VCSK+GVSGYPT++ F  G L  K Y G R A+ + +++  EAG
Sbjct  71   PVALAKVDCTVETNVCSKHGVSGYPTLKVFKNGEL-AKDYSGPREADGIVKYMVREAG  127


 Score = 92.8 bits (229),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 70/108 (65%), Gaps = 3/108 (3%)
 Frame = +1

Query  160  VVVLTEENFEKEVG-QDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDCD  336
            V V+  +NF++ V  +D+  L+EFYAPWCGHCK LAP+Y++L    K  ++V+I K+D  
Sbjct  368  VKVVVGKNFDEIVNNEDKDVLIEFYAPWCGHCKSLAPKYDELAEKLKDEENVVIAKMDAT  427

Query  337  EHKSVCSKYGVSGYPTIQWFPKGSLE-PKKYEGARTAEALTEFVNTEA  477
             +  V   Y V G+PTI + PKG+   PKKYEG R  +   ++++ EA
Sbjct  428  AN-DVPPNYEVRGFPTIYFAPKGNKSTPKKYEGGREVDDFVKYLSKEA  474



>gb|KFA63218.1| hypothetical protein S40285_04917 [Stachybotrys chlorohalonata 
IBT 40285]
Length=376

 Score =   121 bits (303),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/112 (51%), Positives = 73/112 (65%), Gaps = 2/112 (2%)
 Frame = +1

Query  157  DVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDCD  336
            DV +LT+  F + VG D+  LV F APWCGHCKKLAP +E L + F    +V+I KVD D
Sbjct  142  DVKILTDATFSEAVGGDKNVLVAFTAPWCGHCKKLAPTWETLASDFVNEPNVIIAKVDAD  201

Query  337  EH--KSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
                KS   +YGV  YPTI++FP GS E + YEG RT +A   F+N +AGT+
Sbjct  202  NDNSKSTAQEYGVKSYPTIKYFPAGSKEAQPYEGGRTEDAFINFINEKAGTH  253


 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/110 (45%), Positives = 69/110 (63%), Gaps = 2/110 (2%)
 Frame = +1

Query  169  LTEENFEKEVGQD-RAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKS-VLIGKVDCDEH  342
            L   NF++ V +  +  LVEF+APWCGHCK LAP YE+L  +F+ AK  V I KVD D  
Sbjct  25   LIPSNFDEVVLKSGKPTLVEFFAPWCGHCKNLAPVYEELALAFEHAKDKVQIAKVDADAE  84

Query  343  KSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTNVK  492
            KS+  ++GV G+PT++WF   S  P  Y+  R  E+L+ F+  + G  +K
Sbjct  85   KSLGKRFGVQGFPTLKWFDGKSDTPVDYKSGRDLESLSSFITEKTGVKLK  134



>ref|XP_008874577.1| protein disulfide-isomerase domain [Aphanomyces invadans]
 gb|ETV96800.1| protein disulfide-isomerase domain [Aphanomyces invadans]
Length=355

 Score =   120 bits (302),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/112 (49%), Positives = 73/112 (65%), Gaps = 0/112 (0%)
 Frame = +1

Query  157  DVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDCD  336
            DVV LT   F+  V   +   V+FYAPWCGHCK L P +E L  SFK    V+I KVD D
Sbjct  20   DVVTLTPNTFKSVVDGSKNVFVKFYAPWCGHCKNLEPTWETLATSFKNVDDVVIAKVDAD  79

Query  337  EHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTNVK  492
            EHK + S++ V+G+PT++++ KG+  P  Y G R+ + L EFVN  AGTNV+
Sbjct  80   EHKELGSEWEVNGFPTLKFWNKGAKYPDPYNGGRSEDELIEFVNKAAGTNVR  131


 Score =   106 bits (265),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 70/114 (61%), Gaps = 3/114 (3%)
 Frame = +1

Query  160  VVVLTEENFEKEVGQD--RAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDC  333
            VV LTE +F   + QD  +  LVEFYAPWCGHCK LAP +++LGA F    +V+I KVD 
Sbjct  139  VVALTESDFA-SIAQDPTKHVLVEFYAPWCGHCKSLAPTWDKLGAVFAGDDNVVIAKVDA  197

Query  334  DEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTNVKV  495
                 +  K+GVSGYPTI++F  G+ EP+ Y   R       FVN  AGT+  V
Sbjct  198  TATGELAKKFGVSGYPTIKYFGTGASEPEDYGLGRDLPDFVSFVNEHAGTHRTV  251



>gb|KHN95748.1| protein disulfide-isomerase tigA precursor [Metarhizium album 
ARSEF 1941]
Length=372

 Score =   121 bits (303),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 77/111 (69%), Gaps = 2/111 (2%)
 Frame = +1

Query  160  VVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDCD-  336
            VV+LT+ +F + +G D+  LV F APWCGHCK LAP +E L A F    +V+I KVD + 
Sbjct  143  VVMLTDSSFAEVIGSDKNVLVAFTAPWCGHCKNLAPTWESLAADFANEANVVIAKVDAEA  202

Query  337  -EHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
               K+V ++ GV+ YPTI+WFP GS + + Y+GAR+ +A  EF+N EAGT+
Sbjct  203  PHSKAVATEQGVTSYPTIKWFPAGSKKAESYDGARSEDAFVEFINKEAGTH  253


 Score =   100 bits (250),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 71/110 (65%), Gaps = 2/110 (2%)
 Frame = +1

Query  169  LTEENFEKEVGQDRA-ALVEFYAPWCGHCKKLAPEYEQLGASFKKAKS-VLIGKVDCDEH  342
            LT  NF+K V +     LVEF+APWCGHCK LAP YE+L  + + AK  V I KVD D  
Sbjct  25   LTHSNFDKVVLKSGIPTLVEFFAPWCGHCKSLAPTYEELALALEHAKDKVQIAKVDADSE  84

Query  343  KSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTNVK  492
            + +  ++G+ G+PT+++F   S +P++Y+  R  E+LT+F+  +AG   K
Sbjct  85   RELGKRFGIQGFPTLKYFDGKSDKPEEYKSGRDLESLTKFLTEKAGVKAK  134



>gb|AAU45393.1| protein disulfide isomerase [Entamoeba histolytica]
 dbj|BAN37720.1| protein disulfide isomerase, putative [Entamoeba histolytica]
 dbj|BAN38501.1| protein disulfide isomerase, putative [Entamoeba histolytica]
 dbj|BAN39751.1| protein disulfide isomerase, putative [Entamoeba histolytica]
Length=337

 Score =   120 bits (301),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 74/105 (70%), Gaps = 2/105 (2%)
 Frame = +1

Query  157  DVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDCD  336
            DVV L   NF   V   +   V+F+APWCGHCKKLAPEY +L  ++K  + ++I ++DCD
Sbjct  16   DVVSLNPTNFNTIVDGSKHVFVKFFAPWCGHCKKLAPEYIKLADAYKDKQDIVIAELDCD  75

Query  337  --EHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFV  465
              +HK +C K+G+SG+PT+++F KG+ EP +YEG RT E L+ F+
Sbjct  76   NKDHKDLCGKFGISGFPTLKFFRKGTTEPIEYEGGRTVEDLSHFI  120


 Score = 89.0 bits (219),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 65/110 (59%), Gaps = 2/110 (2%)
 Frame = +1

Query  157  DVVVLTEENFEKEVGQ-DRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDC  333
            +VV +T   F+  V    +   V+F+APWCGHCK LAP+Y ++   +     +++ +VDC
Sbjct  131  NVVSVTTATFDSIVMDPTKNVFVKFFAPWCGHCKALAPKYIEVSKMYAGEDDLVVAEVDC  190

Query  334  DEHKSVCSKYGVSGYPTIQWFPKG-SLEPKKYEGARTAEALTEFVNTEAG  480
              ++  C+KY V GYPT++ FPKG + +P  YEG R  +    + NT  G
Sbjct  191  TANQETCNKYEVHGYPTLKSFPKGENKKPIAYEGGREVKDFVTYFNTNYG  240



>dbj|BAN38303.1| protein disulfide isomerase, putative [Entamoeba histolytica]
Length=337

 Score =   120 bits (301),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 74/105 (70%), Gaps = 2/105 (2%)
 Frame = +1

Query  157  DVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDCD  336
            DVV L   NF   V   +   V+F+APWCGHCKKLAPEY +L  ++K  + ++I ++DCD
Sbjct  16   DVVSLNPTNFNTIVDGSKHVFVKFFAPWCGHCKKLAPEYIKLADAYKDKQDIVIAELDCD  75

Query  337  --EHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFV  465
              +HK +C K+G+SG+PT+++F KG+ EP +YEG RT E L+ F+
Sbjct  76   NKDHKDLCGKFGISGFPTLKFFRKGTTEPIEYEGGRTVEDLSHFI  120


 Score = 89.0 bits (219),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 65/110 (59%), Gaps = 2/110 (2%)
 Frame = +1

Query  157  DVVVLTEENFEKEVGQ-DRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDC  333
            +VV +T   F+  V    +   V+F+APWCGHCK LAP+Y ++   +     +++ +VDC
Sbjct  131  NVVSVTTATFDSIVMDPTKNVFVKFFAPWCGHCKALAPKYIEVSKMYAGEDDLVVAEVDC  190

Query  334  DEHKSVCSKYGVSGYPTIQWFPKG-SLEPKKYEGARTAEALTEFVNTEAG  480
              ++  C+KY V GYPT++ FPKG + +P  YEG R  +    + NT  G
Sbjct  191  TANQETCNKYEVHGYPTLKSFPKGENKKPIAYEGGREVKDFVTYFNTNYG  240



>ref|XP_650651.1| protein disulfide isomerase [Entamoeba histolytica HM-1:IMSS]
 gb|EAL45264.1| protein disulfide isomerase, putative [Entamoeba histolytica 
HM-1:IMSS]
 gb|EMD47466.1| disulfide isomerase, putative [Entamoeba histolytica KU27]
Length=368

 Score =   120 bits (302),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 74/105 (70%), Gaps = 2/105 (2%)
 Frame = +1

Query  157  DVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDCD  336
            DVV L   NF   V   +   V+F+APWCGHCKKLAPEY +L  ++K  + ++I ++DCD
Sbjct  47   DVVSLNPTNFNTIVDGSKHVFVKFFAPWCGHCKKLAPEYIKLADAYKDKQDIVIAELDCD  106

Query  337  --EHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFV  465
              +HK +C K+G+SG+PT+++F KG+ EP +YEG RT E L+ F+
Sbjct  107  NKDHKDLCGKFGISGFPTLKFFRKGTTEPIEYEGGRTVEDLSHFI  151


 Score = 89.0 bits (219),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 65/110 (59%), Gaps = 2/110 (2%)
 Frame = +1

Query  157  DVVVLTEENFEKEVGQ-DRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDC  333
            +VV +T   F+  V    +   V+F+APWCGHCK LAP+Y ++   +     +++ +VDC
Sbjct  162  NVVSVTTATFDSIVMDPTKNVFVKFFAPWCGHCKALAPKYIEVSKMYAGEDDLVVAEVDC  221

Query  334  DEHKSVCSKYGVSGYPTIQWFPKG-SLEPKKYEGARTAEALTEFVNTEAG  480
              ++  C+KY V GYPT++ FPKG + +P  YEG R  +    + NT  G
Sbjct  222  TANQETCNKYEVHGYPTLKSFPKGENKKPIAYEGGREVKDFVTYFNTNYG  271



>ref|XP_001684070.1| putative protein disulfide isomerase [Leishmania major strain 
Friedlin]
 emb|CAJ04838.1| putative protein disulfide isomerase [Leishmania major strain 
Friedlin]
Length=377

 Score =   120 bits (302),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 82/108 (76%), Gaps = 4/108 (4%)
 Frame = +1

Query  160  VVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKS----VLIGKV  327
            +V ++++NF++ VG+++A LVEFYAPWCGHCK +APEY  LGA+++ + +    +L+GKV
Sbjct  34   IVQMSKDNFDQLVGKEKAVLVEFYAPWCGHCKSMAPEYAALGAAYEASTNAKDLLLVGKV  93

Query  328  DCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNT  471
            D  +   +  ++GV+G+PTI +F  GSLEP+KY+G RTAE   +++++
Sbjct  94   DATQDSDLGKRFGVTGFPTILYFAPGSLEPEKYKGGRTAEDFAKYLSS  141


 Score = 92.4 bits (228),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 45/108 (42%), Positives = 64/108 (59%), Gaps = 4/108 (4%)
 Frame = +1

Query  169  LTEENFEKEVGQ-DRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDCDE--  339
            L   NF+  V    +A LV FYAPWCGHCK L P Y  L   F   K V+I +++ D+  
Sbjct  160  LVHTNFDAVVKDPSKAVLVMFYAPWCGHCKALKPIYNTLAKVFSNDKDVVIARINADDAA  219

Query  340  HKSVCSKYGVSGYPTIQWFPKGSLE-PKKYEGARTAEALTEFVNTEAG  480
            ++ + ++Y V+G+PT+ +FPKG+ E P +Y+  R  E    FVN  AG
Sbjct  220  NRKIATEYAVAGFPTVYFFPKGADEKPVEYKNGRNLEDFLTFVNENAG  267



>emb|CCM04393.1| predicted protein [Fibroporia radiculosa]
Length=556

 Score =   122 bits (306),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 61/137 (45%), Positives = 85/137 (62%), Gaps = 2/137 (1%)
 Frame = +1

Query  91   SRSRICTALAIVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPE  270
            S  +    L    L    A+A +VV L  +NF+  +GQ + ALVEF+APWCGHCK LAP 
Sbjct  187  SSMKFAFTLFAAVLSLGGAWASNVVELDPDNFDSIIGQGKPALVEFFAPWCGHCKNLAPI  246

Query  271  YEQLGASFKKAKS-VLIGKVDCDE-HKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTA  444
            YEQL  S+  AK  V+I KVD D   + + +K+GV+G+PT++WF     EP+KYEG R  
Sbjct  247  YEQLADSYAYAKDKVIIAKVDADGVGRPLGTKFGVTGFPTLKWFGPEGGEPEKYEGGRDL  306

Query  445  EALTEFVNTEAGTNVKV  495
            +AL  FV +++G    +
Sbjct  307  DALANFVTSKSGVKSSI  323


 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 62/112 (55%), Gaps = 14/112 (13%)
 Frame = +1

Query  154  DDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDC  333
            DDVV+          G D  A+V F APWCGHCK L P ++ +   F      +I  VD 
Sbjct  340  DDVVL--------NSGND--AIVAFTAPWCGHCKNLKPTWDSVAKDFATESKCIIANVDA  389

Query  334  D--EHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGT  483
            D   +K +  KYGVS YPTI++F  G  E   YEGART +A  EF+N + GT
Sbjct  390  DAAHNKPLGEKYGVSSYPTIKFFHDGKAE--DYEGARTEKAFVEFLNEKCGT  439



>ref|XP_004258971.1| protein disulfide isomerase, putative [Entamoeba invadens IP1]
 gb|ELP92200.1| protein disulfide isomerase, putative [Entamoeba invadens IP1]
Length=127

 Score =   115 bits (287),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 51/119 (43%), Positives = 80/119 (67%), Gaps = 1/119 (1%)
 Frame = +1

Query  109  TALAIVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGA  288
             AL ++ + F++A ++ +V LT E F       +  LV+F+APWCGHCK+LAP Y +L  
Sbjct  2    NALLVLLIAFASASSEGLVSLTAETFPTYKASGKTILVKFFAPWCGHCKRLAPTYVELAT  61

Query  289  SFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFV  465
            + K+ ++V+I +V+CD+++ +C+  GV G+PT+Q F  G  EP KY+G RT E L +FV
Sbjct  62   AMKENENVVIAEVNCDDNREICTANGVRGFPTVQLF-NGEAEPVKYQGPRTLEDLKKFV  119



>ref|XP_008730139.1| protein disulfide-isomerase domain [Cladophialophora carrionii 
CBS 160.54]
 gb|ETI21258.1| protein disulfide-isomerase domain [Cladophialophora carrionii 
CBS 160.54]
Length=370

 Score =   120 bits (301),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 76/110 (69%), Gaps = 2/110 (2%)
 Frame = +1

Query  160  VVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDCDE  339
            V +LT+ +F+ E+G D+  LV F APWCGHCK LAP +E++ A F     VLI KVD + 
Sbjct  146  VEMLTDSSFKTEIGGDKDVLVAFTAPWCGHCKSLAPTWEKVAADFASEPGVLIAKVDAEA  205

Query  340  H--KSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGT  483
               K+     G++GYPTI++FPKGS E + Y GAR+ EAL EFVN++AGT
Sbjct  206  ENAKATAQDQGITGYPTIKFFPKGSKEAESYSGARSEEALVEFVNSKAGT  255


 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 56/119 (47%), Positives = 75/119 (63%), Gaps = 3/119 (3%)
 Frame = +1

Query  145  AFADDVVVLTEENFEKEVGQD-RAALVEFYAPWCGHCKKLAPEYEQLGASFKKA-KSVLI  318
            A A DVV L   NF+  V +  + ALVEF+APWCGHCK LAP YE+L  +F  +   V I
Sbjct  19   ASASDVVNLIPSNFDTVVFESGKPALVEFFAPWCGHCKNLAPVYEELATAFAASGNKVTI  78

Query  319  GKVDCDEHKSVCSKYGVSGYPTIQWFP-KGSLEPKKYEGARTAEALTEFVNTEAGTNVK  492
              VD D+HK +  ++GV G+PT++WF  K   EP+ Y G R  E+LT FV+ ++G   K
Sbjct  79   ANVDADKHKDLGKRFGVQGFPTLKWFDGKPGSEPEDYNGGRDLESLTAFVSEKSGVKAK  137



>ref|XP_007733462.1| protein disulfide-isomerase A6 [Capronia epimyces CBS 606.96]
 gb|EXJ84477.1| protein disulfide-isomerase A6 [Capronia epimyces CBS 606.96]
Length=369

 Score =   120 bits (301),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 58/110 (53%), Positives = 76/110 (69%), Gaps = 2/110 (2%)
 Frame = +1

Query  160  VVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVD--C  333
            V +LT+  F++EVG D+  LV F APWCGHCK LAP +E+L   F    +VLI KVD   
Sbjct  146  VEILTDTTFKEEVGGDKDVLVAFTAPWCGHCKSLAPIWEKLADDFASESNVLIAKVDAEA  205

Query  334  DEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGT  483
            +  K+      V+GYPTI++FPKGS EP++Y G R+ EAL +FVNT+AGT
Sbjct  206  ENSKATARAQEVTGYPTIKFFPKGSTEPEQYSGPRSEEALVDFVNTKAGT  255


 Score =   111 bits (278),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 54/115 (47%), Positives = 75/115 (65%), Gaps = 3/115 (3%)
 Frame = +1

Query  157  DVVVLTEENFEKEVGQ-DRAALVEFYAPWCGHCKKLAPEYEQLGASF-KKAKSVLIGKVD  330
            DVV L   NF+K V + ++ ALVEF+APWCGHCK LAP YE+L ++F      V +  VD
Sbjct  23   DVVNLIPSNFDKVVFESNKPALVEFFAPWCGHCKNLAPTYEELASAFAASGNKVTVANVD  82

Query  331  CDEHKSVCSKYGVSGYPTIQWFP-KGSLEPKKYEGARTAEALTEFVNTEAGTNVK  492
             D+HK +  ++GV G+PT++WF  K   EP+ Y G R  E+LT+F+  + G  VK
Sbjct  83   ADKHKELGKRFGVQGFPTLKWFDGKPGSEPEDYNGGRDLESLTKFIIDKTGVKVK  137



>ref|XP_005833128.1| hypothetical protein GUITHDRAFT_157801 [Guillardia theta CCMP2712]
 gb|EKX46148.1| hypothetical protein GUITHDRAFT_157801 [Guillardia theta CCMP2712]
Length=173

 Score =   116 bits (291),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 55/113 (49%), Positives = 73/113 (65%), Gaps = 3/113 (3%)
 Frame = +1

Query  163  VVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDCDE  339
            VVL  +NFE EV    + + ++FYAPWCGHCK + P ++ LG  +  + SVLIG VDC +
Sbjct  3    VVLDSKNFENEVFNSGKGSFIKFYAPWCGHCKAMKPAWDDLGKHYLASSSVLIGDVDCTQ  62

Query  340  HKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFV--NTEAGTNVK  492
               +CSKYGVSGYPTI++FP G  E K Y G R+ + L +F   N E   +VK
Sbjct  63   ENELCSKYGVSGYPTIKYFPAGDKEGKPYNGGRSLDDLKKFTEDNLEVKCDVK  115



>gb|ESS69956.1| protein disulfide isomerase [Trypanosoma cruzi Dm28c]
Length=376

 Score =   120 bits (301),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 62/143 (43%), Positives = 88/143 (62%), Gaps = 9/143 (6%)
 Frame = +1

Query  94   RSRICTALAIVALFFSAAFADD-------VVVLTEENFEKEVGQDRAALVEFYAPWCGHC  252
            R+        VA   S A ADD       +V LT  NF++ VG+   ALVEFYAPWCG+C
Sbjct  8    RTSFLVLFLAVATLASVARADDPSVSLEGIVDLTASNFDEHVGKGVPALVEFYAPWCGYC  67

Query  253  KKLAPEYEQLGASFKKAKS-VLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYE  429
            KK+ PE+E++G + KKA+  VL+GKVD  +++ +  ++GV+GYPTI +FP  S   ++Y 
Sbjct  68   KKMVPEFEKVGQAVKKARDKVLVGKVDATQNRDLAERFGVNGYPTILFFPADSQTKQQYS  127

Query  430  GARTAEALTEFVNTEA-GTNVKV  495
             AR A A   F+N +  G N+ V
Sbjct  128  EAREATAFLSFLNRQVPGLNIGV  150


 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 73/112 (65%), Gaps = 4/112 (4%)
 Frame = +1

Query  163  VVLTEENFEKEVGQD-RAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDCDE  339
            V LT+ NF+  V  + + ALV FYAPWCGHCKKL P +E L  +FK+   ++IGK++ D+
Sbjct  158  VELTKRNFDAVVMDEAKDALVMFYAPWCGHCKKLHPVFELLATAFKEEADIVIGKLNADD  217

Query  340  --HKSVCSKYGVSGYPTIQWFPKGSL-EPKKYEGARTAEALTEFVNTEAGTN  486
              + +V ++Y V GYPT+ +F K S  EP+ Y G R+ E L ++VN   G N
Sbjct  218  ASNAAVRNRYKVDGYPTLAFFQKKSKSEPQYYNGGRSLEELVDYVNEHTGKN  269



>ref|XP_011112771.1| hypothetical protein H072_6996 [Dactylellina haptotyla CBS 200.50]
 gb|EPS39257.1| hypothetical protein H072_6996 [Dactylellina haptotyla CBS 200.50]
Length=372

 Score =   120 bits (301),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 85/122 (70%), Gaps = 5/122 (4%)
 Frame = +1

Query  115  LAIVALFFSAAFA---DDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLG  285
            L+  ++ F A+ A    DVV LT++NF+  + Q + ALV+FYA WCGHCKKLAP Y++LG
Sbjct  5    LSAASVLFCASLALAGADVVELTDKNFDSIINQGKPALVKFYADWCGHCKKLAPAYDELG  64

Query  286  ASFKKAKS-VLIGKVDCDEHKSVCSKYGVSGYPTIQWFP-KGSLEPKKYEGARTAEALTE  459
             +F   K  V+I K+D  ++K + S+YGV G+PT++WF    + EP+ Y+G RT EAL+E
Sbjct  65   TAFSSVKDKVIIAKIDGSKNKKINSQYGVKGFPTLKWFSGDKAKEPEDYKGGRTLEALSE  124

Query  460  FV  465
            FV
Sbjct  125  FV  126


 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 74/114 (65%), Gaps = 6/114 (5%)
 Frame = +1

Query  160  VVVLTEENFEKEVGQD--RAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDC  333
            V +LT+ NFE E+  D  +   V+FYAPWCGHCK LAP YE+L   F +  S++I +VDC
Sbjct  148  VKILTDSNFE-EIANDPKKGVFVKFYAPWCGHCKSLAPVYEKLAVDFSREPSIVIAEVDC  206

Query  334  DEH--KSVCSKYGVSGYPTIQWFPKG-SLEPKKYEGARTAEALTEFVNTEAGTN  486
            +    K+ C K+ +  +PT+++FP G S +  +++G R   ++  FVN +AGT+
Sbjct  207  NNQNTKASCDKHEIQSFPTLKYFPAGASAKVVEFQGEREESSMVAFVNVQAGTD  260



>gb|KIW64262.1| protein disulfide-isomerase domain [Capronia semiimmersa]
Length=370

 Score =   120 bits (301),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 77/110 (70%), Gaps = 2/110 (2%)
 Frame = +1

Query  160  VVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDCDE  339
            V +LT+ +F+ E+G D+  LV F APWCGHCK LAP +E++ A F    +VLI KVD + 
Sbjct  146  VEMLTDSSFKTEIGGDKDVLVAFTAPWCGHCKSLAPTWEKVAADFASEPNVLIAKVDAEA  205

Query  340  H--KSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGT  483
               K+     G++GYPTI++FPKGS E + Y GAR+ EAL EF+N++AGT
Sbjct  206  ENAKATAQDQGITGYPTIKFFPKGSKEAEPYSGARSEEALVEFINSKAGT  255


 Score =   113 bits (283),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 84/138 (61%), Gaps = 4/138 (3%)
 Frame = +1

Query  88   MSRSRICTALAIVALFFSAAFADDVVVLTEENFEKEVGQD-RAALVEFYAPWCGHCKKLA  264
            M + R     A +AL   A+ A DV+ L   NF+K V +  + ALVEF+APWCGHCK LA
Sbjct  1    MVQLRSFLPFATLALPLLAS-ASDVINLIPSNFDKIVFESGKPALVEFFAPWCGHCKNLA  59

Query  265  PEYEQLGASFKKA-KSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFP-KGSLEPKKYEGAR  438
            P YE+L  +F  +   V I  VD D+HK +  ++GV G+PT++WF  K   EP+ Y G R
Sbjct  60   PVYEELATAFAASGNKVTIANVDADKHKDLGKRFGVQGFPTLKWFDGKPGSEPEDYNGGR  119

Query  439  TAEALTEFVNTEAGTNVK  492
              E+LT FV+ ++G   K
Sbjct  120  DLESLTAFVSEKSGVKAK  137



>gb|KIW86012.1| protein disulfide-isomerase domain [Fonsecaea pedrosoi CBS 271.37]
Length=370

 Score =   120 bits (300),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 75/110 (68%), Gaps = 2/110 (2%)
 Frame = +1

Query  160  VVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVD--C  333
            V +LT+  F+ EVG D+  LV F APWCGHCK LAP +E+L   F    +VLI KVD   
Sbjct  146  VEMLTDTTFKSEVGGDKDILVAFTAPWCGHCKSLAPTWEKLATDFANEPNVLIAKVDAEA  205

Query  334  DEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGT  483
            +  K+     G++GYPTI++FPKGS E + Y GAR+ EAL +FVN++AGT
Sbjct  206  ENSKATAQSQGITGYPTIKFFPKGSTEAEPYSGARSEEALVDFVNSKAGT  255


 Score =   108 bits (270),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 54/115 (47%), Positives = 72/115 (63%), Gaps = 3/115 (3%)
 Frame = +1

Query  157  DVVVLTEENFEKEVGQD-RAALVEFYAPWCGHCKKLAPEYEQLGASF-KKAKSVLIGKVD  330
            DV+ L   NF+K V +  + ALVEF+APWCGHCK LAP YE+L  +F      V I  VD
Sbjct  23   DVINLIPSNFDKVVFESGKPALVEFFAPWCGHCKNLAPVYEELATAFAASGNKVTIANVD  82

Query  331  CDEHKSVCSKYGVSGYPTIQWFP-KGSLEPKKYEGARTAEALTEFVNTEAGTNVK  492
             D+HK +  ++GV G+PT++WF  K   EP+ Y G R  E+LT FV  ++G   K
Sbjct  83   ADKHKDLGKRFGVQGFPTLKWFDGKPGSEPEDYNGGRDLESLTAFVTEKSGVKGK  137



>dbj|BAJ33558.1| protein disulfide isomerase S-1 [Glycine max]
Length=280

 Score =   119 bits (297),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +1

Query  325  VDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTNVKVAAI  504
            VDCDEHKS+CSKYGVSGYPTIQWFPKGSLEPKKYEG RT ++L EFVNTE GTNVK+A  
Sbjct  1    VDCDEHKSLCSKYGVSGYPTIQWFPKGSLEPKKYEGPRTVDSLAEFVNTEGGTNVKIATA  60

Query  505  PS  510
            PS
Sbjct  61   PS  62


 Score =   114 bits (286),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 78/114 (68%), Gaps = 1/114 (1%)
 Frame = +1

Query  157  DVVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDC  333
            +VVVLT ENF + V  + +  LVEFYAPWCGHCK LAP YE++  +FK  + V+I  +D 
Sbjct  63   NVVVLTSENFNEVVLDETKDVLVEFYAPWCGHCKSLAPTYEKVVTAFKLEEDVVIANLDA  122

Query  334  DEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTNVKV  495
            D++K +  KY VSG+PT+++FPKG+   ++Y G R  +    F+N ++GT+  V
Sbjct  123  DKYKDLAEKYDVSGFPTLKFFPKGNKAGEEYGGGRDLDDFVAFINEKSGTSRDV  176



>ref|XP_003302794.1| hypothetical protein PTT_14744 [Pyrenophora teres f. teres 0-1]
 gb|EFQ89109.1| hypothetical protein PTT_14744 [Pyrenophora teres f. teres 0-1]
Length=363

 Score =   120 bits (300),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 59/116 (51%), Positives = 78/116 (67%), Gaps = 2/116 (2%)
 Frame = +1

Query  160  VVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDCDE  339
            VV L ++ F+++VG+D+  LV F APWCGHCK LAP +E L   F    SVLI KVD + 
Sbjct  144  VVYLDDKTFKEKVGKDQNVLVAFTAPWCGHCKTLAPIWETLATDFVNEPSVLIAKVDAEA  203

Query  340  H--KSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTNVKVAA  501
               K++ ++ GVS YPTI++FPKGS EP  YEGAR  +A  +F+NT AGT+  V  
Sbjct  204  ENAKALATEQGVSSYPTIKYFPKGSTEPLPYEGARDEKAFIDFLNTNAGTHRAVGG  259


 Score =   107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 75/120 (63%), Gaps = 3/120 (3%)
 Frame = +1

Query  160  VVVLTEENFEKEVGQD-RAALVEFYAPWCGHCKKLAPEYEQLGASFKKA-KSVLIGKVDC  333
            V+ L   NF+  V +  + ALVEF+APWCGHCK LAP +E+L   F+ A   V + KVD 
Sbjct  23   VIDLEPSNFDSVVLKSGKPALVEFFAPWCGHCKNLAPVWEELATVFQHAGDKVTVAKVDA  82

Query  334  DEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTNVKV-AAIPS  510
            D HKS+  +YGVSG+PT++WF   S +P  Y G R  E+L++F+  +     KV   +PS
Sbjct  83   DNHKSLGKRYGVSGFPTLKWFDGKSDKPTDYTGGRDLESLSKFIQEKTSIKPKVKGKLPS  142



>ref|XP_001734779.1| protein disulfide isomerase [Entamoeba dispar SAW760]
 gb|EDR29051.1| protein disulfide isomerase, putative [Entamoeba dispar SAW760]
Length=337

 Score =   119 bits (299),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 51/117 (44%), Positives = 78/117 (67%), Gaps = 2/117 (2%)
 Frame = +1

Query  121  IVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKK  300
            I+    +   + DVV L   NF   V   +   V+F+APWCGHCKKLAPEY +L  ++K 
Sbjct  4    ILFTLLTFLVSADVVSLNPANFNTIVDGSKHVFVKFFAPWCGHCKKLAPEYIKLADAYKN  63

Query  301  AKSVLIGKVDCD--EHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFV  465
             + ++I ++DCD  +HK +C K+G++G+PT+++F KG+ EP +YEG RT E L+ F+
Sbjct  64   KQDIVIAELDCDNKDHKDLCGKFGINGFPTLKFFRKGTTEPIEYEGGRTVEDLSHFI  120


 Score = 92.4 bits (228),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 66/110 (60%), Gaps = 2/110 (2%)
 Frame = +1

Query  157  DVVVLTEENFEKEVGQ-DRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDC  333
            +VV +T   F+  V    +   V+F+APWCGHCK LAP+Y ++   +     ++I +VDC
Sbjct  131  NVVSVTSATFDSIVMDPTKNVFVKFFAPWCGHCKALAPKYIEVSKMYAGEDDLVIAEVDC  190

Query  334  DEHKSVCSKYGVSGYPTIQWFPKG-SLEPKKYEGARTAEALTEFVNTEAG  480
             E++  C+KY V GYPT++ FPKG + +P  YEG R  +    + NT  G
Sbjct  191  TENQETCNKYEVHGYPTLKSFPKGENKKPIAYEGGREVKDFVTYFNTNYG  240



>ref|XP_007922552.1| hypothetical protein MYCFIDRAFT_52408 [Pseudocercospora fijiensis 
CIRAD86]
 gb|EME85983.1| hypothetical protein MYCFIDRAFT_52408 [Pseudocercospora fijiensis 
CIRAD86]
Length=367

 Score =   120 bits (300),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 64/140 (46%), Positives = 86/140 (61%), Gaps = 3/140 (2%)
 Frame = +1

Query  100  RICTALAIVALFFSAAFADDVVVLTEENFEKEVGQD-RAALVEFYAPWCGHCKKLAPEYE  276
            R+   L      FS   A  V+ LT +NF+KE+ +  + ALVEF+APWCGHCK LAP YE
Sbjct  3    RLNQLLTAGLAAFSTVSAGSVLDLTPKNFDKEILKSGKPALVEFFAPWCGHCKNLAPIYE  62

Query  277  QLGASFKKAKS-VLIGKVDCDEHKSVCSKYGVSGYPTIQWFP-KGSLEPKKYEGARTAEA  450
            +L ASF+ AK  V I KVD DEHK +  KY +SG+PT++WF   G  EP++Y   R  E+
Sbjct  63   ELAASFEFAKDKVTIAKVDADEHKELGKKYEISGFPTLKWFDGTGKSEPEEYSSGRDLES  122

Query  451  LTEFVNTEAGTNVKVAAIPS  510
            LT F+  + G   +    P+
Sbjct  123  LTAFITEKTGVKSRKPKSPA  142


 Score =   113 bits (282),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 59/130 (45%), Positives = 79/130 (61%), Gaps = 10/130 (8%)
 Frame = +1

Query  151  ADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVD  330
            A  V +LT+  F+++VG+D+ A+V F APWCGHCK LAP +E++   F    SVLI KVD
Sbjct  142  ASQVEMLTDTTFDEKVGKDQDAIVAFTAPWCGHCKSLAPVWEKVAHDFAAEPSVLIAKVD  201

Query  331  CD--EHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGT-------  483
             +    K+   ++GV  YPTI +FPKGS E   Y G R+ EAL +F+N +AGT       
Sbjct  202  AEAPNAKATAQRFGVKSYPTIFYFPKGSQEQVAYSGGRSEEALVDFMNEKAGTFRAPGGT  261

Query  484  -NVKVAAIPS  510
             N     IPS
Sbjct  262  LNTLAGIIPS  271



>ref|XP_007262963.1| thioredoxin-domain-containing protein [Fomitiporia mediterranea 
MF3/22]
 gb|EJD06699.1| thioredoxin-domain-containing protein [Fomitiporia mediterranea 
MF3/22]
Length=163

 Score =   115 bits (288),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 59/129 (46%), Positives = 81/129 (63%), Gaps = 2/129 (2%)
 Frame = +1

Query  127  ALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAK  306
            ALF +   A +V+ L  +NF+  +G+ + ALVEF+ PWCGHCKKLAP YE+L  ++  AK
Sbjct  11   ALFAAVVAASNVIELNPDNFDDFIGKGKPALVEFFTPWCGHCKKLAPVYEELANAYAHAK  70

Query  307  S-VLIGKVDCDE-HKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAG  480
              V+I KV+ D   K +  +YGV+GYPT++WF     E + YEGAR  EAL  FV   +G
Sbjct  71   DKVVIAKVEADGVGKPLGKQYGVTGYPTLKWFNVDGGESEIYEGARNLEALATFVTQRSG  130

Query  481  TNVKVAAIP  507
               K+   P
Sbjct  131  VKSKIKDPP  139



>ref|XP_001936301.1| protein disulfide-isomerase A4 precursor [Pyrenophora tritici-repentis 
Pt-1C-BFP]
 gb|EDU48888.1| protein disulfide-isomerase A4 precursor [Pyrenophora tritici-repentis 
Pt-1C-BFP]
Length=363

 Score =   119 bits (299),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 59/116 (51%), Positives = 78/116 (67%), Gaps = 2/116 (2%)
 Frame = +1

Query  160  VVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDCDE  339
            VV L ++ F+++VG+D+  LV F APWCGHCK LAP +E L   F    SVLI KVD + 
Sbjct  144  VVYLDDKTFKEKVGKDQNVLVAFTAPWCGHCKTLAPVWETLANDFVNEPSVLIAKVDAEA  203

Query  340  H--KSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTNVKVAA  501
               K++ ++ GVS YPTI++FPKGS EP  YEGAR  +A  +F+NT AGT+  V  
Sbjct  204  ENAKALATEQGVSSYPTIKYFPKGSTEPLPYEGARDEKAFIDFLNTNAGTHRAVGG  259


 Score =   107 bits (268),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 76/120 (63%), Gaps = 3/120 (3%)
 Frame = +1

Query  160  VVVLTEENFEKEVGQD-RAALVEFYAPWCGHCKKLAPEYEQLGASFKKA-KSVLIGKVDC  333
            V+ L   NF+K V +  + ALVEF+APWCGHCK LAP +E+L   F+ A   V + KVD 
Sbjct  23   VIDLEPSNFDKVVLKSGKPALVEFFAPWCGHCKNLAPVWEELATVFQHAGDKVTVAKVDA  82

Query  334  DEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTNVKV-AAIPS  510
            D HKS+  ++GVSG+PT++WF   S +P  Y G R  E+L++F+  +     KV   +PS
Sbjct  83   DNHKSLGKRFGVSGFPTLKWFDGKSDKPTDYTGGRDLESLSKFIQEKTSIKPKVKGKLPS  142



>ref|XP_002174561.1| protein disulfide isomerase [Schizosaccharomyces japonicus yFS275]
 gb|EEB08268.1| protein disulfide isomerase [Schizosaccharomyces japonicus yFS275]
Length=366

 Score =   119 bits (299),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 59/141 (42%), Positives = 84/141 (60%), Gaps = 4/141 (3%)
 Frame = +1

Query  100  RICTALAIVALFFSAAFADDVVVL-TEENFEKEVGQ-DRAALVEFYAPWCGHCKKLAPEY  273
            R+ + L  +A  F+ A A  VV   + +  EK V    +  LV+FYA WCGHCK LAP Y
Sbjct  2    RLLSLLCCLATLFTYALAGHVVEFESLDELEKTVANAKKGTLVKFYASWCGHCKNLAPIY  61

Query  274  EQLGASFKKAKSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEAL  453
            E+LG  F   + ++I +VD D H  V SK+ + GYPT++WFP G+ EP++Y   R  E+L
Sbjct  62   EELGDHFADDEDIIIARVDADRHSKVGSKFDIRGYPTLKWFPSGAEEPEQYTSGRDLESL  121

Query  454  TEFVNTEAGTN--VKVAAIPS  510
             +FV+ + G    V+V   PS
Sbjct  122  VDFVSAKTGVKKPVQVVETPS  142


 Score = 92.0 bits (227),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 44/111 (40%), Positives = 66/111 (59%), Gaps = 2/111 (2%)
 Frame = +1

Query  160  VVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDCD  336
            VV L    F+  V  +++  LVEFYA WC +CK+L P YEQ+  +      V++ K++ D
Sbjct  144  VVELDSTTFDSVVLDEEKDVLVEFYADWCSYCKRLRPIYEQVAVALANEPGVVVAKINAD  203

Query  337  EHKSVCSKYGVSGYPTIQWFPKGS-LEPKKYEGARTAEALTEFVNTEAGTN  486
             H+ +    G+SG+PTI+ F +G+  EP  +EG+RT E +  FVN E  T 
Sbjct  204  IHRDIGMLQGISGFPTIKLFKRGAKREPLSFEGSRTTEGIVNFVNEECDTR  254



>emb|CCE28619.1| probable protein disulfide-isomerase precursor [Claviceps purpurea 
20.1]
Length=372

 Score =   119 bits (298),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 75/112 (67%), Gaps = 2/112 (2%)
 Frame = +1

Query  157  DVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDCD  336
            ++V+LT+E F + +G D+  LV F APWCGHCK LAP +E +   F   K+V+I KVD +
Sbjct  142  EIVMLTDETFAETIGSDKNVLVAFTAPWCGHCKTLAPVFESVALDFSGDKNVVIAKVDAE  201

Query  337  --EHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
                K+V  + GVS YPTI+WFP GS E + Y G RT E+  EFVN +AGT+
Sbjct  202  AANSKAVAKENGVSSYPTIKWFPAGSKEGEAYSGERTEESFLEFVNKKAGTH  253


 Score =   100 bits (249),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 75/113 (66%), Gaps = 2/113 (2%)
 Frame = +1

Query  160  VVVLTEENFEKEVGQD-RAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKS-VLIGKVDC  333
            V+ LT  NF++ V +  +  LVEF+APWCGHCK LAP YE+L ++F+ AKS V I KVD 
Sbjct  22   VIDLTPANFDQVVLKSGKPTLVEFFAPWCGHCKTLAPVYEELASAFEHAKSKVQIAKVDA  81

Query  334  DEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTNVK  492
            D  +++  ++GV G+PT+++F   + +P+ Y+  R  E+L+ F+  + G   K
Sbjct  82   DAERALGKRFGVQGFPTLKYFDGKTDKPEDYKSGRDLESLSAFIAKKTGVKPK  134



>dbj|GAN11239.1| protein disulfide isomerase-like 2-1-like [Mucor ambiguus]
Length=447

 Score =   120 bits (300),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 76/116 (66%), Gaps = 1/116 (1%)
 Frame = +1

Query  157  DVVVLTEENF-EKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDC  333
            DVV LT +NF E  +   +  LVEFYA WCGHCK LAP +E++G++F   ++ +I K+D 
Sbjct  226  DVVTLTTKNFHEVALNPKKNVLVEFYASWCGHCKNLAPIWEKIGSTFANEENCVIAKIDA  285

Query  334  DEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTNVKVAA  501
            DE + + S++ +SG+PTI++FP G  EP  YEG RT  A  EF+N   GT  KV  
Sbjct  286  DEERDIGSEFDISGFPTIKFFPAGESEPVAYEGGRTEAAFVEFLNKHCGTQRKVGG  341


 Score =   119 bits (298),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 53/117 (45%), Positives = 77/117 (66%), Gaps = 4/117 (3%)
 Frame = +1

Query  157  DVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKS-VLIGKVDC  333
            +VVVLT+ NF+  +   + ALVEFYAPWCGHCK LAP Y QLG +F  +K  VL+ K+D 
Sbjct  104  NVVVLTDANFKNVIDGSKPALVEFYAPWCGHCKNLAPVYAQLGDAFSSSKDKVLVAKIDA  163

Query  334  DEHKSVCSKYGVSGYPTIQWFPKGSLEP---KKYEGARTAEALTEFVNTEAGTNVKV  495
            D+H+   + +GV G+PT++WFPKG   P   + Y+G R   +L  F+  ++G   ++
Sbjct  164  DQHRDTGALFGVQGFPTLKWFPKGVHSPEGVEDYKGGRDLNSLAAFIKEKSGVAPRI  220



>emb|CCX16619.1| Similar to Protein disulfide-isomerase erp38; acc. no. Q92249 
[Pyronema omphalodes CBS 100304]
Length=367

 Score =   119 bits (298),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/115 (49%), Positives = 76/115 (66%), Gaps = 2/115 (2%)
 Frame = +1

Query  157  DVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDCD  336
            DVVVLT+ NF+  V  ++  LVEFYAPWCGHCK LAP YE +   F    +++I KVD +
Sbjct  142  DVVVLTDSNFDTIVNGEKNVLVEFYAPWCGHCKSLAPIYETVATEFAVEDTLIIAKVDAN  201

Query  337  --EHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTNVKV  495
                K+   KYG++G+PT+++FP GS EP  Y+  RTA  L  F+N +AGT+  V
Sbjct  202  APTGKATAEKYGITGFPTLKFFPAGSTEPIDYDSGRTATDLFAFLNEKAGTHRAV  256


 Score =   111 bits (278),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 53/124 (43%), Positives = 80/124 (65%), Gaps = 2/124 (2%)
 Frame = +1

Query  133  FFSAAFADDVVVLTEENFEKEVGQD-RAALVEFYAPWCGHCKKLAPEYEQLGASF-KKAK  306
            F +   A +VV LT +NF++ + +    +LVEFYAPWCGHCKKLAP +E+L  SF  K  
Sbjct  13   FVATVIASNVVDLTPKNFDEIILKSGNPSLVEFYAPWCGHCKKLAPTWEELADSFADKKD  72

Query  307  SVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTN  486
             + I KV+ D+H ++  +YG+SG+PT+++F   + +P  Y+G R  E+ TEF+   +G  
Sbjct  73   KITIAKVNGDDHSALTKRYGISGFPTLKYFDGKTDKPIAYDGGRDLESFTEFIGKHSGVK  132

Query  487  VKVA  498
             K A
Sbjct  133  SKGA  136



>ref|XP_007760811.1| protein disulfide-isomerase tigA [Cladophialophora yegresii CBS 
114405]
 gb|EXJ55701.1| protein disulfide-isomerase tigA [Cladophialophora yegresii CBS 
114405]
Length=370

 Score =   119 bits (298),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 75/110 (68%), Gaps = 2/110 (2%)
 Frame = +1

Query  160  VVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDCDE  339
            V +LT+  F+ EVG D+  LV F APWCGHCK LAP +E++ A F     VLI KVD + 
Sbjct  146  VEMLTDSTFQTEVGGDKDVLVAFTAPWCGHCKSLAPTWEKVAADFASEPGVLIAKVDAEA  205

Query  340  H--KSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGT  483
               K+     G++GYPTI++FPKGS E + Y GAR+ EA+ +FVN++AGT
Sbjct  206  ENAKATAQDQGITGYPTIKFFPKGSKEAESYSGARSEEAIVDFVNSKAGT  255


 Score =   110 bits (276),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 82/138 (59%), Gaps = 4/138 (3%)
 Frame = +1

Query  88   MSRSRICTALAIVALFFSAAFADDVVVLTEENFEKEVGQD-RAALVEFYAPWCGHCKKLA  264
            M + R       +AL   A+ A DVV L   NF+  V +  + ALVEF+APWCGHCK LA
Sbjct  1    MVQLRSFLPFVTLALPLLAS-ASDVVNLIPSNFDTVVFESGKPALVEFFAPWCGHCKNLA  59

Query  265  PEYEQLGASFKKA-KSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFP-KGSLEPKKYEGAR  438
            P YE+L  +F  +   V I  VD D+HK +  ++GV G+PT++WF  K   EP+ Y G R
Sbjct  60   PVYEELATAFATSGNKVTIANVDADKHKDLGKRFGVQGFPTLKWFDGKPGSEPQDYNGGR  119

Query  439  TAEALTEFVNTEAGTNVK  492
              E+LT FV+ ++G   K
Sbjct  120  DLESLTAFVSEKSGVKAK  137



>ref|XP_002126714.1| PREDICTED: protein disulfide-isomerase A3 [Ciona intestinalis]
Length=476

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/131 (44%), Positives = 83/131 (63%), Gaps = 10/131 (8%)
 Frame = +1

Query  88   MSRSRICTALAIVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAP  267
            ++ S +C A+         + ADDV+VLT+ NF+ E+ +    L+EFYAPWCGHCKKLAP
Sbjct  6    IALSALCVAIV--------SAADDVLVLTDSNFDAEIVKHSIILMEFYAPWCGHCKKLAP  57

Query  268  EYEQLGASFKKAK-SVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTA  444
            EY+      K+    + IGKVDC E+ + CSK+GVSGYPT++ F  G L  K Y+G R A
Sbjct  58   EYDIAATKLKRNDPPIRIGKVDCTENTATCSKFGVSGYPTLKLFADGKLS-KDYDGPRQA  116

Query  445  EALTEFVNTEA  477
            + + +++   A
Sbjct  117  DGIVKYMQKAA  127


 Score = 85.5 bits (210),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 42/108 (39%), Positives = 67/108 (62%), Gaps = 3/108 (3%)
 Frame = +1

Query  160  VVVLTEENFEKEV-GQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDCD  336
            V V+T + F++ V  + +  L+EFYAPWCGHCK L P++ +LG   K    ++I K+D  
Sbjct  363  VTVVTGKTFDEIVMDESKDVLIEFYAPWCGHCKSLEPKWNELGEKMKDNNDIVIAKIDAT  422

Query  337  EHKSVCSKYGVSGYPTIQWFPKGSLE-PKKYEGARTAEALTEFVNTEA  477
             + S  S++ VSG+PTI + PKG+ + P KY+G R     ++++   A
Sbjct  423  ANDS-PSQFQVSGFPTIYFAPKGNKQNPVKYQGGREVADFSKYLKENA  469



>gb|KIR33635.1| protein disulfide-isomerase domain [Cryptococcus gattii MMRL2647]
Length=408

 Score =   119 bits (298),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 65/142 (46%), Positives = 88/142 (62%), Gaps = 8/142 (6%)
 Frame = +1

Query  94   RSRICTALAIVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEY  273
            R  I  + A++A F S   A +VV L   NF++ +GQD+ ALVE    WCGHCK LAP Y
Sbjct  2    RLSISISAALLA-FTSLVSASNVVDLDTTNFDQIIGQDKGALVEL---WCGHCKNLAPTY  57

Query  274  EQLGASFKKAKSVLIGKVDCDE-HKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEA  450
            E+L  +F   K V+I K D D   + + S++GVSG+PT++WFP GSLEP  Y GAR  E 
Sbjct  58   ERLADAFPSNK-VIIAKTDADGVGRELGSRFGVSGFPTLKWFPAGSLEPIPYSGARDLET  116

Query  451  LTEFVNTEAG--TNVKVAAIPS  510
            L  FV  ++G  +N+K    P+
Sbjct  117  LAAFVTKQSGVKSNIKPPPPPA  138


 Score =   103 bits (256),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 73/117 (62%), Gaps = 3/117 (3%)
 Frame = +1

Query  169  LTEENFEK-EVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDCD--E  339
            L   NF++  + + +  LV F APWCGHCK + P YE++   F     V+I  +D D  E
Sbjct  142  LDVSNFDEIALNESKDVLVAFTAPWCGHCKNMKPAYEKVAKVFSSEPDVVIALMDADDAE  201

Query  340  HKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTNVKVAAIPS  510
            +K V  +YGVS +PTI++FPKGS +P  Y+  RTAE   +++N ++GT+  V+ + S
Sbjct  202  NKPVAQRYGVSSFPTIKFFPKGSKDPVPYDSGRTAEQFVDWINDKSGTHRSVSGLLS  258



>gb|KGB74644.1| disulfide-isomerase [Cryptococcus gattii R265]
 gb|KIR27195.1| protein disulfide-isomerase domain [Cryptococcus gattii LA55]
 gb|KIR40813.1| protein disulfide-isomerase domain [Cryptococcus gattii Ram5]
 gb|KIR74494.1| protein disulfide-isomerase domain [Cryptococcus gattii CA1014]
 gb|KIR94017.1| protein disulfide-isomerase domain [Cryptococcus gattii CBS 10090]
 gb|KIS01024.1| protein disulfide-isomerase domain [Cryptococcus gattii 2001/935-1]
 gb|KIY58449.1| protein disulfide-isomerase domain [Cryptococcus gattii 99/473]
Length=408

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 65/142 (46%), Positives = 88/142 (62%), Gaps = 8/142 (6%)
 Frame = +1

Query  94   RSRICTALAIVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEY  273
            R  I  + A++A F S   A +VV L   NF++ +GQD+ ALVE    WCGHCK LAP Y
Sbjct  2    RLSISISAALLA-FTSLVSASNVVDLDTTNFDQIIGQDKGALVEL---WCGHCKNLAPTY  57

Query  274  EQLGASFKKAKSVLIGKVDCDE-HKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEA  450
            E+L  +F   K V+I K D D   + + S++GVSG+PT++WFP GSLEP  Y GAR  E 
Sbjct  58   ERLADAFPSNK-VIIAKTDADGVGRELGSRFGVSGFPTLKWFPAGSLEPIPYSGARDLET  116

Query  451  LTEFVNTEAG--TNVKVAAIPS  510
            L  FV  ++G  +N+K    P+
Sbjct  117  LAAFVTKQSGVKSNIKPPPPPA  138


 Score =   103 bits (256),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 73/117 (62%), Gaps = 3/117 (3%)
 Frame = +1

Query  169  LTEENFEK-EVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDCD--E  339
            L   NF++  + + +  LV F APWCGHCK + P YE++   F     V+I  +D D  E
Sbjct  142  LDVSNFDEIALNESKDVLVAFTAPWCGHCKNMKPAYEKVAKVFSSEPDVVIALMDADDAE  201

Query  340  HKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTNVKVAAIPS  510
            +K V  +YGVS +PTI++FPKGS +P  Y+  RTAE   +++N ++GT+  V+ + S
Sbjct  202  NKPVAQRYGVSSFPTIKFFPKGSKDPVPYDSGRTAEQFVDWINDKSGTHRSVSGLLS  258



>ref|XP_003191872.1| disulfide-isomerase precursor [Cryptococcus gattii WM276]
 gb|ADV20085.1| Disulfide-isomerase precursor, putative [Cryptococcus gattii 
WM276]
 gb|KIR77416.1| protein disulfide-isomerase domain [Cryptococcus gattii EJB2]
 gb|KIY36418.1| protein disulfide-isomerase domain [Cryptococcus gattii E566]
 gb|KJE05931.1| protein disulfide-isomerase domain [Cryptococcus gattii NT-10]
Length=408

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 65/142 (46%), Positives = 88/142 (62%), Gaps = 8/142 (6%)
 Frame = +1

Query  94   RSRICTALAIVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEY  273
            R  I  + A++A F S   A +VV L   NF++ +GQD+ ALVE    WCGHCK LAP Y
Sbjct  2    RLSISISAALLA-FTSLVSASNVVDLDTTNFDQIIGQDKGALVEL---WCGHCKNLAPTY  57

Query  274  EQLGASFKKAKSVLIGKVDCDE-HKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEA  450
            E+L  +F   K V+I K D D   + + S++GVSG+PT++WFP GSLEP  Y GAR  E 
Sbjct  58   ERLADAFPSNK-VIIAKTDADGVGRELGSRFGVSGFPTLKWFPAGSLEPIPYSGARDLET  116

Query  451  LTEFVNTEAG--TNVKVAAIPS  510
            L  FV  ++G  +N+K    P+
Sbjct  117  LAAFVTKQSGVKSNIKPPPPPA  138


 Score =   103 bits (258),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 73/117 (62%), Gaps = 3/117 (3%)
 Frame = +1

Query  169  LTEENFEK-EVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDCDE--  339
            L   NF++  + + +  LV F APWCGHCK + P YE++   F     V+I  +D DE  
Sbjct  142  LDASNFDEIALNESKDVLVAFTAPWCGHCKNMKPAYEKVAKVFSSEPDVVIALMDADEAE  201

Query  340  HKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTNVKVAAIPS  510
            +K V  +YGVS +PTI++FPKGS +P  Y+  RTAE   +++N ++GT+  V+ + S
Sbjct  202  NKPVAQRYGVSSFPTIKFFPKGSKDPVAYDSGRTAEQFVDWINDKSGTHRSVSGLLS  258



>gb|KIR55900.1| protein disulfide-isomerase domain [Cryptococcus gattii Ru294]
Length=408

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 65/142 (46%), Positives = 88/142 (62%), Gaps = 8/142 (6%)
 Frame = +1

Query  94   RSRICTALAIVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEY  273
            R  I  + A++A F S   A +VV L   NF++ +GQD+ ALVE    WCGHCK LAP Y
Sbjct  2    RLSISISAALLA-FTSLVSASNVVDLDTTNFDQIIGQDKGALVEL---WCGHCKNLAPTY  57

Query  274  EQLGASFKKAKSVLIGKVDCDE-HKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEA  450
            E+L  +F   K V+I K D D   + + S++GVSG+PT++WFP GSLEP  Y GAR  E 
Sbjct  58   ERLADAFPSNK-VIIAKTDADGVGRELGSRFGVSGFPTLKWFPAGSLEPIPYSGARDLET  116

Query  451  LTEFVNTEAG--TNVKVAAIPS  510
            L  FV  ++G  +N+K    P+
Sbjct  117  LAAFVTKQSGVKSNIKPPPPPA  138


 Score =   103 bits (256),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 73/117 (62%), Gaps = 3/117 (3%)
 Frame = +1

Query  169  LTEENFEK-EVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDCDE--  339
            L   NF++  + + +  LV F APWCGHCK + P YE++   F     V+I  +D DE  
Sbjct  142  LDASNFDEIALNESKDVLVAFTAPWCGHCKNMKPAYEKVAKVFSSEPDVVIALMDADEAE  201

Query  340  HKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTNVKVAAIPS  510
            +K +  +YGVS +PTI++FPKGS +P  Y+  RTAE   +++N ++GT+  V+ + S
Sbjct  202  NKPIAQRYGVSSFPTIKFFPKGSKDPVAYDSGRTAEQFVDWINDKSGTHRSVSGLLS  258



>emb|CEP19187.1| hypothetical protein [Parasitella parasitica]
Length=444

 Score =   119 bits (298),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 53/117 (45%), Positives = 77/117 (66%), Gaps = 4/117 (3%)
 Frame = +1

Query  157  DVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKS-VLIGKVDC  333
            +VVVLT+ NF+  +   + ALVEFYAPWCGHCK LAP Y QLG +F  +K  VL+ K+D 
Sbjct  101  NVVVLTDNNFKSVIDGSKPALVEFYAPWCGHCKNLAPVYAQLGDAFSSSKDKVLVAKLDA  160

Query  334  DEHKSVCSKYGVSGYPTIQWFPKGSLEP---KKYEGARTAEALTEFVNTEAGTNVKV  495
            D+H+   + +GV G+PT++WFPKG   P   + Y+G R   +L  F+  ++G   ++
Sbjct  161  DQHRDTGALFGVQGFPTLKWFPKGVHSPEGVEDYKGGRDLNSLAAFIKEKSGVAPRI  217


 Score =   117 bits (294),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 52/116 (45%), Positives = 77/116 (66%), Gaps = 1/116 (1%)
 Frame = +1

Query  157  DVVVLTEENF-EKEVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDC  333
            DVV LT +NF E  +  ++  LVEFYA WCGHCK LAP +E++G++F   ++ ++ K+D 
Sbjct  223  DVVSLTAKNFHEVALNPNKNVLVEFYASWCGHCKNLAPVWEKIGSTFANEENCIVAKIDA  282

Query  334  DEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTNVKVAA  501
            D+ + + +++ +SG+PTI++FP G  EP  YEG RT  A  EF+N   GT  KV  
Sbjct  283  DQEREIGTEFDISGFPTIKFFPAGESEPIAYEGGRTEAAFVEFLNKHCGTQRKVGG  338



>gb|KIR87562.1| protein disulfide-isomerase domain [Cryptococcus gattii IND107]
Length=408

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 64/142 (45%), Positives = 88/142 (62%), Gaps = 8/142 (6%)
 Frame = +1

Query  94   RSRICTALAIVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPEY  273
            R  I  + A++A F S   A +VV L   NF++ +GQD+ ALVE    WCGHCK LAP Y
Sbjct  2    RLSISISAALLA-FTSLVSASNVVDLDTTNFDQIIGQDKGALVEL---WCGHCKNLAPTY  57

Query  274  EQLGASFKKAKSVLIGKVDCDE-HKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEA  450
            E+L  +F   K ++I K D D   + + S++GVSG+PT++WFP GSLEP  Y GAR  E 
Sbjct  58   ERLADAFPSNK-IIIAKTDADGVGRELGSRFGVSGFPTLKWFPAGSLEPIPYSGARDLET  116

Query  451  LTEFVNTEAG--TNVKVAAIPS  510
            L  FV  ++G  +N+K    P+
Sbjct  117  LAAFVTKQSGVKSNIKPPPPPA  138


 Score =   103 bits (256),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 73/117 (62%), Gaps = 3/117 (3%)
 Frame = +1

Query  169  LTEENFEK-EVGQDRAALVEFYAPWCGHCKKLAPEYEQLGASFKKAKSVLIGKVDCD--E  339
            L   NF++  + + +  LV F APWCGHCK + P YE++   F     V+I  +D D  E
Sbjct  142  LDVSNFDEIALNESKDVLVAFTAPWCGHCKNMKPAYEKVAKVFSSEPDVVIALMDADDAE  201

Query  340  HKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNTEAGTNVKVAAIPS  510
            +K V  +YGVS +PTI++FPKGS +P  Y+  RTAE   +++N ++GT+  V+ + S
Sbjct  202  NKPVAQRYGVSSFPTIKFFPKGSKDPVAYDSGRTAEQFVDWINDKSGTHRSVSGLLS  258



>ref|XP_007699519.1| hypothetical protein COCSADRAFT_159986 [Bipolaris sorokiniana 
ND90Pr]
 gb|EMD64994.1| hypothetical protein COCSADRAFT_159986 [Bipolaris sorokiniana 
ND90Pr]
Length=361

 Score =   118 bits (295),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 60/134 (45%), Positives = 85/134 (63%), Gaps = 3/134 (2%)
 Frame = +1

Query  118  AIVALFFSAAFADDVVVLTEENFEKEVGQD-RAALVEFYAPWCGHCKKLAPEYEQLGASF  294
            A++AL  + A AD V+ L   NF+  V +  + ALVEF+APWCGHCK LAP YE+L   F
Sbjct  9    AVIALLPAIASADAVIDLNPSNFDDVVLKSGKPALVEFFAPWCGHCKNLAPVYEELATVF  68

Query  295  KKA-KSVLIGKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTAEALTEFVNT  471
            + A   V + KVD D HKS+  +YGVSG+PT++WF   + +P  Y+G R  E+L++F+  
Sbjct  69   QHAGDKVSVAKVDADNHKSLGKRYGVSGFPTLKWFDGKTDKPVDYKGGRDLESLSKFITE  128

Query  472  EAGTNVKV-AAIPS  510
                  K+ A +PS
Sbjct  129  NTSVKPKIKAKLPS  142


 Score =   109 bits (273),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 59/137 (43%), Positives = 79/137 (58%), Gaps = 2/137 (1%)
 Frame = +1

Query  91   SRSRICTALAIVALFFSAAFADDVVVLTEENFEKEVGQDRAALVEFYAPWCGHCKKLAPE  270
            S S+  T    V     A     VV L +++F+++VG+D+  LV F APWCGHCK LAP 
Sbjct  121  SLSKFITENTSVKPKIKAKLPSQVVYLDDKSFKEKVGKDQNVLVAFTAPWCGHCKTLAPV  180

Query  271  YEQLGASFKKAKSVLIGKVD--CDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARTA  444
            +E L   F     VLI KVD   +  K++  + GVSGYPTI++F KGS E   Y GAR  
Sbjct  181  WETLANDFVNEPDVLIAKVDAEAENSKALAQEQGVSGYPTIKYFAKGSTEALPYNGARAE  240

Query  445  EALTEFVNTEAGTNVKV  495
            +   +F+N  AGT+  V
Sbjct  241  KDFIDFLNANAGTHRAV  257



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 557408213115