BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002B09

Length=497
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ABL67954.2|  1-aminocyclopropane-1-carboxylate oxidase               250   2e-79   Ipomoea nil [qian niu]
dbj|BAF33502.1|  ACC oxidase                                            211   5e-64   Phelipanche ramosa
gb|AAD28196.2|AF115261_1  1-aminocyclopropane-1-carboxylate oxidase     209   1e-63   Trifolium repens [creeping white clover]
gb|ABO32691.1|  ACC oxidase ACO3                                        208   3e-63   Nicotiana attenuata
ref|XP_009802116.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    208   5e-63   Nicotiana sylvestris
ref|NP_001275208.1|  1-aminocyclopropane-1-carboxylate oxidase          207   7e-63   Solanum tuberosum [potatoes]
ref|XP_004486198.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    207   9e-63   Cicer arietinum [garbanzo]
gb|AGN74918.1|  1-aminocyclopropane-1-carboxylate oxidase               207   1e-62   Morus alba
ref|XP_002273430.3|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    207   2e-62   Vitis vinifera
dbj|BAC66950.1|  ACC oxidase                                            206   2e-62   Striga hermonthica [purple witchweed]
ref|NP_001234638.1|  1-aminocyclopropane-1-carboxylate oxidase          206   3e-62   Solanum lycopersicum
ref|XP_011096014.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    205   7e-62   Sesamum indicum [beniseed]
ref|XP_008224728.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    205   7e-62   Prunus mume [ume]
sp|P31239.1|ACCO_PEA  RecName: Full=1-aminocyclopropane-1-carboxy...    205   9e-62   Pisum sativum [garden pea]
gb|ABF61805.1|  1-aminocyclopropane-1-carboxylate oxidase               204   9e-62   Medicago sativa [alfalfa]
gb|KJB57824.1|  hypothetical protein B456_009G182300                    202   1e-61   Gossypium raimondii
emb|CAI64500.1|  1-aminocyclopropane-1-carboxylate oxidase 2            204   1e-61   Prunus domestica subsp. syriaca [Mirabelle plum]
gb|ACU23036.1|  unknown                                                 200   2e-61   Glycine max [soybeans]
ref|XP_011086213.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    204   2e-61   Sesamum indicum [beniseed]
ref|XP_010110622.1|  1-aminocyclopropane-1-carboxylate oxidase 3        204   2e-61   Morus notabilis
ref|XP_009791489.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    204   2e-61   Nicotiana sylvestris
emb|CAH18930.1|  1-aminocyclopropane-1-carboxylate oxidase              204   2e-61   Pyrus communis
emb|CAJ56065.1|  ACC oxidase                                            204   2e-61   Vigna radiata [mung bean]
ref|XP_003594162.1|  1-aminocyclopropane-1-carboxylate oxidase          201   2e-61   
dbj|BAD06178.1|  ACC oxidase                                            204   2e-61   Pisum sativum var. macrocarpum [snow pea]
gb|KJB57823.1|  hypothetical protein B456_009G182300                    203   3e-61   Gossypium raimondii
ref|XP_007211643.1|  hypothetical protein PRUPE_ppa008813mg             203   3e-61   Prunus persica
gb|AAZ83342.1|  ACC oxidase 1                                           203   3e-61   Gossypium hirsutum [American cotton]
ref|NP_001289250.1|  1-aminocyclopropane-1-carboxylate oxidase 1        203   3e-61   Pyrus x bretschneideri [bai li]
gb|AGF95124.1|  1-aminocyclopropane-1-carboxylate oxidase               203   4e-61   Prunus persica
gb|AEM62877.1|  ACC oxidase 1                                           202   7e-61   Actinidia chinensis
emb|CAJ56064.1|  ACC oxidase                                            202   8e-61   Vigna radiata [mung bean]
sp|P31237.1|ACCO_ACTDE  RecName: Full=1-aminocyclopropane-1-carbo...    202   1e-60   Actinidia deliciosa [Chinese gooseberry]
emb|CAJ56066.1|  ACC oxidase                                            202   1e-60   Vigna radiata [mung bean]
ref|XP_003594161.1|  1-aminocyclopropane-1-carboxylate oxidase          202   1e-60   Medicago truncatula
ref|XP_003529653.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    202   1e-60   Glycine max [soybeans]
gb|AFK48521.1|  unknown                                                 201   1e-60   Lotus japonicus
gb|ACU24286.1|  unknown                                                 202   1e-60   Glycine max [soybeans]
gb|KDO78385.1|  hypothetical protein CISIN_1g018920mg                   199   1e-60   Citrus sinensis [apfelsine]
gb|AEM62885.1|  ACC oxidase 6                                           201   1e-60   Actinidia chinensis
ref|XP_009593567.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    202   2e-60   Nicotiana tomentosiformis
ref|XP_004304079.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    201   2e-60   Fragaria vesca subsp. vesca
gb|AHL69752.1|  aminocyclopropanecarboxylate oxidase                    201   2e-60   Picrorhiza kurrooa
ref|NP_001241899.1|  1-aminocyclopropane-1-carboxylate oxidase-like     201   2e-60   
ref|NP_001281047.1|  1-aminocyclopropane-1-carboxylate oxidase 1        201   2e-60   Malus domestica [apple tree]
gb|KHG24528.1|  1-aminocyclopropane-1-carboxylate oxidase               200   2e-60   Gossypium arboreum [tree cotton]
ref|XP_003534723.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    201   2e-60   Glycine max [soybeans]
gb|AAF36484.1|AF129074_1  1-aminocyclopropane-1-carboxylate oxidase     201   2e-60   Prunus persica
gb|AAC48977.1|  1-aminocyclopropane-1-carboxylate oxidase               201   2e-60   Pelargonium x hortorum [bedding geranium]
sp|Q00985.1|ACCO1_MALDO  RecName: Full=1-aminocyclopropane-1-carb...    201   3e-60   Malus domestica [apple tree]
ref|XP_008342143.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    201   3e-60   
gb|AFJ75398.1|  1-aminocyclopropane-1-carboxylic acid oxidase           201   3e-60   Salvia miltiorrhiza [Chinese salvia]
ref|XP_007153995.1|  hypothetical protein PHAVU_003G082300g             201   3e-60   Phaseolus vulgaris [French bean]
gb|KHN32985.1|  1-aminocyclopropane-1-carboxylate oxidase               201   3e-60   Glycine soja [wild soybean]
emb|CAA67216.1|  ACC oxidase                                            201   3e-60   Malus domestica [apple tree]
gb|AEM62881.1|  ACC oxidase 4                                           201   3e-60   Actinidia chinensis
gb|AEM62882.1|  ACC oxidase 4                                           201   3e-60   Actinidia deliciosa [Chinese gooseberry]
gb|AAK07883.1|AF315316_1  ACC oxidase                                   201   4e-60   Vigna radiata [mung bean]
gb|KHG24527.1|  1-aminocyclopropane-1-carboxylate oxidase               200   4e-60   Gossypium arboreum [tree cotton]
gb|ABK59094.1|  1-amino-cyclopropane-1-carboxylic acid oxidase 3        200   4e-60   Manihot esculenta [manioc]
ref|XP_011000640.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    201   4e-60   Populus euphratica
gb|ABW91146.1|  ACC oxidase 1                                           200   4e-60   Ziziphus jujuba [Chinese jujube]
gb|AEP19803.1|  ACC oxidase 1                                           200   4e-60   Ziziphus jujuba [Chinese jujube]
gb|AHA06004.1|  1-aminocyclopropane-1-carboxylate oxidase               200   5e-60   Lupinus luteus
emb|CAJ56067.1|  ACC oxidase                                            200   6e-60   Vigna radiata [mung bean]
ref|XP_006449820.1|  hypothetical protein CICLE_v10015965mg             200   6e-60   Citrus clementina [clementine]
ref|XP_003549632.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    200   7e-60   Glycine max [soybeans]
ref|XP_007026207.1|  Ethylene-forming enzyme                            200   7e-60   
emb|CAH58646.1|  aminocyclopropan-1-carboxylate oxidase                 200   7e-60   Plantago major [cart-track plant]
ref|XP_006348170.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    200   8e-60   Solanum tuberosum [potatoes]
sp|Q08507.1|ACCO3_PETHY  RecName: Full=1-aminocyclopropane-1-carb...    199   9e-60   Petunia x hybrida [garden petunia]
gb|ACJ84384.1|  unknown                                                 196   1e-59   Medicago truncatula
gb|ACU24032.1|  unknown                                                 199   1e-59   Glycine max [soybeans]
gb|EYU27738.1|  hypothetical protein MIMGU_mgv1a010275mg                199   1e-59   Erythranthe guttata [common monkey flower]
gb|AAA99793.1|  1-aminocyclopropane-1-carboxylic acid oxidase           199   2e-59   Nicotiana glutinosa
ref|XP_009609240.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    199   2e-59   Nicotiana tomentosiformis
ref|XP_009355918.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    199   2e-59   Pyrus x bretschneideri [bai li]
dbj|BAH80550.1|  1-aminocyclopropane-1-carboxylate oxidase              197   2e-59   Eucalyptus grandis [rose gum]
emb|CAD21844.1|  ACC oxidase 1                                          199   2e-59   Fagus sylvatica
ref|NP_001233867.1|  1-aminocyclopropane-1-carboxylate oxidase          199   2e-59   
ref|XP_009630256.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    199   2e-59   Nicotiana tomentosiformis
ref|XP_010052892.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    198   3e-59   Eucalyptus grandis [rose gum]
prf||1909340A  Pch313 protein                                           198   3e-59
ref|XP_007215698.1|  hypothetical protein PRUPE_ppa008791mg             198   3e-59   Prunus persica
ref|NP_001280183.1|  1-aminocyclopropane-1-carboxylate oxidase          198   3e-59   Prunus mume [ume]
dbj|BAH66891.1|  1-aminocyclopropane-1-carboxylate oxidase              197   3e-59   Prunus mume [ume]
ref|XP_008371045.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    198   4e-59   Malus domestica [apple tree]
ref|XP_009768154.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    198   4e-59   Nicotiana sylvestris
ref|XP_010035513.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    198   4e-59   Eucalyptus grandis [rose gum]
gb|ACS71641.1|  ACC oxidase                                             197   5e-59   Dorcoceras hygrometricum
ref|XP_009789991.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    197   6e-59   Nicotiana sylvestris
ref|XP_011047191.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    197   6e-59   Populus euphratica
gb|KEH35231.1|  1-aminocyclopropane-1-carboxylate oxidase               194   6e-59   Medicago truncatula
gb|AAL35971.1|  1-aminocyclopropanecarboxylic acid oxidase              197   6e-59   Medicago truncatula
ref|XP_002316589.1|  aminocyclopropane carboxylate oxidase family...    197   9e-59   Populus trichocarpa [western balsam poplar]
gb|AGG20315.1|  1-aminocyclopropane-1-carboxylate oxidase 4             197   9e-59   Capsicum annuum
emb|CDP04457.1|  unnamed protein product                                197   1e-58   Coffea canephora [robusta coffee]
emb|CAH65725.1|  1-aminocyclopropane-1-carboxylate oxidase              196   1e-58   Carica papaya [mamon]
gb|AAC98808.1|  ACC oxidase                                             197   1e-58   Carica papaya [mamon]
gb|AAL78058.1|  ripening-induced ACC oxidase                            196   1e-58   Carica papaya [mamon]
ref|XP_010099139.1|  1-aminocyclopropane-1-carboxylate oxidase          197   1e-58   Morus notabilis
gb|AAA99792.1|  1-aminocyclopropane-1-carboxylic acid oxidase           197   1e-58   Nicotiana glutinosa
ref|XP_007147675.1|  hypothetical protein PHAVU_006G144900g             196   1e-58   Phaseolus vulgaris [French bean]
gb|AAF64528.1|AF254125_1  ACC oxidase                                   196   1e-58   Carica papaya [mamon]
emb|CAA58232.1|  1-amniocyclopropane-1-carboxylate oxidase              196   1e-58   Nicotiana tabacum [American tobacco]
emb|CAA60576.1|  1-aminocyclopropane-1-carboxylate oxidase              196   1e-58   Pyrus communis
gb|KDP30812.1|  hypothetical protein JCGZ_13755                         196   2e-58   Jatropha curcas
gb|ACJ84896.1|  unknown                                                 193   2e-58   Medicago truncatula
gb|AIR72293.1|  1-amino-cyclopropane-1-carboxylic acid oxidase          196   2e-58   Prunus salicina [Japanese plum]
emb|CAI64499.1|  1-aminocyclopropane-1-carboxylate oxidase 1            196   2e-58   Prunus domestica subsp. syriaca [Mirabelle plum]
gb|AAC48922.1|  1-aminocyclopropane-1-carboxylate oxidase homolog       196   2e-58   Vigna radiata [mung bean]
gb|AFK42210.1|  unknown                                                 196   2e-58   Medicago truncatula
ref|XP_003601593.1|  1-aminocyclopropane-1-carboxylate oxidase          196   2e-58   Medicago truncatula
gb|ACX71872.1|  ACC oxidase 1                                           196   3e-58   Lithospermum erythrorhizon
ref|XP_009629716.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    196   3e-58   Nicotiana tomentosiformis
gb|AEM62878.1|  ACC oxidase 2                                           195   4e-58   Actinidia deliciosa [Chinese gooseberry]
dbj|BAG06705.1|  1-aminocyclopropane-1-carboxylate oxidase              195   4e-58   Ficus carica
sp|Q43792.1|ACCO_TOBAC  RecName: Full=1-aminocyclopropane-1-carbo...    195   4e-58   Nicotiana tabacum [American tobacco]
gb|ADR73045.1|  ACC oxidase 2 isoform A                                 195   5e-58   Nicotiana tabacum [American tobacco]
dbj|BAA83466.1|  ACC oxidase                                            195   5e-58   Nicotiana tabacum [American tobacco]
gb|AFK45850.1|  unknown                                                 195   5e-58   Lotus japonicus
gb|AAP41850.1|  1-aminocyclopropane-1-carboxylate oxidase               195   5e-58   Hevea brasiliensis [jebe]
ref|XP_009781832.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    195   5e-58   Nicotiana sylvestris
gb|KJB10710.1|  hypothetical protein B456_001G217400                    195   6e-58   Gossypium raimondii
emb|CAN85573.1|  ACC oxidase 2                                          195   6e-58   Hevea brasiliensis [jebe]
ref|NP_001267871.1|  aconitase 2, mitochondrial                         195   6e-58   Vitis vinifera
gb|ABI95858.1|  1-aminocyclopropane-1-carboxylate oxidase               194   6e-58   Nicotiana suaveolens
ref|XP_004502173.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    194   6e-58   Cicer arietinum [garbanzo]
sp|O48882.1|ACCO2_MALDO  RecName: Full=1-aminocyclopropane-1-carb...    195   7e-58   Malus domestica [apple tree]
gb|AEM62879.1|  ACC oxidase 3                                           195   7e-58   Actinidia chinensis
gb|AAD28197.2|AF115262_1  1-aminocyclopropane-1-carboxylate oxidase     194   7e-58   Trifolium repens [creeping white clover]
ref|XP_009790903.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    194   7e-58   Nicotiana sylvestris
ref|XP_010035505.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    194   8e-58   Eucalyptus grandis [rose gum]
gb|KDP30813.1|  hypothetical protein JCGZ_13756                         194   8e-58   Jatropha curcas
gb|AAU10090.1|  1-aminocyclopropane-1-carboxylate oxidase               194   1e-57   Fragaria x ananassa
ref|XP_009365121.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    194   1e-57   Pyrus x bretschneideri [bai li]
gb|AGM48542.1|  1-aminocyclopropane-1-carboxylate oxidase               194   1e-57   Coffea arabica [arabica coffee]
emb|CDP21175.1|  unnamed protein product                                189   1e-57   Coffea canephora [robusta coffee]
gb|AAB05171.1|  ACC oxidase                                             194   1e-57   Nicotiana glutinosa
dbj|BAG30908.1|  ACC oxidase                                            194   1e-57   Capsicum chinense [bonnet pepper]
gb|EYU33867.1|  hypothetical protein MIMGU_mgv1a010647mg                194   1e-57   Erythranthe guttata [common monkey flower]
ref|XP_010035507.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    194   1e-57   Eucalyptus grandis [rose gum]
ref|XP_002320487.1|  1-aminocyclopropane-1-carboxylate oxidase fa...    194   1e-57   Populus trichocarpa [western balsam poplar]
ref|XP_010035506.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    194   1e-57   Eucalyptus grandis [rose gum]
gb|AAB70884.1|  1-aminocyclopropane-1-carboxylate oxidase               194   1e-57   Pelargonium x hortorum [bedding geranium]
gb|AEM62883.1|  ACC oxidase 5                                           194   1e-57   Actinidia chinensis
gb|AEM62880.1|  ACC oxidase 3                                           194   1e-57   Actinidia deliciosa [Chinese gooseberry]
gb|KFK42831.1|  hypothetical protein AALP_AA1G045000                    194   2e-57   Arabis alpina [alpine rockcress]
dbj|BAF33504.1|  ACC synthase                                           194   2e-57   Orobanche minor
ref|NP_001233928.1|  1-aminocyclopropane-1-carboxylate oxidase 4        194   2e-57   Solanum lycopersicum
dbj|BAA94601.1|  1-aminocyclopropane-1-carboxylate oxidase              194   2e-57   Populus x canadensis [Canadian poplar]
dbj|BAD60998.1|  1-aminocyclopropane-1-carboxylate oxidase              194   2e-57   Pyrus pyrifolia [sha li]
gb|ACU18811.1|  unknown                                                 191   2e-57   Glycine max [soybeans]
dbj|BAA19605.1|  ACC-oxidase                                            193   2e-57   Vigna angularis [azuki bean]
sp|Q08508.1|ACCO4_PETHY  RecName: Full=1-aminocyclopropane-1-carb...    194   2e-57   Petunia x hybrida [garden petunia]
ref|XP_010035510.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    194   2e-57   Eucalyptus grandis [rose gum]
ref|XP_009613638.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    194   2e-57   Nicotiana tomentosiformis
dbj|BAA21541.1|  1-aminocyclopropane-1-carboxylic acid oxidase          193   2e-57   Actinidia deliciosa [Chinese gooseberry]
gb|AEM62884.1|  ACC oxidase 5                                           193   2e-57   Actinidia deliciosa [Chinese gooseberry]
ref|XP_010035511.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    193   2e-57   Eucalyptus grandis [rose gum]
ref|XP_006357981.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    193   2e-57   Solanum tuberosum [potatoes]
ref|XP_010035508.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    193   2e-57   Eucalyptus grandis [rose gum]
sp|P05116.2|ACCO1_SOLLC  RecName: Full=1-aminocyclopropane-1-carb...    193   3e-57   Solanum lycopersicum
ref|XP_010035504.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    193   3e-57   Eucalyptus grandis [rose gum]
ref|XP_008440054.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    193   3e-57   Cucumis melo [Oriental melon]
sp|P54847.1|ACCO3_CUCME  RecName: Full=1-aminocyclopropane-1-carb...    193   3e-57   Cucumis melo [Oriental melon]
gb|AAL37174.1|AF320071_1  1-aminocyclopropane-1-carboxylate oxidase     193   3e-57   Carica papaya [mamon]
ref|XP_004293334.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    193   3e-57   Fragaria vesca subsp. vesca
ref|XP_009604053.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    193   3e-57   Nicotiana tomentosiformis
dbj|BAC53656.1|  1-aminocyclopropene-1-carboxylate oxidase              193   3e-57   Malus domestica [apple tree]
emb|CAH64841.1|  1-aminocyclopropane-1-carboxylate oxidase              193   3e-57   Carica papaya [mamon]
gb|AAK57516.1|  ACC oxidase                                             193   3e-57   Carica papaya [mamon]
ref|XP_008348143.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    193   4e-57   
dbj|BAD60999.1|  1-aminocyclopropane-1-carboxylate oxidase              193   4e-57   Pyrus pyrifolia [sha li]
emb|CAA82646.1|  ethylene forming enzyme (EFE)                          192   5e-57   Nicotiana tabacum [American tobacco]
ref|XP_006383841.1|  aminocyclopropane carboxylate oxidase family...    192   6e-57   Populus trichocarpa [western balsam poplar]
gb|AAB02051.1|  1-aminocyclopropane-1-carboxylate oxidase               192   6e-57   Carica papaya [mamon]
gb|ABK96379.1|  unknown                                                 192   6e-57   Populus trichocarpa x Populus deltoides
ref|XP_006595831.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    192   7e-57   
gb|AFZ76981.1|  ACC oxidase                                             192   8e-57   Boehmeria nivea [Chinese silk-plant]
gb|KDP20691.1|  hypothetical protein JCGZ_21162                         192   8e-57   Jatropha curcas
gb|ACU20024.1|  unknown                                                 189   8e-57   Glycine max [soybeans]
gb|KHN44756.1|  1-aminocyclopropane-1-carboxylate oxidase               192   8e-57   Glycine soja [wild soybean]
emb|CAN85571.1|  ACC oxidase 3                                          192   9e-57   Hevea brasiliensis [jebe]
emb|CAN68493.1|  hypothetical protein VITISV_042552                     191   1e-56   Vitis vinifera
emb|CAA71738.1|  1-aminocyclopropane-1-carboxylate oxidase              191   1e-56   Betula pendula [white birch]
gb|AFF19571.1|  1-aminocyclopropane-1-carboxylate oxidase               191   1e-56   Momordica charantia [balsam pear]
gb|ACU82854.3|  1-aminocyclopropane-1-carboxylate oxidase               191   1e-56   Eriobotrya japonica [loquat]
ref|XP_006351971.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    191   1e-56   Solanum tuberosum [potatoes]
ref|NP_001275482.1|  1-aminocyclopropane-1-carboxylate oxidase          191   1e-56   Solanum tuberosum [potatoes]
gb|ADK39027.1|  1-aminocyclopropane-1-carboxylic acid oxidase           191   2e-56   Betula luminifera [liang ye hua]
gb|KHG21578.1|  1-aminocyclopropane-1-carboxylate oxidase 3             191   2e-56   Gossypium arboreum [tree cotton]
ref|XP_003519448.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    191   2e-56   Glycine max [soybeans]
emb|CAN85569.1|  ACC oxidase 1                                          191   2e-56   Hevea brasiliensis [jebe]
emb|CDP05673.1|  unnamed protein product                                191   2e-56   Coffea canephora [robusta coffee]
ref|XP_007141655.1|  hypothetical protein PHAVU_008G214200g             191   2e-56   Phaseolus vulgaris [French bean]
gb|AGV54270.1|  1-aminocyclopropane-1-carboxylic acid oxidase           191   3e-56   Phaseolus vulgaris [French bean]
gb|ACO91560.1|  1-aminocyclopropane-1-carboxylate oxidase               191   3e-56   Paeonia suffruticosa [moutan peony]
ref|NP_171994.1|  1-aminocyclopropane-1-carboxylate oxidase             191   3e-56   Arabidopsis thaliana [mouse-ear cress]
gb|AEK70335.1|  1-aminocyclopropane-1-carboxylate oxidase               190   3e-56   Paeonia lactiflora [common garden peony]
ref|XP_002535327.1|  1-aminocyclopropane-1-carboxylate oxidase, p...    191   3e-56   Ricinus communis
dbj|BAB89352.1|  1-aminocyclopropane-1-carboxylate oxidase              191   3e-56   Diospyros kaki [Japanese persimmon]
gb|ACU24333.1|  unknown                                                 187   3e-56   Glycine max [soybeans]
emb|CAA47251.1|  ethylene-forming enzyme                                191   3e-56   Arabidopsis thaliana [mouse-ear cress]
dbj|BAQ21979.1|  1-aminocyclopropane-1-carboxylate oxidase              191   3e-56   Gentiana triflora
ref|XP_004134785.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    191   3e-56   
gb|AAK43970.1|AF370155_1  putative 1-aminocyclopropane-1-carboxyl...    191   3e-56   Arabidopsis thaliana [mouse-ear cress]
gb|ABW91147.1|  ACC oxidase 2                                           191   3e-56   Ziziphus jujuba [Chinese jujube]
ref|XP_007049183.1|  Ethylene-forming enzyme                            190   3e-56   Theobroma cacao [chocolate]
emb|CAN85572.1|  ACC oxidase 1                                          190   4e-56   Hevea brasiliensis [jebe]
gb|AFU90135.1|  1-aminocyclopropane-1-carboxylate oxidase               190   4e-56   Paeonia lactiflora [common garden peony]
gb|AEM42994.1|  ACC oxidase                                             190   4e-56   Siraitia grosvenorii [arhat fruit]
emb|CDP05674.1|  unnamed protein product                                190   5e-56   Coffea canephora [robusta coffee]
gb|AGN52989.1|  ACC oxidase                                             190   5e-56   Euphorbia esula [wolf's milk]
ref|XP_010522369.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    190   5e-56   Tarenaya hassleriana [spider flower]
ref|XP_006584893.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    189   5e-56   Glycine max [soybeans]
gb|AEM65196.1|  ACC oxidase                                             190   5e-56   Garcinia mangostana [mangosteen]
ref|XP_010035512.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    190   6e-56   Eucalyptus grandis [rose gum]
gb|AAZ83343.1|  ACC oxidase 2                                           189   6e-56   Gossypium hirsutum [American cotton]
gb|KHG22879.1|  1-aminocyclopropane-1-carboxylate oxidase               189   7e-56   Gossypium arboreum [tree cotton]
ref|XP_010057880.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    189   7e-56   Eucalyptus grandis [rose gum]
ref|XP_010475176.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    189   7e-56   Camelina sativa [gold-of-pleasure]
gb|AHN13883.1|  1-aminocyclopropane-1-carboxylate oxidase 1             189   8e-56   Coffea arabica [arabica coffee]
gb|AAC12934.1|  1-aminocyclopropane-1-carboxylic acid oxidase           189   8e-56   Phaseolus vulgaris [French bean]
gb|KJB67282.1|  hypothetical protein B456_010G184900                    189   9e-56   Gossypium raimondii
dbj|BAB83762.1|  1-aminocyclopropane-1-carboxylic acid oxidase          189   1e-55   Phaseolus lunatus
ref|XP_006418070.1|  hypothetical protein EUTSA_v10008207mg             189   1e-55   Eutrema salsugineum [saltwater cress]
gb|AAA33708.1|  ethylene-forming enzyme                                 189   1e-55   Petunia x hybrida [garden petunia]
gb|KHN00185.1|  1-aminocyclopropane-1-carboxylate oxidase               189   1e-55   Glycine soja [wild soybean]
sp|Q08506.1|ACCO1_PETHY  RecName: Full=1-aminocyclopropane-1-carb...    189   1e-55   Petunia x hybrida [garden petunia]
gb|AFJ75133.1|  ACC oxidase                                             188   1e-55   Malus domestica [apple tree]
gb|AFJ75135.1|  ACC oxidase                                             188   1e-55   Malus domestica [apple tree]
gb|AAR99394.1|  ACC oxidase ACO1                                        189   2e-55   Nicotiana attenuata
ref|XP_004251527.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    189   2e-55   
gb|AFJ75134.1|  ACC oxidase                                             188   2e-55   Malus domestica [apple tree]
ref|XP_010252569.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    188   2e-55   Nelumbo nucifera [Indian lotus]
gb|ABC69167.2|  1-aminocyclopropane-1-carboxylate oxidase               188   2e-55   Paeonia suffruticosa [moutan peony]
gb|ABB97398.1|  ACC oxidase                                             187   3e-55   Trifolium repens [creeping white clover]
ref|XP_002892259.1|  hypothetical protein ARALYDRAFT_887679             188   3e-55   
gb|ADR73046.1|  ACC oxidase 2 isoform B                                 187   3e-55   Nicotiana tabacum [American tobacco]
gb|AEC32837.1|  1-aminocyclopropane-1-carboxylate oxidase               188   3e-55   Psidium guajava [guava]
gb|AFK29447.1|  1-aminocyclopropane-1-carboxylate oxidase               187   4e-55   Arabidopsis kamchatica
ref|XP_003616885.1|  1-aminocyclopropane-1-carboxylate oxidase          185   4e-55   
ref|XP_010457570.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    187   5e-55   Camelina sativa [gold-of-pleasure]
gb|AAC67233.1|  ACC oxidase 2                                           187   5e-55   Cucumis sativus [cucumbers]
gb|ACJ84876.1|  unknown                                                 184   5e-55   Medicago truncatula
gb|KHG03155.1|  1-aminocyclopropane-1-carboxylate oxidase 1             187   5e-55   Gossypium arboreum [tree cotton]
gb|AEC32838.1|  1-aminocyclopropane-1-carboxylate oxidase               187   6e-55   Psidium guajava [guava]
emb|CDP11301.1|  unnamed protein product                                181   6e-55   Coffea canephora [robusta coffee]
ref|XP_004507658.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    187   6e-55   
gb|KJB67305.1|  hypothetical protein B456_010G185000                    184   6e-55   Gossypium raimondii
gb|KDO78383.1|  hypothetical protein CISIN_1g018920mg                   188   6e-55   Citrus sinensis [apfelsine]
sp|P07920.1|ACCO2_SOLLC  RecName: Full=1-aminocyclopropane-1-carb...    187   7e-55   Solanum lycopersicum
gb|KJB22700.1|  hypothetical protein B456_004G062100                    184   7e-55   Gossypium raimondii
gb|AAZ83344.1|  ACC oxidase 3                                           187   9e-55   Gossypium hirsutum [American cotton]
sp|Q8S932.1|ACCO_DIOKA  RecName: Full=1-aminocyclopropane-1-carbo...    187   9e-55   Diospyros kaki [Japanese persimmon]
ref|XP_009119214.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    187   9e-55   Brassica rapa
ref|XP_003610488.1|  1-aminocyclopropane-1-carboxylate oxidase          187   1e-54   
gb|ABB97399.1|  ACC oxidase                                             186   1e-54   Trifolium repens [creeping white clover]
gb|AAB71421.1|  1-aminocyclopropapne-1-carboxylic acid oxidase          186   1e-54   Helianthus annuus
dbj|BAH15312.1|  ACC oxidase 2                                          186   1e-54   Lactuca sativa [cultivated lettuce]
ref|XP_003616884.1|  1-aminocyclopropane-1-carboxylate oxidase          186   2e-54   Medicago truncatula
gb|AAD28198.2|AF115263_1  1-aminocyclopropane-1-carboxylate oxidase     186   2e-54   Trifolium repens [creeping white clover]
ref|XP_004172177.1|  PREDICTED: LOW QUALITY PROTEIN: 1-aminocyclo...    186   2e-54   
gb|AFK49530.1|  unknown                                                 186   2e-54   Medicago truncatula
emb|CDY18281.1|  BnaC05g03040D                                          186   2e-54   Brassica napus [oilseed rape]
gb|AAO13735.1|AF252853_1  putative 1-aminocyclopropane-1-carboxyl...    186   2e-54   Brassica oleracea
emb|CAB97173.1|  putative 1-aminocyclopropane-1-carboxylic acid o...    186   2e-54   Mangifera indica
ref|XP_007160495.1|  hypothetical protein PHAVU_002G326600g             184   2e-54   Phaseolus vulgaris [French bean]
ref|XP_010484553.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    186   2e-54   Camelina sativa [gold-of-pleasure]
gb|AFK29449.1|  1-aminocyclopropane-1-carboxylate oxidase               186   2e-54   Arabidopsis halleri subsp. halleri
gb|AHW85523.1|  1-aminocyclopropane-1-carboxylate oxidase               185   2e-54   Malus floribunda [Japanese crab apple]
gb|AAB70883.1|  1-aminocyclopropane-1-carboxylate oxidase               186   2e-54   Pelargonium x hortorum [bedding geranium]
gb|ABA01476.1|  ACC oxidase ACO4                                        185   3e-54   Gossypium hirsutum [American cotton]
gb|KJB22699.1|  hypothetical protein B456_004G062100                    185   3e-54   Gossypium raimondii
gb|AFK41584.1|  unknown                                                 185   3e-54   Lotus japonicus
ref|XP_006447652.1|  hypothetical protein CICLE_v10015962mg             183   3e-54   
ref|XP_002302856.1|  1-aminocyclopropane-1-carboxylate oxidase fa...    185   4e-54   Populus trichocarpa [western balsam poplar]
gb|ABK58140.1|  1-amino-cyclopropane-1-carboxylic acid oxidase          185   4e-54   Manihot esculenta [manioc]
emb|CDY53397.1|  BnaAnng12450D                                          185   4e-54   
gb|KJB67306.1|  hypothetical protein B456_010G185000                    184   6e-54   
ref|XP_007160496.1|  hypothetical protein PHAVU_002G326600g             184   6e-54   
emb|CAA04872.1|  1-aminocyclopropane-1-carboxylate oxidase              179   7e-54   
gb|KDO54311.1|  hypothetical protein CISIN_1g020953mg                   184   7e-54   
ref|XP_006447653.1|  hypothetical protein CICLE_v10015962mg             184   7e-54   
gb|ABI33224.1|  ACC oxidase                                             184   8e-54   
gb|ADB03782.1|  1-aminocyclopropane-1-carboxylate oxidase               183   1e-53   
ref|XP_010686763.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    184   1e-53   
gb|ABK97619.1|  1-aminocyclopropane-1-carboxylic acid oxidase           183   2e-53   
ref|XP_004151282.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    182   3e-53   
gb|AAB97368.1|  1-aminocyclopropane-1-carboxylate oxidase               182   3e-53   
emb|CBI28867.3|  unnamed protein product                                182   3e-53   
gb|AAT99445.1|  ripening related ACC oxidase 2                          182   3e-53   
ref|XP_010688910.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    182   4e-53   
gb|AAC67232.1|  ACC oxidase 1                                           181   4e-53   
ref|XP_011047006.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    182   5e-53   
ref|NP_001275812.1|  ACC oxidase                                        182   7e-53   
ref|XP_007141649.1|  hypothetical protein PHAVU_008G213800g             181   7e-53   
ref|XP_007144188.1|  hypothetical protein PHAVU_007G135600g             181   8e-53   
gb|ADX66712.1|  ACO1 protein                                            182   8e-53   
emb|CBA35164.1|  ACC oxidase                                            181   8e-53   
emb|CDP21246.1|  unnamed protein product                                175   8e-53   
ref|XP_004165740.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    181   9e-53   
dbj|BAA33378.1|  ACC oxidase                                            181   1e-52   
gb|KHN44760.1|  1-aminocyclopropane-1-carboxylate oxidase               181   1e-52   
gb|AIS71925.1|  1-aminocyclopropane-1-carboxylate oxidase 1             181   1e-52   
gb|KJB42846.1|  hypothetical protein B456_007G170100                    181   1e-52   
gb|AAS16934.1|  1-aminocyclopropane-1-carboxylate oxidase 2             181   1e-52   
ref|XP_008456405.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    181   1e-52   
gb|KJB08659.1|  hypothetical protein B456_001G096300                    181   1e-52   
emb|CAA71140.1|  1-aminocyclopropane-1-carboxylic acid oxidase          181   1e-52   
gb|KHN44761.1|  1-aminocyclopropane-1-carboxylate oxidase               181   1e-52   
gb|KHG23673.1|  1-aminocyclopropane-1-carboxylate oxidase               181   2e-52   
ref|XP_010546539.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    181   2e-52   
ref|XP_003545587.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    180   2e-52   
ref|XP_006305365.1|  hypothetical protein CARUB_v10009749mg             181   2e-52   
dbj|BAI39989.1|  ACC oxidase                                            180   4e-52   
ref|NP_001284392.1|  1-aminocyclopropane-1-carboxylate oxidase 1        180   4e-52   
gb|ACL68417.3|  ACC oxidase                                             179   5e-52   
emb|CAA63342.1|  ACC oxidase                                            173   5e-52   
gb|ACU23120.1|  unknown                                                 175   1e-51   
dbj|BAH15311.1|  ACC oxidase 1                                          178   2e-51   
gb|ACY76262.1|  ACC oxidase                                             178   2e-51   
gb|AAN86821.1|  1-aminocyclopropane-1-carboxylate oxidase 2             177   3e-51   
gb|ABC02397.1|  1-aminocyclopropane-1-carboxylate oxidase               177   4e-51   
gb|KEH32649.1|  non-heme dioxygenase in morphine synthesis amino-...    186   4e-51   
gb|AAO37687.1|  1-aminocyclopropane-1-carboxylic acid oxidase 1         176   5e-51   
ref|NP_001242835.1|  uncharacterized protein LOC100819184               176   7e-51   
ref|XP_003545591.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    176   7e-51   
emb|CAA67119.1|  ACC oxidase                                            176   8e-51   
gb|KHN38493.1|  1-aminocyclopropane-1-carboxylate oxidase               176   8e-51   
ref|NP_001241509.1|  uncharacterized protein LOC100815336               176   8e-51   
gb|ABL67953.2|  1-aminocyclopropane-1-carboxylate oxidase               176   1e-50   
ref|NP_001267694.1|  1-aminocyclopropane-1-carboxylate oxidase 1-...    176   1e-50   
gb|AAC67234.1|  ACC oxidase 3                                           176   1e-50   
pdb|1W9Y|A  Chain A, The Structure Of Acc Oxidase                       176   1e-50   
gb|AAR22910.1|  ACC oxidase                                             176   2e-50   
gb|ABU62792.1|  1-aminocyclopropane-1-carboxylate oxidase               173   4e-50   
gb|ABU62791.1|  1-aminocyclopropane-1-carboxylate oxidase               173   5e-50   
sp|P19464.1|ACCO_PERAE  RecName: Full=1-aminocyclopropane-1-carbo...    174   5e-50   
dbj|BAA96787.1|  1-aminocyclopropane-1-carboxylate oxidase              172   6e-50   
ref|XP_003616886.1|  1-aminocyclopropane-1-carboxylate oxidase          174   9e-50   
gb|AAP94014.1|  ACC oxidase AC02                                        172   2e-49   
gb|AFV50550.1|  1-aminocyclopropane-1-carboxylate oxidase               172   2e-49   
ref|NP_001234024.1|  1-aminocyclopropane-1-carboxylate oxidase 1        172   3e-49   
dbj|BAE20195.1|  aco                                                    172   4e-49   
ref|XP_010270047.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    172   5e-49   
gb|AAC49833.1|  1-aminocyclopropane-1-carboxylic acid oxidase           171   6e-49   
emb|CAD21843.1|  ACC oxidase 1                                          169   2e-48   
dbj|BAE20196.1|  aco                                                    169   3e-48   
gb|AEX08302.1|  1-aminocyclopropane-1-carboxylate oxidase               165   7e-48   
gb|AEX08300.1|  1-aminocyclopropane-1-carboxylate oxidase               165   9e-48   
dbj|BAE20197.1|  aco                                                    168   1e-47   
dbj|BAF44098.1|  1-aminocyclopropane-1-carboxylate oxidase              166   2e-47   
ref|XP_010533786.1|  PREDICTED: LOW QUALITY PROTEIN: 1-aminocyclo...    168   2e-47   
gb|AEX08288.1|  1-aminocyclopropane-1-carboxylate oxidase               163   6e-47   
emb|CAH64549.1|  1-aminocyclopropane-1-carboxylate oxidase              164   1e-46   
gb|ABG78034.1|  1-aminocyclopropane-1-carboxylate oxidase               165   1e-46   
ref|XP_006306083.1|  hypothetical protein CARUB_v10011493mg             166   1e-46   
dbj|BAE20198.1|  aco                                                    165   2e-46   
gb|EPS72760.1|  hypothetical protein M569_01997                         164   2e-46   
gb|ABM74187.1|  1-aminocyclopropane-1-carboxylate oxidase               164   3e-46   
gb|AEX08306.1|  1-aminocyclopropane-1-carboxylate oxidase               160   4e-46   
gb|AEX08307.1|  1-aminocyclopropane-1-carboxylate oxidase               160   4e-46   
gb|AAB65753.1|  1-aminocyclopropane-1-carboxylic acid oxidase           164   5e-46   
emb|CDY08654.1|  BnaC04g19630D                                          164   5e-46   
gb|ABU23719.1|  1-aminocyclopropane-1-carboxylate oxidase               162   1e-45   
ref|XP_010493627.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    163   1e-45   
ref|XP_009123393.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    163   2e-45   
emb|CDY32039.1|  BnaA03g60430D                                          162   2e-45   
sp|P31528.1|ACCO_DIACA  RecName: Full=Probable 1-aminocyclopropan...    162   2e-45   
gb|AAA33273.1|  amino-cyclopropane carboxylic acid oxidase              162   2e-45   
gb|ABY26553.1|  ACC oxidase                                             162   2e-45   
gb|AGC25242.1|  ACC oxidase                                             162   2e-45   
ref|XP_009148622.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    162   3e-45   
ref|XP_002889907.1|  predicted protein                                  162   3e-45   
ref|XP_006417277.1|  hypothetical protein EUTSA_v10008225mg             162   4e-45   
gb|AAM20919.1|AF441282_1  1-aminocyclopropane-1-carboxylate oxidase     160   4e-45   
gb|AAC49825.1|  1-aminocyclopropane-1-carboxylic acid oxidase           155   7e-45   
ref|XP_009118157.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    160   9e-45   
ref|XP_006647976.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    161   9e-45   
gb|AGE15421.1|  1-aminocyclopropane-1-carboxylate oxidase               160   1e-44   
ref|NP_172665.1|  1-aminocyclopropane-1-carboxylate oxidase             160   1e-44   
gb|AAY85373.1|  1-aminocyclopropane-1-carboxylate oxidase               157   1e-44   
ref|XP_003570545.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    160   1e-44   
gb|ABY53430.1|  1-aminocyclopropane-1-carboxylate oxidase               160   1e-44   
gb|AAC49824.1|  1-aminocyclopropane-1-carboxylic acid oxidase           158   2e-44   
gb|KFK40603.1|  hypothetical protein AALP_AA2G017200                    159   3e-44   
ref|XP_006391897.1|  hypothetical protein EUTSA_v10023595mg             159   3e-44   
gb|KFK43467.1|  hypothetical protein AALP_AA1G128800                    159   3e-44   
ref|XP_002462474.1|  hypothetical protein SORBIDRAFT_02g026280          159   4e-44   
gb|ABB89910.1|  1-aminocyclopropane-1-carboxylate oxidase               158   4e-44   
gb|AAT72475.1|  AT1G05010                                               155   4e-44   
emb|CAC39107.1|  ACC oxidase                                            159   4e-44   
gb|AAP94013.1|  ACC oxidase AC01                                        157   5e-44   
ref|XP_002888029.1|  hypothetical protein ARALYDRAFT_475105             159   6e-44   
gb|AFK29147.1|  ACC-oxidase                                             157   7e-44   
gb|ACO37154.1|  ACC oxidase                                             157   8e-44   
gb|ACT22772.1|  ACC oxidase 2                                           158   1e-43   
ref|XP_003578206.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    158   1e-43   
gb|ACD87811.1|  putative ACC oxidase                                    156   1e-43   
gb|EMT02126.1|  hypothetical protein F775_27074                         154   1e-43   
emb|CDY34603.1|  BnaC08g41620D                                          157   1e-43   
emb|CAA57285.1|  ACC oxidase                                            157   1e-43   
ref|XP_010943257.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    157   1e-43   
gb|ABC02869.1|  1-aminocyclopropane-1-carboxylate oxidase               156   2e-43   
gb|AAC27484.1|  ACC oxidase                                             157   2e-43   
gb|EAZ44946.1|  hypothetical protein OsJ_29588                          156   2e-43   
emb|CAA11200.1|  ACC oxidase                                            157   2e-43   
ref|NP_176428.1|  1-aminocyclopropane-1-carboxylate oxidase 2           157   2e-43   
gb|AAB00556.1|  1-aminocyclopropane-1-carboxylate oxidase               157   2e-43   
gb|ABV45543.1|  1-aminocyclopropane-1-carboxylate oxidase               157   2e-43   
gb|AFI41198.1|  ACC oxidase 2                                           157   2e-43   
ref|XP_008805606.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    157   2e-43   
gb|ACH99202.1|  1-aminocyclopropane-1-carboxylate oxidase               157   2e-43   
emb|CAE53174.1|  1-aminocyclopropane-1-carboxylate oxidase              157   3e-43   
ref|XP_008651663.1|  PREDICTED: uncharacterized protein LOC100382...    157   3e-43   
gb|AAA32981.1|  amino-cyclopropane-carboxylic acid oxidase              157   3e-43   
ref|XP_009410048.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    157   3e-43   
ref|XP_004954061.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    157   3e-43   
gb|AAS09956.1|  1-aminocyclopropane-1-carboxylate oxidase               157   4e-43   
emb|CAA59749.1|  1-aminocyclopropane-1-carboxylate oxidase (ACC o...    156   4e-43   
ref|NP_001063330.1|  Os09g0451400                                       156   4e-43   
sp|A2Z1W9.1|ACCO1_ORYSI  RecName: Full=1-aminocyclopropane-1-carb...    156   4e-43   
dbj|BAB32502.1|  1-aminocyclopropane-1-carboxylate oxidase              156   4e-43   
gb|AFO63019.1|  ACC oxidase                                             156   5e-43   
dbj|BAJ90796.1|  predicted protein                                      156   5e-43   
gb|AAR00930.1|U86045_1  1-aminocyclopropane-1-carboxylate oxidase       156   7e-43   
gb|AFO63016.1|  ACC oxidase                                             156   8e-43   
gb|AGC96124.1|  1-aminocyclopropane-1-carboxylate oxidase protein       154   1e-42   
dbj|BAK04182.1|  predicted protein                                      155   1e-42   
gb|AFO63018.1|  ACC oxidase                                             155   1e-42   
dbj|BAK03337.1|  predicted protein                                      155   1e-42   
ref|XP_006302557.1|  hypothetical protein CARUB_v10020664mg             155   2e-42   
gb|AAB65754.1|  1-aminocyclopropane-1-carboxylic acid oxidase           154   2e-42   
gb|AHJ14562.1|  ACC oxidase                                             154   3e-42   
ref|XP_008803519.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    154   3e-42   
gb|ABW20470.1|  ACC oxidase                                             154   3e-42   
gb|EAY87690.1|  hypothetical protein OsI_09105                          154   4e-42   
gb|ACS34759.1|  1-aminocyclopropane-1-carboxylate oxidase               154   5e-42   
gb|ABR53742.1|  1-aminocyclopropane-1-carboxylate oxidase 2             152   6e-42   
ref|NP_001048259.1|  Os02g0771600                                       153   7e-42   
gb|ABO65266.1|  1-aminocyclopropane-1-carboxylate oxidase               153   7e-42   
gb|AEX08286.1|  1-aminocyclopropane-1-carboxylate oxidase               149   7e-42   
ref|XP_002452894.1|  hypothetical protein SORBIDRAFT_04g034520          153   1e-41   
gb|AAC05507.1|  1-aminocyclopropane-1-carboxylate oxidase               152   1e-41   
ref|XP_009387204.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    152   1e-41   
emb|CAA64856.1|  1-aminocyclopropane-1-carboxylate oxidase              152   1e-41   
ref|XP_010913394.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    152   1e-41   
dbj|BAB11918.1|  1-aminocyclopropane-1-carboxylate oxidase              151   2e-41   
ref|XP_004956979.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    152   2e-41   
gb|ABU23720.1|  1-aminocyclopropane-1-carboxylate oxidase               150   2e-41   
gb|AEX08324.1|  1-aminocyclopropane-1-carboxylate oxidase               148   3e-41   
ref|NP_001105235.1|  ACC oxidase20                                      152   3e-41   
gb|AEZ06406.1|  1-aminocycloproane-1-carboxylate oxidase                151   3e-41   
ref|XP_009113083.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    151   3e-41   
gb|AAR00506.1|  1-aminocyclopropane-1-carboxylate oxidase               151   4e-41   
sp|Q39705.1|ACCO2_DORSP  RecName: Full=1-aminocyclopropane-1-carb...    151   5e-41   
gb|AEX08295.1|  1-aminocyclopropane-1-carboxylate oxidase               147   5e-41   
gb|AEX08296.1|  1-aminocyclopropane-1-carboxylate oxidase               147   7e-41   
ref|XP_006660677.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    150   7e-41   
dbj|BAK00833.1|  predicted protein                                      150   8e-41   
gb|AFO63015.1|  ACC oxidase                                             150   8e-41   
dbj|BAA81897.1|  1-aminocyclopropane-1-carboxylic acid oxidase          149   9e-41   
gb|AAM74522.1|  fruit ripening-related ACC oxidase                      149   1e-40   
gb|EEC84681.1|  hypothetical protein OsI_31599                          150   1e-40   
ref|XP_010418231.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    150   1e-40   
ref|XP_004956981.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    150   1e-40   
sp|Q09052.1|ACCO1_BRAJU  RecName: Full=1-aminocyclopropane-1-carb...    150   1e-40   
ref|XP_010473457.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    150   1e-40   
ref|NP_001063329.1|  Os09g0451000                                       150   1e-40   
gb|AEO92024.1|  1-aminocyclopropane-1-carboxylic acid oxidase           148   2e-40   
gb|ABR53743.1|  1-aminocyclopropane-1-carboxylate oxidase 3             148   2e-40   
ref|XP_010430292.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    149   3e-40   
ref|NP_001130227.1|  1-aminocyclopropane-1-carboxylate oxidase 1A...    149   3e-40   
sp|P31238.1|ACCO1_DORSP  RecName: Full=1-aminocyclopropane-1-carb...    149   4e-40   
gb|AEX08284.1|  1-aminocyclopropane-1-carboxylate oxidase               144   5e-40   
gb|AEX08323.1|  1-aminocyclopropane-1-carboxylate oxidase               144   6e-40   
gb|ABR53741.1|  1-aminocyclopropane-1-carboxylate oxidase 1             147   7e-40   
gb|AEX08310.1|  1-aminocyclopropane-1-carboxylate oxidase               144   7e-40   
gb|AEX08303.1|  1-aminocyclopropane-1-carboxylate oxidase               144   8e-40   
gb|ABU23721.1|  1-aminocyclopropane-1-carboxylate oxidase               146   8e-40   
gb|AEX08297.1|  1-aminocyclopropane-1-carboxylate oxidase               144   9e-40   
gb|AEX08293.1|  1-aminocyclopropane-1-carboxylate oxidase               144   9e-40   
gb|AEX08291.1|  1-aminocyclopropane-1-carboxylate oxidase               144   1e-39   
gb|AEX08290.1|  1-aminocyclopropane-1-carboxylate oxidase               144   1e-39   
emb|CAH65482.1|  1-aminocyclopropane-1-carboxylate oxidase              145   1e-39   
gb|AEX08321.1|  1-aminocyclopropane-1-carboxylate oxidase               143   2e-39   
ref|XP_009413270.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    147   2e-39   
gb|AEX08294.1|  1-aminocyclopropane-1-carboxylate oxidase               143   2e-39   
gb|AEX08289.1|  1-aminocyclopropane-1-carboxylate oxidase               143   2e-39   
gb|AEX08283.1|  1-aminocyclopropane-1-carboxylate oxidase               142   3e-39   
emb|CAD44265.2|  putative aminocyclopropane carboxylate oxidase         146   3e-39   
gb|AEX08281.1|  1-aminocyclopropane-1-carboxylate oxidase               142   3e-39   
dbj|BAF36562.1|  ACC oxidase                                            146   3e-39   
emb|CAI38682.1|  1-aminocyclopropane-1-carboxylate oxidase              141   4e-39   
emb|CAH65483.1|  1-aminocyclopropane-1-carboxylate oxidase              141   4e-39   
gb|AEX08316.1|  1-aminocyclopropane-1-carboxylate oxidase               142   4e-39   
gb|AEX08298.1|  1-aminocyclopropane-1-carboxylate oxidase               142   5e-39   
gb|KCW46928.1|  hypothetical protein EUGRSUZ_K00742                     145   6e-39   



>gb|ABL67954.2| 1-aminocyclopropane-1-carboxylate oxidase [Ipomoea nil]
Length=319

 Score =   250 bits (639),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 119/119 (100%), Positives = 119/119 (100%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC
Sbjct  1    MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM
Sbjct  61   MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  119



>dbj|BAF33502.1| ACC oxidase [Phelipanche ramosa]
Length=318

 Score =   211 bits (536),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 95/118 (81%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            MA+FP+IN+ +LN EER A ME IKDACENWGFFELV+HGI+ E MDTVE+LTK+HYKKC
Sbjct  1    MATFPVINMEKLNGEERSATMEMIKDACENWGFFELVNHGITAEFMDTVERLTKEHYKKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            MEQRFKEMV +KGL+A+Q+EI DLDWESTFFL+HLPVSNISEIPDLED YRKVMKEFA
Sbjct  61   MEQRFKEMVTSKGLEAIQSEITDLDWESTFFLRHLPVSNISEIPDLEDEYRKVMKEFA  118



>gb|AAD28196.2|AF115261_1 1-aminocyclopropane-1-carboxylate oxidase [Trifolium repens]
 gb|ABB97396.1| ACC oxidase [Trifolium repens]
Length=318

 Score =   209 bits (533),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 94/118 (80%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FPI+++ +LNTEER + ME+IKDACENWGFFELV+HGISIE+MD VEKLTKDHYKKC
Sbjct  1    MENFPIVDMGKLNTEERKSTMEKIKDACENWGFFELVNHGISIEMMDKVEKLTKDHYKKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            MEQRFKEMV++KGL+ VQ+EINDLDWESTFFL+HLP SNISEIPDL+D YRK+MKEFA
Sbjct  61   MEQRFKEMVSSKGLECVQSEINDLDWESTFFLRHLPFSNISEIPDLDDDYRKIMKEFA  118



>gb|ABO32691.1| ACC oxidase ACO3 [Nicotiana attenuata]
Length=316

 Score =   208 bits (530),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 95/118 (81%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FP++N+  LNTE+R A ME IKDACENWGFFE+V+HGIS EL+DTVEKLTK HYKKC
Sbjct  1    METFPVVNMELLNTEQRAATMETIKDACENWGFFEVVNHGISHELLDTVEKLTKGHYKKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            ME+RFKEMVA+KGL+AVQTEI DLDWESTFFLKHLPVSNISE+PDLED YRK+MKEFA
Sbjct  61   MEERFKEMVASKGLEAVQTEIKDLDWESTFFLKHLPVSNISEVPDLEDEYRKIMKEFA  118



>ref|XP_009802116.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase [Nicotiana 
sylvestris]
Length=316

 Score =   208 bits (529),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 94/118 (80%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FP++N+  LNTE+R A ME IKDACENWGFFE+V+HGIS EL+DTVEKLTK HYKKC
Sbjct  1    METFPVVNMELLNTEQRAATMETIKDACENWGFFEVVNHGISHELLDTVEKLTKGHYKKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            ME+RFKEMVA+KGL+AVQTEI DLDWESTFFLKHLP+SNISE+PDLED YRK+MKEFA
Sbjct  61   MEERFKEMVASKGLEAVQTEIKDLDWESTFFLKHLPISNISEVPDLEDEYRKIMKEFA  118



>ref|NP_001275208.1| 1-aminocyclopropane-1-carboxylate oxidase [Solanum tuberosum]
 gb|AAK68076.1|AF384821_1 1-aminocyclopropane-1-carboxylate oxidase [Solanum tuberosum]
Length=319

 Score =   207 bits (528),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 94/118 (80%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FP++N+  LNTE+R AI+E+IKDACENWGFFE++ HGIS +LMDTVEK TK+HYKKC
Sbjct  1    METFPVVNMEMLNTEKRAAILEKIKDACENWGFFEVIYHGISHDLMDTVEKFTKEHYKKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            MEQRFKEMVA+KGL+AVQTEI+DLDWESTFFLKHLPVSNISE+PDLED YRK+MKEFA
Sbjct  61   MEQRFKEMVASKGLEAVQTEIDDLDWESTFFLKHLPVSNISEVPDLEDDYRKIMKEFA  118



>ref|XP_004486198.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase-like [Cicer 
arietinum]
Length=316

 Score =   207 bits (527),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 94/119 (79%), Positives = 111/119 (93%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FPI+++ +LNTEER A ++++KDACENWGFFELV+HGISIELMDTVEKLTK+HYKKC
Sbjct  1    MENFPIVDMGKLNTEERKATLDKMKDACENWGFFELVNHGISIELMDTVEKLTKEHYKKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            MEQRFKEMV +KGL+ VQ+EINDLDWESTFFL+HLPVSNISEIPDL+  YRKVMKEFA+
Sbjct  61   MEQRFKEMVESKGLEYVQSEINDLDWESTFFLRHLPVSNISEIPDLDQDYRKVMKEFAV  119



>gb|AGN74918.1| 1-aminocyclopropane-1-carboxylate oxidase [Morus alba]
Length=319

 Score =   207 bits (526),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 93/118 (79%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FPIINL +LN EER   MEQIKDACENWGFFELV+HGI  E +DTVEK+TKDHY+KC
Sbjct  1    MENFPIINLEKLNGEERKTTMEQIKDACENWGFFELVNHGIPHEFLDTVEKMTKDHYRKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            MEQRFKE+VA+KGL+AVQ E+ND+DWESTFFL+HLPVSNISEIPDL+D YRKVM+EFA
Sbjct  61   MEQRFKELVASKGLEAVQAEVNDMDWESTFFLRHLPVSNISEIPDLDDEYRKVMREFA  118



>ref|XP_002273430.3| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase [Vitis vinifera]
Length=318

 Score =   207 bits (526),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 95/118 (81%), Positives = 106/118 (90%), Gaps = 0/118 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M SFP+IN+  LN EER A ME IKDACENWGFFELV+HGIS ELMDTVEKLTK+HYKKC
Sbjct  1    MESFPVINMENLNGEERAATMENIKDACENWGFFELVNHGISHELMDTVEKLTKEHYKKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            MEQRFKE+VA+KGL+AVQ+EINDLDWESTFFL+HLP SN+SEIPDLE+ YRK MKEF 
Sbjct  61   MEQRFKEVVASKGLEAVQSEINDLDWESTFFLRHLPTSNMSEIPDLEEDYRKAMKEFT  118



>dbj|BAC66950.1| ACC oxidase [Striga hermonthica]
Length=318

 Score =   206 bits (525),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 93/118 (79%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            MA+FP+IN+A+LN E RPA M QI+DAC+NWGFFE+V+HGIS E MD VE+LTK+HYKKC
Sbjct  1    MATFPVINMAKLNGEGRPATMAQIEDACQNWGFFEVVNHGISAEFMDRVERLTKEHYKKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            MEQRFKEMVAAKGL+AVQ+EINDLDWESTFFL+HLP SNISEIPDL   YR+VMKEFA
Sbjct  61   MEQRFKEMVAAKGLEAVQSEINDLDWESTFFLRHLPSSNISEIPDLHPEYREVMKEFA  118



>ref|NP_001234638.1| 1-aminocyclopropane-1-carboxylate oxidase [Solanum lycopersicum]
 gb|ABP68407.1| 1-aminocyclopropane-1-carboxylate oxidase [Solanum lycopersicum]
Length=319

 Score =   206 bits (524),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 92/118 (78%), Positives = 109/118 (92%), Gaps = 0/118 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FP++N+  LNTE+R A +E+IKDACENWGFFE+++HGIS EL+DTVEK TK+HYKKC
Sbjct  1    METFPVVNMEMLNTEKRAAALEKIKDACENWGFFEVINHGISHELLDTVEKFTKEHYKKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            MEQRFKEMVA+KGL+ VQTEI+DLDWESTFFLKHLPVSNISE+PDLED YRK+MKEFA
Sbjct  61   MEQRFKEMVASKGLEGVQTEIDDLDWESTFFLKHLPVSNISEVPDLEDDYRKIMKEFA  118



>ref|XP_011096014.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase [Sesamum 
indicum]
Length=317

 Score =   205 bits (521),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 91/118 (77%), Positives = 109/118 (92%), Gaps = 0/118 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            MA+FP++N+ +LN EER A M  IKDACENWGFFEL++HGI+ E +DTVE+LTK+HY+KC
Sbjct  1    MATFPVVNMEKLNGEERTATMAVIKDACENWGFFELLNHGIAPEFLDTVERLTKEHYRKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            MEQRFKEMVA+KGL+AVQ+EINDLDWESTFFL+HLPVSNISEIPDL++ YRKVMKEFA
Sbjct  61   MEQRFKEMVASKGLEAVQSEINDLDWESTFFLRHLPVSNISEIPDLDEEYRKVMKEFA  118



>ref|XP_008224728.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 1 [Prunus 
mume]
Length=318

 Score =   205 bits (521),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 93/119 (78%), Positives = 112/119 (94%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FP+++L+Q+N E+R A ME+I DACENWGFFELV+HGIS ELMDTVEKLTK+HYKKC
Sbjct  1    MEAFPVVDLSQINGEKREATMEKINDACENWGFFELVNHGISHELMDTVEKLTKEHYKKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            MEQRFKEMVA+KGL+AVQ+EI+DLDWESTFFL+HLPVSNIS+IPDL++ YRKVMKEFA+
Sbjct  61   MEQRFKEMVASKGLEAVQSEIHDLDWESTFFLRHLPVSNISQIPDLDEDYRKVMKEFAV  119



>sp|P31239.1|ACCO_PEA RecName: Full=1-aminocyclopropane-1-carboxylate oxidase; Short=ACC 
oxidase; AltName: Full=Ethylene-forming enzyme; Short=EFE 
[Pisum sativum]
 gb|AAA33644.1| 1-aminocyclopropane-1-carboxylate oxidase [Pisum sativum]
Length=317

 Score =   205 bits (521),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 93/118 (79%), Positives = 109/118 (92%), Gaps = 0/118 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FPI+++ +LNTE+R + ME IKDACENWGFFE V+HGISIE+MDTVEKLTK+HYKKC
Sbjct  1    MENFPIVDMGKLNTEDRKSTMELIKDACENWGFFECVNHGISIEMMDTVEKLTKEHYKKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            MEQRFKEMVA KGL+ VQ+EI+DLDWESTFFL+HLPVS+ISEIPDL+D YRKVMKEFA
Sbjct  61   MEQRFKEMVATKGLECVQSEIDDLDWESTFFLRHLPVSSISEIPDLDDDYRKVMKEFA  118



>gb|ABF61805.1| 1-aminocyclopropane-1-carboxylate oxidase [Medicago sativa]
Length=317

 Score =   204 bits (520),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 93/118 (79%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FP++++ +LNTEER A ME IKDACENWGFFE V+HGISIELMD VEKLTK+HYKKC
Sbjct  1    MENFPVVDMGKLNTEERKATMEMIKDACENWGFFECVNHGISIELMDKVEKLTKEHYKKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            MEQRFKEMVA+KGL+ VQ+EINDLDWESTFFL+HLP SNISEIPDL++ YRK MKEFA
Sbjct  61   MEQRFKEMVASKGLECVQSEINDLDWESTFFLRHLPSSNISEIPDLDEDYRKTMKEFA  118



>gb|KJB57824.1| hypothetical protein B456_009G182300 [Gossypium raimondii]
Length=238

 Score =   202 bits (513),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 92/117 (79%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = +3

Query  87   SFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKCME  266
            +FP+I+ ++LN EER A ME IKDACENWGFFELV+HGIS ELMDTVE+LTK+HY+KCME
Sbjct  4    TFPVIDFSKLNGEERAAAMEMIKDACENWGFFELVNHGISHELMDTVERLTKEHYRKCME  63

Query  267  QRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            QRFKEMVA+KGL+AVQ+EIND+DWESTFFL+HLP SN+SEIPDLE+ YRKVMKEFA+
Sbjct  64   QRFKEMVASKGLEAVQSEINDMDWESTFFLRHLPESNMSEIPDLEEDYRKVMKEFAV  120



>emb|CAI64500.1| 1-aminocyclopropane-1-carboxylate oxidase 2, partial [Prunus 
domestica subsp. syriaca]
Length=304

 Score =   204 bits (518),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 93/119 (78%), Positives = 111/119 (93%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FP+++L+Q+N E+R A ME+I DACENWGFFELV+HGIS ELMDTVEKLTK+HYKKC
Sbjct  1    METFPVVDLSQINGEKRGAAMEKINDACENWGFFELVNHGISHELMDTVEKLTKEHYKKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            MEQRFKEMVA KGL+AVQ+EI+DLDWESTFFL+HLPVSNIS+IPDL++ YRKVMKEFA+
Sbjct  61   MEQRFKEMVANKGLEAVQSEIHDLDWESTFFLRHLPVSNISQIPDLDEDYRKVMKEFAV  119



>gb|ACU23036.1| unknown [Glycine max]
Length=202

 Score =   200 bits (509),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 90/119 (76%), Positives = 109/119 (92%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            MA+FP++++ +LNTEERPA ME IKDACENWGFFELV+HGISIELMDTVEKLTK+HYKK 
Sbjct  1    MANFPVVDVGKLNTEERPAAMEIIKDACENWGFFELVNHGISIELMDTVEKLTKEHYKKT  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            MEQRFKEMV +KGL++VQ+EINDLDWESTFFL+HLP+SN+S+  DL+  YRK MK+FA+
Sbjct  61   MEQRFKEMVTSKGLESVQSEINDLDWESTFFLRHLPLSNVSDNADLDQDYRKTMKKFAL  119



>ref|XP_011086213.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase-like [Sesamum 
indicum]
Length=317

 Score =   204 bits (518),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 91/118 (77%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            MA+FP+IN+ +LN E R A ME IKDACENWGFFE+V+HGI+ E MDTVEKLTK+HY+KC
Sbjct  1    MATFPVINMEKLNGEGRAATMEMIKDACENWGFFEVVNHGIAPEFMDTVEKLTKEHYRKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            MEQRFKEMVA KGL+AVQ+EINDLDWESTFFL+HLPVSN+S++PDLE  YR+VMKEFA
Sbjct  61   MEQRFKEMVAKKGLEAVQSEINDLDWESTFFLRHLPVSNMSQVPDLEAEYRRVMKEFA  118



>ref|XP_010110622.1| 1-aminocyclopropane-1-carboxylate oxidase 3 [Morus notabilis]
 gb|EXC27244.1| 1-aminocyclopropane-1-carboxylate oxidase 3 [Morus notabilis]
Length=319

 Score =   204 bits (518),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 92/118 (78%), Positives = 106/118 (90%), Gaps = 0/118 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FPIINL +LN EER   MEQIKDACENWGFFELV+H I  E +DTVEK+TKDHY+KC
Sbjct  1    MENFPIINLEKLNGEERKTTMEQIKDACENWGFFELVNHSIPHEFLDTVEKMTKDHYRKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            MEQRFKE+VA+KGL+AVQ E+ND+DWESTFFL+HLPVSNISEIPDL+D YRKVM+EFA
Sbjct  61   MEQRFKELVASKGLEAVQAEVNDMDWESTFFLRHLPVSNISEIPDLDDEYRKVMREFA  118



>ref|XP_009791489.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase-like [Nicotiana 
sylvestris]
Length=320

 Score =   204 bits (518),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 95/118 (81%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FP+I++  LNTE+R A ME+IKDACENWGF ELV+HGIS ELMDTVEKLTK+HYKKC
Sbjct  1    METFPVIDMEMLNTEQRAATMEKIKDACENWGFLELVNHGISHELMDTVEKLTKEHYKKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            MEQRFKEMVA KGL+AVQ EI+DLDWESTFFLKHLPVSNIS++PDL D YRKVMKEFA
Sbjct  61   MEQRFKEMVANKGLEAVQAEIDDLDWESTFFLKHLPVSNISDVPDLVDDYRKVMKEFA  118



>emb|CAH18930.1| 1-aminocyclopropane-1-carboxylate oxidase [Pyrus communis]
Length=314

 Score =   204 bits (518),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 92/119 (77%), Positives = 109/119 (92%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            MA+FP+++L+ +N EER A +E+I DACENWGFFELV+HGIS EL+DTVEK+TKDHYKK 
Sbjct  1    MATFPVVDLSLVNGEERVATLEKINDACENWGFFELVNHGISTELLDTVEKMTKDHYKKT  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            MEQRFKEMVAAKGLDAVQ+EI+DLDWESTFFL+HLP SNISE+PDLE+ YRK MKEFA+
Sbjct  61   MEQRFKEMVAAKGLDAVQSEIHDLDWESTFFLRHLPSSNISEVPDLEEDYRKTMKEFAV  119



>emb|CAJ56065.1| ACC oxidase [Vigna radiata]
Length=317

 Score =   204 bits (518),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 93/118 (79%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            MASFP++++ +LNTEER A ME IKDACENWGFFELV+HGISIELMDTVEKLTK+HYKK 
Sbjct  1    MASFPVVDMGKLNTEERGAAMEMIKDACENWGFFELVNHGISIELMDTVEKLTKEHYKKT  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            MEQRFKEMVA KGL++VQ+EINDLDWESTFFL+HLPVSN+SE  DL+  YRK+MK+FA
Sbjct  61   MEQRFKEMVANKGLESVQSEINDLDWESTFFLRHLPVSNVSENTDLDQDYRKIMKQFA  118



>ref|XP_003594162.1| 1-aminocyclopropane-1-carboxylate oxidase [Medicago truncatula]
 gb|AES64413.1| 1-aminocyclopropane-1-carboxylate oxidase [Medicago truncatula]
Length=225

 Score =   201 bits (510),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 92/118 (78%), Positives = 106/118 (90%), Gaps = 0/118 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FP++++ +LNTEER A ME IKDACENWGFFE V+H ISIELMD VEKLTK+HYKKC
Sbjct  1    MENFPVVDMGKLNTEERKATMEMIKDACENWGFFECVNHSISIELMDKVEKLTKEHYKKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            MEQRFKEMVA+KGL+ VQ+EINDLDWESTFFL+HLP SNISEIPDL++ YRK MKEFA
Sbjct  61   MEQRFKEMVASKGLECVQSEINDLDWESTFFLRHLPSSNISEIPDLDEDYRKTMKEFA  118



>dbj|BAD06178.1| ACC oxidase [Pisum sativum var. macrocarpon]
Length=323

 Score =   204 bits (518),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 93/118 (79%), Positives = 109/118 (92%), Gaps = 0/118 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FPI+++ +LNTE+R + ME IKDACENWGFFE V+HGISIE+MDTVEKLTK+HYKKC
Sbjct  1    MENFPIVDMGKLNTEDRKSTMELIKDACENWGFFECVNHGISIEMMDTVEKLTKEHYKKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            MEQRFKEMVA KGL+ VQ+EI+DLDWESTFFL+HLPVS+ISEIPDL+D YRKVMKEFA
Sbjct  61   MEQRFKEMVATKGLECVQSEIDDLDWESTFFLRHLPVSSISEIPDLDDDYRKVMKEFA  118



>gb|KJB57823.1| hypothetical protein B456_009G182300 [Gossypium raimondii]
Length=319

 Score =   203 bits (517),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 92/117 (79%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = +3

Query  87   SFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKCME  266
            +FP+I+ ++LN EER A ME IKDACENWGFFELV+HGIS ELMDTVE+LTK+HY+KCME
Sbjct  4    TFPVIDFSKLNGEERAAAMEMIKDACENWGFFELVNHGISHELMDTVERLTKEHYRKCME  63

Query  267  QRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            QRFKEMVA+KGL+AVQ+EIND+DWESTFFL+HLP SN+SEIPDLE+ YRKVMKEFA+
Sbjct  64   QRFKEMVASKGLEAVQSEINDMDWESTFFLRHLPESNMSEIPDLEEDYRKVMKEFAV  120



>ref|XP_007211643.1| hypothetical protein PRUPE_ppa008813mg [Prunus persica]
 gb|EMJ12842.1| hypothetical protein PRUPE_ppa008813mg [Prunus persica]
Length=318

 Score =   203 bits (517),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 92/119 (77%), Positives = 112/119 (94%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FP+++L+Q+N E+R A ME++ DACENWGFFELV+HGIS ELMDTVEKLTK+HYKKC
Sbjct  1    METFPVVDLSQINGEKREATMEKMNDACENWGFFELVNHGISHELMDTVEKLTKEHYKKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            MEQRFKEMVA+KGL+AVQ+EI+DLDWESTFFL+HLPVSNIS+IPDL++ YRKVMKEFA+
Sbjct  61   MEQRFKEMVASKGLEAVQSEIHDLDWESTFFLRHLPVSNISQIPDLDEDYRKVMKEFAV  119



>gb|AAZ83342.1| ACC oxidase 1 [Gossypium hirsutum]
Length=319

 Score =   203 bits (517),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 92/117 (79%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = +3

Query  87   SFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKCME  266
            +FP+I+ ++LN EER A ME IKDACENWGFFELV+HGIS ELMDTVE+LTK+HY+KCME
Sbjct  4    TFPVIDFSKLNGEERAAAMEMIKDACENWGFFELVNHGISHELMDTVERLTKEHYRKCME  63

Query  267  QRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            QRFKEMVA+KGL+AVQ+EIND+DWESTFFL+HLP SN+SEIPDLE+ YRKVMKEFA+
Sbjct  64   QRFKEMVASKGLEAVQSEINDMDWESTFFLRHLPESNMSEIPDLEEDYRKVMKEFAV  120



>ref|NP_001289250.1| 1-aminocyclopropane-1-carboxylate oxidase 1 [Pyrus x bretschneideri]
 dbj|BAA76387.1| ACC oxidase [Pyrus pyrifolia]
 gb|ABO38176.1| ACC oxidase [Pyrus pyrifolia]
 gb|ABY51681.2| 1-aminocyclopropane-1-carboxylate oxidase [Pyrus x bretschneideri]
 gb|ACJ12491.1| 1-aminocyclopropane-1-carboxylate [Pyrus x bretschneideri]
 gb|AFA46526.1| ACC oxidase [Pyrus pyrifolia]
Length=314

 Score =   203 bits (517),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 92/119 (77%), Positives = 109/119 (92%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            MA+FP+++L+ +N EER A +E+I DACENWGFFELV+HGIS EL+DTVEK+TKDHYKK 
Sbjct  1    MATFPVVDLSLVNGEERVATLEKINDACENWGFFELVNHGISTELLDTVEKMTKDHYKKT  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            MEQRFKEMVAAKGLDAVQ+EI+DLDWESTFFL+HLP SNISE+PDLE+ YRK MKEFA+
Sbjct  61   MEQRFKEMVAAKGLDAVQSEIHDLDWESTFFLRHLPSSNISEVPDLEEDYRKTMKEFAV  119



>gb|AGF95124.1| 1-aminocyclopropane-1-carboxylate oxidase, partial [Prunus persica]
Length=335

 Score =   203 bits (517),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = +3

Query  66   ERQRKMASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKD  245
            +R+R+M +FPIINL  LN E R A ME+IKDACENWGFFELV HGI  E +DTVE+LTK+
Sbjct  12   KREREMENFPIINLEGLNGEGRKATMEKIKDACENWGFFELVSHGIPTEFLDTVERLTKE  71

Query  246  HYKKCMEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMK  425
            HY++C+EQRFKE+VA+KGL+AV+TE+ND+DWESTF+L+HLP SNISE+PDLED YR VMK
Sbjct  72   HYRQCLEQRFKELVASKGLEAVKTEVNDMDWESTFYLRHLPKSNISEVPDLEDQYRNVMK  131

Query  426  EFAM  437
            EFA+
Sbjct  132  EFAL  135



>gb|AEM62877.1| ACC oxidase 1 [Actinidia chinensis]
 gb|AEY77404.1| ACC oxidase-like protein [Actinidia deliciosa]
Length=319

 Score =   202 bits (515),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 93/118 (79%), Positives = 106/118 (90%), Gaps = 0/118 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FP+I++ +LN EER   ME+IKDACENWGFFELV+HGIS ELMDTVE+LTK+HY KC
Sbjct  1    MEAFPVIDMEKLNGEERAPTMEKIKDACENWGFFELVNHGISHELMDTVERLTKEHYNKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            MEQRFKEMVA KGL+AVQ+EINDLDWESTFFL+HLPVSNISEIPDLE  +RK MKEFA
Sbjct  61   MEQRFKEMVATKGLEAVQSEINDLDWESTFFLRHLPVSNISEIPDLEQDHRKAMKEFA  118



>emb|CAJ56064.1| ACC oxidase [Vigna radiata]
Length=317

 Score =   202 bits (514),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 92/118 (78%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            MA+FP++++ +LNTEER A ME IKDACENWGFFELV+HGISIELMDTVEKLTK+HYKK 
Sbjct  1    MANFPVVDMGKLNTEERGAAMEMIKDACENWGFFELVNHGISIELMDTVEKLTKEHYKKT  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            MEQRFKEMVA KGL++VQ+EINDLDWESTFFL+HLPVSN+SE  DL+  YRK+MK+FA
Sbjct  61   MEQRFKEMVANKGLESVQSEINDLDWESTFFLRHLPVSNVSENTDLDQDYRKIMKQFA  118



>sp|P31237.1|ACCO_ACTDE RecName: Full=1-aminocyclopropane-1-carboxylate oxidase; Short=ACC 
oxidase; AltName: Full=Ethylene-forming enzyme; Short=EFE 
[Actinidia deliciosa]
 gb|AAA18566.1| tomato and apple ACC oxidase homologue [Actinidia deliciosa]
Length=319

 Score =   202 bits (514),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 93/118 (79%), Positives = 106/118 (90%), Gaps = 0/118 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FP+I++ +LN EER   ME+IKDACENWGFFELV+HGIS ELMDTVE+LTK+HY KC
Sbjct  1    MEAFPVIDMEKLNGEERAPTMEKIKDACENWGFFELVNHGISHELMDTVERLTKEHYNKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            MEQRFKEMVA KGL+AVQ+EINDLDWESTFFL+HLPVSNISEIPDLE  +RK MKEFA
Sbjct  61   MEQRFKEMVATKGLEAVQSEINDLDWESTFFLRHLPVSNISEIPDLEQDHRKAMKEFA  118



>emb|CAJ56066.1| ACC oxidase [Vigna radiata]
Length=317

 Score =   202 bits (514),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 92/118 (78%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            MA+FP++++ +LNTEER A ME IKDACENWGFFELV+HGISIELMDTVEKLTK+HYKK 
Sbjct  1    MANFPVVDMGKLNTEERGAAMEMIKDACENWGFFELVNHGISIELMDTVEKLTKEHYKKT  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            MEQRFKEMVA KGL++VQ+EINDLDWESTFFL+HLPVSN+SE  DL+  YRK+MK+FA
Sbjct  61   MEQRFKEMVANKGLESVQSEINDLDWESTFFLRHLPVSNVSENTDLDQDYRKIMKQFA  118



>ref|XP_003594161.1| 1-aminocyclopropane-1-carboxylate oxidase [Medicago truncatula]
 gb|ABD32649.1| 2OG-Fe(II) oxygenase [Medicago truncatula]
 gb|AES64412.1| 1-aminocyclopropane-1-carboxylate oxidase [Medicago truncatula]
 gb|AFK40757.1| unknown [Medicago truncatula]
Length=317

 Score =   202 bits (514),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 92/118 (78%), Positives = 106/118 (90%), Gaps = 0/118 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FP++++ +LNTEER A ME IKDACENWGFFE V+H ISIELMD VEKLTK+HYKKC
Sbjct  1    MENFPVVDMGKLNTEERKATMEMIKDACENWGFFECVNHSISIELMDKVEKLTKEHYKKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            MEQRFKEMVA+KGL+ VQ+EINDLDWESTFFL+HLP SNISEIPDL++ YRK MKEFA
Sbjct  61   MEQRFKEMVASKGLECVQSEINDLDWESTFFLRHLPSSNISEIPDLDEDYRKTMKEFA  118



>ref|XP_003529653.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase-like [Glycine 
max]
 gb|KHN28772.1| 1-aminocyclopropane-1-carboxylate oxidase [Glycine soja]
Length=318

 Score =   202 bits (513),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 90/117 (77%), Positives = 106/117 (91%), Gaps = 0/117 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M  FP++++  LN EER A ME IKDACENWGFFELV+HGISIELMDTVE++TK+HYKKC
Sbjct  1    MEKFPVVDMGNLNNEERSATMEIIKDACENWGFFELVNHGISIELMDTVERMTKEHYKKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEF  431
            MEQRFKEMVA+KGL++ Q+EINDLDWESTFFL+HLP SNISEIPDL++ YRKVMK+F
Sbjct  61   MEQRFKEMVASKGLESAQSEINDLDWESTFFLRHLPASNISEIPDLDEDYRKVMKDF  117



>gb|AFK48521.1| unknown [Lotus japonicus]
Length=309

 Score =   201 bits (512),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 90/119 (76%), Positives = 108/119 (91%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FP++++ +LNTEE+   ME IKDACENWGFFELV+HGIS+ELMDTVE+L K+HYKK 
Sbjct  1    MENFPVVDMGKLNTEEKAGTMEIIKDACENWGFFELVNHGISLELMDTVERLAKEHYKKR  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            MEQRFKEMVA+KGL++ Q+EINDLDWESTFFL+HLPVSNISEIPDL+D YRK MKEFA+
Sbjct  61   MEQRFKEMVASKGLESAQSEINDLDWESTFFLRHLPVSNISEIPDLDDDYRKAMKEFAL  119



>gb|ACU24286.1| unknown [Glycine max]
Length=318

 Score =   202 bits (513),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 89/117 (76%), Positives = 106/117 (91%), Gaps = 0/117 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M  FP++++  LN EER A ME IKDACENWGFFELV+HG+SIELMDTVE++TK+HYKKC
Sbjct  1    MEKFPVVDMGNLNNEERSATMEIIKDACENWGFFELVNHGVSIELMDTVERMTKEHYKKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEF  431
            MEQRFKEMVA+KGL++ Q+EINDLDWESTFFL+HLP SNISEIPDL++ YRKVMK+F
Sbjct  61   MEQRFKEMVASKGLESAQSEINDLDWESTFFLRHLPASNISEIPDLDEDYRKVMKDF  117



>gb|KDO78385.1| hypothetical protein CISIN_1g018920mg [Citrus sinensis]
Length=225

 Score =   199 bits (505),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 89/119 (75%), Positives = 109/119 (92%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FPII+L++LN +ER A ME I DACENWGFFELV+HGIS EL+DTV++LTK+HY KC
Sbjct  1    MENFPIIDLSKLNGDERSATMEMINDACENWGFFELVNHGISHELLDTVQRLTKEHYGKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            M+QRFK+MVA+KGL+AVQ+E+NDLDWESTFFL+HLPVSN++EIPDLED YRK MKEFA+
Sbjct  61   MDQRFKQMVASKGLEAVQSEVNDLDWESTFFLRHLPVSNMAEIPDLEDDYRKAMKEFAV  119



>gb|AEM62885.1| ACC oxidase 6 [Actinidia chinensis]
Length=317

 Score =   201 bits (512),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 94/118 (80%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FP+I++ +LN EER A ME IKDACENWGFFEL++HGIS ELMDTVE LTK HYKKC
Sbjct  1    MEAFPVIDMEKLNGEERAASMEVIKDACENWGFFELMNHGISHELMDTVEMLTKGHYKKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            MEQRFKEMVA+KGL+AVQ+EI+DLDWESTFFL+HLPVSNISEIPDLE+ YRK MKEFA
Sbjct  61   MEQRFKEMVASKGLEAVQSEIDDLDWESTFFLRHLPVSNISEIPDLEEDYRKTMKEFA  118



>ref|XP_009593567.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase-like [Nicotiana 
tomentosiformis]
Length=321

 Score =   202 bits (513),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 93/118 (79%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FP++++  LNTE+R AIME++KDACENWGF ELV+HGIS ELMDTVEKLTK+HYKKC
Sbjct  1    METFPVVDMEMLNTEQRAAIMEKLKDACENWGFLELVNHGISHELMDTVEKLTKEHYKKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            MEQRFKEMVA KGL+AVQTEI+DLDWE TFFLKHLPVSNIS++PDL+  YRKVMKEFA
Sbjct  61   MEQRFKEMVANKGLEAVQTEIDDLDWEITFFLKHLPVSNISDVPDLDHDYRKVMKEFA  118



>ref|XP_004304079.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase [Fragaria 
vesca subsp. vesca]
Length=320

 Score =   201 bits (512),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 88/119 (74%), Positives = 107/119 (90%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FP+IN+ +LN EER A ME IKDACENWGFFELV+HGI+ E +DTVEK+TKDHYK C
Sbjct  1    MENFPVINMEKLNGEERKATMETIKDACENWGFFELVNHGIATEFLDTVEKMTKDHYKNC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            +EQRFKE+VA+KGL+AV TE+ND+DWESTF+LKHLP SNISE+PDL++ YRKVMKEFA+
Sbjct  61   LEQRFKELVASKGLNAVNTEVNDMDWESTFYLKHLPRSNISEVPDLDEEYRKVMKEFAL  119



>gb|AHL69752.1| aminocyclopropanecarboxylate oxidase [Picrorhiza kurrooa]
Length=318

 Score =   201 bits (512),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 91/118 (77%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            MA+FP++N+ +LN EER A ME IKDACENWGFFELV+HGI+ E MD VE+LTK+HYK+ 
Sbjct  1    MATFPVVNMEKLNGEERSATMEMIKDACENWGFFELVNHGIAPEFMDIVERLTKEHYKRA  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            MEQRFKEMV +KGL+AVQ+EI+DLDWESTFFL+HLPVSNISEIPDLE+ YRKVMKEFA
Sbjct  61   MEQRFKEMVESKGLEAVQSEIDDLDWESTFFLRHLPVSNISEIPDLEEEYRKVMKEFA  118



>ref|NP_001241899.1| 1-aminocyclopropane-1-carboxylate oxidase-like [Glycine max]
 gb|AEI54340.1| 1-aminocyclopropane-1-carboxylate oxidase [Glycine max]
Length=318

 Score =   201 bits (511),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 90/119 (76%), Positives = 110/119 (92%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            MA+FP++++ +LNTEER A ME IKDACENWGFFELV+HGISIELMDTVE+LTK+HYKK 
Sbjct  1    MANFPVVDMGKLNTEERAAAMEIIKDACENWGFFELVNHGISIELMDTVERLTKEHYKKT  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            MEQRFKEMVA+KGL++VQ+EINDLDWESTFFL+HLPVSN+S+  DL++ YRK MK+FA+
Sbjct  61   MEQRFKEMVASKGLESVQSEINDLDWESTFFLRHLPVSNVSDNSDLDEEYRKTMKKFAL  119



>ref|NP_001281047.1| 1-aminocyclopropane-1-carboxylate oxidase 1 [Malus domestica]
 gb|ABA03057.1| ACC oxidase [Malus domestica]
Length=313

 Score =   201 bits (511),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 91/119 (76%), Positives = 108/119 (91%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            MA+FP+++L+ +N EER A +E+I DACENWGFFELV+HG+S EL+DTVEK+TKDHYKK 
Sbjct  1    MATFPVVDLSLVNGEERAATLEKINDACENWGFFELVNHGMSTELLDTVEKMTKDHYKKT  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            MEQRFKEMVAAKGLD VQ+EI+DLDWESTFFL+HLP SNISEIPDLE+ YRK MKEFA+
Sbjct  61   MEQRFKEMVAAKGLDDVQSEIHDLDWESTFFLRHLPSSNISEIPDLEEEYRKTMKEFAV  119



>gb|KHG24528.1| 1-aminocyclopropane-1-carboxylate oxidase [Gossypium arboreum]
Length=288

 Score =   200 bits (509),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 90/117 (77%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = +3

Query  87   SFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKCME  266
            +FP+I+ ++LN EER A ME IKDACENWGFFELV+HGIS ELM+TVE+LTK+HY+KCME
Sbjct  4    TFPVIDFSKLNGEERAAAMEMIKDACENWGFFELVNHGISHELMETVERLTKEHYRKCME  63

Query  267  QRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            QRFKEMV +KGL+AVQ+EIND+DWESTFFL+HLP SN+SEIPDLE+ YRKVMKEFA+
Sbjct  64   QRFKEMVVSKGLEAVQSEINDMDWESTFFLRHLPESNMSEIPDLEEDYRKVMKEFAV  120



>ref|XP_003534723.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase [Glycine 
max]
 gb|KHN40848.1| 1-aminocyclopropane-1-carboxylate oxidase [Glycine soja]
Length=318

 Score =   201 bits (511),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 90/119 (76%), Positives = 109/119 (92%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            MA+FP++++ +LNTEERPA ME IKDACENWGFFELV+HGISIELMDTVEKLTK+HYKK 
Sbjct  1    MANFPVVDMGKLNTEERPAAMEIIKDACENWGFFELVNHGISIELMDTVEKLTKEHYKKT  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            MEQRFKEMV +KGL++VQ+EINDLDWESTFFL+HLP+SN+S+  DL+  YRK MK+FA+
Sbjct  61   MEQRFKEMVTSKGLESVQSEINDLDWESTFFLRHLPLSNVSDNADLDQDYRKTMKKFAL  119



>gb|AAF36484.1|AF129074_1 1-aminocyclopropane-1-carboxylate oxidase [Prunus persica]
Length=318

 Score =   201 bits (511),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 91/119 (76%), Positives = 111/119 (93%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FP+++L+Q+  E+R A ME++ DACENWGFFELV+HGIS ELMDTVEKLTK+HYKKC
Sbjct  1    METFPVVDLSQITGEKREAAMEKMNDACENWGFFELVNHGISHELMDTVEKLTKEHYKKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            MEQRFKEMVA+KGL+AVQ+EI+DLDWESTFFL+HLPVSNIS+IPDL++ YRKVMKEFA+
Sbjct  61   MEQRFKEMVASKGLEAVQSEIHDLDWESTFFLRHLPVSNISQIPDLDEDYRKVMKEFAV  119



>gb|AAC48977.1| 1-aminocyclopropane-1-carboxylate oxidase [Pelargonium x hortorum]
 prf||2104412A aminocyclopropane carboxylate oxidase
Length=318

 Score =   201 bits (511),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 89/118 (75%), Positives = 106/118 (90%), Gaps = 0/118 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M SFP+IN+ +LN EER A ME+IKDACENWGFFEL++HGI  EL+DTVEK+TK+HY+KC
Sbjct  1    MESFPVINMEKLNGEERAATMEKIKDACENWGFFELLNHGIPYELLDTVEKMTKEHYRKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            MEQRFKEMVA+KGL+ V+ E+ DLDWESTFFLKHLP SNIS++PDL+D YRKVMKEFA
Sbjct  61   MEQRFKEMVASKGLEGVEVEVEDLDWESTFFLKHLPESNISQVPDLQDEYRKVMKEFA  118



>sp|Q00985.1|ACCO1_MALDO RecName: Full=1-aminocyclopropane-1-carboxylate oxidase 1; Short=ACC 
oxidase 1; AltName: Full=Ethylene-forming enzyme; Short=EFE; 
AltName: Full=PAE12; AltName: Full=Protein AP4 [Malus 
domestica]
 emb|CAA43662.1| ethylene related [Malus domestica]
 gb|AAA33412.1| ripening-related protein [Malus sylvestris]
 emb|CAA74328.1| ACC oxidase [Malus domestica]
 gb|AAC36461.1| ACC oxidase [Malus domestica]
 gb|ABA03055.1| ACC oxidase [Malus domestica]
 prf||1905416A aminocyclopropane carboxylate oxidase
Length=314

 Score =   201 bits (511),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 91/119 (76%), Positives = 108/119 (91%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            MA+FP+++L+ +N EER A +E+I DACENWGFFELV+HG+S EL+DTVEK+TKDHYKK 
Sbjct  1    MATFPVVDLSLVNGEERAATLEKINDACENWGFFELVNHGMSTELLDTVEKMTKDHYKKT  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            MEQRFKEMVAAKGLD VQ+EI+DLDWESTFFL+HLP SNISEIPDLE+ YRK MKEFA+
Sbjct  61   MEQRFKEMVAAKGLDDVQSEIHDLDWESTFFLRHLPSSNISEIPDLEEEYRKTMKEFAV  119



>ref|XP_008342143.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase [Malus domestica]
Length=322

 Score =   201 bits (511),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 88/119 (74%), Positives = 105/119 (88%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FP+INL  LN E R A ME+IKDACENWGFFELV HGI  E +DTVE+LTK+HY++C
Sbjct  1    MENFPVINLESLNGEGRKATMEKIKDACENWGFFELVSHGIPTEFLDTVERLTKEHYRQC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            MEQRFKE+VA+KGLDAVQTE+ND+DWESTF+L+HLP SNISE+PDL+D YR VMKEFA+
Sbjct  61   MEQRFKELVASKGLDAVQTEVNDMDWESTFYLRHLPQSNISEVPDLKDEYRNVMKEFAL  119



>gb|AFJ75398.1| 1-aminocyclopropane-1-carboxylic acid oxidase [Salvia miltiorrhiza]
 gb|AFJ75399.1| 1-aminocyclopropane-1-carboxylic acid oxidase [Salvia miltiorrhiza]
Length=314

 Score =   201 bits (510),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 89/118 (75%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            MASFP+I+L ++N EER A++ QIKDACENWGFFELV+HGI+ E MD VEKLTK+HY+KC
Sbjct  1    MASFPVISLEKINGEERAAVLAQIKDACENWGFFELVNHGIAPEFMDKVEKLTKEHYRKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            MEQRF EMVA+KGL+AVQ+EI+DLDWESTFFL+HLP+SNISEIPDL+  YR+VM+EFA
Sbjct  61   MEQRFNEMVASKGLEAVQSEIDDLDWESTFFLRHLPISNISEIPDLDQEYREVMREFA  118



>ref|XP_007153995.1| hypothetical protein PHAVU_003G082300g [Phaseolus vulgaris]
 gb|ESW25989.1| hypothetical protein PHAVU_003G082300g [Phaseolus vulgaris]
Length=318

 Score =   201 bits (510),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 88/119 (74%), Positives = 109/119 (92%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FP++++  LN EER A ME+IKDACENWGFFELV+HGIS+ELMD+VE+LTK+HY+ C
Sbjct  1    MENFPVVDMGNLNNEERGATMEKIKDACENWGFFELVNHGISLELMDSVERLTKEHYRTC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            MEQRFKEMVA+KGL++ Q+EINDLDWESTFFL+HLPVSNISEIPDL + +RKVMK+FA+
Sbjct  61   MEQRFKEMVASKGLESAQSEINDLDWESTFFLRHLPVSNISEIPDLGEDHRKVMKDFAV  119



>gb|KHN32985.1| 1-aminocyclopropane-1-carboxylate oxidase [Glycine soja]
Length=318

 Score =   201 bits (510),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 90/119 (76%), Positives = 110/119 (92%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            MA+FP++++ +LNTEER A ME IKDACENWGFFELV+HGISIELMDTVE+LTK+HYKK 
Sbjct  1    MANFPVVDMGKLNTEERAAAMEIIKDACENWGFFELVNHGISIELMDTVERLTKEHYKKT  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            MEQRFKEMVA+KGL++VQ+EINDLDWESTFFL+HLPVSN+S+  DL++ YRK MK+FA+
Sbjct  61   MEQRFKEMVASKGLESVQSEINDLDWESTFFLRHLPVSNVSDNSDLDEEYRKTMKKFAL  119



>emb|CAA67216.1| ACC oxidase [Malus domestica]
 emb|CAA04895.1| ACC oxidase [Malus domestica]
Length=314

 Score =   201 bits (510),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 91/119 (76%), Positives = 108/119 (91%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            MA+FP+++L+ +N EER A +E+I DACENWGFFELV+HG+S EL+DTVEK+TKDHYKK 
Sbjct  1    MATFPVVDLSLVNGEERAATLEKINDACENWGFFELVNHGMSTELLDTVEKMTKDHYKKT  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            MEQRFKEMVAAKGLD VQ+EI+DLDWESTFFL+HLP SNISEIPDLE+ YRK MKEFA+
Sbjct  61   MEQRFKEMVAAKGLDDVQSEIHDLDWESTFFLRHLPSSNISEIPDLEEDYRKTMKEFAV  119



>gb|AEM62881.1| ACC oxidase 4 [Actinidia chinensis]
Length=317

 Score =   201 bits (510),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 95/118 (81%), Positives = 105/118 (89%), Gaps = 0/118 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FPII++ +LN EER A ME IKDACENWGFFEL++HGIS ELMDTVE LTK HYKKC
Sbjct  1    MEAFPIIDMEKLNGEERAATMEVIKDACENWGFFELMNHGISHELMDTVEMLTKGHYKKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            MEQRFKEMVA KGL+AVQ+EINDLDWESTFFL+HLPVSNI EIPDLE+ YRK MKEFA
Sbjct  61   MEQRFKEMVANKGLEAVQSEINDLDWESTFFLRHLPVSNIFEIPDLEEDYRKTMKEFA  118



>gb|AEM62882.1| ACC oxidase 4 [Actinidia deliciosa]
Length=317

 Score =   201 bits (510),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 95/118 (81%), Positives = 105/118 (89%), Gaps = 0/118 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FPII++ +LN EER A ME IKDACENWGFFEL++HGIS ELMDTVE LTK HYKKC
Sbjct  1    MEAFPIIDMEKLNGEERAATMEVIKDACENWGFFELMNHGISHELMDTVEMLTKGHYKKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            MEQRFKEMVA KGL+AVQ+EINDLDWESTFFL+HLPVSNI EIPDLE+ YRK MKEFA
Sbjct  61   MEQRFKEMVANKGLEAVQSEINDLDWESTFFLRHLPVSNIFEIPDLEEDYRKTMKEFA  118



>gb|AAK07883.1|AF315316_1 ACC oxidase [Vigna radiata]
 gb|AAC48921.1| 1-aminocylopropane-1-carboxylate oxidase homolog [Vigna radiata]
 prf||2102361A aminocyclopropane carboxylate oxidase
Length=317

 Score =   201 bits (510),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 91/118 (77%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            MA+FP++++ +LNTEER   ME IKDACENWGFFELV+HGISIELMDTVEKLTK+HYKK 
Sbjct  1    MANFPVVDMGKLNTEERGTAMEMIKDACENWGFFELVNHGISIELMDTVEKLTKEHYKKT  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            MEQRFKEMVA KGL++VQ+EINDLDWESTFFL+HLPVSN+SE  DL+  YRK+MK+FA
Sbjct  61   MEQRFKEMVANKGLESVQSEINDLDWESTFFLRHLPVSNVSENTDLDQDYRKIMKQFA  118



>gb|KHG24527.1| 1-aminocyclopropane-1-carboxylate oxidase [Gossypium arboreum]
Length=302

 Score =   200 bits (509),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 90/117 (77%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = +3

Query  87   SFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKCME  266
            +FP+I+ ++LN EER A ME IKDACENWGFFELV+HGIS ELM+TVE+LTK+HY+KCME
Sbjct  4    TFPVIDFSKLNGEERAAAMEMIKDACENWGFFELVNHGISHELMETVERLTKEHYRKCME  63

Query  267  QRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            QRFKEMV +KGL+AVQ+EIND+DWESTFFL+HLP SN+SEIPDLE+ YRKVMKEFA+
Sbjct  64   QRFKEMVVSKGLEAVQSEINDMDWESTFFLRHLPESNMSEIPDLEEDYRKVMKEFAV  120



>gb|ABK59094.1| 1-amino-cyclopropane-1-carboxylic acid oxidase 3 [Manihot esculenta]
Length=312

 Score =   200 bits (509),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 90/118 (76%), Positives = 109/118 (92%), Gaps = 0/118 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FP+I+L++L+ EER   ME I+DACENWGFFELV+HGIS ELMDTVE+LTK+HYKKC
Sbjct  1    METFPVIDLSKLSGEERKPTMEMIQDACENWGFFELVNHGISHELMDTVERLTKEHYKKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            MEQRFKEMVA+KGL+AVQ+EI+DLDWESTFFL+HLPVSN++EIPDL++ YRK MKEFA
Sbjct  61   MEQRFKEMVASKGLEAVQSEISDLDWESTFFLRHLPVSNMAEIPDLDEEYRKTMKEFA  118



>ref|XP_011000640.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase [Populus 
euphratica]
 ref|XP_011014997.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase [Populus 
euphratica]
 ref|XP_011014999.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase [Populus 
euphratica]
Length=318

 Score =   201 bits (510),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 90/119 (76%), Positives = 111/119 (93%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M SFP+I+L++LN EER   ME+I+DACENWGFFELV+HGIS +L+DTVE+LTK+HY+KC
Sbjct  1    MESFPVIDLSKLNGEERKPTMEKIEDACENWGFFELVNHGISHDLLDTVERLTKEHYRKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            MEQRFKEMVA+KGL+AVQ+EI+DLDWESTFFL+HLP SN++EIPDLE+ YRKVMKEFA+
Sbjct  61   MEQRFKEMVASKGLEAVQSEISDLDWESTFFLRHLPESNMAEIPDLEEDYRKVMKEFAL  119



>gb|ABW91146.1| ACC oxidase 1 [Ziziphus jujuba]
Length=319

 Score =   200 bits (509),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 88/119 (74%), Positives = 106/119 (89%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FP+INL  LN E R A MEQI+DACENWGFFELV+HGI+ E MD +E++TK+HY+KC
Sbjct  1    MENFPVINLENLNGEGRKATMEQIRDACENWGFFELVNHGIAPEFMDKIERMTKEHYRKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            MEQRFKE+VA+KGL+AVQTE++D+DWESTFFL+HLPVSNISEIPDL D YRK MKEFA+
Sbjct  61   MEQRFKELVASKGLEAVQTEVSDMDWESTFFLRHLPVSNISEIPDLHDDYRKAMKEFAL  119



>gb|AEP19803.1| ACC oxidase 1 [Ziziphus jujuba]
Length=319

 Score =   200 bits (509),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 88/119 (74%), Positives = 106/119 (89%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FP+INL  LN E R A MEQI+DACENWGFFELV+HGI+ E MD +E++TK+HY+KC
Sbjct  1    MENFPVINLENLNGEGRKATMEQIRDACENWGFFELVNHGIAPEFMDKIERMTKEHYRKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            MEQRFKE+VA+KGL+AVQTE++D+DWESTFFL+HLPVSNISEIPDL D YRK MKEFA+
Sbjct  61   MEQRFKELVASKGLEAVQTEVSDMDWESTFFLRHLPVSNISEIPDLHDDYRKAMKEFAL  119



>gb|AHA06004.1| 1-aminocyclopropane-1-carboxylate oxidase [Lupinus luteus]
Length=317

 Score =   200 bits (509),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 91/118 (77%), Positives = 106/118 (90%), Gaps = 0/118 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FPI+++ +LNTEER   M+ IKDACENWGFFELV+HGISIELMDTVE+LTK+HYKKC
Sbjct  1    MENFPIVDIGKLNTEERVPTMDIIKDACENWGFFELVNHGISIELMDTVERLTKEHYKKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            MEQRF EMV +K L++VQ+EI DLDWESTFFL+HLPVSNISE PDL+D YRKVMKEFA
Sbjct  61   MEQRFNEMVTSKSLESVQSEIKDLDWESTFFLRHLPVSNISETPDLDDDYRKVMKEFA  118



>emb|CAJ56067.1| ACC oxidase [Vigna radiata]
Length=317

 Score =   200 bits (508),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 90/118 (76%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            MA+FP++++ +LNTEER A ME IKDACENWGFFELV+HGISIELMDTVE+LTK+HYKK 
Sbjct  1    MANFPVVDMGKLNTEERGAAMEMIKDACENWGFFELVNHGISIELMDTVERLTKEHYKKT  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            MEQRFKEMVA KGL++VQ+EINDLDW+STFFL+HLPVSN+SE  DL+  YRK+MK+FA
Sbjct  61   MEQRFKEMVANKGLESVQSEINDLDWDSTFFLRHLPVSNVSENTDLDQDYRKIMKQFA  118



>ref|XP_006449820.1| hypothetical protein CICLE_v10015965mg [Citrus clementina]
 ref|XP_006467364.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase-like [Citrus 
sinensis]
 gb|ESR63060.1| hypothetical protein CICLE_v10015965mg [Citrus clementina]
 gb|KDO78384.1| hypothetical protein CISIN_1g018920mg [Citrus sinensis]
Length=318

 Score =   200 bits (508),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 89/119 (75%), Positives = 109/119 (92%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FPII+L++LN +ER A ME I DACENWGFFELV+HGIS EL+DTV++LTK+HY KC
Sbjct  1    MENFPIIDLSKLNGDERSATMEMINDACENWGFFELVNHGISHELLDTVQRLTKEHYGKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            M+QRFK+MVA+KGL+AVQ+E+NDLDWESTFFL+HLPVSN++EIPDLED YRK MKEFA+
Sbjct  61   MDQRFKQMVASKGLEAVQSEVNDLDWESTFFLRHLPVSNMAEIPDLEDDYRKAMKEFAV  119



>ref|XP_003549632.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase-like [Glycine 
max]
 gb|KHN03507.1| 1-aminocyclopropane-1-carboxylate oxidase [Glycine soja]
Length=319

 Score =   200 bits (508),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 110/120 (92%), Gaps = 1/120 (1%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELM-DTVEKLTKDHYKK  257
            M +FP++++  LN EER A ME IKDACENWGFFELV+HGISIELM DTVE++TK+HYKK
Sbjct  1    MENFPVVDMGNLNNEERSATMEIIKDACENWGFFELVNHGISIELMMDTVERMTKEHYKK  60

Query  258  CMEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            CMEQRF+EMVA+KGL++ Q+EINDLDWESTFFL+HLPVSNISEIPDL++ YRKVMK+FA+
Sbjct  61   CMEQRFQEMVASKGLESAQSEINDLDWESTFFLRHLPVSNISEIPDLDEDYRKVMKDFAV  120



>ref|XP_007026207.1| Ethylene-forming enzyme [Theobroma cacao]
 gb|EOY28829.1| Ethylene-forming enzyme [Theobroma cacao]
Length=319

 Score =   200 bits (508),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 91/118 (77%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = +3

Query  84   ASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKCM  263
             +FP+I+ ++L+ EER A ME IKDACENWGFFEL++HGIS EL+DTVE+LTK+HY+KCM
Sbjct  3    TTFPVIDFSKLDGEERGATMEMIKDACENWGFFELMNHGISHELLDTVERLTKEHYRKCM  62

Query  264  EQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            EQRFKEMVA+KGL+AVQ EINDLDWESTFFL+HLP SNISEIPDLE+ YRKVMKEFA+
Sbjct  63   EQRFKEMVASKGLEAVQFEINDLDWESTFFLRHLPESNISEIPDLEEEYRKVMKEFAV  120



>emb|CAH58646.1| aminocyclopropan-1-carboxylate oxidase [Plantago major]
Length=318

 Score =   200 bits (508),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 90/118 (76%), Positives = 105/118 (89%), Gaps = 0/118 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            MA+FP++N+  LN +ER + M+ IKDACENWGFFELV+HGI+ E MDTVEKLTKDHY++ 
Sbjct  1    MATFPVVNMENLNGDERSSTMDIIKDACENWGFFELVNHGIAPEFMDTVEKLTKDHYRRS  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            MEQRF EMVA KGL+AVQ+EI DLDWESTFFL+HLPVSNISEIPDL+D YRKVMKEFA
Sbjct  61   MEQRFNEMVANKGLEAVQSEIEDLDWESTFFLRHLPVSNISEIPDLQDEYRKVMKEFA  118



>ref|XP_006348170.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase-like [Solanum 
tuberosum]
Length=320

 Score =   200 bits (508),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 88/118 (75%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = +3

Query  84   ASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKCM  263
            ++FP++++  L TE+RP  M++IKDACENWGFFE+V+HGIS EL+DTVE LTK HYKKCM
Sbjct  3    SNFPVVDMGLLQTEKRPEAMDKIKDACENWGFFEVVNHGISHELLDTVENLTKGHYKKCM  62

Query  264  EQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            EQRFKEMVA+KGL+AVQTEI+DLDWESTFFLKHLPVSN+ E+PDL+D YRKVMK+FA+
Sbjct  63   EQRFKEMVASKGLEAVQTEIDDLDWESTFFLKHLPVSNVYEVPDLDDEYRKVMKDFAL  120



>sp|Q08507.1|ACCO3_PETHY RecName: Full=1-aminocyclopropane-1-carboxylate oxidase 3; Short=ACC 
oxidase 3; AltName: Full=Ethylene-forming enzyme; Short=EFE 
[Petunia x hybrida]
 gb|AAA33697.1| 1-aminocyclopropane-1-carboxylate oxidase [Petunia x hybrida]
Length=320

 Score =   199 bits (507),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 91/118 (77%), Positives = 105/118 (89%), Gaps = 0/118 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FPIINL +LN  ER A ME IKDACENWGFFELV+HGI  E+MDTVEKLTK HYKKC
Sbjct  1    MENFPIINLEKLNGSERDATMEMIKDACENWGFFELVNHGIPHEVMDTVEKLTKGHYKKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            MEQRFKE+VA+KGL+AVQ E+ DLDWESTFFL+HLPVSNISE+PDL+D YR+VM++FA
Sbjct  61   MEQRFKELVASKGLEAVQAEVTDLDWESTFFLRHLPVSNISEVPDLDDEYREVMRDFA  118



>gb|ACJ84384.1| unknown [Medicago truncatula]
Length=203

 Score =   196 bits (497),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 89/119 (75%), Positives = 105/119 (88%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FPIINL  LN +ER A ME+IKDACENWGFFELV+HGI  +LMDTVE+LTK+HY+KC
Sbjct  1    MDNFPIINLENLNGDERKATMEKIKDACENWGFFELVNHGIPHDLMDTVERLTKEHYRKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            MEQRFKE+V++KGL+AVQTE+ D+DWESTF L+HLP SNISEIPDL D YRK MKEFA+
Sbjct  61   MEQRFKELVSSKGLEAVQTEVKDMDWESTFHLRHLPESNISEIPDLSDEYRKSMKEFAL  119



>gb|ACU24032.1| unknown [Glycine max]
Length=318

 Score =   199 bits (506),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 89/119 (75%), Positives = 110/119 (92%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            MA+FP++++ +LNTEER A ME IKDACENWGFFELV+HGISIELMDTVE+LTK++YKK 
Sbjct  1    MANFPVVDMGKLNTEERAAAMEIIKDACENWGFFELVNHGISIELMDTVERLTKEYYKKT  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            MEQRFKEMVA+KGL++VQ+EINDLDWESTFFL+HLPVSN+S+  DL++ YRK MK+FA+
Sbjct  61   MEQRFKEMVASKGLESVQSEINDLDWESTFFLRHLPVSNVSDNSDLDEGYRKTMKKFAL  119



>gb|EYU27738.1| hypothetical protein MIMGU_mgv1a010275mg [Erythranthe guttata]
Length=317

 Score =   199 bits (506),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 90/118 (76%), Positives = 105/118 (89%), Gaps = 0/118 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            MA+FP++N+ +LN +ER A ME I+DAC NWGFFELV+HGIS E MD VEKLTK+HY+K 
Sbjct  1    MATFPVVNMEKLNGDERSATMELIEDACANWGFFELVNHGISPEFMDRVEKLTKEHYRKS  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            ME RFKEMVA+KGLDAVQ+EI DLDWESTFFL+HLP+SNISE+PDLED YRKVMKEFA
Sbjct  61   MEARFKEMVASKGLDAVQSEIEDLDWESTFFLRHLPISNISEVPDLEDEYRKVMKEFA  118



>gb|AAA99793.1| 1-aminocyclopropane-1-carboxylic acid oxidase [Nicotiana glutinosa]
Length=316

 Score =   199 bits (505),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 89/118 (75%), Positives = 105/118 (89%), Gaps = 0/118 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M SFP++N+  LN+E+R A ME IKDACENWGFFE+V+HGIS EL+DTVEK TK HY +C
Sbjct  1    MESFPVVNMELLNSEQRAATMETIKDACENWGFFEVVNHGISHELLDTVEKFTKGHYNEC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            ME+RFKEMVA+KGL+AVQTEI DLDWESTF+LKHLPVS IS++PDLED YRK+MKEFA
Sbjct  61   MERRFKEMVASKGLEAVQTEIKDLDWESTFYLKHLPVSTISQVPDLEDEYRKIMKEFA  118



>ref|XP_009609240.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase-like [Nicotiana 
tomentosiformis]
Length=316

 Score =   199 bits (505),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 90/118 (76%), Positives = 104/118 (88%), Gaps = 0/118 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FP++N+  LNTE+R A ME IKDACENWGFFE+V HGI  EL+D VEKLTK HY KC
Sbjct  1    METFPVVNMELLNTEQRAATMETIKDACENWGFFEVVKHGICHELLDRVEKLTKGHYNKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            ME+RFKEMVA+KGL+AVQTEI DLDWESTFFLKHLP+SNIS++PDLED YRK+MKEFA
Sbjct  61   MEERFKEMVASKGLEAVQTEIKDLDWESTFFLKHLPLSNISQVPDLEDEYRKIMKEFA  118



>ref|XP_009355918.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 2 [Pyrus 
x bretschneideri]
 dbj|BAD61004.1| 1-aminocyclopropane-1-carboxylate oxidase [Pyrus pyrifolia]
Length=314

 Score =   199 bits (505),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 89/119 (75%), Positives = 107/119 (90%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            MA+FP+++++ +N EER A +E+I DACENWGFFELV+HGIS EL+DTVEK+ KDHYKK 
Sbjct  1    MATFPVVDMSLVNGEERAATLEKINDACENWGFFELVNHGISTELLDTVEKMNKDHYKKT  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            MEQRFKEMV AKGLDAVQ++I+DLDWESTFFL+HLP SNISEIPDLE+ YRK MKEFA+
Sbjct  61   MEQRFKEMVVAKGLDAVQSQIHDLDWESTFFLRHLPSSNISEIPDLEEDYRKTMKEFAV  119



>dbj|BAH80550.1| 1-aminocyclopropane-1-carboxylate oxidase [Eucalyptus grandis]
Length=271

 Score =   197 bits (501),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 89/119 (75%), Positives = 107/119 (90%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M SFP+IN+  LN E+R   M++IKDACENWGFFELV+HGI  ELMDTVE++TK+HYKKC
Sbjct  1    MESFPVINMENLNGEKRAITMDKIKDACENWGFFELVNHGIPPELMDTVERMTKEHYKKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            MEQRF+E+VA+KGL+ VQTE++DLDWESTF LKHLPVSNIS+IPDL+D YRKVMKEFA+
Sbjct  61   MEQRFRELVASKGLEYVQTEVHDLDWESTFHLKHLPVSNISQIPDLDDDYRKVMKEFAV  119



>emb|CAD21844.1| ACC oxidase 1 [Fagus sylvatica]
Length=319

 Score =   199 bits (505),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 89/119 (75%), Positives = 105/119 (88%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FP+INL +LN EER   ME+IKDACENWGFFELV+HG+  EL+DTVE+L K+HYKKC
Sbjct  1    MENFPVINLEKLNGEERGTTMEKIKDACENWGFFELVNHGLPHELLDTVERLAKEHYKKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            MEQRFKE+V A+GL+ VQTE+NDLDWESTF ++HLP SNISEIPDLED YRKVMKEFA+
Sbjct  61   MEQRFKELVTAQGLEGVQTEVNDLDWESTFHVRHLPQSNISEIPDLEDEYRKVMKEFAL  119



>ref|NP_001233867.1| 1-aminocyclopropane-1-carboxylate oxidase [Solanum lycopersicum]
 dbj|BAA34924.1| 1-aminocyclopropane-1-carboxylate oxidase [Solanum lycopersicum]
Length=320

 Score =   199 bits (505),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 88/118 (75%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = +3

Query  84   ASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKCM  263
            ++FP++++  L TE+RP  M++IKDACENWGFFELV+HGIS EL+D VE LTK HYKKCM
Sbjct  3    SNFPVVDMGLLQTEKRPEAMDKIKDACENWGFFELVNHGISHELLDAVENLTKGHYKKCM  62

Query  264  EQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            EQRFKEMVA+KGL+AVQTEI+DLDWESTFFLKHLPVSN+ E+PDL+D YRKVMK+FA+
Sbjct  63   EQRFKEMVASKGLEAVQTEIDDLDWESTFFLKHLPVSNVYEVPDLDDEYRKVMKDFAL  120



>ref|XP_009630256.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 1 [Nicotiana 
tomentosiformis]
Length=319

 Score =   199 bits (505),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 89/118 (75%), Positives = 104/118 (88%), Gaps = 0/118 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FPIINL +LN  ER A ME IKDACENWGFFELV+HGI  E+MDTVEKLTK HYKKC
Sbjct  1    MENFPIINLEKLNGSERAATMEMIKDACENWGFFELVNHGIPHEVMDTVEKLTKGHYKKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            MEQRFKE+VA+KGL+ VQ E+ D+DWESTFFL+HLPVSNISE+PDL+D YR+VM++FA
Sbjct  61   MEQRFKELVASKGLEGVQAEVTDMDWESTFFLRHLPVSNISEVPDLDDQYREVMRDFA  118



>ref|XP_010052892.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase [Eucalyptus 
grandis]
 gb|KCW77022.1| hypothetical protein EUGRSUZ_D01368 [Eucalyptus grandis]
Length=319

 Score =   198 bits (504),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 89/119 (75%), Positives = 107/119 (90%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M  FP+INL +LN EER   ME I+DACENWGFFELV+HGIS ELMDTVE+LTK HYK+C
Sbjct  1    MEIFPVINLEKLNGEERGVTMEMIRDACENWGFFELVNHGISHELMDTVERLTKGHYKEC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            ME++FKEMVA+KGL+AVQ+EI D+DWESTFFL+HLPVSNISE+PDL++ YRKVM+EFA+
Sbjct  61   MERKFKEMVASKGLEAVQSEIGDIDWESTFFLRHLPVSNISEVPDLKEDYRKVMREFAL  119



>prf||1909340A Pch313 protein
Length=319

 Score =   198 bits (504),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 87/119 (73%), Positives = 105/119 (88%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FPIINL  LN E R A ME+IKDACENWGFFELV HGI  E +DTVE+LTK+HY++C
Sbjct  1    MENFPIINLEGLNGEGRKATMEKIKDACENWGFFELVSHGIPTEFLDTVERLTKEHYRQC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            +EQRFKE+VA+KGL+AV+TE+ND+DWESTF+L+HLP SNISE+PDLED YR VMKEFA+
Sbjct  61   LEQRFKELVASKGLEAVKTEVNDMDWESTFYLRHLPKSNISEVPDLEDQYRNVMKEFAL  119



>ref|XP_007215698.1| hypothetical protein PRUPE_ppa008791mg [Prunus persica]
 gb|AAF36483.1|AF129073_1 1-aminocyclopropane-1-carboxylate oxidase [Prunus persica]
 gb|AAL26910.1|AF319166_1 1-aminocyclopropane 1-carboxylic acid oxidase [Prunus persica]
 emb|CAA54449.1| 1-aminocyclopropane-1-carboxylate oxidase [Prunus persica]
 gb|AAC33524.1| 1-aminocyclopropane-1-carboxylate oxidase [Prunus armeniaca]
 gb|AAQ10260.1| 1-aminocyclopropane-1-carboxylate oxidase [Prunus persica]
 gb|EMJ16897.1| hypothetical protein PRUPE_ppa008791mg [Prunus persica]
Length=319

 Score =   198 bits (504),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 87/119 (73%), Positives = 105/119 (88%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FPIINL  LN E R A ME+IKDACENWGFFELV HGI  E +DTVE+LTK+HY++C
Sbjct  1    MENFPIINLEGLNGEGRKATMEKIKDACENWGFFELVSHGIPTEFLDTVERLTKEHYRQC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            +EQRFKE+VA+KGL+AV+TE+ND+DWESTF+L+HLP SNISE+PDLED YR VMKEFA+
Sbjct  61   LEQRFKELVASKGLEAVKTEVNDMDWESTFYLRHLPKSNISEVPDLEDQYRNVMKEFAL  119



>ref|NP_001280183.1| 1-aminocyclopropane-1-carboxylate oxidase [Prunus mume]
 sp|Q9MB94.1|ACCO_PRUMU RecName: Full=1-aminocyclopropane-1-carboxylate oxidase; Short=ACC 
oxidase; AltName: Full=Ethylene-forming enzyme; Short=EFE 
[Prunus mume]
 dbj|BAA90550.1| ACC oxidase [Prunus mume]
Length=319

 Score =   198 bits (503),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 87/119 (73%), Positives = 105/119 (88%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FPIINL  LN E R A ME+IKDACENWGFFELV HGI  E +DTVE+LTK+HY++C
Sbjct  1    MENFPIINLEGLNGEGRKATMEKIKDACENWGFFELVSHGIPTEFLDTVERLTKEHYRQC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            +EQRFKE+VA+KGL+AV+TE+ND+DWESTF+L+HLP SNISE+PDLED YR VMKEFA+
Sbjct  61   LEQRFKELVASKGLEAVKTEVNDMDWESTFYLRHLPKSNISEVPDLEDQYRNVMKEFAL  119



>dbj|BAH66891.1| 1-aminocyclopropane-1-carboxylate oxidase [Prunus mume]
Length=305

 Score =   197 bits (502),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 87/119 (73%), Positives = 105/119 (88%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FPIINL  LN E R A ME+IKDACENWGFFELV HGI  E +DTVE+LTK+HY++C
Sbjct  1    MENFPIINLEGLNGEGRKATMEKIKDACENWGFFELVSHGIPTEFLDTVERLTKEHYRQC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            +EQRFKE+VA+KGL+AV+TE+ND+DWESTF+L+HLP SNISE+PDLED YR VMKEFA+
Sbjct  61   LEQRFKELVASKGLEAVKTEVNDMDWESTFYLRHLPKSNISEVPDLEDQYRNVMKEFAL  119



>ref|XP_008371045.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 2 [Malus 
domestica]
Length=330

 Score =   198 bits (504),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 90/119 (76%), Positives = 107/119 (90%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            MA+FP++++  +N EER A +E+I DACENWGFFELV+HGIS EL+DTVEK+ KDHYKK 
Sbjct  1    MATFPVVDMDLINGEERAATLEKINDACENWGFFELVNHGISTELLDTVEKMNKDHYKKT  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            MEQRFKEMVAAKGL+AVQ+EI+DLDWESTFFL+HLP SNISEIPDLE+ YRK MKEFA+
Sbjct  61   MEQRFKEMVAAKGLEAVQSEIHDLDWESTFFLRHLPSSNISEIPDLEEDYRKTMKEFAV  119



>ref|XP_009768154.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 1 [Nicotiana 
sylvestris]
Length=319

 Score =   198 bits (503),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 89/118 (75%), Positives = 104/118 (88%), Gaps = 0/118 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FPIINL +LN  E+ A ME IKDACENWGFFELV+HGI  E+MDTVEKLTK HYKKC
Sbjct  1    MENFPIINLEKLNGSEKAATMEMIKDACENWGFFELVNHGIPHEVMDTVEKLTKGHYKKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            MEQRFKE+VA+KGL+ VQ E+ D+DWESTFFL+HLPVSNISE+PDL+D YR+VMK+FA
Sbjct  61   MEQRFKELVASKGLEGVQAEVTDMDWESTFFLRHLPVSNISEVPDLDDQYREVMKDFA  118



>ref|XP_010035513.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 3-like [Eucalyptus 
grandis]
 gb|KCW46935.1| hypothetical protein EUGRSUZ_K00750 [Eucalyptus grandis]
Length=320

 Score =   198 bits (503),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 89/119 (75%), Positives = 107/119 (90%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M SFP+IN+  LN E+R   M++IKDACENWGFFELV+HGI  ELMDTVE++TK+HYKKC
Sbjct  1    MESFPVINMENLNGEKRAITMDKIKDACENWGFFELVNHGIPPELMDTVERMTKEHYKKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            MEQRF+E+VA+KGL+ VQTE++DLDWESTF LKHLPVSNIS+IPDL+D YRKVMKEFA+
Sbjct  61   MEQRFRELVASKGLEYVQTEVHDLDWESTFHLKHLPVSNISQIPDLDDDYRKVMKEFAV  119



>gb|ACS71641.1| ACC oxidase [Boea hygrometrica]
Length=317

 Score =   197 bits (502),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 88/118 (75%), Positives = 106/118 (90%), Gaps = 0/118 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            MA+FP+IN+ +LN +ER A ME IKDACENWGFFELV+HGIS E MDTVE+LTK+HYKK 
Sbjct  1    MATFPVINMEKLNGDERSATMEIIKDACENWGFFELVNHGISPEFMDTVERLTKEHYKKT  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            MEQRFKEMV++KGL++VQ+EI DLDWESTF+L+HLPVSNI+EIPDLE  YR+V+KEF 
Sbjct  61   MEQRFKEMVSSKGLESVQSEITDLDWESTFYLRHLPVSNITEIPDLEQEYRRVLKEFG  118



>ref|XP_009789991.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 3-like [Nicotiana 
sylvestris]
Length=319

 Score =   197 bits (502),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 89/118 (75%), Positives = 105/118 (89%), Gaps = 0/118 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M  FPIINL +LN  ER AIM++IKDACENWGFFELV+HGI  E+MD VEKLTK HYKKC
Sbjct  1    MEKFPIINLEKLNGTERAAIMDKIKDACENWGFFELVNHGIPHEVMDRVEKLTKGHYKKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            MEQRFKE+VA+KGL+AVQ E+ DLDWESTFFL+HLPVSNIS++PDL+D YR+VM++FA
Sbjct  61   MEQRFKELVASKGLEAVQAEVTDLDWESTFFLRHLPVSNISQVPDLDDEYREVMRDFA  118



>ref|XP_011047191.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase [Populus 
euphratica]
Length=319

 Score =   197 bits (502),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = +3

Query  90   FPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKCMEQ  269
            FP+I++ +LN EER A ME+IKDACENWGFFEL++HGIS EL+DTVE++TK+HYKKCMEQ
Sbjct  3    FPVISMEKLNGEERAATMEKIKDACENWGFFELLNHGISHELLDTVERMTKEHYKKCMEQ  62

Query  270  RFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            RFKE+VA+K LD VQTEI D+DWESTF+L+HLP SNI+EIPDL+D YRKVMKEFA+
Sbjct  63   RFKELVASKALDGVQTEIKDMDWESTFYLRHLPKSNIAEIPDLDDEYRKVMKEFAL  118



>gb|KEH35231.1| 1-aminocyclopropane-1-carboxylate oxidase [Medicago truncatula]
Length=229

 Score =   194 bits (494),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 89/119 (75%), Positives = 105/119 (88%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FPIINL  LN +ER A ME+IKDACENWGFFELV+HGI  +LMDTVE+LTK+HY+KC
Sbjct  1    MDNFPIINLENLNGDERKATMEKIKDACENWGFFELVNHGIPHDLMDTVERLTKEHYRKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            MEQRFKE+V++KGL+AVQTE+ D+DWESTF L+HLP SNISEIPDL D YRK MKEFA+
Sbjct  61   MEQRFKELVSSKGLEAVQTEVKDMDWESTFHLRHLPESNISEIPDLSDEYRKSMKEFAL  119



>gb|AAL35971.1| 1-aminocyclopropanecarboxylic acid oxidase [Medicago truncatula]
Length=313

 Score =   197 bits (501),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 90/119 (76%), Positives = 105/119 (88%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M SFPIINL  LN +ER A ME+IKDACENWGFFELV+HGI  +LMDTVE+LTK+HY+KC
Sbjct  1    MDSFPIINLENLNGDERKATMEKIKDACENWGFFELVNHGIPHDLMDTVERLTKEHYRKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            MEQRFKE+V++KGL+AVQTE+ D+DWESTF L+HLP SNISEIPDL D YRK MKEFA+
Sbjct  61   MEQRFKELVSSKGLEAVQTEVKDMDWESTFHLRHLPESNISEIPDLSDEYRKSMKEFAL  119



>ref|XP_002316589.1| aminocyclopropane carboxylate oxidase family protein [Populus 
trichocarpa]
 gb|EEE97201.1| aminocyclopropane carboxylate oxidase family protein [Populus 
trichocarpa]
Length=318

 Score =   197 bits (500),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 88/119 (74%), Positives = 109/119 (92%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M SFP+I+L++LN EER   ME+I+DACENWGFFELV+HGIS +L+DTVE+ TK+HY+KC
Sbjct  1    MESFPVIDLSKLNGEERKPTMEKIEDACENWGFFELVNHGISHDLLDTVERRTKEHYRKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            MEQRFKEMVA+KGL+ VQ+EI+DLDWESTFFL+HLP SN++EIPDLE+ YRKVMKEFA+
Sbjct  61   MEQRFKEMVASKGLEGVQSEISDLDWESTFFLRHLPESNMAEIPDLEEDYRKVMKEFAL  119



>gb|AGG20315.1| 1-aminocyclopropane-1-carboxylate oxidase 4 [Capsicum annuum]
Length=320

 Score =   197 bits (501),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = +3

Query  87   SFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKCME  266
            +FP++++  L TE+R   M++IKDACENWGFFELVDHGIS EL+D VE  TK HYKKCME
Sbjct  4    TFPVVDMGLLQTEKRAETMDKIKDACENWGFFELVDHGISHELLDAVENFTKGHYKKCME  63

Query  267  QRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            QRFKEMVA+KGL+AVQTEINDLDWESTFFLKHLPVSN+ E+PDL+D YR VMKEFA+
Sbjct  64   QRFKEMVASKGLEAVQTEINDLDWESTFFLKHLPVSNVYEVPDLDDEYRNVMKEFAL  120



>emb|CDP04457.1| unnamed protein product [Coffea canephora]
Length=318

 Score =   197 bits (500),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 89/118 (75%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            MA+FP+I++ +L+ EER A M  IKDACE+WGFFE+++HGIS E MDTVE+LTK+HYKKC
Sbjct  1    MATFPVIDMEKLDGEERAATMGVIKDACESWGFFEVLNHGISNEFMDTVERLTKEHYKKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            ME +FKEMV +KGL+AVQTEINDLDWESTFFL+HLPVSNISE+PDL+D YRKVMKEFA
Sbjct  61   MELKFKEMVESKGLEAVQTEINDLDWESTFFLRHLPVSNISEVPDLDDEYRKVMKEFA  118



>emb|CAH65725.1| 1-aminocyclopropane-1-carboxylate oxidase [Carica papaya]
Length=309

 Score =   196 bits (499),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 85/119 (71%), Positives = 106/119 (89%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FP+IN+  LN EER A M++I+DACENWGFFELV+HGI IEL+DTVE+LTK HY+KC
Sbjct  1    MENFPVINMEGLNGEERAATMKKIEDACENWGFFELVNHGIPIELLDTVERLTKGHYRKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            MEQRFKE++A+KGLD +QTE+ D+DWESTFF++HLP  NI+EIPDL+D YRKVMKEFA+
Sbjct  61   MEQRFKEIMASKGLDGIQTEVTDMDWESTFFIRHLPEPNIAEIPDLDDEYRKVMKEFAL  119



>gb|AAC98808.1| ACC oxidase [Carica papaya]
 emb|CAE53415.1| 1-aminocyclopropane-1-carboxylate oxidase [Carica papaya]
 emb|CAH68522.1| 1-aminocyclopropane-1-carboxylate oxidase [Carica papaya]
Length=318

 Score =   197 bits (500),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 89/119 (75%), Positives = 106/119 (89%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FP+I+L++LN EER + ME I DACENWGFFELV+HGIS +LMDTVE+LTK+HYKKC
Sbjct  1    MENFPVIDLSKLNGEERASTMELIHDACENWGFFELVNHGISHDLMDTVERLTKEHYKKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            MEQRFKEMV + GL+AVQ+EIND+DWESTFFL+HLP SN+ EIPDLED YRK MKEFA+
Sbjct  61   MEQRFKEMVESNGLEAVQSEINDMDWESTFFLRHLPASNMHEIPDLEDDYRKAMKEFAV  119



>gb|AAL78058.1| ripening-induced ACC oxidase [Carica papaya]
Length=310

 Score =   196 bits (499),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 85/119 (71%), Positives = 106/119 (89%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FP+IN+  LN EER A M++I+DACENWGFFELV+HGI IEL+DTVE+LTK HY+KC
Sbjct  1    MENFPVINMEGLNGEERAATMKKIEDACENWGFFELVNHGIPIELLDTVERLTKGHYRKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            MEQRFKE++A+KGLD +QTE+ D+DWESTFF++HLP  NI+EIPDL+D YRKVMKEFA+
Sbjct  61   MEQRFKEIMASKGLDGIQTEVTDMDWESTFFIRHLPEPNIAEIPDLDDEYRKVMKEFAL  119



>ref|XP_010099139.1| 1-aminocyclopropane-1-carboxylate oxidase [Morus notabilis]
 gb|EXB77011.1| 1-aminocyclopropane-1-carboxylate oxidase [Morus notabilis]
Length=322

 Score =   197 bits (500),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = +3

Query  87   SFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKCME  266
            +FP+I++A+LN EER   ME I DACENWGFFEL++HGIS ELMD VE+LTK+HY+KCME
Sbjct  5    TFPVIDMAKLNGEERKETMELINDACENWGFFELMNHGISHELMDAVERLTKEHYRKCME  64

Query  267  QRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            QRFKEMVA+KGLD VQ+EINDLDWESTFFL+H PVSN+SEIPDL+D YRK MKEFA
Sbjct  65   QRFKEMVASKGLDVVQSEINDLDWESTFFLRHRPVSNMSEIPDLDDDYRKAMKEFA  120



>gb|AAA99792.1| 1-aminocyclopropane-1-carboxylic acid oxidase [Nicotiana glutinosa]
Length=320

 Score =   197 bits (500),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 90/118 (76%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FPIINL +LN  ER   ME IKDACENWGFFELV+HGI  E+MDTVEKLTK HYKKC
Sbjct  1    MENFPIINLEKLNGSERADTMEMIKDACENWGFFELVNHGIPHEVMDTVEKLTKGHYKKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            MEQRFKE+VA KGL+AVQ E+ DLDWESTFFL+HLPVSNISE+PDL+D YR+VM++FA
Sbjct  61   MEQRFKELVANKGLEAVQAEVTDLDWESTFFLRHLPVSNISEVPDLDDQYREVMRDFA  118



>ref|XP_007147675.1| hypothetical protein PHAVU_006G144900g [Phaseolus vulgaris]
 gb|ESW19669.1| hypothetical protein PHAVU_006G144900g [Phaseolus vulgaris]
Length=317

 Score =   196 bits (499),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 88/119 (74%), Positives = 108/119 (91%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            MA+FP++++ +LNTEER A ME IKDACENWGF ELV+HGISIELMDTVE+ TK+HYKK 
Sbjct  1    MANFPVVDMEKLNTEERGAAMETIKDACENWGFLELVNHGISIELMDTVERFTKEHYKKT  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            MEQRFKEMVA KGL++V++EINDLDWESTFFL+HLPVSN+SE  DL++ YRK+MK+FA+
Sbjct  61   MEQRFKEMVANKGLESVESEINDLDWESTFFLRHLPVSNVSENADLDEDYRKIMKQFAL  119



>gb|AAF64528.1|AF254125_1 ACC oxidase [Carica papaya]
Length=318

 Score =   196 bits (499),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 89/119 (75%), Positives = 106/119 (89%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FP+I+L++LN EER + ME I DACENWGFFELV+HGIS +LMDTVE+LTK+HYKKC
Sbjct  1    MENFPVIDLSKLNGEERASTMELIHDACENWGFFELVNHGISHDLMDTVERLTKEHYKKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            MEQRFKEMV + GL+AVQ+EIND+DWESTFFL+HLP SN+ EIPDLED YRK MKEFA+
Sbjct  61   MEQRFKEMVESNGLEAVQSEINDMDWESTFFLRHLPASNMHEIPDLEDDYRKAMKEFAV  119



>emb|CAA58232.1| 1-amniocyclopropane-1-carboxylate oxidase [Nicotiana tabacum]
Length=308

 Score =   196 bits (499),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  114  LNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKCMEQRFKEMVAA  293
            LNTE+R A ME IKDACENWGFFE+V+HGIS EL+DTVEKLTK HYKKCME+RFKEMVA+
Sbjct  4    LNTEQRAATMETIKDACENWGFFEVVNHGISHELLDTVEKLTKGHYKKCMEERFKEMVAS  63

Query  294  KGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            KGL+AVQTEI DLDWESTFFLKHLP+SNISE+PDLED YRK+MKEFA
Sbjct  64   KGLEAVQTEIKDLDWESTFFLKHLPISNISEVPDLEDEYRKIMKEFA  110



>emb|CAA60576.1| 1-aminocyclopropane-1-carboxylate oxidase [Pyrus communis]
Length=313

 Score =   196 bits (499),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 90/119 (76%), Positives = 109/119 (92%), Gaps = 1/119 (1%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            MA+FP+++L+ +N EER A +E+I DACENWGFFELV+HG+S EL+DTVEK+TKDHYKK 
Sbjct  1    MATFPVVDLSLVNGEERVATLEKINDACENWGFFELVNHGMSTELLDTVEKMTKDHYKKT  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            MEQRFKEMVAAKGLDAVQ++I+DLDWESTFFL+HLP SNISE+PDLE+ YRK MKEFA+
Sbjct  61   MEQRFKEMVAAKGLDAVQSDIHDLDWESTFFLRHLP-SNISEVPDLEEDYRKTMKEFAV  118



>gb|KDP30812.1| hypothetical protein JCGZ_13755 [Jatropha curcas]
Length=319

 Score =   196 bits (499),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 87/115 (76%), Positives = 103/115 (90%), Gaps = 0/115 (0%)
 Frame = +3

Query  90   FPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKCMEQ  269
            FP+IN+ +LN +ER A M +IKDACENWGFFEL++HGI+ E +DTVE+LTK HY+KCMEQ
Sbjct  3    FPVINMEKLNGDERAATMAKIKDACENWGFFELLNHGIAPEFLDTVERLTKAHYRKCMEQ  62

Query  270  RFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            RFKEMVA+KGLDA QTEI D+DWESTFFL+HLP SNI+EIPDL+D YRKVMKEFA
Sbjct  63   RFKEMVASKGLDATQTEIKDMDWESTFFLRHLPQSNIAEIPDLDDEYRKVMKEFA  117



>gb|ACJ84896.1| unknown [Medicago truncatula]
Length=221

 Score =   193 bits (491),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 88/119 (74%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FPIINL  LN +ER A ME+IKDACENWGFFELV+HGI  +LMDTVE+LTK+HY+KC
Sbjct  1    MDNFPIINLENLNGDERKATMEKIKDACENWGFFELVNHGIPHDLMDTVERLTKEHYRKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            MEQRFKE+V++KGL+AVQTE+ D+DWES F L+HLP SNISEIPDL D YRK MKEFA+
Sbjct  61   MEQRFKELVSSKGLEAVQTEVKDMDWESAFHLRHLPESNISEIPDLSDEYRKSMKEFAL  119



>gb|AIR72293.1| 1-amino-cyclopropane-1-carboxylic acid oxidase [Prunus salicina]
Length=319

 Score =   196 bits (498),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 86/119 (72%), Positives = 105/119 (88%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FPIINL  L+ E R A ME+IKDACENWGFFELV HGI  E +DTVE+LTK+HY++C
Sbjct  1    MENFPIINLEGLDGEGRKATMEKIKDACENWGFFELVSHGIPTEFLDTVERLTKEHYRQC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            +EQRFKE+VA+KGL+AV+TE+ND+DWESTF+L+HLP SNISE+PDLED YR VMKEFA+
Sbjct  61   LEQRFKELVASKGLEAVKTEVNDMDWESTFYLRHLPKSNISEVPDLEDQYRNVMKEFAL  119



>emb|CAI64499.1| 1-aminocyclopropane-1-carboxylate oxidase 1 [Prunus domestica 
subsp. syriaca]
Length=319

 Score =   196 bits (498),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 87/119 (73%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FPIINL  LN E R A ME+IKDACENWGFFELV HGI  E +DTVE+LTK+HY++C
Sbjct  1    MENFPIINLLGLNGEGRKATMEKIKDACENWGFFELVSHGIPTEFLDTVERLTKEHYRQC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            +EQRFKE+VA+KGL+AV+TE+ND+DWESTF L+HLP SNISE+PDLED YR VMKEFA+
Sbjct  61   LEQRFKELVASKGLEAVKTEVNDMDWESTFHLRHLPKSNISEVPDLEDQYRNVMKEFAL  119



>gb|AAC48922.1| 1-aminocyclopropane-1-carboxylate oxidase homolog [Vigna radiata]
Length=308

 Score =   196 bits (497),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 86/115 (75%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +3

Query  93   PIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKCMEQR  272
            P++++  LN EER A ME+IKDACENWGFFE+V+HGISIELMD+V++LTK+HYK+CME+R
Sbjct  1    PVVDMKNLNNEERGATMEKIKDACENWGFFEVVNHGISIELMDSVDRLTKEHYKRCMEER  60

Query  273  FKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            FKEMVA+KGL+  ++EINDLDWESTFFL+HLPVSNISEIPDL D YRKVMK+FA+
Sbjct  61   FKEMVASKGLECAESEINDLDWESTFFLRHLPVSNISEIPDLADDYRKVMKDFAV  115



>gb|AFK42210.1| unknown [Medicago truncatula]
Length=313

 Score =   196 bits (497),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 89/119 (75%), Positives = 105/119 (88%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FPIINL  LN +ER A ME+IKDACENWGFFELV+HGI  +LMDTVE+LTK+HY+KC
Sbjct  1    MDNFPIINLENLNGDERKATMEKIKDACENWGFFELVNHGIPHDLMDTVERLTKEHYRKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            MEQRFKE+V++KGL+AVQTE+ D+DWESTF L+HLP SNISEIPDL D YRK MKEFA+
Sbjct  61   MEQRFKELVSSKGLEAVQTEVKDMDWESTFHLRHLPESNISEIPDLSDEYRKSMKEFAL  119



>ref|XP_003601593.1| 1-aminocyclopropane-1-carboxylate oxidase [Medicago truncatula]
 gb|AES71844.1| 1-aminocyclopropane-1-carboxylate oxidase [Medicago truncatula]
Length=313

 Score =   196 bits (497),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 89/119 (75%), Positives = 105/119 (88%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FPIINL  LN +ER A ME+IKDACENWGFFELV+HGI  +LMDTVE+LTK+HY+KC
Sbjct  1    MDNFPIINLENLNGDERKATMEKIKDACENWGFFELVNHGIPHDLMDTVERLTKEHYRKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            MEQRFKE+V++KGL+AVQTE+ D+DWESTF L+HLP SNISEIPDL D YRK MKEFA+
Sbjct  61   MEQRFKELVSSKGLEAVQTEVKDMDWESTFHLRHLPESNISEIPDLSDEYRKSMKEFAL  119



>gb|ACX71872.1| ACC oxidase 1 [Lithospermum erythrorhizon]
Length=317

 Score =   196 bits (497),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 90/118 (76%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FPIINL +LN +ER A ME IKDACE WGFFELV+HGIS +LMDTVE+LTK HYKK 
Sbjct  1    MEAFPIINLEKLNGDERGATMEMIKDACEKWGFFELVNHGISHDLMDTVERLTKGHYKKS  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            ME RFKEMVA+KGLDAVQ EINDLDWESTFFLKHLP+ NISE+PDL+D YR+ M++FA
Sbjct  61   MEHRFKEMVASKGLDAVQAEINDLDWESTFFLKHLPLPNISEVPDLDDEYRETMRQFA  118



>ref|XP_009629716.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase-like [Nicotiana 
tomentosiformis]
Length=320

 Score =   196 bits (497),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 87/118 (74%), Positives = 105/118 (89%), Gaps = 0/118 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FPIINL +LN  ER A M+ IKDACENWGFFELV+HGI  E+MDTVEK+TK HYKKC
Sbjct  1    MENFPIINLEKLNGSERAATMDMIKDACENWGFFELVNHGIPHEVMDTVEKMTKGHYKKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            MEQRFKE+VA+KGL+AVQ E+ DLDWESTFFL+HLP+SNIS++PDL+D YR+VM++FA
Sbjct  61   MEQRFKELVASKGLEAVQAEVTDLDWESTFFLRHLPLSNISQVPDLDDEYREVMRDFA  118



>gb|AEM62878.1| ACC oxidase 2 [Actinidia deliciosa]
Length=319

 Score =   195 bits (496),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 89/118 (75%), Positives = 105/118 (89%), Gaps = 0/118 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FP+I++ +L  +ER   ME+I DACENWGFFEL++HGIS ELMDTVE+LTK+HYKKC
Sbjct  1    METFPVIDMEKLTGKERSPTMEKINDACENWGFFELMNHGISHELMDTVERLTKEHYKKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            MEQRFKEMVA KGL+AVQ+EI+DLDWESTFFL+HLPVSNISEIPDLE  +RK MKEFA
Sbjct  61   MEQRFKEMVATKGLEAVQSEIDDLDWESTFFLRHLPVSNISEIPDLEQDHRKAMKEFA  118



>dbj|BAG06705.1| 1-aminocyclopropane-1-carboxylate oxidase [Ficus carica]
Length=322

 Score =   195 bits (496),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 88/116 (76%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = +3

Query  87   SFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKCME  266
            +FP+I++ +LN +ER   ME I DACENWGFFE+++HGIS ELMDTVE+LTK+HY+KCME
Sbjct  5    TFPVIDMTKLNGDERKTTMELINDACENWGFFEVMNHGISHELMDTVERLTKEHYRKCME  64

Query  267  QRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            QRFKEMVA KGLD VQ+EI DLDWESTFFL+HLPVSN+SEIPDL D YRKVMKEFA
Sbjct  65   QRFKEMVATKGLDVVQSEIKDLDWESTFFLRHLPVSNMSEIPDLGDDYRKVMKEFA  120



>sp|Q43792.1|ACCO_TOBAC RecName: Full=1-aminocyclopropane-1-carboxylate oxidase; Short=ACC 
oxidase; AltName: Full=Ethylene-forming enzyme; Short=EFE 
[Nicotiana tabacum]
 emb|CAA86468.1| 1-aminocyclopropane-1-carboxylate deaminase [Nicotiana tabacum]
Length=319

 Score =   195 bits (496),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 88/118 (75%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FPIINL +LN  ER   ME IKDACENWGFFELV+HGI  E+MDTVEK+TK HYKKC
Sbjct  1    MENFPIINLEKLNGSERADTMEMIKDACENWGFFELVNHGIPHEVMDTVEKMTKGHYKKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            MEQRFKE+VA+KGL+AVQ E+ DLDWESTFFL+HLPVSNI E+PDL+D YR+VM++FA
Sbjct  61   MEQRFKELVASKGLEAVQAEVTDLDWESTFFLRHLPVSNICEVPDLDDQYREVMRDFA  118



>gb|ADR73045.1| ACC oxidase 2 isoform A [Nicotiana tabacum]
Length=308

 Score =   195 bits (495),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  114  LNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKCMEQRFKEMVAA  293
            LNTE+R A ME IKDACENWGFFE+V+HGIS EL+DTVEKLTK HYKKCME+RFKEMVA+
Sbjct  4    LNTEQRAATMETIKDACENWGFFEVVNHGISHELLDTVEKLTKGHYKKCMEERFKEMVAS  63

Query  294  KGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            KGL+AVQTEI D DWESTFFLKHLP+SNISE+PDLED YRK+MKEFA
Sbjct  64   KGLEAVQTEIKDFDWESTFFLKHLPISNISEVPDLEDEYRKIMKEFA  110



>dbj|BAA83466.1| ACC oxidase [Nicotiana tabacum]
Length=319

 Score =   195 bits (495),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 88/118 (75%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FPIINL +LN  ER   ME IKDACENWGFFELV+HGI  E+MDTVEK+TK HYKKC
Sbjct  1    MENFPIINLEKLNGSERADTMEMIKDACENWGFFELVNHGIPHEVMDTVEKMTKGHYKKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            MEQRFKE+VA+KGL+AVQ E+ DLDWESTFFL+HLPVSNI E+PDL+D YR+VM++FA
Sbjct  61   MEQRFKELVASKGLEAVQAEVTDLDWESTFFLRHLPVSNICEVPDLDDQYREVMRDFA  118



>gb|AFK45850.1| unknown [Lotus japonicus]
Length=318

 Score =   195 bits (495),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 88/119 (74%), Positives = 107/119 (90%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            MA+FP++++++LNTEER A ME IKD CENWGFFELV+H IS E MDTVE+LTK+HYK+ 
Sbjct  1    MANFPVVDMSKLNTEERVATMELIKDVCENWGFFELVNHEISTEFMDTVERLTKEHYKRF  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            MEQRFKEMVA KGL+ VQ+EI+DLDWESTFFL+HLP SNISE+PDL++ YRKVMKEFA+
Sbjct  61   MEQRFKEMVATKGLETVQSEIDDLDWESTFFLRHLPSSNISEVPDLDEDYRKVMKEFAV  119



>gb|AAP41850.1| 1-aminocyclopropane-1-carboxylate oxidase [Hevea brasiliensis]
 emb|CAN85570.1| ACC oxidase 2 [Hevea brasiliensis]
Length=318

 Score =   195 bits (495),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 102/115 (89%), Gaps = 0/115 (0%)
 Frame = +3

Query  90   FPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKCMEQ  269
            FP+INL +LN EER A M +IKDACENWGFFEL++HGI  E MDTVE++TK HY+KCMEQ
Sbjct  3    FPVINLGKLNGEERAATMAKIKDACENWGFFELLNHGIEPEFMDTVERMTKGHYRKCMEQ  62

Query  270  RFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            RFKEMVA+KGL+ VQTEI D+DWESTFFL+HLP SNI+++PDL+D YRKVMK+FA
Sbjct  63   RFKEMVASKGLEGVQTEIKDMDWESTFFLRHLPESNIAQVPDLDDEYRKVMKDFA  117



>ref|XP_009781832.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase [Nicotiana 
sylvestris]
Length=319

 Score =   195 bits (495),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 88/118 (75%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FPIINL +LN  ER   ME IKDACENWGFFELV+HGI  E+MDTVEK+TK HYKKC
Sbjct  1    MENFPIINLEKLNGSERADTMEMIKDACENWGFFELVNHGIPHEVMDTVEKMTKGHYKKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            MEQRFKE+VA+KGL+AVQ E+ DLDWESTFFL+HLPVSNI E+PDL+D YR+VM++FA
Sbjct  61   MEQRFKELVASKGLEAVQAEVTDLDWESTFFLRHLPVSNICEVPDLDDQYREVMRDFA  118



>gb|KJB10710.1| hypothetical protein B456_001G217400 [Gossypium raimondii]
Length=311

 Score =   195 bits (495),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 86/119 (72%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            MA+FP+INL +LN EER  IMEQIKDACENWGFFEL++HGI  E +DTVE+LTK+HYKKC
Sbjct  1    MATFPVINLEKLNGEERATIMEQIKDACENWGFFELLNHGIPHEFLDTVERLTKEHYKKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            MEQRFKE+VA+K L+ +Q E+ D+DWESTFFL+HLP SN++EIPDL   YRKVMKEFA+
Sbjct  61   MEQRFKELVASKALEGLQAEVTDMDWESTFFLRHLPESNMAEIPDLAHEYRKVMKEFAL  119



>emb|CAN85573.1| ACC oxidase 2 [Hevea brasiliensis]
Length=318

 Score =   195 bits (495),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 102/115 (89%), Gaps = 0/115 (0%)
 Frame = +3

Query  90   FPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKCMEQ  269
            FP+INL +LN EER A M +IKDACENWGFFEL++HGI  E MDTVE++TK HY+KCMEQ
Sbjct  3    FPVINLGKLNGEERAATMAKIKDACENWGFFELLNHGIEPEFMDTVERMTKGHYRKCMEQ  62

Query  270  RFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            RFKEMVA+KGL+ VQTEI D+DWESTFFL+HLP SNI+++PDL+D YRKVMK+FA
Sbjct  63   RFKEMVASKGLEGVQTEIKDMDWESTFFLRHLPESNIAQVPDLDDEYRKVMKDFA  117



>ref|NP_001267871.1| aconitase 2, mitochondrial [Vitis vinifera]
 gb|AFU66005.1| 1-aminocyclopropane-1-carboxylic acid oxidase 2 [Vitis vinifera]
Length=318

 Score =   195 bits (495),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 88/119 (74%), Positives = 103/119 (87%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FP+IN+  LN EER A ME IKDACENWGFFELV+HGIS E MD VEKLTK HY+KC
Sbjct  1    MEAFPVINMEMLNGEERGATMEMIKDACENWGFFELVNHGISHEQMDAVEKLTKGHYRKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            MEQRFKE+VAAK L+ VQTEI D+DWESTFFL+HLPVSN+S+ PDL++ YRKVMK+FA+
Sbjct  61   MEQRFKELVAAKALEGVQTEIKDMDWESTFFLRHLPVSNVSDFPDLDEEYRKVMKDFAL  119



>gb|ABI95858.1| 1-aminocyclopropane-1-carboxylate oxidase [Nicotiana suaveolens]
Length=308

 Score =   194 bits (494),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  114  LNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKCMEQRFKEMVAA  293
            LNTE+R A ME+IKDACENWGFFE+V+HGI  EL+DTVEKLTK HYKKCMEQRFKEMVA+
Sbjct  4    LNTEQRAATMEKIKDACENWGFFEVVNHGICHELLDTVEKLTKGHYKKCMEQRFKEMVAS  63

Query  294  KGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            KGL+AV+TEI DLDWESTFFLKHLP+SNISE+PDLED YRK+MKEFA
Sbjct  64   KGLEAVETEIKDLDWESTFFLKHLPISNISEVPDLEDEYRKIMKEFA  110



>ref|XP_004502173.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase-like [Cicer 
arietinum]
Length=313

 Score =   194 bits (494),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 88/119 (74%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FP+INL  +N EER A ME+IKDACENWGFFELV+HGI  +LMDTVE+LTK+HY+KC
Sbjct  1    MENFPVINLDNINGEERKATMEKIKDACENWGFFELVNHGIPHDLMDTVERLTKEHYRKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            MEQRFKE+VA KGL+AVQTE+ D+DWESTF L+HLP SNISE+PDL D YRK MKEFA+
Sbjct  61   MEQRFKELVANKGLEAVQTEVKDMDWESTFHLRHLPESNISEVPDLTDEYRKSMKEFAL  119



>sp|O48882.1|ACCO2_MALDO RecName: Full=1-aminocyclopropane-1-carboxylate oxidase 2; Short=ACC 
oxidase 2; AltName: Full=Ethylene-forming enzyme; Short=EFE 
[Malus domestica]
 gb|AAB94031.1| 1-aminocyclopropane-1-carboxylate oxidase [Malus domestica]
Length=330

 Score =   195 bits (496),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 89/119 (75%), Positives = 106/119 (89%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            MA+FP++++  +N EER A +E+I DACENWGFFELV+HGIS EL+DTVEK+ KDHYKK 
Sbjct  1    MATFPVVDMDLINGEERAATLEKINDACENWGFFELVNHGISTELLDTVEKMNKDHYKKT  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            MEQRFKEMVAAKGL+AVQ+EI+ LDWESTFFL+HLP SNISEIPDLE+ YRK MKEFA+
Sbjct  61   MEQRFKEMVAAKGLEAVQSEIHYLDWESTFFLRHLPSSNISEIPDLEEDYRKTMKEFAV  119



>gb|AEM62879.1| ACC oxidase 3 [Actinidia chinensis]
Length=319

 Score =   195 bits (495),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 89/118 (75%), Positives = 105/118 (89%), Gaps = 0/118 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FP+I++ +L  +ER   ME+I DACENWGFFEL++HGIS ELMDTVE+LTK+HYKKC
Sbjct  1    MEAFPVIDMEKLTGKERSPTMEKINDACENWGFFELMNHGISHELMDTVERLTKEHYKKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            MEQRFKEMVA KGL+AVQ+EI+DLDWESTFFL+HLPVSNISEIPDLE  +RK MKEFA
Sbjct  61   MEQRFKEMVATKGLEAVQSEIDDLDWESTFFLRHLPVSNISEIPDLEQDHRKSMKEFA  118



>gb|AAD28197.2|AF115262_1 1-aminocyclopropane-1-carboxylate oxidase [Trifolium repens]
 gb|ABB97397.1| ACC oxidase [Trifolium repens]
Length=314

 Score =   194 bits (494),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 89/119 (75%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FPIINL  LN EER A ME+IKDACENWGFFELV+HGIS +LMDTVE+LTK+HY+ C
Sbjct  1    MENFPIINLENLNGEERKATMEKIKDACENWGFFELVNHGISHDLMDTVERLTKEHYRIC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            MEQRFK++VA KGL+AVQTE+ D+DWESTF L+HLP SNISE+PDL D YRK MKEFA+
Sbjct  61   MEQRFKDLVANKGLEAVQTEVKDMDWESTFHLRHLPESNISEVPDLTDEYRKAMKEFAL  119



>ref|XP_009790903.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase-like [Nicotiana 
sylvestris]
Length=320

 Score =   194 bits (494),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 86/118 (73%), Positives = 106/118 (90%), Gaps = 0/118 (0%)
 Frame = +3

Query  84   ASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKCM  263
             +FP+++L  L TE+R   +++IKDACENWGFFELV+HGIS E++DTVEKLTK+HYKKCM
Sbjct  3    TTFPVVDLGLLQTEKRAETLDKIKDACENWGFFELVNHGISHEVLDTVEKLTKEHYKKCM  62

Query  264  EQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            EQRFKEMVA+KGL+AVQTEI+DLDWESTF+LKHLPVS + E+PDLED YR VMK+FA+
Sbjct  63   EQRFKEMVASKGLEAVQTEIDDLDWESTFYLKHLPVSTVYEVPDLEDKYRNVMKDFAL  120



>ref|XP_010035505.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 1-like [Eucalyptus 
grandis]
 gb|KCW46926.1| hypothetical protein EUGRSUZ_K00740 [Eucalyptus grandis]
Length=320

 Score =   194 bits (494),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 88/119 (74%), Positives = 105/119 (88%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M SFP+IN+  LN EER   M++IKDACENWGFFELV+HGI  ELMDTVE++TK HYKKC
Sbjct  1    MESFPVINIENLNGEERAITMDKIKDACENWGFFELVNHGIPPELMDTVERMTKGHYKKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            MEQRF+E+VA+KGL+ V+TE++DLDWESTF LKHLPVSNI +IPDL+D YRKVMKEFA+
Sbjct  61   MEQRFRELVASKGLEYVETEVHDLDWESTFHLKHLPVSNIYQIPDLDDDYRKVMKEFAV  119



>gb|KDP30813.1| hypothetical protein JCGZ_13756 [Jatropha curcas]
Length=319

 Score =   194 bits (494),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 87/115 (76%), Positives = 101/115 (88%), Gaps = 0/115 (0%)
 Frame = +3

Query  90   FPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKCMEQ  269
            FP+INL +LN  ER   M +IKDACENWGFFEL++HGI+ E +DTVE+LTK HY+KCMEQ
Sbjct  3    FPVINLEKLNGGERAVTMAKIKDACENWGFFELLNHGIAPEFLDTVERLTKAHYRKCMEQ  62

Query  270  RFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            RFKEMVA+KGLDA QTEI D+DWESTFFL+HLP SNI+EIPDL+D YRKVMKEFA
Sbjct  63   RFKEMVASKGLDATQTEIKDMDWESTFFLRHLPQSNIAEIPDLDDEYRKVMKEFA  117



>gb|AAU10090.1| 1-aminocyclopropane-1-carboxylate oxidase [Fragaria x ananassa]
Length=320

 Score =   194 bits (494),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 86/119 (72%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FP+IN+ +LN EER A ME IKDACENWGFFELV+HGI    +DTVEK+TKDHYK C
Sbjct  1    MENFPVINMEKLNGEERNATMETIKDACENWGFFELVNHGIPTVFLDTVEKMTKDHYKNC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            +EQRFKE VA+KGL+AV TE+ND+DWESTF+LKHLP SNISE+PDL++ YRKVMK+FA+
Sbjct  61   LEQRFKEPVASKGLNAVNTEVNDMDWESTFYLKHLPRSNISEVPDLDEEYRKVMKDFAL  119



>ref|XP_009365121.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase [Pyrus x 
bretschneideri]
 ref|XP_009365122.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase [Pyrus x 
bretschneideri]
 dbj|BAD61000.1| 1-aminocyclopropane-1-carboxylate oxidase [Pyrus pyrifolia]
Length=322

 Score =   194 bits (494),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 86/119 (72%), Positives = 103/119 (87%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FP+INL  LN E R A ME+IKDACENWGFFELV HGI  EL+DTVE+LTK+HYK+C
Sbjct  1    MENFPVINLESLNGEGRKATMEKIKDACENWGFFELVSHGIPTELLDTVERLTKEHYKQC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            +EQRFKE+VA+KGL+ VQTE+ D+DWESTF L+HLP SNISE+PDL+D YR VMKEFA+
Sbjct  61   LEQRFKELVASKGLEGVQTEVKDMDWESTFHLRHLPQSNISEVPDLKDEYRNVMKEFAL  119



>gb|AGM48542.1| 1-aminocyclopropane-1-carboxylate oxidase [Coffea arabica]
Length=318

 Score =   194 bits (493),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 89/118 (75%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            MA+FP+I++ +L+ EER A M  IKDACE+WGFFE+++HGIS ELMDTVE+LTK+HYKKC
Sbjct  1    MATFPVIDMEKLDGEERAATMGVIKDACESWGFFEVLNHGISNELMDTVERLTKEHYKKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            ME +FKEMV +K L+AVQTEINDLDWESTFFL+HLPVSNISE+PDL+D YRKVMKEFA
Sbjct  61   MELKFKEMVESKELEAVQTEINDLDWESTFFLRHLPVSNISEVPDLDDEYRKVMKEFA  118



>emb|CDP21175.1| unnamed protein product, partial [Coffea canephora]
Length=174

 Score =   189 bits (481),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 83/119 (70%), Positives = 103/119 (87%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FP+IN+  LN ++R + ME IKDACENWGFFELV+HGI  E+MDTVE+LTK HYKKC
Sbjct  1    MENFPVINMKNLNGDKRASTMEHIKDACENWGFFELVNHGIPHEMMDTVERLTKGHYKKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            MEQRFKE+VA+K L+ VQ EI D+DWESTFFL+HLPVSNIS++PDL++ YR +MKEFA+
Sbjct  61   MEQRFKELVASKALEGVQVEITDMDWESTFFLRHLPVSNISQVPDLDNEYRTIMKEFAV  119



>gb|AAB05171.1| ACC oxidase [Nicotiana glutinosa]
Length=320

 Score =   194 bits (493),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 91/118 (77%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M SFPI+++  LNTE+R  IME++KDACENWGF ELV+HGIS ELMDTVEKLTK+HY K 
Sbjct  1    MESFPIVDMEMLNTEQRAVIMEKLKDACENWGFLELVNHGISHELMDTVEKLTKEHYNKS  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            MEQRFKEMV  KGL+ VQTEI+DLDWES FFLKHLPVSNIS+IPDL+  YRKVMKEFA
Sbjct  61   MEQRFKEMVTNKGLEVVQTEIDDLDWESAFFLKHLPVSNISDIPDLDHDYRKVMKEFA  118



>dbj|BAG30908.1| ACC oxidase [Capsicum chinense]
Length=319

 Score =   194 bits (493),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 88/118 (75%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FPIINL +LN  ER   M  IKDACENWGFFELV+HGI  E+MDTVEKLTK HYKKC
Sbjct  1    MENFPIINLEKLNGAERANTMGMIKDACENWGFFELVNHGIPHEVMDTVEKLTKGHYKKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            MEQRFKE+VA+KGL+AVQ E+ DLDWESTFFL+HLPVSNIS++PDL+D YR+VM++FA
Sbjct  61   MEQRFKELVASKGLEAVQAEVTDLDWESTFFLRHLPVSNISDVPDLDDEYREVMRDFA  118



>gb|EYU33867.1| hypothetical protein MIMGU_mgv1a010647mg [Erythranthe guttata]
Length=306

 Score =   194 bits (492),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 90/118 (76%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            MASFP+IN+ +L+ EER A M  I DACENWGFFELV+HGI  E+MDTVEKLTKDHYKKC
Sbjct  1    MASFPVINMEKLHGEERGATMAMINDACENWGFFELVNHGIGREIMDTVEKLTKDHYKKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            MEQRFKEMVA  GL+ V++EI DLDWE+TFFL+HLP+SNISE  DLED YRKVMKEFA
Sbjct  61   MEQRFKEMVAKTGLENVESEIKDLDWETTFFLRHLPLSNISEFHDLEDEYRKVMKEFA  118



>ref|XP_010035507.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 1-like [Eucalyptus 
grandis]
Length=320

 Score =   194 bits (493),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 88/119 (74%), Positives = 105/119 (88%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FP IN+  LN E+R   M++IKDACENWGFFELV+HGI  ELMDTVE++TK HYKKC
Sbjct  1    MENFPAINMENLNGEQRAITMDKIKDACENWGFFELVNHGIPPELMDTVERMTKGHYKKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            MEQRFKE+VA+KGL+ V+TE++DLDWESTF LKHLPVSNIS+IPDL+D YRKVMKEFA+
Sbjct  61   MEQRFKELVASKGLEYVETEVHDLDWESTFHLKHLPVSNISQIPDLDDDYRKVMKEFAV  119



>ref|XP_002320487.1| 1-aminocyclopropane-1-carboxylate oxidase family protein [Populus 
trichocarpa]
 gb|ABK96069.1| unknown [Populus trichocarpa]
 gb|EEE98802.1| 1-aminocyclopropane-1-carboxylate oxidase family protein [Populus 
trichocarpa]
Length=319

 Score =   194 bits (493),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = +3

Query  90   FPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKCMEQ  269
            FP+I++ +LN EER A ME+IKDACENWGFFEL++HGIS E +DTVE++TK+HYKKCMEQ
Sbjct  3    FPVISMEKLNGEERAATMEKIKDACENWGFFELLNHGISHEFLDTVERMTKEHYKKCMEQ  62

Query  270  RFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            RFKE+VA+K LD VQTEI DLDWESTF L+HLP SNI+EIPDL+D YRKVMKEFA+
Sbjct  63   RFKELVASKALDGVQTEIKDLDWESTFQLRHLPKSNIAEIPDLDDEYRKVMKEFAL  118



>ref|XP_010035506.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 1-like [Eucalyptus 
grandis]
Length=320

 Score =   194 bits (493),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 88/119 (74%), Positives = 105/119 (88%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FP IN+  LN E+R   M++IKDACENWGFFELV+HGI  ELMDTVE++TK HYKKC
Sbjct  1    MENFPAINMENLNGEQRAITMDKIKDACENWGFFELVNHGIPPELMDTVERMTKGHYKKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            MEQRFKE+VA+KGL+ V+TE++DLDWESTF LKHLPVSNIS+IPDL+D YRKVMKEFA+
Sbjct  61   MEQRFKELVASKGLEYVETEVHDLDWESTFHLKHLPVSNISQIPDLDDDYRKVMKEFAV  119



>gb|AAB70884.1| 1-aminocyclopropane-1-carboxylate oxidase [Pelargonium x hortorum]
Length=320

 Score =   194 bits (493),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 85/119 (71%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M  FP+INL +LN E R   M++IKDACENWGFFE+++HGI  EL+DTVEK+TK+HYKKC
Sbjct  1    MEKFPVINLEKLNGEGRAETMDKIKDACENWGFFEVLNHGIPYELLDTVEKMTKEHYKKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            MEQRFKEMV +KGLD V+ E+ D+DWESTFFLKHLP SNIS++PDL+D+YRKVMKEFA+
Sbjct  61   MEQRFKEMVTSKGLDGVEAEVEDMDWESTFFLKHLPESNISQVPDLQDNYRKVMKEFAL  119



>gb|AEM62883.1| ACC oxidase 5 [Actinidia chinensis]
Length=318

 Score =   194 bits (493),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 85/119 (71%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FP+IN+ +LN E+R A ME I DACENWGFFELV+HGISIEL+D VE++TK+HYKKC
Sbjct  1    METFPVINMQKLNGEQRGATMELINDACENWGFFELVNHGISIELLDRVERMTKEHYKKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            MEQRFKE+VA+K L+ VQ E+  +DWESTFFL+HLP SNISE+PDL+D YRKVMKEFA+
Sbjct  61   MEQRFKELVASKALEGVQAEVTTMDWESTFFLRHLPQSNISEVPDLDDEYRKVMKEFAL  119



>gb|AEM62880.1| ACC oxidase 3 [Actinidia deliciosa]
Length=319

 Score =   194 bits (493),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 88/118 (75%), Positives = 105/118 (89%), Gaps = 0/118 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FP+I++ +L  +ER   ME+I DACENWGFFEL++HGIS ELMDTVE+LTK+HYKKC
Sbjct  1    MEAFPVIDMEKLTGKERSPTMEKINDACENWGFFELMNHGISHELMDTVERLTKEHYKKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            MEQRFKEMVA KGL+A+Q+EI+DLDWESTFFL+HLPVSNISEIPDLE  +RK MKEFA
Sbjct  61   MEQRFKEMVATKGLEALQSEIDDLDWESTFFLRHLPVSNISEIPDLEQDHRKAMKEFA  118



>gb|KFK42831.1| hypothetical protein AALP_AA1G045000 [Arabis alpina]
Length=323

 Score =   194 bits (493),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 87/118 (74%), Positives = 105/118 (89%), Gaps = 0/118 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M SFPIINL +LN EER  IME+IKDACENWGFFE V+HGIS EL+D VEK+TK+HYKKC
Sbjct  1    MESFPIINLEKLNGEERGIIMEKIKDACENWGFFECVNHGISHELLDKVEKMTKEHYKKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            ME+RFKE +  +GLD+V++E+ND+DWESTF+LKHLPVSNIS++PDLED YR +MKEFA
Sbjct  61   MEERFKESIKNRGLDSVRSEVNDVDWESTFYLKHLPVSNISDVPDLEDDYRTLMKEFA  118



>dbj|BAF33504.1| ACC synthase [Orobanche minor]
Length=311

 Score =   194 bits (492),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 88/120 (73%), Positives = 108/120 (90%), Gaps = 1/120 (1%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FP+IN+ +LN EER A ME IKDACENWGFFE+++HGI+ E MD+VE+LTK+HYKKC
Sbjct  1    MTTFPVINMEKLNGEERSATMEMIKDACENWGFFEVMNHGIAPEFMDSVERLTKEHYKKC  60

Query  261  MEQRFKEMVAAKG-LDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            ME+RF+EMVA+KG ++A+Q+EINDLDWESTFFL HLPVSNISEIP L+D YRKVMKEFA+
Sbjct  61   MEKRFEEMVASKGNIEALQSEINDLDWESTFFLTHLPVSNISEIPHLQDEYRKVMKEFAV  120



>ref|NP_001233928.1| 1-aminocyclopropane-1-carboxylate oxidase 4 [Solanum lycopersicum]
 sp|P24157.1|ACCO4_SOLLC RecName: Full=1-aminocyclopropane-1-carboxylate oxidase 4; Short=ACC 
oxidase 4; AltName: Full=Ethylene-forming enzyme; Short=EFE; 
AltName: Full=Protein pHTOM5 [Solanum lycopersicum]
 emb|CAA41689.1| ethylene-forming enzyme [Solanum lycopersicum]
 emb|CAA90904.1| 1-aminocyclopropane-1-carboxylic acid oxidase [Solanum lycopersicum]
Length=316

 Score =   194 bits (492),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 87/118 (74%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FPIINL  LN +ER   ME IKDACENWGFFELV+HGI  E+MDTVEKLTK HYKKC
Sbjct  1    MENFPIINLENLNGDERAKTMEMIKDACENWGFFELVNHGIPHEVMDTVEKLTKGHYKKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            MEQRFKE+VA+KGL+AVQ E+ DLDWESTFFL+HLP SNIS++PDL++ YR+VM++FA
Sbjct  61   MEQRFKELVASKGLEAVQAEVTDLDWESTFFLRHLPTSNISQVPDLDEEYREVMRDFA  118



>dbj|BAA94601.1| 1-aminocyclopropane-1-carboxylate oxidase [Populus x canadensis]
Length=319

 Score =   194 bits (492),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = +3

Query  90   FPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKCMEQ  269
            FP+I++ +LN EER A ME+IKDACENWGFFEL++HGIS E +DTVE++TK+HYKKCMEQ
Sbjct  3    FPVISMEKLNGEERAATMEKIKDACENWGFFELLNHGISHEFLDTVERMTKEHYKKCMEQ  62

Query  270  RFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            RFKE+VA+K LD VQTEI DLDWESTF L+HLP SNI+EIPDL+D YRKVMKEFA+
Sbjct  63   RFKELVASKALDGVQTEIKDLDWESTFQLRHLPKSNIAEIPDLDDEYRKVMKEFAL  118



>dbj|BAD60998.1| 1-aminocyclopropane-1-carboxylate oxidase [Pyrus pyrifolia]
 gb|AFA46528.1| ACC oxidase [Pyrus pyrifolia]
Length=322

 Score =   194 bits (492),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 83/119 (70%), Positives = 105/119 (88%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FP+INL  LN E R A ME+IKDACENWGFFELV HGI  E +DTVE+LTK+HY++C
Sbjct  1    MENFPVINLESLNGEGRKATMEKIKDACENWGFFELVSHGIPTEFLDTVERLTKEHYRQC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            +EQ+FKE+VA+KGL+AV+TE+ND+DWESTF+L+HLP SNIS++PDL+D YR VMKEFA+
Sbjct  61   LEQKFKELVASKGLEAVKTEVNDMDWESTFYLRHLPQSNISQVPDLKDEYRNVMKEFAL  119



>gb|ACU18811.1| unknown [Glycine max]
Length=235

 Score =   191 bits (485),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 87/119 (73%), Positives = 105/119 (88%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FP+INL +LN EER   ME+IKDACENWGFFELV+HGI  +L+DTVE+LTK+HY+KC
Sbjct  1    MTNFPVINLEKLNGEERNDTMEKIKDACENWGFFELVNHGIPHDLLDTVERLTKEHYRKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            ME+RFKE +A+KGLDAVQTE+ D+DWESTF L+HLP SNISEIPDL D YRKVMK+FA+
Sbjct  61   MEERFKEFMASKGLDAVQTEVKDMDWESTFHLRHLPESNISEIPDLIDEYRKVMKDFAL  119



>dbj|BAA19605.1| ACC-oxidase [Vigna angularis]
Length=310

 Score =   193 bits (491),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 85/118 (72%), Positives = 104/118 (88%), Gaps = 0/118 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FP+INL  +N EER A++E+I+DACENWGFFELV+HGI +EL+DTVE+LTK+HY+KC
Sbjct  1    MENFPVINLENINGEERKAVLEKIEDACENWGFFELVNHGIPLELLDTVERLTKEHYRKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            MEQRFKE VA+KGL+ VQ EI D+DWESTFFL+HLP SNISEIPDL + YRK MK+FA
Sbjct  61   MEQRFKEAVASKGLEGVQGEIKDMDWESTFFLRHLPHSNISEIPDLSEEYRKAMKDFA  118



>sp|Q08508.1|ACCO4_PETHY RecName: Full=1-aminocyclopropane-1-carboxylate oxidase 4; Short=ACC 
oxidase 4; AltName: Full=Ethylene-forming enzyme; Short=EFE 
[Petunia x hybrida]
 gb|AAA33698.1| 1-aminocyclopropane-1-carboxylate oxidase [Petunia x hybrida]
Length=319

 Score =   194 bits (492),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 89/118 (75%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FPIINL  L   ER A ME IKDACENWGFFELV+HGI  E+MDTVEK TK HYKKC
Sbjct  1    MENFPIINLENLCGAERDATMEMIKDACENWGFFELVNHGIPHEVMDTVEKFTKGHYKKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            MEQRFKE+VA+KGL+AVQ E+ DLDWESTFFL+HLPVSNISE+PDL+D YR+VM++FA
Sbjct  61   MEQRFKELVASKGLEAVQAEVTDLDWESTFFLRHLPVSNISEVPDLDDEYREVMRDFA  118



>ref|XP_010035510.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 1-like [Eucalyptus 
grandis]
Length=320

 Score =   194 bits (492),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 87/119 (73%), Positives = 105/119 (88%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FP IN+  LN E+R   M++IKDACENWGFFELV+HGI  ELMDTVE++TK HYKKC
Sbjct  1    MENFPAINMENLNGEQRAITMDKIKDACENWGFFELVNHGIPPELMDTVERMTKGHYKKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            MEQRFKE+VA+ GL++V+TE++DLDWESTF LKHLPVSNIS+IPDL+D YRKVMKEFA+
Sbjct  61   MEQRFKELVASNGLESVETEVHDLDWESTFHLKHLPVSNISQIPDLDDDYRKVMKEFAV  119



>ref|XP_009613638.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase-like [Nicotiana 
tomentosiformis]
Length=320

 Score =   194 bits (492),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 86/118 (73%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = +3

Query  84   ASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKCM  263
            ++FP+++L  L TE+R   M++IKDACENWGFFELV+HGIS E++DT+EKLTK+HYKKCM
Sbjct  3    STFPVVDLWLLQTEKRAETMDKIKDACENWGFFELVNHGISHEVLDTIEKLTKEHYKKCM  62

Query  264  EQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            EQRFKEMVA+KGL+AVQTEI+DLDWESTF+LKHLPVSN+ E+P+LED YR VMK+FA+
Sbjct  63   EQRFKEMVASKGLEAVQTEIDDLDWESTFYLKHLPVSNLYEVPELEDKYRNVMKDFAL  120



>dbj|BAA21541.1| 1-aminocyclopropane-1-carboxylic acid oxidase [Actinidia deliciosa]
Length=317

 Score =   193 bits (491),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 88/116 (76%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = +3

Query  87   SFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKCME  266
            +FP+I++ +L  +ER   ME+I DACENWGFFEL++HGIS ELMDTVE+LTK+HYKKCME
Sbjct  1    TFPVIDMEKLTGKERSPTMEKINDACENWGFFELMNHGISHELMDTVERLTKEHYKKCME  60

Query  267  QRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            QRFKEMVA KGL+AVQ+EI+DLDWESTFFL+HLPVSNISEIPDLE  +RK MKEFA
Sbjct  61   QRFKEMVATKGLEAVQSEIDDLDWESTFFLRHLPVSNISEIPDLEQDHRKAMKEFA  116



>gb|AEM62884.1| ACC oxidase 5 [Actinidia deliciosa]
Length=318

 Score =   193 bits (491),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 85/119 (71%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FP+IN+ +LN E+R A ME I DACENWGFFELV+HGISIEL+D VE++TK+HYKKC
Sbjct  1    METFPVINMEKLNGEQRGATMELINDACENWGFFELVNHGISIELLDRVERMTKEHYKKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            MEQRFKE+VA+K L+ VQ E+  +DWESTFFL+HLP SNISE+PDL+D YRKVMKEFA+
Sbjct  61   MEQRFKELVASKALEGVQAEVTTMDWESTFFLRHLPQSNISEVPDLDDEYRKVMKEFAL  119



>ref|XP_010035511.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 3-like [Eucalyptus 
grandis]
 gb|KCW46933.1| hypothetical protein EUGRSUZ_K00747 [Eucalyptus grandis]
Length=320

 Score =   193 bits (491),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 85/119 (71%), Positives = 105/119 (88%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M SFP+IN+  LN E+R   M++IKDACENWGFFELV+HGI  E MDTVE++TK HY+KC
Sbjct  1    MESFPVINMENLNGEKRAITMDKIKDACENWGFFELVNHGIPPEFMDTVERMTKGHYRKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            M+QRF+E+VA+KGL+ VQTE++DLDWESTF LKHLP+SNIS++PDLED YRKVMKEFA+
Sbjct  61   MDQRFRELVASKGLENVQTEVHDLDWESTFHLKHLPLSNISQVPDLEDDYRKVMKEFAV  119



>ref|XP_006357981.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 4-like [Solanum 
tuberosum]
Length=318

 Score =   193 bits (491),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 87/118 (74%), Positives = 104/118 (88%), Gaps = 0/118 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FPIINL  LN +ER   +E IKDACENWGFFELV+HGI  E+MDTVEKLTK HYKKC
Sbjct  1    MENFPIINLENLNGDERSNTLELIKDACENWGFFELVNHGIPHEVMDTVEKLTKGHYKKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            MEQRFKE+VA+KGL+AVQ E+ DLDWESTFFL+HLPVSNIS++PDL++ YR+VM++FA
Sbjct  61   MEQRFKELVASKGLEAVQAEVTDLDWESTFFLRHLPVSNISQVPDLDNEYREVMRDFA  118



>ref|XP_010035508.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase-like [Eucalyptus 
grandis]
 gb|KCW46932.1| hypothetical protein EUGRSUZ_K00746 [Eucalyptus grandis]
Length=320

 Score =   193 bits (491),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 85/119 (71%), Positives = 105/119 (88%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M SFP+IN+  LN E+R   M++IKDACENWGFFELV+HGI  E MDTVE++TK HY+KC
Sbjct  1    MESFPVINMENLNGEKRAITMDKIKDACENWGFFELVNHGIPPEFMDTVERMTKGHYRKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            M+QRF+E+VA+KGL+ VQTE++DLDWESTF LKHLP+SNIS++PDLED YRKVMKEFA+
Sbjct  61   MDQRFRELVASKGLENVQTEVHDLDWESTFHLKHLPLSNISQVPDLEDDYRKVMKEFAV  119



>sp|P05116.2|ACCO1_SOLLC RecName: Full=1-aminocyclopropane-1-carboxylate oxidase 1; Short=ACC 
oxidase 1; AltName: Full=Ethylene-forming enzyme; Short=EFE; 
AltName: Full=Protein pTOM 13 [Solanum lycopersicum]
 emb|CAA41212.1| 1-Aminocyclopropane-1-carboxylic acid oxidase [Solanum lycopersicum]
 gb|ADO32577.1| 1-aminocyclopropane-1-carboxylic acid oxidase [Solanum lycopersicum]
Length=315

 Score =   193 bits (491),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 86/118 (73%), Positives = 104/118 (88%), Gaps = 0/118 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FPIINL +LN +ER   ME IKDACENWGFFELV+HGI  E+MDTVEK+TK HYKKC
Sbjct  1    MENFPIINLEKLNGDERANTMEMIKDACENWGFFELVNHGIPHEVMDTVEKMTKGHYKKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            MEQRFKE+VA+KGL+AVQ E+ DLDWESTFFL+HLP SNIS++PDL++ YR+VM++FA
Sbjct  61   MEQRFKELVASKGLEAVQAEVTDLDWESTFFLRHLPTSNISQVPDLDEEYREVMRDFA  118



>ref|XP_010035504.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 3 [Eucalyptus 
grandis]
 gb|KCW46925.1| hypothetical protein EUGRSUZ_K00739 [Eucalyptus grandis]
Length=320

 Score =   193 bits (491),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 86/119 (72%), Positives = 103/119 (87%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M SFP+IN+  LN E+R   M++IKDACENWGFFELV+HGI  E MDT+E +TK HYKKC
Sbjct  1    MESFPVINMENLNGEKRAITMDKIKDACENWGFFELVNHGIPPEFMDTIESMTKGHYKKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            MEQRF E+VA+KGL+ VQTE++DLDWESTF LKHLPVSNIS+IPDL+D YR+VMKEFA+
Sbjct  61   MEQRFGELVASKGLECVQTEVHDLDWESTFHLKHLPVSNISQIPDLDDDYRRVMKEFAL  119



>ref|XP_008440054.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 3 [Cucumis 
melo]
Length=320

 Score =   193 bits (491),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 87/115 (76%), Positives = 103/115 (90%), Gaps = 0/115 (0%)
 Frame = +3

Query  90   FPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKCMEQ  269
            FP+IN+  LN E R +++ QI DACENWGFFELV+HGIS ELMD VEKLTK+HY+KCMEQ
Sbjct  5    FPVINMNNLNGESRVSVLNQINDACENWGFFELVNHGISHELMDKVEKLTKEHYRKCMEQ  64

Query  270  RFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            RFKEMVA+KGLD+V+TEIND DWESTFFL+HLPVSN+SEI DL++ Y+KVMKEFA
Sbjct  65   RFKEMVASKGLDSVETEINDTDWESTFFLRHLPVSNMSEIGDLDEEYKKVMKEFA  119



>sp|P54847.1|ACCO3_CUCME RecName: Full=1-aminocyclopropane-1-carboxylate oxidase 3; Short=ACC 
oxidase 3; AltName: Full=Ethylene-forming enzyme; Short=EFE 
[Cucumis melo]
 emb|CAA64799.1| ACC oxidase [Cucumis melo]
Length=320

 Score =   193 bits (491),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 87/115 (76%), Positives = 103/115 (90%), Gaps = 0/115 (0%)
 Frame = +3

Query  90   FPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKCMEQ  269
            FP+IN+  LN E R +++ QI DACENWGFFELV+HGIS ELMD VEKLTK+HY+KCMEQ
Sbjct  5    FPVINMNNLNGESRVSVLNQINDACENWGFFELVNHGISHELMDKVEKLTKEHYRKCMEQ  64

Query  270  RFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            RFKEMVA+KGLD+V+TEIND DWESTFFL+HLPVSN+SEI DL++ Y+KVMKEFA
Sbjct  65   RFKEMVASKGLDSVETEINDTDWESTFFLRHLPVSNMSEIGDLDEEYKKVMKEFA  119



>gb|AAL37174.1|AF320071_1 1-aminocyclopropane-1-carboxylate oxidase [Carica papaya]
Length=318

 Score =   193 bits (490),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 88/119 (74%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FP+I+L++LN EER   ME I DACENWGFFELV+HGIS +LMDTVE+LTK+HY KC
Sbjct  1    MENFPVIDLSKLNGEERALTMELIHDACENWGFFELVNHGISHDLMDTVERLTKEHYMKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            MEQRFKEMV + GL+AVQ+EIND+DWESTFFL+HLP SN+ EIPDLED YRK MKEFA+
Sbjct  61   MEQRFKEMVESNGLEAVQSEINDMDWESTFFLRHLPASNMHEIPDLEDDYRKAMKEFAV  119



>ref|XP_004293334.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 1 [Fragaria 
vesca subsp. vesca]
Length=312

 Score =   193 bits (490),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 86/119 (72%), Positives = 106/119 (89%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FP++N+ QLN E+R A ME+I DACENWGFFEL++HGIS ELMD VEKLTK+HY+KC
Sbjct  1    MENFPVVNMEQLNGEKRAATMEKINDACENWGFFELMNHGISHELMDKVEKLTKEHYRKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            MEQRFKEMVA+KGL+AV +EI DLDWESTFFL+HLP SNIS++PDL++ YR+ MKEFA+
Sbjct  61   MEQRFKEMVASKGLEAVNSEIEDLDWESTFFLRHLPFSNISQVPDLDEDYREAMKEFAV  119



>ref|XP_009604053.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase [Nicotiana 
tomentosiformis]
Length=319

 Score =   193 bits (490),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 87/118 (74%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FPIINL +LN  ER   ME IKDACENWGFFELV+HGI  E+MDTVEK+TK HYKKC
Sbjct  1    MENFPIINLEKLNGSERADTMEMIKDACENWGFFELVNHGIPHEVMDTVEKMTKGHYKKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            MEQRFKE+VA KGL+AVQ E+ DLDWESTFFL+HLPVSNISE+ DL+D YR++M++FA
Sbjct  61   MEQRFKELVAGKGLEAVQAEVTDLDWESTFFLRHLPVSNISEVSDLDDQYREIMRDFA  118



>dbj|BAC53656.1| 1-aminocyclopropene-1-carboxylate oxidase [Malus domestica]
Length=322

 Score =   193 bits (490),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 85/119 (71%), Positives = 102/119 (86%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FP+INL  LN E R A ME+IKDACENWGFFELV HGI  E +DTVE+LTK+HYK+C
Sbjct  1    MENFPVINLESLNGEGRKATMEKIKDACENWGFFELVSHGIPTEFLDTVERLTKEHYKQC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            +EQRFKE+VA+KGL+ VQTE+ D+DWESTF L+HLP SNISE+PDL+D YR VMKEFA+
Sbjct  61   LEQRFKELVASKGLEGVQTEVKDMDWESTFHLRHLPQSNISEVPDLKDEYRNVMKEFAL  119



>emb|CAH64841.1| 1-aminocyclopropane-1-carboxylate oxidase [Carica papaya]
Length=318

 Score =   193 bits (490),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 88/119 (74%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FP+I+L++LN EER   ME I DACENWGFFELV+HGIS +LMDTVE+LTK+HY KC
Sbjct  1    MENFPVIDLSKLNGEERALTMELIHDACENWGFFELVNHGISHDLMDTVERLTKEHYMKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            MEQRFKEMV + GL+AVQ+EIND+DWESTFFL+HLP SN+ EIPDLED YRK MKEFA+
Sbjct  61   MEQRFKEMVESNGLEAVQSEINDMDWESTFFLRHLPASNMHEIPDLEDDYRKAMKEFAV  119



>gb|AAK57516.1| ACC oxidase [Carica papaya]
 gb|AAS16933.1| 1-aminocyclopropane-1-carboxylate oxidase 1 [Carica papaya]
 gb|AAT99444.1| ripening related ACC oxidase 1 [Carica papaya]
Length=318

 Score =   193 bits (490),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 88/119 (74%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FP+I+L++LN EER   ME I DACENWGFFELV+HGIS +LMDTVE+LTK+HY KC
Sbjct  1    MENFPVIDLSKLNGEERALTMELIHDACENWGFFELVNHGISHDLMDTVERLTKEHYMKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            MEQRFKEMV + GL+AVQ+EIND+DWESTFFL+HLP SN+ EIPDLED YRK MKEFA+
Sbjct  61   MEQRFKEMVESNGLEAVQSEINDMDWESTFFLRHLPASNMHEIPDLEDDYRKAMKEFAV  119



>ref|XP_008348143.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase [Malus domestica]
 ref|XP_008348145.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase [Malus domestica]
Length=322

 Score =   193 bits (490),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 85/119 (71%), Positives = 102/119 (86%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FP+INL  LN E R A ME+IKDACENWGFFELV HGI  E +DTVE+LTK+HYK+C
Sbjct  1    MENFPVINLESLNGEGRKATMEKIKDACENWGFFELVSHGIPTEFLDTVERLTKEHYKQC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            +EQRFKE+VA+KGL+ VQTE+ D+DWESTF L+HLP SNISE+PDL+D YR VMKEFA+
Sbjct  61   LEQRFKELVASKGLEGVQTEVKDMDWESTFHLRHLPQSNISEVPDLKDEYRNVMKEFAL  119



>dbj|BAD60999.1| 1-aminocyclopropane-1-carboxylate oxidase [Pyrus pyrifolia]
Length=322

 Score =   193 bits (490),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 83/119 (70%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FP+INL  LN E R A ME+IKDACENWGFFELV HGI  E +DTVE+LTK+HY++C
Sbjct  1    MENFPVINLESLNGEGRKATMEKIKDACENWGFFELVSHGIPTEFLDTVERLTKEHYRQC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            +EQ+FKE+VA+KGL+AVQTE+ D+DWESTF+L+HLP SNIS++PDL+D YR VMKEFA+
Sbjct  61   LEQKFKELVASKGLEAVQTEVKDMDWESTFYLRHLPQSNISQVPDLKDEYRNVMKEFAL  119



>emb|CAA82646.1| ethylene forming enzyme (EFE) [Nicotiana tabacum]
Length=319

 Score =   192 bits (489),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 86/118 (73%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FPIINL +LN  E+ A ME IKDACENWGFFELV+HGI  E+MDTVEKLTK HYKKC
Sbjct  1    MENFPIINLEKLNGSEKAATMEMIKDACENWGFFELVNHGIPHEVMDTVEKLTKGHYKKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            MEQRFKE+VA+KGL+ VQ E+ D+DW  TFFL+HLPVSNISE+PDL+D YR+VM++FA
Sbjct  61   MEQRFKELVASKGLEGVQAEVTDMDWVCTFFLRHLPVSNISEVPDLDDQYREVMRDFA  118



>ref|XP_006383841.1| aminocyclopropane carboxylate oxidase family protein [Populus 
trichocarpa]
 gb|ERP61638.1| aminocyclopropane carboxylate oxidase family protein [Populus 
trichocarpa]
Length=318

 Score =   192 bits (488),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 86/119 (72%), Positives = 106/119 (89%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FP+I+L++LN EER   ME I DACENWGFFELV+HGIS +L+D VE+LTK+HY+KC
Sbjct  1    METFPVIDLSKLNGEERKPTMEVINDACENWGFFELVNHGISHDLLDAVERLTKEHYRKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            MEQRFKEMVA+KGL+AVQ+EI+DLDWESTFFL+HLP SN++EIPDL + YRK MKEFA+
Sbjct  61   MEQRFKEMVASKGLEAVQSEIDDLDWESTFFLRHLPESNLAEIPDLGEDYRKTMKEFAL  119



>gb|AAB02051.1| 1-aminocyclopropane-1-carboxylate oxidase [Carica papaya]
Length=310

 Score =   192 bits (488),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 85/119 (71%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FP+IN+  LN EER A M++I+DACENWGFFELV+HGI IEL+DTVE+LTK HY+KC
Sbjct  1    MENFPVINMEGLNGEERAATMKKIEDACENWGFFELVNHGIPIELLDTVERLTKGHYRKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            MEQRFKE++A+KGLD +QTE+ D+DWESTFF  HLP  NI+EIPDL+D YRKVMKEFA+
Sbjct  61   MEQRFKEIMASKGLDGIQTEVTDMDWESTFFNCHLPEPNIAEIPDLDDEYRKVMKEFAL  119



>gb|ABK96379.1| unknown [Populus trichocarpa x Populus deltoides]
Length=318

 Score =   192 bits (488),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 86/119 (72%), Positives = 106/119 (89%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FP+I+L++LN EER   ME I DACENWGFFELV+HGIS +L+D VE+LTK+HY+KC
Sbjct  1    METFPVIDLSKLNGEERKPTMEVINDACENWGFFELVNHGISHDLLDAVERLTKEHYRKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            MEQRFKEMVA+KGL+AVQ+EI+DLDWESTFFL+HLP SN++EIPDL + YRK MKEFA+
Sbjct  61   MEQRFKEMVASKGLEAVQSEIDDLDWESTFFLRHLPESNLAEIPDLGEDYRKTMKEFAL  119



>ref|XP_006595831.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase-like [Glycine 
max]
Length=315

 Score =   192 bits (487),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 87/119 (73%), Positives = 105/119 (88%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FP+INL +LN EER   ME+IKDACENWGFFELV+HGI  +L+DTVE+LTK+HY+KC
Sbjct  1    MTNFPVINLEKLNGEERNDTMEKIKDACENWGFFELVNHGIPHDLLDTVERLTKEHYRKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            ME+RFKE +A+KGLDAVQTE+ D+DWESTF L+HLP SNISEIPDL D YRKVMK+FA+
Sbjct  61   MEERFKEFMASKGLDAVQTEVKDMDWESTFHLRHLPESNISEIPDLIDEYRKVMKDFAL  119



>gb|AFZ76981.1| ACC oxidase [Boehmeria nivea]
Length=326

 Score =   192 bits (488),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 85/116 (73%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = +3

Query  87   SFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKCME  266
            +FP+I++++LN EER + ME I DACENWGFFEL++HGIS ELMD VE+LTK+HY+KCME
Sbjct  6    TFPVIDMSKLNGEERASTMEMINDACENWGFFELMNHGISHELMDIVERLTKEHYRKCME  65

Query  267  QRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            QRFKEMVA KGL+AVQ+EI DLDWESTFFL+HLP SNI+EIPDL D YR  M+EFA
Sbjct  66   QRFKEMVATKGLEAVQSEITDLDWESTFFLRHLPFSNIAEIPDLGDDYRSAMREFA  121



>gb|KDP20691.1| hypothetical protein JCGZ_21162 [Jatropha curcas]
Length=320

 Score =   192 bits (488),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 86/118 (73%), Positives = 106/118 (90%), Gaps = 0/118 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FP+I+L++L+ E R   M+ IKDACENWGFFELV+HGIS ELMDTVE+LTK+HY+KC
Sbjct  1    MENFPVIDLSKLSGEGRKETMDMIKDACENWGFFELVNHGISHELMDTVERLTKEHYRKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            ME+RFKEMVA+KGL+AV++EINDLDWESTFFL+HLPVSN++EIP+L   YRK MKEFA
Sbjct  61   MEERFKEMVASKGLEAVESEINDLDWESTFFLRHLPVSNLAEIPNLHQDYRKTMKEFA  118



>gb|ACU20024.1| unknown [Glycine max]
Length=235

 Score =   189 bits (481),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 86/119 (72%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FP+INL +LN EER   ME+IKDACENWGFFELV+HGI  +L+DTVE+LTK+HY+KC
Sbjct  1    MTNFPVINLEKLNGEERNDTMEKIKDACENWGFFELVNHGIPHDLLDTVERLTKEHYRKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            ME+RFKE +A+KGLDAVQTE+ D+DWESTF L+HLP  NISEIPDL D YRKVMK+FA+
Sbjct  61   MEERFKEFMASKGLDAVQTEVKDMDWESTFHLRHLPEPNISEIPDLIDEYRKVMKDFAL  119



>gb|KHN44756.1| 1-aminocyclopropane-1-carboxylate oxidase [Glycine soja]
Length=315

 Score =   192 bits (487),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 87/119 (73%), Positives = 105/119 (88%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FP+INL +LN EER   ME+IKDACENWGFFELV+HGI  +L+DTVE+LTK+HY+KC
Sbjct  1    MTNFPVINLEKLNGEERNDTMEKIKDACENWGFFELVNHGIPHDLLDTVERLTKEHYRKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            ME+RFKE +A+KGLDAVQTE+ D+DWESTF L+HLP SNISEIPDL D YRKVMK+FA+
Sbjct  61   MEERFKEFMASKGLDAVQTEVKDMDWESTFHLRHLPESNISEIPDLIDEYRKVMKDFAL  119



>emb|CAN85571.1| ACC oxidase 3 [Hevea brasiliensis]
Length=318

 Score =   192 bits (487),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 84/115 (73%), Positives = 101/115 (88%), Gaps = 0/115 (0%)
 Frame = +3

Query  90   FPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKCMEQ  269
            FP+INL +LN EER + M +IKDACENWGFFEL+DHGI  E +DTVE++TK HY+KCMEQ
Sbjct  3    FPVINLEKLNGEERASTMAKIKDACENWGFFELLDHGIEPEFLDTVERMTKGHYRKCMEQ  62

Query  270  RFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            RFKEM+A KGL+ VQTEI DLDWESTF+L+HLP SNI+++PDL+D YRKVMKEFA
Sbjct  63   RFKEMMAGKGLENVQTEIKDLDWESTFYLRHLPESNIAQVPDLDDEYRKVMKEFA  117



>emb|CAN68493.1| hypothetical protein VITISV_042552 [Vitis vinifera]
Length=307

 Score =   191 bits (486),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 87/119 (73%), Positives = 102/119 (86%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FP+IN+  LN EER A ME IKDACENWGFFELV+HGIS E MD VEKLTK HY+KC
Sbjct  1    MEAFPVINMEMLNGEERGATMEMIKDACENWGFFELVNHGISHEQMDAVEKLTKGHYRKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            MEQRFKE+VAAK L+ VQTEI D+DWESTFFL+HLPVSN+S+ PDL++ Y KVMK+FA+
Sbjct  61   MEQRFKELVAAKALEGVQTEIKDMDWESTFFLRHLPVSNVSDFPDLDEEYXKVMKDFAL  119



>emb|CAA71738.1| 1-aminocyclopropane-1-carboxylate oxidase [Betula pendula]
Length=318

 Score =   191 bits (486),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 84/118 (71%), Positives = 106/118 (90%), Gaps = 0/118 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            MA+FP+I++ +LN EER A ME I+DACENWGFFELV+HGIS +L+DTVEKL K+HY+KC
Sbjct  1    MATFPVIDMEKLNGEERGATMELIEDACENWGFFELVNHGISHDLLDTVEKLNKEHYRKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            ME+RFK+MVA+KGL+A Q+E+ D+DWESTFFL+HLP SN+SEIPDL++ YRK MKEFA
Sbjct  61   MEERFKDMVASKGLEAAQSEVRDMDWESTFFLRHLPASNMSEIPDLDEDYRKAMKEFA  118



>gb|AFF19571.1| 1-aminocyclopropane-1-carboxylate oxidase [Momordica charantia]
Length=317

 Score =   191 bits (486),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            MA FP+INL  +N + RP I+EQI+DAC NWGFFE+V+HGI  E +D VEK+T+DHYKKC
Sbjct  1    MAIFPVINLDSINGDARPKILEQIEDACRNWGFFEVVNHGIPHEFLDRVEKMTRDHYKKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEF  431
            ME+RFKE VA+KGL+A Q E+ND+DWESTFFL+HLP SNISEIPDL+D YRKVMKEF
Sbjct  61   MEERFKETVASKGLEAAQAEVNDMDWESTFFLRHLPQSNISEIPDLDDEYRKVMKEF  117



>gb|ACU82854.3| 1-aminocyclopropane-1-carboxylate oxidase [Eriobotrya japonica]
 gb|ADB10838.1| 1-aminocyclopropane-1-carboxylate oxidase [Eriobotrya japonica]
Length=322

 Score =   191 bits (486),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 84/119 (71%), Positives = 102/119 (86%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FP+INL  LN E R A ME+IKDACENWGFFELV HGI  E +DTVE+LTK+HYK+C
Sbjct  1    MENFPVINLQSLNGEGRKATMEKIKDACENWGFFELVSHGIPTEFLDTVERLTKEHYKQC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            +EQRFKE+VA+KGL+ V+TE+ D+DWESTF L+HLP SNISE+PDL+D YR VMKEFA+
Sbjct  61   LEQRFKELVASKGLEGVRTEVKDMDWESTFHLRHLPQSNISEVPDLKDEYRNVMKEFAL  119



>ref|XP_006351971.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 2-like [Solanum 
tuberosum]
Length=316

 Score =   191 bits (486),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 87/118 (74%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FPIINL +LN  ER A ME+I DACENWGFFELV+HGI  E+MDTVEKLTK HYKKC
Sbjct  1    MENFPIINLEKLNGAERAATMEKINDACENWGFFELVNHGIPHEVMDTVEKLTKGHYKKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            MEQRFKE+VA KGL+ V+ E+ D+DWESTFFL+HLP SNISEIPDL+D YR+VM++FA
Sbjct  61   MEQRFKELVAKKGLEGVEVEVTDMDWESTFFLRHLPSSNISEIPDLDDVYREVMRDFA  118



>ref|NP_001275482.1| 1-aminocyclopropane-1-carboxylate oxidase [Solanum tuberosum]
 gb|AAK68075.1|AF384820_1 1-aminocyclopropane-1-carboxylate oxidase [Solanum tuberosum]
Length=315

 Score =   191 bits (486),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 85/118 (72%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FPIINL +LN +ER   ME IKDACENWGFFELV+HGI  E+MDTV+K+TK HYKKC
Sbjct  1    MENFPIINLEKLNGDERANTMEMIKDACENWGFFELVNHGIPHEVMDTVDKMTKGHYKKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            MEQRFKE+VA+KGL+AVQ E+ DLDWESTFFL+HLP SNIS++PDL+  YR+VM++FA
Sbjct  61   MEQRFKELVASKGLEAVQAEVTDLDWESTFFLRHLPTSNISQVPDLDGEYREVMRDFA  118



>gb|ADK39027.1| 1-aminocyclopropane-1-carboxylic acid oxidase [Betula luminifera]
Length=318

 Score =   191 bits (485),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 84/118 (71%), Positives = 106/118 (90%), Gaps = 0/118 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            MA+FP+I++ +LN EER   ME I+DACENWGFFELV+HGIS +L+DTVEKL K+HY+KC
Sbjct  1    MATFPVIDMEKLNGEERGETMELIEDACENWGFFELVNHGISHDLLDTVEKLNKEHYRKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            ME+RFK+MVA+KGL+A Q+E++D+DWESTFFL+HLP SNISEIPDL++ YRK MKEFA
Sbjct  61   MEERFKDMVASKGLEAAQSEVSDMDWESTFFLRHLPASNISEIPDLDEDYRKAMKEFA  118



>gb|KHG21578.1| 1-aminocyclopropane-1-carboxylate oxidase 3 [Gossypium arboreum]
Length=317

 Score =   191 bits (485),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 83/119 (70%), Positives = 105/119 (88%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            MA+FP+INL +LN +ER  IMEQIKDACENWGFFE+++HGI  + MDTVE+LTK+HYKKC
Sbjct  1    MATFPVINLEKLNGDERSRIMEQIKDACENWGFFEVMNHGIPHDFMDTVERLTKEHYKKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            MEQRFKE+VA+K L+ ++ E+ D+DWESTF+L+HLP SN++EIPDL D YRKVMKEFA+
Sbjct  61   MEQRFKELVASKALEGLEAEVTDMDWESTFYLRHLPESNMAEIPDLSDEYRKVMKEFAV  119



>ref|XP_003519448.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase [Glycine 
max]
 gb|KHN38495.1| 1-aminocyclopropane-1-carboxylate oxidase [Glycine soja]
Length=315

 Score =   191 bits (485),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 86/119 (72%), Positives = 106/119 (89%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FP+INL +L+ EER   ME+IKDACENWGFFELV+HGI  +++DTVE+LTK+HY+KC
Sbjct  1    MTNFPLINLEKLSGEERNDTMEKIKDACENWGFFELVNHGIPHDILDTVERLTKEHYRKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            ME+RFKE+VA+KGLDAVQTE+ D+DWESTF L+HLP SNISEIPDL D YRKVMK+FA+
Sbjct  61   MEERFKELVASKGLDAVQTEVKDMDWESTFHLRHLPESNISEIPDLIDEYRKVMKDFAL  119



>emb|CAN85569.1| ACC oxidase 1 [Hevea brasiliensis]
Length=312

 Score =   191 bits (484),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 87/119 (73%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FP+I+L++L+ EER   ME I DACENWGFFELV+HG+S ELMDTVE LTK+HY+KC
Sbjct  1    METFPVIDLSKLSDEERKPTMEMIHDACENWGFFELVNHGMSPELMDTVEILTKEHYRKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            MEQRFKEMVA KGL+AVQ+EINDLDWEST FL HLPVSN++EIPDL++ YRK M EFA+
Sbjct  61   MEQRFKEMVARKGLEAVQSEINDLDWESTLFLSHLPVSNMAEIPDLDEEYRKTMNEFAV  119



>emb|CDP05673.1| unnamed protein product [Coffea canephora]
Length=319

 Score =   191 bits (484),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 84/119 (71%), Positives = 103/119 (87%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FPIIN+  L+ ++R + ME IKDACENWGFFELV+HGI  E+MDTVE+LTK HYKKC
Sbjct  1    MENFPIINMKNLHGDKRASTMEHIKDACENWGFFELVNHGIPHEMMDTVERLTKGHYKKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            MEQRFKE+VA+K L+ VQ EI D+DWESTFFL+HLPVSNIS++PDL+D YR +MKEFA+
Sbjct  61   MEQRFKELVASKALEGVQVEITDMDWESTFFLRHLPVSNISQVPDLDDEYRTIMKEFAV  119



>ref|XP_007141655.1| hypothetical protein PHAVU_008G214200g [Phaseolus vulgaris]
 gb|ESW13649.1| hypothetical protein PHAVU_008G214200g [Phaseolus vulgaris]
Length=315

 Score =   191 bits (484),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 85/119 (71%), Positives = 106/119 (89%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M++FP+IN  +LN EER  IME+IKDACENWGFFELVDHGI  +L+DTVE+LTK+HY+KC
Sbjct  1    MSNFPVINFEKLNGEERKDIMEKIKDACENWGFFELVDHGIPHDLLDTVERLTKEHYEKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            ME+RFKE +A+KGL+A+QTE+ D+DWESTF L+HLP SNISE+PDL D YRKVMK+FA+
Sbjct  61   MEERFKESMASKGLEAIQTEVKDMDWESTFHLRHLPESNISEVPDLVDEYRKVMKDFAL  119



>gb|AGV54270.1| 1-aminocyclopropane-1-carboxylic acid oxidase [Phaseolus vulgaris]
Length=315

 Score =   191 bits (484),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 85/119 (71%), Positives = 106/119 (89%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M++FP+IN  +LN EER  IME+IKDACENWGFFELVDHGI  +L+DTVE+LTK+HY+KC
Sbjct  1    MSNFPVINFEKLNGEERKDIMEKIKDACENWGFFELVDHGIPHDLLDTVERLTKEHYEKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            ME+RFKE +A+KGL+A+QTE+ D+DWESTF L+HLP SNISE+PDL D YRKVMK+FA+
Sbjct  61   MEERFKESMASKGLEAIQTEVKDMDWESTFHLRHLPESNISEVPDLVDEYRKVMKDFAL  119



>gb|ACO91560.1| 1-aminocyclopropane-1-carboxylate oxidase [Paeonia suffruticosa]
Length=312

 Score =   191 bits (484),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 88/118 (75%), Positives = 105/118 (89%), Gaps = 3/118 (3%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            MA+FP+INL +LN EER A ME I DACENWGFFE+V+HGIS E MDTVEKLTK+HYKKC
Sbjct  1    MANFPVINLEKLNGEERAATMEIINDACENWGFFEIVNHGISPEFMDTVEKLTKEHYKKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            MEQ+FKE+VA+K   A++TEIND+DWESTF L+HLP+SN++EIPDL+D YRKVMKEFA
Sbjct  61   MEQKFKELVASK---ALETEINDMDWESTFHLRHLPISNMAEIPDLDDEYRKVMKEFA  115



>ref|NP_171994.1| 1-aminocyclopropane-1-carboxylate oxidase [Arabidopsis thaliana]
 sp|Q06588.2|ACCO4_ARATH RecName: Full=1-aminocyclopropane-1-carboxylate oxidase 4; Short=ACC 
oxidase; AltName: Full=Ethylene-forming enzyme; Short=EFE 
[Arabidopsis thaliana]
 gb|AAC97998.1| Identical to 1-aminocyclopropane-1-carboxylate oxidase (ACC oxidase) 
gb|X66719 (EAT1). ESTs gb|T43073, gb|T5714, gb|R90435, 
gb|R44023, gb|AA597926, gb|AI099676, gb|AA650810 and gb|29725 
come from this gene [Arabidopsis thaliana]
 gb|AAN12929.1| 1-aminocyclopropane-1-carboxylate oxidase [Arabidopsis thaliana]
 gb|AEE27779.1| 1-aminocyclopropane-1-carboxylate oxidase [Arabidopsis thaliana]
Length=323

 Score =   191 bits (484),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 83/118 (70%), Positives = 105/118 (89%), Gaps = 0/118 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M SFPIINL +LN EER   ME+IKDACENWGFFE V+HGIS+EL+D VEK+TK+HYKKC
Sbjct  1    MESFPIINLEKLNGEERAITMEKIKDACENWGFFECVNHGISLELLDKVEKMTKEHYKKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            ME+RFKE +  +GLD++++E+ND+DWESTF+LKHLPVSNIS++PDL+D YR +MK+FA
Sbjct  61   MEERFKESIKNRGLDSLRSEVNDVDWESTFYLKHLPVSNISDVPDLDDDYRTLMKDFA  118



>gb|AEK70335.1| 1-aminocyclopropane-1-carboxylate oxidase [Paeonia lactiflora]
 gb|AFA51947.1| 1-aminocyclopropane-1-carboxylate oxidase [Paeonia lactiflora]
 gb|AIE48275.1| ACC oxidase [Paeonia lactiflora]
Length=312

 Score =   190 bits (483),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 88/118 (75%), Positives = 105/118 (89%), Gaps = 3/118 (3%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            MA+FP+INL +LN EER A ME I DACENWGFFE+V+HGIS E MDTVEKLTK+HYKKC
Sbjct  1    MANFPVINLEKLNGEERAATMEIINDACENWGFFEIVNHGISPEFMDTVEKLTKEHYKKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            MEQ+FKE+VA+K   A++TEIND+DWESTF L+HLP+SN++EIPDL+D YRKVMKEFA
Sbjct  61   MEQKFKELVASK---ALETEINDMDWESTFHLRHLPISNMAEIPDLDDEYRKVMKEFA  115



>ref|XP_002535327.1| 1-aminocyclopropane-1-carboxylate oxidase, putative [Ricinus 
communis]
 gb|EEF27056.1| 1-aminocyclopropane-1-carboxylate oxidase, putative [Ricinus 
communis]
Length=315

 Score =   191 bits (484),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 86/118 (73%), Positives = 105/118 (89%), Gaps = 0/118 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M  FP+++L++LN EE+   ME IKDACENWGFFELV+HGIS EL+D VE+LTK+HYKK 
Sbjct  1    MECFPVVDLSKLNGEEKKPTMELIKDACENWGFFELVNHGISHELLDIVERLTKEHYKKF  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            MEQRFKEMVA+KGL+AVQ+EINDLDWESTFFL+HLP+SN++EIPDL++ YR  MKEFA
Sbjct  61   MEQRFKEMVASKGLEAVQSEINDLDWESTFFLRHLPISNMAEIPDLDEEYRNTMKEFA  118



>dbj|BAB89352.1| 1-aminocyclopropane-1-carboxylate oxidase [Diospyros kaki]
Length=320

 Score =   191 bits (484),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 86/118 (73%), Positives = 105/118 (89%), Gaps = 0/118 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FP+IN+  LN E R A ME++++ACENWGFFE+V+HGIS ELMD+VE+LTK+HYKK 
Sbjct  1    MEAFPVINMEILNGEGREAAMEKLRNACENWGFFEVVNHGISHELMDSVERLTKEHYKKF  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            MEQRFKEMVA+KGL+ VQ+EINDLDWESTFFL+HLP SN+SE+PDLED Y+K MKEFA
Sbjct  61   MEQRFKEMVASKGLEVVQSEINDLDWESTFFLRHLPSSNLSELPDLEDDYKKAMKEFA  118



>gb|ACU24333.1| unknown [Glycine max]
Length=217

 Score =   187 bits (476),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 85/119 (71%), Positives = 105/119 (88%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FP+INL +L+ EER   ME+IKDACENWGFFELV+HGI  +++D VE+LTK+HY+KC
Sbjct  1    MTNFPLINLEKLSGEERNDTMEKIKDACENWGFFELVNHGIPHDILDIVERLTKEHYRKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            ME+RFKE+VA+KGLDAVQTE+ D+DWESTF L+HLP SNISEIPDL D YRKVMK+FA+
Sbjct  61   MEERFKELVASKGLDAVQTEVKDMDWESTFHLRHLPESNISEIPDLIDEYRKVMKDFAL  119



>emb|CAA47251.1| ethylene-forming enzyme [Arabidopsis thaliana]
Length=323

 Score =   191 bits (484),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 83/118 (70%), Positives = 105/118 (89%), Gaps = 0/118 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M SFPIINL +LN EER   ME+IKDACENWGFFE V+HGIS+EL+D VEK+TK+HYKKC
Sbjct  1    MESFPIINLEKLNGEERAITMEKIKDACENWGFFECVNHGISLELLDKVEKMTKEHYKKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            ME+RFKE +  +GLD++++E+ND+DWESTF+LKHLPVSNIS++PDL+D YR +MK+FA
Sbjct  61   MEERFKESIKNRGLDSLRSEVNDVDWESTFYLKHLPVSNISDVPDLDDDYRTLMKDFA  118



>dbj|BAQ21979.1| 1-aminocyclopropane-1-carboxylate oxidase [Gentiana triflora]
Length=317

 Score =   191 bits (484),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 85/116 (73%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = +3

Query  87   SFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKCME  266
            +FPI+N+ +LN EER   ME IKDACENWGFFE+++HGI+ E MD VEKLTKDHYKKCME
Sbjct  2    AFPIVNMEKLNGEERSTTMELIKDACENWGFFEILNHGIAAEFMDKVEKLTKDHYKKCME  61

Query  267  QRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            QRF+EMV  KGL+AV+ E+NDLDWESTF L+HLP SNISEIPDL+D YR VM+EFA
Sbjct  62   QRFQEMVERKGLEAVEGEVNDLDWESTFHLRHLPTSNISEIPDLDDQYRDVMREFA  117



>ref|XP_004134785.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 3-like [Cucumis 
sativus]
 gb|KGN49070.1| ACC oxidase 2 [Cucumis sativus]
Length=320

 Score =   191 bits (484),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 102/115 (89%), Gaps = 0/115 (0%)
 Frame = +3

Query  90   FPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKCMEQ  269
            FP+IN+  LN E R +++ QI DACENWGFFELV+HGI  ELMD VEK+TK+HY+KCMEQ
Sbjct  5    FPVINMNNLNGESRVSVLNQINDACENWGFFELVNHGIPHELMDKVEKMTKEHYRKCMEQ  64

Query  270  RFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            RFKEMVA+KGLD+V+TEIND DWESTFFL+HLPVSN+SEI DL++ Y+KVMKEFA
Sbjct  65   RFKEMVASKGLDSVETEINDTDWESTFFLRHLPVSNMSEIGDLDEEYKKVMKEFA  119



>gb|AAK43970.1|AF370155_1 putative 1-aminocyclopropane-1-carboxylate oxidase [Arabidopsis 
thaliana]
Length=323

 Score =   191 bits (484),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 83/118 (70%), Positives = 105/118 (89%), Gaps = 0/118 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M SFPIINL +LN EER   ME+IKDACENWGFFE V+HGIS+EL+D VEK+TK+HYKKC
Sbjct  1    MESFPIINLEKLNGEERAITMEKIKDACENWGFFECVNHGISLELLDKVEKMTKEHYKKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            ME+RFKE +  +GLD++++E+ND+DWESTF+LKHLPVSNIS++PDL+D YR +MK+FA
Sbjct  61   MEERFKESIKNRGLDSLRSEVNDVDWESTFYLKHLPVSNISDVPDLDDDYRTLMKDFA  118



>gb|ABW91147.1| ACC oxidase 2 [Ziziphus jujuba]
Length=321

 Score =   191 bits (484),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 85/118 (72%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FP+I++ +LN EER A ME+I DACENWGFFELV+HGI+ E MDTVE+ TK+HY+KC
Sbjct  1    MENFPVIDMEKLNGEERAATMEKINDACENWGFFELVNHGIAPEFMDTVERQTKEHYRKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            MEQRFKEMV +KGL+ VQ+EI+DLDWESTFF++HLPV NISEIPDL + YRK MKEFA
Sbjct  61   MEQRFKEMVESKGLEVVQSEIDDLDWESTFFVRHLPVPNISEIPDLHEGYRKAMKEFA  118



>ref|XP_007049183.1| Ethylene-forming enzyme [Theobroma cacao]
 gb|EOX93340.1| Ethylene-forming enzyme [Theobroma cacao]
Length=316

 Score =   190 bits (483),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 83/119 (70%), Positives = 105/119 (88%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            MA+FP+INLA+LN EER A ME+IKDACENWGFFEL++HGI  + +D+VE+LTK+HYKK 
Sbjct  1    MATFPVINLAKLNGEERAATMEKIKDACENWGFFELLNHGIPHDFLDSVERLTKEHYKKS  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            MEQRF+E+VA+K L+ +Q E+ D+DWESTFFL+HLP SN++EIPDL D YRKVMKEFA+
Sbjct  61   MEQRFQELVASKALEGLQAEVTDMDWESTFFLRHLPESNMAEIPDLADEYRKVMKEFAL  119



>emb|CAN85572.1| ACC oxidase 1 [Hevea brasiliensis]
Length=312

 Score =   190 bits (482),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 87/118 (74%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FP+I+L++L+ EER   ME I DACENWGFFELV+HG+S ELMDTVE LTK+HY+KC
Sbjct  1    METFPVIDLSKLSDEERKPTMEMIHDACENWGFFELVNHGMSPELMDTVEILTKEHYRKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            MEQRFKEMVA KGL+AVQ+EINDLDWEST FL HLPVSN +EIPDL++ YRK M EFA
Sbjct  61   MEQRFKEMVARKGLEAVQSEINDLDWESTLFLSHLPVSNTAEIPDLDEEYRKTMNEFA  118



>gb|AFU90135.1| 1-aminocyclopropane-1-carboxylate oxidase [Paeonia lactiflora]
Length=312

 Score =   190 bits (482),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 88/118 (75%), Positives = 105/118 (89%), Gaps = 3/118 (3%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            MA+FP+INL +LN EER A ME I DACENWGFFE+V+HGIS E MDTVEKLTK+HYKKC
Sbjct  1    MANFPVINLEKLNGEERAATMEIINDACENWGFFEIVNHGISPEFMDTVEKLTKEHYKKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            MEQ+FKE+VA+K   A++TEIND+DWESTF L+HLP+SN++EIPDL+D YRKVMKEFA
Sbjct  61   MEQKFKELVASK---ALETEINDMDWESTFQLRHLPISNMAEIPDLDDEYRKVMKEFA  115



>gb|AEM42994.1| ACC oxidase [Siraitia grosvenorii]
Length=317

 Score =   190 bits (482),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 84/118 (71%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            MA+FP+INL  +N + R  IMEQ++DAC+NWGFFELV+HGI  E +DTVEK+T+ HYKKC
Sbjct  1    MANFPVINLENINGDGRAKIMEQLEDACQNWGFFELVNHGIPHEFLDTVEKMTRYHYKKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            MEQRFKE VA+KGL+A Q E+ D+DWESTFFL+HLP SNISEIPDL+D YRK+MKEFA
Sbjct  61   MEQRFKETVASKGLEAAQAEVKDMDWESTFFLRHLPESNISEIPDLDDDYRKIMKEFA  118



>emb|CDP05674.1| unnamed protein product [Coffea canephora]
Length=319

 Score =   190 bits (482),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 83/119 (70%), Positives = 103/119 (87%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FP+IN+  LN ++R + M+ IKDACENWGFFELV+HGI  E+MDTVE+LTK HYKKC
Sbjct  1    MENFPVINMKNLNGDKRASTMDIIKDACENWGFFELVNHGIPHEMMDTVERLTKGHYKKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            MEQRFKE+VA+K L+ VQ EI D+DWESTFFL+HLPVSNIS++PDL+D YR +MKEFA+
Sbjct  61   MEQRFKELVASKALEGVQAEITDMDWESTFFLRHLPVSNISQVPDLDDEYRTIMKEFAV  119



>gb|AGN52989.1| ACC oxidase [Euphorbia esula]
Length=313

 Score =   190 bits (482),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = +3

Query  90   FPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKCMEQ  269
            FP+IN+ +LN EER A M +IKDACENWGFFE+++HGI  E MD VE +TK HY+KCMEQ
Sbjct  3    FPVINMEKLNGEERAATMAKIKDACENWGFFEILNHGIETEFMDRVESMTKGHYQKCMEQ  62

Query  270  RFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            RFKEMVA+KGLD+VQTEI DLDWESTF ++HLP SNISEIPDL D YRK+MKEFA
Sbjct  63   RFKEMVASKGLDSVQTEIKDLDWESTFHIRHLPQSNISEIPDLADDYRKLMKEFA  117



>ref|XP_010522369.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 4 [Tarenaya 
hassleriana]
Length=318

 Score =   190 bits (482),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 85/118 (72%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FPIINL +LN +ER A M+ IKDACENWGFFE V+HGI  EL+D VEK+TK+HY+KC
Sbjct  1    MENFPIINLEKLNGDERAATMDLIKDACENWGFFECVNHGIPHELLDRVEKMTKEHYRKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            ME+RFKE++  +GLDAVQ+E+ND+DWESTFFLKHLP+SNIS+IPDL D YR VMKEFA
Sbjct  61   MEERFKELMKERGLDAVQSEVNDVDWESTFFLKHLPISNISDIPDLHDDYRAVMKEFA  118



>ref|XP_006584893.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase-like [Glycine 
max]
Length=310

 Score =   189 bits (481),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 84/118 (71%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FP+INL  LN EER  I+EQI+DACENWGFFELV+HGI  EL+D VE+LTK+HY+KC
Sbjct  1    MENFPVINLENLNGEERKTILEQIEDACENWGFFELVNHGIPHELLDIVERLTKEHYRKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            MEQRFKE VA+KGL+ +Q E+ D++WESTFFL+HLP SNIS+IPDL + YRKVMKEFA
Sbjct  61   MEQRFKEAVASKGLEGIQAEVKDMNWESTFFLRHLPDSNISQIPDLSEEYRKVMKEFA  118



>gb|AEM65196.1| ACC oxidase [Garcinia mangostana]
Length=320

 Score =   190 bits (482),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 87/119 (73%), Positives = 106/119 (89%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M SFP+++L++LN EER   ME IKDACENWGFFEL++HGIS ELMDT+E+LTK+HYKK 
Sbjct  1    MESFPVVDLSKLNGEERKPTMEIIKDACENWGFFELMNHGISHELMDTLERLTKEHYKKS  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            +E++FKE+VAAKGL+AVQ+EI DLDWESTFFL+HLPVSN+ EIPDL   YRKVMKEFA+
Sbjct  61   LEEKFKELVAAKGLEAVQSEITDLDWESTFFLRHLPVSNMDEIPDLSLDYRKVMKEFAL  119



>ref|XP_010035512.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 3-like [Eucalyptus 
grandis]
 gb|KCW46934.1| hypothetical protein EUGRSUZ_K00749 [Eucalyptus grandis]
Length=320

 Score =   190 bits (482),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 83/119 (70%), Positives = 103/119 (87%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M SFP+IN+  LN E+R   M++I D CENWGFFELV+HGI  E MDTVE++TK HY+KC
Sbjct  1    MESFPVINMENLNGEKRAITMDKINDVCENWGFFELVNHGIPPEFMDTVERMTKGHYRKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            M+QRF+E+VA+KGL+ VQTE++DLDWESTF LKHLP+SNIS++PDLED YRKVMKEFA+
Sbjct  61   MDQRFRELVASKGLENVQTEVHDLDWESTFHLKHLPLSNISQVPDLEDDYRKVMKEFAV  119



>gb|AAZ83343.1| ACC oxidase 2 [Gossypium hirsutum]
Length=319

 Score =   189 bits (481),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 86/118 (73%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = +3

Query  84   ASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKCM  263
             +FP+I+L+++N EER A M+ IKDACENWGFFEL +HGIS ELMDTVEKLTK+HYKKCM
Sbjct  3    VAFPVIDLSKINGEERGATMDMIKDACENWGFFELTNHGISHELMDTVEKLTKEHYKKCM  62

Query  264  EQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            E RFKEMV +KGL+ VQ+EI D+DWESTFFL+HLP SN+ EIPDLE  YRKVMK+FA+
Sbjct  63   EDRFKEMVTSKGLEVVQSEITDMDWESTFFLRHLPESNLYEIPDLEYDYRKVMKQFAV  120



>gb|KHG22879.1| 1-aminocyclopropane-1-carboxylate oxidase [Gossypium arboreum]
Length=319

 Score =   189 bits (481),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 86/118 (73%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = +3

Query  84   ASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKCM  263
             +FP+I+L+++N EER A M+ IKDACENWGFFEL +HGIS ELMDTVEKLTK+HYKKCM
Sbjct  3    VAFPVIDLSKINGEERGATMDMIKDACENWGFFELTNHGISHELMDTVEKLTKEHYKKCM  62

Query  264  EQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            E RFKEMV +KGL+ VQ+EI D+DWESTFFL+HLP SN+ EIPDLE  YRKVMK+FA+
Sbjct  63   EDRFKEMVTSKGLEVVQSEITDMDWESTFFLRHLPESNLYEIPDLEYDYRKVMKQFAV  120



>ref|XP_010057880.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase [Eucalyptus 
grandis]
 gb|KCW75225.1| hypothetical protein EUGRSUZ_E03977 [Eucalyptus grandis]
Length=317

 Score =   189 bits (481),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 84/118 (71%), Positives = 104/118 (88%), Gaps = 0/118 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M SFP+I+L +LN EER A M +IKDACENWGFFELV+HGIS +LMD VE+LTK+HY KC
Sbjct  1    MESFPVIDLEKLNGEERGATMAKIKDACENWGFFELVNHGISHQLMDGVERLTKEHYAKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            ME +FK+MVA+KGL+A Q+E++D+DWESTF L+HLPVSNISE+PDLED +RK MK+FA
Sbjct  61   MEHKFKQMVASKGLEAAQSEVDDIDWESTFHLRHLPVSNISEVPDLEDDHRKAMKQFA  118



>ref|XP_010475176.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 4-like [Camelina 
sativa]
Length=323

 Score =   189 bits (481),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 84/118 (71%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M SFPIINL +LN E+R   MEQIKDACENWGFFE V+HGIS EL+D VEK+TK+HYKKC
Sbjct  1    MESFPIINLEKLNGEDRAITMEQIKDACENWGFFECVNHGISHELLDKVEKMTKEHYKKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            ME RFKE +  +GLD++++E+ND+DWESTF+LKHLPVSNIS++PDL+D YR +MKEFA
Sbjct  61   MEARFKESIKNRGLDSLRSEVNDVDWESTFYLKHLPVSNISDVPDLDDDYRTLMKEFA  118



>gb|AHN13883.1| 1-aminocyclopropane-1-carboxylate oxidase 1 [Coffea arabica]
Length=319

 Score =   189 bits (481),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 83/119 (70%), Positives = 103/119 (87%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FP+IN+  LN ++R + M+ IKDACENWGFFELV+HGI  E+MDTVE+LTK HYKKC
Sbjct  1    MENFPVINMKNLNGDKRASTMDIIKDACENWGFFELVNHGIPHEMMDTVERLTKGHYKKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            MEQRFKE+VA+K L+ VQ EI D+DWESTFFL+HLPVSNIS++PDL+D YR +MKEFA+
Sbjct  61   MEQRFKELVASKALEGVQAEITDMDWESTFFLRHLPVSNISQVPDLDDEYRTLMKEFAV  119



>gb|AAC12934.1| 1-aminocyclopropane-1-carboxylic acid oxidase [Phaseolus vulgaris]
Length=315

 Score =   189 bits (480),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 84/119 (71%), Positives = 106/119 (89%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M++FP+IN  +LN EER  IME+IKDACENWGFFELVDHGI  +L+DTVE+LTK+HY+KC
Sbjct  1    MSNFPVINFEKLNGEERKDIMEKIKDACENWGFFELVDHGIPHDLLDTVERLTKEHYEKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            ME++FKE +A+KGL+A+QTE+ D+DWESTF L+HLP SNISE+PDL D YRKVMK+FA+
Sbjct  61   MEEKFKESMASKGLEAIQTEVKDMDWESTFHLRHLPESNISEVPDLVDEYRKVMKDFAL  119



>gb|KJB67282.1| hypothetical protein B456_010G184900 [Gossypium raimondii]
Length=328

 Score =   189 bits (481),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 86/125 (69%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = +3

Query  63   EERQRKMASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTK  242
            +E+ +   +FP+I+L+++N EER A M+ IKDACENWGFFEL++HGIS ELMDTVE+LTK
Sbjct  5    KEKTKMEVAFPVIDLSKINGEERGATMDMIKDACENWGFFELMNHGISHELMDTVERLTK  64

Query  243  DHYKKCMEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVM  422
            +HYKKCME+RFKEMV +KGL+ VQ+EI D+DWESTF L HLP SN+ EIPDLED YRKVM
Sbjct  65   EHYKKCMEERFKEMVTSKGLEVVQSEITDMDWESTFSLCHLPKSNLYEIPDLEDDYRKVM  124

Query  423  KEFAM  437
            K+FA+
Sbjct  125  KQFAV  129



>dbj|BAB83762.1| 1-aminocyclopropane-1-carboxylic acid oxidase [Phaseolus lunatus]
Length=315

 Score =   189 bits (480),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 83/119 (70%), Positives = 106/119 (89%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M++FP+IN  +LN EER   ME+IKDACENWGFFELV+HGI  +L+DTVE+LTK+HY+KC
Sbjct  1    MSNFPVINFERLNGEERKDTMEKIKDACENWGFFELVNHGIPHDLLDTVERLTKEHYQKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            ME+RFKE++A+KGL+A+QTE+ D+DWESTF L+HLP SNISE+PDL D YRKVMK+FA+
Sbjct  61   MEERFKELMASKGLEAIQTEVKDMDWESTFHLRHLPESNISEVPDLVDEYRKVMKDFAL  119



>ref|XP_006418070.1| hypothetical protein EUTSA_v10008207mg [Eutrema salsugineum]
 gb|ESQ36423.1| hypothetical protein EUTSA_v10008207mg [Eutrema salsugineum]
Length=323

 Score =   189 bits (480),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 84/118 (71%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M SFPIINL +LN EER   ME+IKDACENWGFFE V+HGI  EL+D VEK+TK+HYKKC
Sbjct  1    MESFPIINLEKLNGEERGITMEKIKDACENWGFFECVNHGIPHELLDRVEKMTKEHYKKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            ME+RFKE +  +GLD+V++E+ND+DWESTF+LKHLPVSNIS++PDL+D YR +MKEFA
Sbjct  61   MEERFKESIKNRGLDSVRSEVNDVDWESTFYLKHLPVSNISDVPDLDDDYRTLMKEFA  118



>gb|AAA33708.1| ethylene-forming enzyme [Petunia x hybrida]
 prf||1909343A ethylene-forming enzyme
Length=320

 Score =   189 bits (480),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 84/118 (71%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FPII+L ++N  ER A ME IKDACENWGFFELV+HGI  E+MDTVEK+TK HYKKC
Sbjct  1    MENFPIISLDKVNGVERAATMEMIKDACENWGFFELVNHGIPREVMDTVEKMTKGHYKKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            MEQRFKE+VA+K L+ VQ E+ D+DWESTFFLKHLP+SNISE+PDL++ YR+VM++FA
Sbjct  61   MEQRFKELVASKALEGVQAEVTDMDWESTFFLKHLPISNISEVPDLDEEYREVMRDFA  118



>gb|KHN00185.1| 1-aminocyclopropane-1-carboxylate oxidase [Glycine soja]
Length=310

 Score =   189 bits (479),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 84/118 (71%), Positives = 101/118 (86%), Gaps = 0/118 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FP+I L  LN EER  I+EQI+DACENWGFFELV+HGI  EL+D VE+LTK+HY+KC
Sbjct  1    MENFPVIKLENLNGEERKTILEQIEDACENWGFFELVNHGIPHELLDIVERLTKEHYRKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            MEQRFKE VA+KGL+ +Q E+ D+DWESTFFL+HLP SNIS+IPDL + YRKVMKEFA
Sbjct  61   MEQRFKEAVASKGLEGIQAEVKDMDWESTFFLRHLPDSNISQIPDLSEEYRKVMKEFA  118



>sp|Q08506.1|ACCO1_PETHY RecName: Full=1-aminocyclopropane-1-carboxylate oxidase 1; Short=ACC 
oxidase 1; Short=ACCO; AltName: Full=Ethylene-forming 
enzyme; Short=EFE [Petunia x hybrida]
 gb|AAC37381.1| 1-aminocyclopropane-1-carboxylate oxidase [Petunia x hybrida]
Length=319

 Score =   189 bits (480),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 84/118 (71%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FPII+L ++N  ER A ME IKDACENWGFFELV+HGI  E+MDTVEK+TK HYKKC
Sbjct  1    MENFPIISLDKVNGVERAATMEMIKDACENWGFFELVNHGIPREVMDTVEKMTKGHYKKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            MEQRFKE+VA+K L+ VQ E+ D+DWESTFFLKHLP+SNISE+PDL++ YR+VM++FA
Sbjct  61   MEQRFKELVASKALEGVQAEVTDMDWESTFFLKHLPISNISEVPDLDEEYREVMRDFA  118



>gb|AFJ75133.1| ACC oxidase, partial [Malus domestica]
Length=301

 Score =   188 bits (478),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 87/112 (78%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = +3

Query  102  NLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKCMEQRFKE  281
            +L+ +N EER A +E+I DACENWGFFELV+HG+S EL+DTVEK+TKDHYKK MEQRFKE
Sbjct  1    DLSLVNGEERAATLEKINDACENWGFFELVNHGMSTELLDTVEKMTKDHYKKTMEQRFKE  60

Query  282  MVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            MVAAKGLD VQ+EI+DLDWESTFFL+HLP SNISEIPDLE+ YRK MKEFA+
Sbjct  61   MVAAKGLDDVQSEIHDLDWESTFFLRHLPSSNISEIPDLEEEYRKTMKEFAV  112



>gb|AFJ75135.1| ACC oxidase, partial [Malus domestica]
Length=300

 Score =   188 bits (477),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 87/112 (78%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = +3

Query  102  NLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKCMEQRFKE  281
            +L+ +N EER A +E+I DACENWGFFELV+HG+S EL+DTVEK+TKDHYKK MEQRFKE
Sbjct  1    DLSLVNGEERAATLEKINDACENWGFFELVNHGMSTELLDTVEKMTKDHYKKTMEQRFKE  60

Query  282  MVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            MVAAKGLD VQ+EI+DLDWESTFFL+HLP SNISEIPDLE+ YRK MKEFA+
Sbjct  61   MVAAKGLDDVQSEIHDLDWESTFFLRHLPSSNISEIPDLEEDYRKTMKEFAV  112



>gb|AAR99394.1| ACC oxidase ACO1 [Nicotiana attenuata]
Length=319

 Score =   189 bits (479),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 84/118 (71%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FPIINL +LN  E+ A ME IKDACENWGFFELV+HGI  E+MDTVEKLTK HYKKC
Sbjct  1    MENFPIINLEKLNGSEKAATMEMIKDACENWGFFELVNHGIPHEVMDTVEKLTKGHYKKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            MEQRFKE+VA+KGL+ V+ E+ D+DWESTFFL+HLPV+NISE+  L+D YR+VM++FA
Sbjct  61   MEQRFKELVASKGLEGVEAEVTDMDWESTFFLRHLPVANISEVAGLDDQYREVMRDFA  118



>ref|XP_004251527.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 2 [Solanum 
lycopersicum]
Length=316

 Score =   189 bits (479),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 85/118 (72%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FPIINL +LN  ER A ME+I DACENWGFFELV+HGI  E+MDTVEKLTK HYKKC
Sbjct  1    MENFPIINLEKLNGAERVATMEKINDACENWGFFELVNHGIPHEVMDTVEKLTKGHYKKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            MEQRFKE+VA KGL+ V+ E+ D+DWESTFFL+HLP SNIS++PDL+D YR+VM++FA
Sbjct  61   MEQRFKELVAKKGLEGVEVEVTDMDWESTFFLRHLPSSNISQLPDLDDVYREVMRDFA  118



>gb|AFJ75134.1| ACC oxidase, partial [Malus domestica]
Length=301

 Score =   188 bits (477),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 87/112 (78%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = +3

Query  102  NLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKCMEQRFKE  281
            +L+ +N EER A +E+I DACENWGFFELV+HG+S EL+DTVEK+TKDHYKK MEQRFKE
Sbjct  1    DLSLVNGEERAATLEKINDACENWGFFELVNHGMSTELLDTVEKMTKDHYKKTMEQRFKE  60

Query  282  MVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            MVAAKGLD VQ+EI+DLDWESTFFL+HLP SNISEIPDLE+ YRK MKEFA+
Sbjct  61   MVAAKGLDDVQSEIHDLDWESTFFLRHLPSSNISEIPDLEEDYRKTMKEFAV  112



>ref|XP_010252569.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase-like [Nelumbo 
nucifera]
Length=319

 Score =   188 bits (478),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 85/119 (71%), Positives = 99/119 (83%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            MA FPIIN+ +LN EER A ME +KDACENWGFFEL++HGIS ELMDTVE+LTK HY KC
Sbjct  1    MAYFPIINMEKLNGEERAATMEILKDACENWGFFELLNHGISHELMDTVERLTKGHYNKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            +EQRFK+ VA K L+ VQ EI D+DWESTFFL+HLP SN+SEIPDL D YR+ MKEF +
Sbjct  61   LEQRFKDSVATKALEGVQKEITDMDWESTFFLRHLPASNLSEIPDLSDEYRQAMKEFVV  119



>gb|ABC69167.2| 1-aminocyclopropane-1-carboxylate oxidase [Paeonia suffruticosa]
Length=312

 Score =   188 bits (478),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 87/118 (74%), Positives = 104/118 (88%), Gaps = 3/118 (3%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            MA+FP+INL +LN  ER A ME I DACENWGFFE+V+HGIS E MDTVEKLTK+HYKKC
Sbjct  1    MANFPVINLEKLNGGERAATMEIINDACENWGFFEIVNHGISPEFMDTVEKLTKEHYKKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            MEQ+FKE+VA+K   A++TEIND+DWESTF L+HLP+SN++EIPDL+D YRKVMKEFA
Sbjct  61   MEQKFKELVASK---ALETEINDMDWESTFHLRHLPISNMAEIPDLDDEYRKVMKEFA  115



>gb|ABB97398.1| ACC oxidase [Trifolium repens]
Length=306

 Score =   187 bits (476),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 84/119 (71%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FPII+L +LN  ER   M +IKDACENWGFFELV+HGI  +LMDT+E+LTK+HY+KC
Sbjct  1    MMNFPIISLERLNGVERKDTMAKIKDACENWGFFELVNHGIPHDLMDTLERLTKEHYRKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            MEQRFKE+V++KGLDAVQTE+ D+DWESTF ++HLP SNISE+PDL D YRKVMKEF++
Sbjct  61   MEQRFKELVSSKGLDAVQTEVKDMDWESTFHVRHLPESNISELPDLSDEYRKVMKEFSL  119



>ref|XP_002892259.1| hypothetical protein ARALYDRAFT_887679 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68518.1| hypothetical protein ARALYDRAFT_887679 [Arabidopsis lyrata subsp. 
lyrata]
Length=323

 Score =   188 bits (477),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 83/118 (70%), Positives = 104/118 (88%), Gaps = 0/118 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M SFPII+L +LN EER   ME+IKDACENWGFFE V+HGIS EL+D VEK+TK+HYKKC
Sbjct  1    MESFPIISLEKLNGEERAITMEKIKDACENWGFFECVNHGISHELLDKVEKMTKEHYKKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            ME+RFKE +  +GLD++++E+ND+DWESTF+LKHLPVSNIS++PDL+D YR +MKEFA
Sbjct  61   MEERFKESIKNRGLDSLRSEVNDVDWESTFYLKHLPVSNISDVPDLDDDYRTLMKEFA  118



>gb|ADR73046.1| ACC oxidase 2 isoform B [Nicotiana tabacum]
Length=308

 Score =   187 bits (476),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 86/107 (80%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = +3

Query  114  LNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKCMEQRFKEMVAA  293
            LNTE+R A ME IKDACENWGFFE+V HGI  EL+D VEKLTK HY KCME+RFKEMVA+
Sbjct  4    LNTEQRAATMETIKDACENWGFFEVVKHGICHELLDRVEKLTKGHYNKCMEERFKEMVAS  63

Query  294  KGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            KGL+AVQTEI DLDWESTFFLKHLP+SNIS++PDLED YRK+MKEFA
Sbjct  64   KGLEAVQTEIKDLDWESTFFLKHLPLSNISQVPDLEDEYRKIMKEFA  110



>gb|AEC32837.1| 1-aminocyclopropane-1-carboxylate oxidase [Psidium guajava]
Length=320

 Score =   188 bits (477),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 85/119 (71%), Positives = 103/119 (87%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FP+IN+  LN E+R   M++IKDACENWGFFELV+HGI  E+MDTVE+LTK HYKKC
Sbjct  1    MENFPVINMESLNGEKRAITMDKIKDACENWGFFELVNHGIPPEMMDTVERLTKGHYKKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            MEQRF+E+VA+KGL+ VQ E++DLDWESTF LKHLP SNI +IPDL+D YRKVMKEFA+
Sbjct  61   MEQRFRELVASKGLEYVQKEVHDLDWESTFHLKHLPESNIFQIPDLDDDYRKVMKEFAV  119



>gb|AFK29447.1| 1-aminocyclopropane-1-carboxylate oxidase [Arabidopsis kamchatica]
 gb|AFK29448.1| 1-aminocyclopropane-1-carboxylate oxidase [Arabidopsis halleri 
subsp. gemmifera]
 gb|AFK29450.1| 1-aminocyclopropane-1-carboxylate oxidase [Arabidopsis lyrata 
subsp. lyrata]
Length=323

 Score =   187 bits (476),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 83/118 (70%), Positives = 104/118 (88%), Gaps = 0/118 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M SFPII+L +LN EER   ME+IKDACENWGFFE V+HGIS EL+D VEK+TK+HYKKC
Sbjct  1    MESFPIISLEKLNGEERAITMEKIKDACENWGFFECVNHGISHELLDKVEKMTKEHYKKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            ME+RFKE +  +GLD++++E+ND+DWESTF+LKHLPVSNIS++PDL+D YR +MKEFA
Sbjct  61   MEERFKESIKNRGLDSLRSEVNDVDWESTFYLKHLPVSNISDVPDLDDDYRTLMKEFA  118



>ref|XP_003616885.1| 1-aminocyclopropane-1-carboxylate oxidase [Medicago truncatula]
Length=245

 Score =   185 bits (470),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 83/119 (70%), Positives = 103/119 (87%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FPII+L +LN  ER   ME+IKDACENWGFFELV+HGI  +LMDT+E+LTK+HY+KC
Sbjct  2    MMNFPIISLEKLNGVERKDTMEKIKDACENWGFFELVNHGIPHDLMDTLERLTKEHYRKC  61

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            ME RFKE++++KGLD VQTE+ D+DWESTF ++HLP SNISEIPDL D YRKVMKEF++
Sbjct  62   MEHRFKEVISSKGLDVVQTEVKDMDWESTFHVRHLPESNISEIPDLSDEYRKVMKEFSL  120



>ref|XP_010457570.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 4 [Camelina 
sativa]
Length=323

 Score =   187 bits (476),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 83/118 (70%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M SFPII+L +LN EER   ME+IKDACENWGFFE V+HGIS EL+D VEK+TK+HYKKC
Sbjct  1    MESFPIISLEKLNGEERAITMEKIKDACENWGFFECVNHGISHELLDKVEKMTKEHYKKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            ME RFKE +  +GLD++++E+ND+DWESTF+LKHLPVSNIS++PDL+D YR  MKEFA
Sbjct  61   MEARFKESIKNRGLDSLRSEVNDVDWESTFYLKHLPVSNISDVPDLDDEYRTTMKEFA  118



>gb|AAC67233.1| ACC oxidase 2 [Cucumis sativus]
Length=318

 Score =   187 bits (475),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 84/115 (73%), Positives = 100/115 (87%), Gaps = 0/115 (0%)
 Frame = +3

Query  90   FPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKCMEQ  269
            FP+IN+  LN E R + + QI D CENWGFFELV+HGI  ELMD VEK+TK+HY+KCMEQ
Sbjct  3    FPVINMNNLNGESRVSFLNQINDVCENWGFFELVNHGIPHELMDKVEKMTKEHYRKCMEQ  62

Query  270  RFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFA  434
            RFKEMVA+KGLD+V+TEIND DWESTFFL+HLPVSN+SEI DL++ Y+KVMKEFA
Sbjct  63   RFKEMVASKGLDSVETEINDTDWESTFFLRHLPVSNMSEIGDLDEEYKKVMKEFA  117



>gb|ACJ84876.1| unknown [Medicago truncatula]
 gb|AFK35527.1| unknown [Medicago truncatula]
Length=217

 Score =   184 bits (467),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 83/119 (70%), Positives = 103/119 (87%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FPII+L +LN  ER   ME+IKDACENWGFFELV+HGI  +LMDT+E+LTK+HY+KC
Sbjct  1    MMNFPIISLEKLNGVERKDTMEKIKDACENWGFFELVNHGIPHDLMDTLERLTKEHYRKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            ME RFKE++++KGLD VQTE+ D+DWESTF ++HLP SNISEIPDL D YRKVMKEF++
Sbjct  61   MEHRFKEVISSKGLDVVQTEVKDMDWESTFHVRHLPESNISEIPDLSDEYRKVMKEFSL  119



>gb|KHG03155.1| 1-aminocyclopropane-1-carboxylate oxidase 1 [Gossypium arboreum]
Length=310

 Score =   187 bits (474),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 81/119 (68%), Positives = 101/119 (85%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            MA FP+IN+ +LN EER A ME IKDACENWGFFE+++HGI  + MD +E LTK+HYKKC
Sbjct  1    MAKFPVINMEKLNGEERAATMELIKDACENWGFFEVLNHGIPYDFMDKIESLTKEHYKKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            MEQRFKE+VA+K L+ +Q E+ D+DWESTF+L+HLP SN++EIPDL D YRKVMKEFA+
Sbjct  61   MEQRFKELVASKALEGLQAEVTDMDWESTFYLRHLPESNMAEIPDLTDEYRKVMKEFAL  119



>gb|AEC32838.1| 1-aminocyclopropane-1-carboxylate oxidase [Psidium guajava]
Length=320

 Score =   187 bits (475),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 84/119 (71%), Positives = 103/119 (87%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M SFP+IN+  LN E+R   M++IKDACENWGFFELV+HGI  E+MDT+E++TK HYKKC
Sbjct  1    MESFPVINMENLNGEKRAITMDKIKDACENWGFFELVNHGIPPEMMDTIERMTKGHYKKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            MEQRF+E+VA+KGL+ VQ E++DLDWESTF LKHLP SNIS+I DL+D YRKVMKEFA+
Sbjct  61   MEQRFRELVASKGLEYVQKEVHDLDWESTFHLKHLPESNISQISDLDDDYRKVMKEFAV  119



>emb|CDP11301.1| unnamed protein product [Coffea canephora]
Length=111

 Score =   181 bits (458),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 79/111 (71%), Positives = 96/111 (86%), Gaps = 0/111 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M +FP+IN+  LN ++R + ME IKDACENWGFFELV+HGI  E+MDTVE+LTK HYKKC
Sbjct  1    MENFPVINMKNLNGDKRASTMEHIKDACENWGFFELVNHGIPHEMMDTVERLTKGHYKKC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYR  413
            MEQRFKE+VA+K L+ VQ EI D+DWESTFFL+HLPVSNIS++PDL+D YR
Sbjct  61   MEQRFKELVASKALEGVQAEITDMDWESTFFLRHLPVSNISQVPDLDDEYR  111



>ref|XP_004507658.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase-like [Cicer 
arietinum]
Length=315

 Score =   187 bits (475),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 84/119 (71%), Positives = 102/119 (86%), Gaps = 0/119 (0%)
 Frame = +3

Query  81   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  260
            M  FP++++ +LNTEE+ + ME IKDACENW FFELV+HGIS ELMDTVE+LTK++YK+C
Sbjct  1    MEKFPVVDMGKLNTEEKTSTMEMIKDACENWSFFELVNHGISTELMDTVERLTKENYKQC  60

Query  261  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  437
            MEQRF++MVA+KGL+  Q EIN LDWESTFFL HLP+SNISEIPDL   YRK MKEFA+
Sbjct  61   MEQRFRKMVASKGLETAQYEINYLDWESTFFLSHLPLSNISEIPDLHHDYRKAMKEFAV  119



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 552737873190