BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002B07

Length=624
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009609022.1|  PREDICTED: uncharacterized protein LOC104102883    154   2e-39   Nicotiana tomentosiformis
ref|XP_009763194.1|  PREDICTED: uncharacterized protein LOC104215143    154   2e-39   Nicotiana sylvestris
gb|EYU28702.1|  hypothetical protein MIMGU_mgv1a001248mg                150   6e-38   Erythranthe guttata [common monkey flower]
ref|XP_011086395.1|  PREDICTED: uncharacterized protein LOC105168145    148   3e-37   Sesamum indicum [beniseed]
ref|XP_006357262.1|  PREDICTED: uncharacterized protein LOC102598653    146   1e-36   Solanum tuberosum [potatoes]
ref|XP_004238767.1|  PREDICTED: uncharacterized protein LOC101256773    142   3e-35   Solanum lycopersicum
ref|XP_007046233.1|  Uncharacterized protein isoform 3                  139   4e-34   
ref|XP_007046231.1|  Uncharacterized protein isoform 1                  139   5e-34   
ref|XP_007046232.1|  Uncharacterized protein isoform 2                  139   6e-34   
ref|XP_010096339.1|  hypothetical protein L484_021086                   136   4e-33   Morus notabilis
ref|XP_002520139.1|  conserved hypothetical protein                     135   6e-33   Ricinus communis
ref|XP_008389528.1|  PREDICTED: uncharacterized protein LOC103451868    135   7e-33   
emb|CDP00285.1|  unnamed protein product                                135   7e-33   Coffea canephora [robusta coffee]
gb|KJB80039.1|  hypothetical protein B456_013G077900                    135   7e-33   Gossypium raimondii
gb|KJB80038.1|  hypothetical protein B456_013G077900                    135   8e-33   Gossypium raimondii
gb|KHG17997.1|  Membrane protein                                        135   9e-33   Gossypium arboreum [tree cotton]
ref|XP_007225290.1|  hypothetical protein PRUPE_ppa001333mg             135   1e-32   Prunus persica
gb|KDP21229.1|  hypothetical protein JCGZ_21700                         134   2e-32   Jatropha curcas
ref|XP_008221683.1|  PREDICTED: uncharacterized protein LOC103321632    134   3e-32   Prunus mume [ume]
gb|KJB50698.1|  hypothetical protein B456_008G182900                    134   4e-32   Gossypium raimondii
gb|KHG29108.1|  Heat-inducible transcription repressor HrcA             133   4e-32   Gossypium arboreum [tree cotton]
ref|XP_009360399.1|  PREDICTED: uncharacterized protein LOC103950874    133   4e-32   Pyrus x bretschneideri [bai li]
ref|XP_011071029.1|  PREDICTED: uncharacterized protein LOC105156...    132   9e-32   Sesamum indicum [beniseed]
ref|XP_010044706.1|  PREDICTED: uncharacterized protein LOC104433602    130   4e-31   Eucalyptus grandis [rose gum]
ref|XP_002269942.1|  PREDICTED: uncharacterized protein LOC100255337    130   4e-31   Vitis vinifera
emb|CBI32021.3|  unnamed protein product                                130   5e-31   Vitis vinifera
ref|XP_008353106.1|  PREDICTED: uncharacterized protein LOC103416653    130   9e-31   
ref|XP_011010794.1|  PREDICTED: uncharacterized protein LOC105115567    128   3e-30   Populus euphratica
ref|XP_010262507.1|  PREDICTED: uncharacterized protein LOC104601022    128   4e-30   Nelumbo nucifera [Indian lotus]
ref|XP_006827133.1|  hypothetical protein AMTR_s00010p00249430          127   1e-29   
ref|XP_009402670.1|  PREDICTED: uncharacterized protein LOC103986...    125   2e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006438610.1|  hypothetical protein CICLE_v10030693mg             125   3e-29   
ref|XP_006483238.1|  PREDICTED: uncharacterized protein LOC102613577    125   3e-29   Citrus sinensis [apfelsine]
ref|XP_006438611.1|  hypothetical protein CICLE_v10030693mg             125   3e-29   Citrus clementina [clementine]
ref|XP_010932674.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    124   5e-29   
gb|KJB50702.1|  hypothetical protein B456_008G182900                    122   1e-28   Gossypium raimondii
ref|XP_010683264.1|  PREDICTED: uncharacterized protein LOC104897980    123   2e-28   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB50700.1|  hypothetical protein B456_008G182900                    122   3e-28   Gossypium raimondii
gb|KJB50701.1|  hypothetical protein B456_008G182900                    122   3e-28   Gossypium raimondii
ref|XP_008805506.1|  PREDICTED: uncharacterized protein LOC103718...    121   4e-28   
ref|XP_008805504.1|  PREDICTED: uncharacterized protein LOC103718...    122   4e-28   Phoenix dactylifera
ref|XP_004298449.1|  PREDICTED: uncharacterized protein LOC101310...    122   5e-28   Fragaria vesca subsp. vesca
ref|XP_002266784.1|  PREDICTED: uncharacterized protein LOC100254494    121   6e-28   
ref|XP_010264947.1|  PREDICTED: uncharacterized protein LOC104602813    121   6e-28   Nelumbo nucifera [Indian lotus]
emb|CBI29239.3|  unnamed protein product                                121   6e-28   Vitis vinifera
gb|KHN30518.1|  hypothetical protein glysoja_045712                     120   2e-27   Glycine soja [wild soybean]
ref|XP_003551988.1|  PREDICTED: uncharacterized protein LOC100808045    120   2e-27   Glycine max [soybeans]
gb|KHN13484.1|  hypothetical protein glysoja_029585                     119   6e-27   Glycine soja [wild soybean]
ref|XP_003530682.2|  PREDICTED: uncharacterized protein LOC100796980    118   8e-27   Glycine max [soybeans]
gb|KGN51885.1|  hypothetical protein Csa_5G604300                       116   6e-26   Cucumis sativus [cucumbers]
ref|XP_006296984.1|  hypothetical protein CARUB_v10012978mg             115   7e-26   Capsella rubella
ref|XP_008446313.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    115   8e-26   Cucumis melo [Oriental melon]
ref|XP_011463103.1|  PREDICTED: uncharacterized protein LOC101310...    115   9e-26   Fragaria vesca subsp. vesca
ref|XP_008789389.1|  PREDICTED: uncharacterized protein LOC103706...    114   2e-25   
ref|XP_009395685.1|  PREDICTED: uncharacterized protein LOC103980887    114   2e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008789375.1|  PREDICTED: uncharacterized protein LOC103706...    114   3e-25   Phoenix dactylifera
ref|XP_004509944.1|  PREDICTED: uncharacterized protein LOC101513...    114   3e-25   Cicer arietinum [garbanzo]
gb|EPS68544.1|  hypothetical protein M569_06219                         112   6e-25   Genlisea aurea
ref|XP_004170264.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    112   7e-25   
ref|XP_004135196.1|  PREDICTED: uncharacterized protein LOC101203447    112   7e-25   Cucumis sativus [cucumbers]
ref|XP_007153848.1|  hypothetical protein PHAVU_003G0698001g            111   8e-25   Phaseolus vulgaris [French bean]
ref|XP_007153849.1|  hypothetical protein PHAVU_003G0698001g            111   8e-25   Phaseolus vulgaris [French bean]
ref|XP_010917702.1|  PREDICTED: uncharacterized protein LOC105042268    112   1e-24   
gb|KEH19840.1|  plant/MEB5-like protein                                 110   4e-24   Medicago truncatula
ref|XP_004489991.1|  PREDICTED: uncharacterized protein LOC101501...    110   7e-24   Cicer arietinum [garbanzo]
ref|XP_002883095.1|  hypothetical protein ARALYDRAFT_898144             109   1e-23   Arabidopsis lyrata subsp. lyrata
ref|XP_006406675.1|  hypothetical protein EUTSA_v10020058mg             109   1e-23   Eutrema salsugineum [saltwater cress]
dbj|BAJ99760.1|  predicted protein                                      108   1e-23   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004962963.1|  PREDICTED: uncharacterized protein LOC101782397    108   2e-23   Setaria italica
ref|XP_006649417.1|  PREDICTED: uncharacterized protein LOC102709155    108   3e-23   Oryza brachyantha
dbj|BAB02713.1|  unnamed protein product                                108   3e-23   Arabidopsis thaliana [mouse-ear cress]
gb|EEC74537.1|  hypothetical protein OsI_10057                          108   3e-23   Oryza sativa Indica Group [Indian rice]
ref|NP_001048995.1|  Os03g0152800                                       108   3e-23   
ref|NP_566591.1|  uncharacterized protein                               108   3e-23   Arabidopsis thaliana [mouse-ear cress]
gb|ABF94028.1|  expressed protein                                       108   3e-23   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010465853.1|  PREDICTED: uncharacterized protein LOC104746144    107   4e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010487691.1|  PREDICTED: uncharacterized protein LOC104765639    107   4e-23   Camelina sativa [gold-of-pleasure]
emb|CDY51921.1|  BnaAnng10980D                                          107   4e-23   Brassica napus [oilseed rape]
gb|EEE58339.1|  hypothetical protein OsJ_09447                          107   6e-23   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004509945.1|  PREDICTED: uncharacterized protein LOC101513...    107   6e-23   
ref|XP_010506097.1|  PREDICTED: uncharacterized protein LOC104782771    107   8e-23   Camelina sativa [gold-of-pleasure]
ref|XP_002442155.1|  hypothetical protein SORBIDRAFT_08g015250          106   1e-22   Sorghum bicolor [broomcorn]
emb|CDY18479.1|  BnaA01g27160D                                          104   5e-22   Brassica napus [oilseed rape]
emb|CDX75947.1|  BnaC03g40300D                                          104   5e-22   
ref|XP_009135553.1|  PREDICTED: uncharacterized protein LOC103859731    104   5e-22   Brassica rapa
gb|KEH19841.1|  plant/MEB5-like protein                                 103   8e-22   Medicago truncatula
ref|XP_003558789.1|  PREDICTED: uncharacterized protein LOC100846542    103   1e-21   Brachypodium distachyon [annual false brome]
ref|XP_010549052.1|  PREDICTED: uncharacterized protein LOC104820344    102   3e-21   Tarenaya hassleriana [spider flower]
ref|XP_009113645.1|  PREDICTED: uncharacterized protein LOC103838...    102   4e-21   Brassica rapa
emb|CDX95569.1|  BnaC01g34610D                                          101   7e-21   
ref|XP_011071030.1|  PREDICTED: uncharacterized protein LOC105156...    100   2e-20   Sesamum indicum [beniseed]
ref|XP_003519773.1|  PREDICTED: uncharacterized protein LOC100812482  95.5    6e-19   Glycine max [soybeans]
gb|AAU89744.1|  At3g17900/MEB5_12-like protein                        91.7    1e-18   Solanum tuberosum [potatoes]
ref|XP_003613589.1|  hypothetical protein MTR_5g038440                94.4    1e-18   
ref|XP_007157397.1|  hypothetical protein PHAVU_002G0667000g          85.1    2e-16   Phaseolus vulgaris [French bean]
ref|XP_002976159.1|  hypothetical protein SELMODRAFT_416167           87.4    3e-16   Selaginella moellendorffii
ref|XP_008655682.1|  PREDICTED: uncharacterized protein LOC103634878  79.0    5e-15   
gb|KEH27799.1|  plant/MEB5-like protein                               57.0    3e-11   Medicago truncatula
gb|EMT27599.1|  hypothetical protein F775_14275                       70.9    8e-11   
gb|KEH27800.1|  plant/MEB5-like protein                               57.4    2e-10   Medicago truncatula
emb|CAN67950.1|  hypothetical protein VITISV_014439                   65.1    3e-09   Vitis vinifera
emb|CAN68661.1|  hypothetical protein VITISV_004406                   63.9    1e-08   Vitis vinifera
ref|XP_002311800.2|  hypothetical protein POPTR_0008s19910g           63.5    2e-08   
tpg|DAA35353.1|  TPA: hypothetical protein ZEAMMB73_291463            61.6    7e-08   
ref|XP_002444307.1|  hypothetical protein SORBIDRAFT_07g019960        56.2    5e-07   



>ref|XP_009609022.1| PREDICTED: uncharacterized protein LOC104102883 [Nicotiana tomentosiformis]
 ref|XP_009609023.1| PREDICTED: uncharacterized protein LOC104102883 [Nicotiana tomentosiformis]
Length=851

 Score =   154 bits (390),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 89/159 (56%), Positives = 111/159 (70%), Gaps = 2/159 (1%)
 Frame = +3

Query  153  MNFLMLRSNqtaapepppaqeiqaeNNYVPKLSTSLDALVAEDPFQHATS--SENCgveg  326
            MNFLMLRSNQTAA E  PA+E+Q+E N+  K ST+L+ L+AEDPF        E      
Sbjct  1    MNFLMLRSNQTAASEHSPAREVQSEPNHASKPSTTLEGLIAEDPFPEGEKHDGEGNEYGN  60

Query  327  ynhgnenggaaagangKCNHVEVTEDEGWIVIPKKELPDNWSEAPXISSLRSMDRFFVFP  506
             +    +      +    NH++V ++EGWI IPK  LPDNWSEA  ISS+ S+DRFFV P
Sbjct  61   VDEDLVDANERTNSRFVANHIDVKDEEGWITIPKDRLPDNWSEASDISSICSLDRFFVIP  120

Query  507  GEQVKILACLSAYREDIEIITPFKVAALMNKNGVDQSSK  623
            GEQV ILACLSAY++D EIITPFKVAA+MNKNG+ QS++
Sbjct  121  GEQVHILACLSAYKQDTEIITPFKVAAVMNKNGIGQSNQ  159



>ref|XP_009763194.1| PREDICTED: uncharacterized protein LOC104215143 [Nicotiana sylvestris]
 ref|XP_009763195.1| PREDICTED: uncharacterized protein LOC104215143 [Nicotiana sylvestris]
Length=849

 Score =   154 bits (389),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 93/159 (58%), Positives = 115/159 (72%), Gaps = 2/159 (1%)
 Frame = +3

Query  153  MNFLMLRSNqtaapepppaqeiqaeNNYVPKLSTSLDALVAEDPFQHATSSENCgvegyn  332
            MNFLMLRSNQTAA E  PA+E+Q+E N+  K ST+L+ L+AEDPF      +  G E  N
Sbjct  1    MNFLMLRSNQTAASEHSPAREVQSEPNHASKPSTTLEGLIAEDPFPEGEKRDGEGDEYGN  60

Query  333  hgnenggaaagangK--CNHVEVTEDEGWIVIPKKELPDNWSEAPXISSLRSMDRFFVFP  506
               +   A    N +   NH++V ++EGWI IPK  LPDNWSEA  ISS+ S+DRFFV P
Sbjct  61   VDEDLLDANEKTNSRFLANHIDVKDEEGWITIPKDRLPDNWSEASDISSICSLDRFFVIP  120

Query  507  GEQVKILACLSAYREDIEIITPFKVAALMNKNGVDQSSK  623
            GEQV ILACLSAY++D EIITPFKVAA+MNKNG+ QS++
Sbjct  121  GEQVHILACLSAYKQDTEIITPFKVAAVMNKNGIGQSNQ  159



>gb|EYU28702.1| hypothetical protein MIMGU_mgv1a001248mg [Erythranthe guttata]
Length=853

 Score =   150 bits (379),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 87/161 (54%), Positives = 109/161 (68%), Gaps = 4/161 (2%)
 Frame = +3

Query  153  MNFLMLRSNqtaapepppaqeiqaeNNYVPKLSTSLDALVAEDPFQHATSSENCgvegyn  332
            MNFLMLRSN   A E    +E +   N V K +T+L  L+ ED F  +  SE    E   
Sbjct  1    MNFLMLRSNNQTAAELQSGKENRVGENDVSKAATTLQGLIGEDVFPQSKPSETSNAESDV  60

Query  333  hgnenggaaagangKCN----HVEVTEDEGWIVIPKKELPDNWSEAPXISSLRSMDRFFV  500
             G+ENG  A       +    H++V EDEG I+IPKKE+PD+W+EAP I SL S+DR FV
Sbjct  61   FGDENGRPAVSNGKTHSQVDSHIDVAEDEGLIIIPKKEVPDSWTEAPDILSLHSLDRSFV  120

Query  501  FPGEQVKILACLSAYREDIEIITPFKVAALMNKNGVDQSSK  623
            FPGEQ++ILACLSAY++DIEIITPFKVAA+MNKNG+ +S K
Sbjct  121  FPGEQIRILACLSAYKQDIEIITPFKVAAVMNKNGIGESLK  161



>ref|XP_011086395.1| PREDICTED: uncharacterized protein LOC105168145 [Sesamum indicum]
Length=848

 Score =   148 bits (373),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 82/157 (52%), Positives = 107/157 (68%), Gaps = 7/157 (4%)
 Frame = +3

Query  153  MNFLMLRSNqtaapepppaqeiqaeN-NYVPKLSTSLDALVAEDPFQHATSSENCgvegy  329
            MNFLMLRSN   A     + +      NYV K +T+L+ L+ EDP+  +TS+E       
Sbjct  1    MNFLMLRSNNQTATPEMQSVKEAQVEANYVSKAATTLEGLIVEDPYNGSTSAE-TRNAES  59

Query  330  nhgnenggaaagangKCN-----HVEVTEDEGWIVIPKKELPDNWSEAPXISSLRSMDRF  494
            +   +  G+ A ++GK N     H +VTE +G I+IP KE+PDNW+EAP I S RS+DR 
Sbjct  60   DESRDENGSMAVSSGKNNSQVDTHTDVTEADGMIIIPYKEVPDNWTEAPDILSFRSLDRS  119

Query  495  FVFPGEQVKILACLSAYREDIEIITPFKVAALMNKNG  605
            FVFPGEQ++ILACLSAY++D EIITPFKVAA+MNKNG
Sbjct  120  FVFPGEQIRILACLSAYKQDTEIITPFKVAAVMNKNG  156



>ref|XP_006357262.1| PREDICTED: uncharacterized protein LOC102598653 [Solanum tuberosum]
Length=839

 Score =   146 bits (368),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 81/151 (54%), Positives = 106/151 (70%), Gaps = 0/151 (0%)
 Frame = +3

Query  153  MNFLMLRSNqtaapepppaqeiqaeNNYVPKLSTSLDALVAEDPFQHATSSENCgvegyn  332
            MNFLMLRSNQTAA E  PA+E+Q+   +  K ST+L+ L+AE+P+  +   +    E  +
Sbjct  1    MNFLMLRSNQTAASEHSPAREVQSVPTHAAKPSTTLEGLIAEEPYTESEKRDGESDEFED  60

Query  333  hgnenggaaagangKCNHVEVTEDEGWIVIPKKELPDNWSEAPXISSLRSMDRFFVFPGE  512
                +      +    NH++V EDEGWI IPK +LPDNWSEAP +SS+ S+DRFFV PGE
Sbjct  61   EDLADINEKNNSQFAANHIDVKEDEGWITIPKDKLPDNWSEAPDVSSICSLDRFFVIPGE  120

Query  513  QVKILACLSAYREDIEIITPFKVAALMNKNG  605
            QV +LACLSA ++D EIITPFKVAA+M +NG
Sbjct  121  QVHVLACLSACKQDTEIITPFKVAAVMKQNG  151



>ref|XP_004238767.1| PREDICTED: uncharacterized protein LOC101256773 [Solanum lycopersicum]
Length=839

 Score =   142 bits (359),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 80/151 (53%), Positives = 105/151 (70%), Gaps = 0/151 (0%)
 Frame = +3

Query  153  MNFLMLRSNqtaapepppaqeiqaeNNYVPKLSTSLDALVAEDPFQHATSSENCgvegyn  332
            MNFLMLRSNQTAA E  PA+ +Q+   +  K ST+L+ L++E+P+  +   +    E  +
Sbjct  1    MNFLMLRSNQTAASEHSPARGVQSVPTHASKPSTTLEGLISEEPYTESEKRDGESDEFED  60

Query  333  hgnenggaaagangKCNHVEVTEDEGWIVIPKKELPDNWSEAPXISSLRSMDRFFVFPGE  512
                +      +    NH++V EDEGWI IPK +LP+NWSEAP ISS+ S+DRFFV PGE
Sbjct  61   EDLADINEKNNSQFVANHMDVKEDEGWITIPKNKLPENWSEAPDISSICSLDRFFVIPGE  120

Query  513  QVKILACLSAYREDIEIITPFKVAALMNKNG  605
            QV ILACLSA ++D EIITPFKVAA+M +NG
Sbjct  121  QVHILACLSACKQDTEIITPFKVAAVMKQNG  151



>ref|XP_007046233.1| Uncharacterized protein isoform 3 [Theobroma cacao]
 gb|EOY02065.1| Uncharacterized protein isoform 3 [Theobroma cacao]
Length=790

 Score =   139 bits (349),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 85/155 (55%), Positives = 110/155 (71%), Gaps = 3/155 (2%)
 Frame = +3

Query  153  MNFLM-LRSNqtaapepppaqeiqaeNNYVPKLSTSLDALVAEDPFQHATSSENCgvegy  329
            MNFL+ LRSNQ   PEPPP  E  AE+ YV K +T+L+ L+AEDP+   ++ EN G E  
Sbjct  1    MNFLLPLRSNQQGTPEPPPVPEEVAESPYVSKSATTLEGLIAEDPYPEYSTVENHGGETN  60

Query  330  nhgnenggaaagangKC--NHVEVTEDEGWIVIPKKELPDNWSEAPXISSLRSMDRFFVF  503
                E+    +  N     NH +V+E++GWI IP K+LPD+W++AP I SLRS+DR FVF
Sbjct  61   GFEGESTDVVSEKNASVLENHTDVSEEDGWITIPYKDLPDDWNQAPDIHSLRSLDRSFVF  120

Query  504  PGEQVKILACLSAYREDIEIITPFKVAALMNKNGV  608
            PGEQV ILACLSA  ++ EIITPFKVAA+M+KNG+
Sbjct  121  PGEQVHILACLSACNQETEIITPFKVAAVMSKNGM  155



>ref|XP_007046231.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY02063.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=861

 Score =   139 bits (350),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 85/155 (55%), Positives = 110/155 (71%), Gaps = 3/155 (2%)
 Frame = +3

Query  153  MNFLM-LRSNqtaapepppaqeiqaeNNYVPKLSTSLDALVAEDPFQHATSSENCgvegy  329
            MNFL+ LRSNQ   PEPPP  E  AE+ YV K +T+L+ L+AEDP+   ++ EN G E  
Sbjct  1    MNFLLPLRSNQQGTPEPPPVPEEVAESPYVSKSATTLEGLIAEDPYPEYSTVENHGGETN  60

Query  330  nhgnenggaaagangKC--NHVEVTEDEGWIVIPKKELPDNWSEAPXISSLRSMDRFFVF  503
                E+    +  N     NH +V+E++GWI IP K+LPD+W++AP I SLRS+DR FVF
Sbjct  61   GFEGESTDVVSEKNASVLENHTDVSEEDGWITIPYKDLPDDWNQAPDIHSLRSLDRSFVF  120

Query  504  PGEQVKILACLSAYREDIEIITPFKVAALMNKNGV  608
            PGEQV ILACLSA  ++ EIITPFKVAA+M+KNG+
Sbjct  121  PGEQVHILACLSACNQETEIITPFKVAAVMSKNGM  155



>ref|XP_007046232.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOY02064.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=847

 Score =   139 bits (349),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 85/155 (55%), Positives = 110/155 (71%), Gaps = 3/155 (2%)
 Frame = +3

Query  153  MNFLM-LRSNqtaapepppaqeiqaeNNYVPKLSTSLDALVAEDPFQHATSSENCgvegy  329
            MNFL+ LRSNQ   PEPPP  E  AE+ YV K +T+L+ L+AEDP+   ++ EN G E  
Sbjct  1    MNFLLPLRSNQQGTPEPPPVPEEVAESPYVSKSATTLEGLIAEDPYPEYSTVENHGGETN  60

Query  330  nhgnenggaaagangKC--NHVEVTEDEGWIVIPKKELPDNWSEAPXISSLRSMDRFFVF  503
                E+    +  N     NH +V+E++GWI IP K+LPD+W++AP I SLRS+DR FVF
Sbjct  61   GFEGESTDVVSEKNASVLENHTDVSEEDGWITIPYKDLPDDWNQAPDIHSLRSLDRSFVF  120

Query  504  PGEQVKILACLSAYREDIEIITPFKVAALMNKNGV  608
            PGEQV ILACLSA  ++ EIITPFKVAA+M+KNG+
Sbjct  121  PGEQVHILACLSACNQETEIITPFKVAAVMSKNGM  155



>ref|XP_010096339.1| hypothetical protein L484_021086 [Morus notabilis]
 gb|EXB63814.1| hypothetical protein L484_021086 [Morus notabilis]
Length=859

 Score =   136 bits (343),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 81/160 (51%), Positives = 105/160 (66%), Gaps = 6/160 (4%)
 Frame = +3

Query  153  MNFLMLRSNqtaapepppaqeiqaeNNYVPKLSTSLDALVAEDPFQHAT-----SSENCg  317
            MNFLM RS Q+   E     E  AE ++ PK + SL++L+AEDP+   +       EN G
Sbjct  1    MNFLM-RSTQSVTTEQASVPEPVAETHHDPKPTASLESLIAEDPYPQYSRVELHDGENDG  59

Query  318  vegynhgnenggaaagangKCNHVEVTEDEGWIVIPKKELPDNWSEAPXISSLRSMDRFF  497
              G N       A   ++    H +V+E+EGWI IP KELPD+W +AP I SLR++DR F
Sbjct  60   FAGENASIAVPDAKKDSSTIAKHSDVSEEEGWITIPYKELPDDWKDAPDIKSLRTLDRSF  119

Query  498  VFPGEQVKILACLSAYREDIEIITPFKVAALMNKNGVDQS  617
            VFPGEQV ILACL+A ++D EIITPFKVAALM+KNG+ +S
Sbjct  120  VFPGEQVHILACLAACKQDAEIITPFKVAALMSKNGIGKS  159



>ref|XP_002520139.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42194.1| conserved hypothetical protein [Ricinus communis]
Length=843

 Score =   135 bits (341),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 71/135 (53%), Positives = 91/135 (67%), Gaps = 10/135 (7%)
 Frame = +3

Query  243  KLSTSLDALVAEDPFQHATSSENCgvegynhgnenggaaagangKC----------NHVE  392
            K S +L+ L+AEDPFQ + ++     +   HG+   G    A G            NH +
Sbjct  35   KPSATLEGLIAEDPFQQSPTATEAHDDDAAHGSTVAGENGRAGGGASAKNESIDVENHSD  94

Query  393  VTEDEGWIVIPKKELPDNWSEAPXISSLRSMDRFFVFPGEQVKILACLSAYREDIEIITP  572
            V+E+EGWI IP  +LPD W+ AP I+SLRS+DR FVFPGEQV ILACLSAY++D EIITP
Sbjct  95   VSEEEGWITIPHGKLPDGWNNAPDINSLRSLDRSFVFPGEQVHILACLSAYKQDTEIITP  154

Query  573  FKVAALMNKNGVDQS  617
            FKVAA+M+KNG+ QS
Sbjct  155  FKVAAVMSKNGIGQS  169



>ref|XP_008389528.1| PREDICTED: uncharacterized protein LOC103451868 [Malus domestica]
Length=855

 Score =   135 bits (341),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 68/129 (53%), Positives = 90/129 (70%), Gaps = 0/129 (0%)
 Frame = +3

Query  237  VPKLSTSLDALVAEDPFQHATSSENCgvegynhgnenggaaagangKCNHVEVTEDEGWI  416
             PK +T+L+ L+AED +   +++E+   E  + G    GA    +    H +V+++EGWI
Sbjct  40   TPKSATTLEGLIAEDSYPQYSTTEDNAAESESSGENGIGAQKETSIIAKHYDVSDEEGWI  99

Query  417  VIPKKELPDNWSEAPXISSLRSMDRFFVFPGEQVKILACLSAYREDIEIITPFKVAALMN  596
             IP KELPDNW++AP I SLR +DR FVFPGEQV ILACLSA ++D EIITPFK+AA MN
Sbjct  100  AIPYKELPDNWNDAPDIQSLRPLDRSFVFPGEQVHILACLSACKQDTEIITPFKLAAAMN  159

Query  597  KNGVDQSSK  623
            KNG+  S K
Sbjct  160  KNGIRLSPK  168



>emb|CDP00285.1| unnamed protein product [Coffea canephora]
Length=865

 Score =   135 bits (341),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 78/161 (48%), Positives = 105/161 (65%), Gaps = 6/161 (4%)
 Frame = +3

Query  153  MNFLMLRSNqtaapepppaqeiqaeNNYVP-KLSTSLDALVAEDPF-----QHATSSENC  314
            MNFL LRSNQTAA       +    + +   KL+T+L+ L+AEDPF       + + ++ 
Sbjct  1    MNFLGLRSNQTAASSEQSYAQEIQGDAHQRVKLATTLEGLIAEDPFPENMVAESRNGDSE  60

Query  315  gvegynhgnenggaaagangKCNHVEVTEDEGWIVIPKKELPDNWSEAPXISSLRSMDRF  494
                 N   ++  A + ++ +  HV+V+EDEGWI IP KELP NWS+AP +SS R +DR 
Sbjct  61   VYGTENGSFDHTSAKSNSHVEGTHVDVSEDEGWIAIPYKELPRNWSDAPDMSSFRPLDRS  120

Query  495  FVFPGEQVKILACLSAYREDIEIITPFKVAALMNKNGVDQS  617
            FVFPGEQ+ IL CLS  ++D+EIITPFKVAA+MNKNG   S
Sbjct  121  FVFPGEQLHILLCLSVCKQDMEIITPFKVAAVMNKNGFGHS  161



>gb|KJB80039.1| hypothetical protein B456_013G077900 [Gossypium raimondii]
Length=795

 Score =   135 bits (340),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 86/153 (56%), Positives = 108/153 (71%), Gaps = 2/153 (1%)
 Frame = +3

Query  153  MNFLMLRSNqtaapepppaqeiqaeNNYVPKLSTSLDALVAEDPFQHATSSENCgvegyn  332
            MNFL+LRSNQ A PEPPP QE  AE+ YV   +TSL+ L+ EDPF    + EN   E   
Sbjct  1    MNFLLLRSNQQAVPEPPPVQEEVAESTYVSSSATSLEGLIGEDPFPEYPTVENHDAETNG  60

Query  333  hgnenggaaagangKC--NHVEVTEDEGWIVIPKKELPDNWSEAPXISSLRSMDRFFVFP  506
            H  +N G  +G       NH++V E++GWI IP ++LPD+W+ AP ISSLRS+DR FVFP
Sbjct  61   HLGDNAGVGSGKKSSVPENHIDVCEEDGWITIPYRDLPDDWNCAPDISSLRSLDRSFVFP  120

Query  507  GEQVKILACLSAYREDIEIITPFKVAALMNKNG  605
            GEQV +LACLSA  ++ EIITPFKVAA+M K+G
Sbjct  121  GEQVHVLACLSACNQETEIITPFKVAAVMCKSG  153



>gb|KJB80038.1| hypothetical protein B456_013G077900 [Gossypium raimondii]
 gb|KJB80040.1| hypothetical protein B456_013G077900 [Gossypium raimondii]
Length=852

 Score =   135 bits (341),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 86/153 (56%), Positives = 108/153 (71%), Gaps = 2/153 (1%)
 Frame = +3

Query  153  MNFLMLRSNqtaapepppaqeiqaeNNYVPKLSTSLDALVAEDPFQHATSSENCgvegyn  332
            MNFL+LRSNQ A PEPPP QE  AE+ YV   +TSL+ L+ EDPF    + EN   E   
Sbjct  1    MNFLLLRSNQQAVPEPPPVQEEVAESTYVSSSATSLEGLIGEDPFPEYPTVENHDAETNG  60

Query  333  hgnenggaaagangKC--NHVEVTEDEGWIVIPKKELPDNWSEAPXISSLRSMDRFFVFP  506
            H  +N G  +G       NH++V E++GWI IP ++LPD+W+ AP ISSLRS+DR FVFP
Sbjct  61   HLGDNAGVGSGKKSSVPENHIDVCEEDGWITIPYRDLPDDWNCAPDISSLRSLDRSFVFP  120

Query  507  GEQVKILACLSAYREDIEIITPFKVAALMNKNG  605
            GEQV +LACLSA  ++ EIITPFKVAA+M K+G
Sbjct  121  GEQVHVLACLSACNQETEIITPFKVAAVMCKSG  153



>gb|KHG17997.1| Membrane protein [Gossypium arboreum]
Length=855

 Score =   135 bits (340),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 86/153 (56%), Positives = 107/153 (70%), Gaps = 2/153 (1%)
 Frame = +3

Query  153  MNFLMLRSNqtaapepppaqeiqaeNNYVPKLSTSLDALVAEDPFQHATSSENCgvegyn  332
            MNFL+LRSNQ A PEPPP QE  AE+ YV   +TSL+ L+ EDPF    + EN   E   
Sbjct  1    MNFLLLRSNQQAVPEPPPVQEEVAESTYVLSSATSLEGLIGEDPFPEYPTVENHDAETNG  60

Query  333  hgnenggaaagangKC--NHVEVTEDEGWIVIPKKELPDNWSEAPXISSLRSMDRFFVFP  506
            H  EN G  +        NH++V +++GWI IP K+LPD+W+ AP ISSLRS+DR FVFP
Sbjct  61   HLGENAGVGSDKKSSVPENHIDVCDEDGWITIPYKDLPDDWNRAPDISSLRSLDRSFVFP  120

Query  507  GEQVKILACLSAYREDIEIITPFKVAALMNKNG  605
            GEQV +LACLSA  ++ EIITPFKVAA+M K+G
Sbjct  121  GEQVHVLACLSACNQETEIITPFKVAAVMCKSG  153



>ref|XP_007225290.1| hypothetical protein PRUPE_ppa001333mg [Prunus persica]
 gb|EMJ26489.1| hypothetical protein PRUPE_ppa001333mg [Prunus persica]
Length=851

 Score =   135 bits (340),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 75/158 (47%), Positives = 102/158 (65%), Gaps = 1/158 (1%)
 Frame = +3

Query  153  MNFLMLRSNqtaapepppaqeiqaeNNY-VPKLSTSLDALVAEDPFQHATSSENCgvegy  329
            MNFLM  S+        P+      + +  PK +T+L+ L+AED +   ++ ++   E  
Sbjct  1    MNFLMRSSHVQRVSAEQPSVPEPPADAHPTPKSATTLEGLIAEDSYPQYSTIDDHVGESE  60

Query  330  nhgnenggaaagangKCNHVEVTEDEGWIVIPKKELPDNWSEAPXISSLRSMDRFFVFPG  509
              G    GA   ++    H +V+++EGWI IP KELPDNW++AP I SLRS+DR FVFPG
Sbjct  61   YRGENAIGANNESSVIAKHYDVSDEEGWIAIPYKELPDNWNDAPDIHSLRSLDRSFVFPG  120

Query  510  EQVKILACLSAYREDIEIITPFKVAALMNKNGVDQSSK  623
            EQV ILACLSA ++D EIITPFK+AA M+KNG+ QS K
Sbjct  121  EQVHILACLSACQQDTEIITPFKLAAAMSKNGIRQSPK  158



>gb|KDP21229.1| hypothetical protein JCGZ_21700 [Jatropha curcas]
Length=851

 Score =   134 bits (337),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 79/160 (49%), Positives = 99/160 (62%), Gaps = 5/160 (3%)
 Frame = +3

Query  153  MNFLMLRSNqtaapepppaqeiqaeNNYVPKLSTSLDALVAEDPF-----QHATSSENCg  317
            MNFL   + Q    E  P QE  A+     K S +L+ L+AEDPF       A   E  G
Sbjct  1    MNFLQRYTTQNVVTEQVPVQEPPADTRQTSKPSGTLEGLIAEDPFPQSPTAQARDGEAQG  60

Query  318  vegynhgnenggaaagangKCNHVEVTEDEGWIVIPKKELPDNWSEAPXISSLRSMDRFF  497
                N       A   ++   NH +V+E+EGWI IP+ ELPD+W+ A  I SLRS+DR F
Sbjct  61   SGDENGTVGGASAKNDSHVVANHQDVSEEEGWITIPQGELPDDWNNATDIHSLRSLDRSF  120

Query  498  VFPGEQVKILACLSAYREDIEIITPFKVAALMNKNGVDQS  617
            VFPGEQV +LACLSAY++D EIITPFKVAA+M+KNG+ QS
Sbjct  121  VFPGEQVHVLACLSAYKQDTEIITPFKVAAVMSKNGIGQS  160



>ref|XP_008221683.1| PREDICTED: uncharacterized protein LOC103321632 [Prunus mume]
Length=851

 Score =   134 bits (337),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 75/156 (48%), Positives = 102/156 (65%), Gaps = 1/156 (1%)
 Frame = +3

Query  153  MNFLMLRSNqtaapepppaqeiqaeNNY-VPKLSTSLDALVAEDPFQHATSSENCgvegy  329
            MNFLM  S+    P   P+      + +  PK +T+L+ L+AED +   ++ ++   E  
Sbjct  1    MNFLMRSSHVQRVPAEQPSVPEPPADAHPTPKSATTLEGLIAEDSYPQYSTIDDHVGESE  60

Query  330  nhgnenggaaagangKCNHVEVTEDEGWIVIPKKELPDNWSEAPXISSLRSMDRFFVFPG  509
              G    GA   ++    H +V+++EGWI IP KELPDNW++AP I SLRS+DR FVFPG
Sbjct  61   YRGENAIGANNESSVIAKHYDVSDEEGWIAIPYKELPDNWNDAPDIHSLRSLDRSFVFPG  120

Query  510  EQVKILACLSAYREDIEIITPFKVAALMNKNGVDQS  617
            EQV ILACLSA ++D EIITPFK+AA M+KNG+ QS
Sbjct  121  EQVHILACLSACKQDTEIITPFKLAAAMSKNGIRQS  156



>gb|KJB50698.1| hypothetical protein B456_008G182900 [Gossypium raimondii]
 gb|KJB50699.1| hypothetical protein B456_008G182900 [Gossypium raimondii]
Length=852

 Score =   134 bits (336),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 79/158 (50%), Positives = 107/158 (68%), Gaps = 1/158 (1%)
 Frame = +3

Query  153  MNFLMLRSNqtaapepppaqeiqaeNNYVPKLSTSLDALVAEDPFQHATSSEN-Cgvegy  329
            MNFL+LRSNQ   PE PP QE  AE++YVPK  TSL+ L+ +DPF    + EN     G 
Sbjct  1    MNFLLLRSNQQGTPESPPVQEDMAESSYVPKSVTSLERLIVQDPFPEYLTVENHGQSNGL  60

Query  330  nhgnenggaaagangKCNHVEVTEDEGWIVIPKKELPDNWSEAPXISSLRSMDRFFVFPG  509
               N        A+   +H +++E++GWI+IP K+LPD+W  AP + SLRS+DR FVFPG
Sbjct  61   LGKNAGAACDKNASVIASHTDISEEDGWIIIPNKDLPDDWDCAPNMRSLRSLDRSFVFPG  120

Query  510  EQVKILACLSAYREDIEIITPFKVAALMNKNGVDQSSK  623
            EQV +L CLSA  ++ EIITPFKVA +M+KNG+ + ++
Sbjct  121  EQVHVLVCLSACNQETEIITPFKVAEVMSKNGMRKGTE  158



>gb|KHG29108.1| Heat-inducible transcription repressor HrcA [Gossypium arboreum]
Length=851

 Score =   133 bits (335),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 78/158 (49%), Positives = 105/158 (66%), Gaps = 1/158 (1%)
 Frame = +3

Query  153  MNFLMLRSNqtaapepppaqeiqaeNNYVPKLSTSLDALVAEDPFQHATSSEN-Cgvegy  329
            MNFL+LRSNQ   PE P  QE  AE++YVPK  TSL+ L+ EDPF      EN     G 
Sbjct  1    MNFLLLRSNQQGTPESPSVQEDMAESSYVPKSVTSLERLIVEDPFPEYLKVENHGQSNGL  60

Query  330  nhgnenggaaagangKCNHVEVTEDEGWIVIPKKELPDNWSEAPXISSLRSMDRFFVFPG  509
               N        A+   +H++++E++GWI+IP K+LPD+W  AP + SLRS+DR FVFPG
Sbjct  61   LGKNAGAACDKNASVIASHIDMSEEDGWIIIPNKDLPDDWDCAPHMRSLRSLDRSFVFPG  120

Query  510  EQVKILACLSAYREDIEIITPFKVAALMNKNGVDQSSK  623
            EQV +L CLSA  ++ E ITPFKVA +M+KNG+ + ++
Sbjct  121  EQVHVLVCLSACNQETETITPFKVAEVMSKNGMQKGTE  158



>ref|XP_009360399.1| PREDICTED: uncharacterized protein LOC103950874 [Pyrus x bretschneideri]
Length=858

 Score =   133 bits (335),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 90/129 (70%), Gaps = 0/129 (0%)
 Frame = +3

Query  237  VPKLSTSLDALVAEDPFQHATSSENCgvegynhgnenggaaagangKCNHVEVTEDEGWI  416
             PK +T+L+ L+AED +   +++E+   E  + G    GA    +    H +V+++EGWI
Sbjct  43   TPKSATTLEGLIAEDSYPQYSTTEDNAAESESSGENGIGAKKETSVIAKHYDVSDEEGWI  102

Query  417  VIPKKELPDNWSEAPXISSLRSMDRFFVFPGEQVKILACLSAYREDIEIITPFKVAALMN  596
             IP KELPDNW++AP I SLR +DR FVFPGEQV ILACLSA ++D EIITPFK+AA M+
Sbjct  103  AIPYKELPDNWNDAPDIQSLRPLDRSFVFPGEQVHILACLSACKQDTEIITPFKLAAAMS  162

Query  597  KNGVDQSSK  623
            KNG+  S K
Sbjct  163  KNGIRLSPK  171



>ref|XP_011071029.1| PREDICTED: uncharacterized protein LOC105156561 isoform X1 [Sesamum 
indicum]
Length=862

 Score =   132 bits (333),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 75/162 (46%), Positives = 101/162 (62%), Gaps = 5/162 (3%)
 Frame = +3

Query  153  MNFLMLRSNqtaapepppaqeiqaeN-NYVPKLSTSLDALVAEDPFQHATSSEN----Cg  317
            MNFLMLRSN   A +   +        N+  K  T+L+ L+AE+     TSSE+      
Sbjct  1    MNFLMLRSNNQTAIQEQQSVNETQVEPNHASKRGTTLEGLIAEEKLPQKTSSESHISEID  60

Query  318  vegynhgnenggaaagangKCNHVEVTEDEGWIVIPKKELPDNWSEAPXISSLRSMDRFF  497
              G  +    G +    +    H++V+E+ G I+IP KE PDNW+EAP I S RS+DR F
Sbjct  61   DYGDENDRTAGSSGKSDSQLDGHIDVSENGGSIIIPCKEFPDNWTEAPDILSYRSLDRSF  120

Query  498  VFPGEQVKILACLSAYREDIEIITPFKVAALMNKNGVDQSSK  623
            VFPGEQ++ILACLSA ++D E+ITPFKVAA+MNKNG+  S +
Sbjct  121  VFPGEQIRILACLSACKQDTEVITPFKVAAVMNKNGLRPSPR  162



>ref|XP_010044706.1| PREDICTED: uncharacterized protein LOC104433602 [Eucalyptus grandis]
 ref|XP_010044707.1| PREDICTED: uncharacterized protein LOC104433602 [Eucalyptus grandis]
 gb|KCW86802.1| hypothetical protein EUGRSUZ_B03410 [Eucalyptus grandis]
Length=855

 Score =   130 bits (328),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 73/159 (46%), Positives = 101/159 (64%), Gaps = 3/159 (2%)
 Frame = +3

Query  153  MNFLMLRSNqtaapepppaqeiqaeNNYVPKLSTSLDALVAEDP--FQHATSSENCgveg  326
            MNFL LR + T A E P       + + + +  T+L+ L+AEDP     A  S     + 
Sbjct  1    MNFL-LRQSPTVAAEQPSVNGSNIDTHKMSRSVTTLEGLIAEDPPPIDSAEDSGGVAAKY  59

Query  327  ynhgnenggaaagangKCNHVEVTEDEGWIVIPKKELPDNWSEAPXISSLRSMDRFFVFP  506
             +        +  A+    H++V+E++GWI IP K+LP+NW++AP I SLRS+DR FVFP
Sbjct  60   EDVSIVGSDTSGDASLMGKHLDVSEEDGWITIPSKKLPENWNDAPDIHSLRSLDRSFVFP  119

Query  507  GEQVKILACLSAYREDIEIITPFKVAALMNKNGVDQSSK  623
            GEQ+ +LACLSA  +D+EIITPFKVAALM+KNG+ Q  K
Sbjct  120  GEQIHVLACLSANEQDMEIITPFKVAALMSKNGIGQGEK  158



>ref|XP_002269942.1| PREDICTED: uncharacterized protein LOC100255337 [Vitis vinifera]
 ref|XP_010652452.1| PREDICTED: uncharacterized protein LOC100255337 [Vitis vinifera]
Length=868

 Score =   130 bits (328),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 79/158 (50%), Positives = 106/158 (67%), Gaps = 2/158 (1%)
 Frame = +3

Query  153  MNFLMLRSNqtaapepppaqeiqaeNNYVPKLSTSLDALVAEDPFQHATSSE-NCgvegy  329
            MNFLM R + TA  + PP  EI     +V K + +L+ L+AED F +    E +  V G 
Sbjct  1    MNFLM-RPSHTAHADEPPVHEISKGTQHVTKPTATLEGLIAEDSFPNYFVDEIHGEVGGE  59

Query  330  nhgnenggaaagangKCNHVEVTEDEGWIVIPKKELPDNWSEAPXISSLRSMDRFFVFPG  509
            N       + + +    N  +VTE+EGWI+IP+KELPDNW +AP I S RS+DR FVFPG
Sbjct  60   NGSVAGLSSKSDSPDLVNLSDVTEEEGWIIIPQKELPDNWRDAPDICSFRSLDRSFVFPG  119

Query  510  EQVKILACLSAYREDIEIITPFKVAALMNKNGVDQSSK  623
            EQV ILACLS+ +++ +IITPFKVAA+M+KNG+ QS+K
Sbjct  120  EQVHILACLSSSKQETQIITPFKVAAMMSKNGIGQSTK  157



>emb|CBI32021.3| unnamed protein product [Vitis vinifera]
Length=832

 Score =   130 bits (327),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 79/158 (50%), Positives = 106/158 (67%), Gaps = 2/158 (1%)
 Frame = +3

Query  153  MNFLMLRSNqtaapepppaqeiqaeNNYVPKLSTSLDALVAEDPFQHATSSE-NCgvegy  329
            MNFLM R + TA  + PP  EI     +V K + +L+ L+AED F +    E +  V G 
Sbjct  1    MNFLM-RPSHTAHADEPPVHEISKGTQHVTKPTATLEGLIAEDSFPNYFVDEIHGEVGGE  59

Query  330  nhgnenggaaagangKCNHVEVTEDEGWIVIPKKELPDNWSEAPXISSLRSMDRFFVFPG  509
            N       + + +    N  +VTE+EGWI+IP+KELPDNW +AP I S RS+DR FVFPG
Sbjct  60   NGSVAGLSSKSDSPDLVNLSDVTEEEGWIIIPQKELPDNWRDAPDICSFRSLDRSFVFPG  119

Query  510  EQVKILACLSAYREDIEIITPFKVAALMNKNGVDQSSK  623
            EQV ILACLS+ +++ +IITPFKVAA+M+KNG+ QS+K
Sbjct  120  EQVHILACLSSSKQETQIITPFKVAAMMSKNGIGQSTK  157



>ref|XP_008353106.1| PREDICTED: uncharacterized protein LOC103416653 [Malus domestica]
Length=1143

 Score =   130 bits (327),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 90/129 (70%), Gaps = 0/129 (0%)
 Frame = +3

Query  237  VPKLSTSLDALVAEDPFQHATSSENCgvegynhgnenggaaagangKCNHVEVTEDEGWI  416
             PK +T+L++L+ ED +   ++ E+   E  + G    GA    +    H +V+++EGWI
Sbjct  40   TPKSATTLESLIGEDSYPQYSTIEDNAGESESRGENGIGAEKETSVIAKHYDVSDEEGWI  99

Query  417  VIPKKELPDNWSEAPXISSLRSMDRFFVFPGEQVKILACLSAYREDIEIITPFKVAALMN  596
             IP KELPDNW++AP I SLRS+DR FVFPGEQV ILACLSA ++D EIITPFK+AA M+
Sbjct  100  SIPYKELPDNWNDAPDIQSLRSLDRSFVFPGEQVHILACLSACKQDTEIITPFKLAAAMS  159

Query  597  KNGVDQSSK  623
            KNG+  S K
Sbjct  160  KNGLRLSPK  168



>ref|XP_011010794.1| PREDICTED: uncharacterized protein LOC105115567 [Populus euphratica]
 ref|XP_011010795.1| PREDICTED: uncharacterized protein LOC105115567 [Populus euphratica]
Length=827

 Score =   128 bits (321),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 82/126 (65%), Gaps = 2/126 (2%)
 Frame = +3

Query  240  PKLSTSLDALVAEDPFQHATSSENCgvegynhgnenggaaagangKCNHVEVTEDEGWIV  419
            P  + +L+ L+AED F  +   +                ++      NH +V+E+EGWI+
Sbjct  27   PSPAVTLEGLIAEDSFPQSEVRDMGIGGENGSVAATKNDSSLVLE--NHSDVSEEEGWII  84

Query  420  IPKKELPDNWSEAPXISSLRSMDRFFVFPGEQVKILACLSAYREDIEIITPFKVAALMNK  599
            IP  ELPD+W  AP I SLRS+DR FVFPGEQV ILACLSAY++D EIITPFKVAA+M+K
Sbjct  85   IPFGELPDDWKNAPDIHSLRSLDRSFVFPGEQVHILACLSAYKQDTEIITPFKVAAVMSK  144

Query  600  NGVDQS  617
            NG  QS
Sbjct  145  NGKGQS  150



>ref|XP_010262507.1| PREDICTED: uncharacterized protein LOC104601022 [Nelumbo nucifera]
Length=873

 Score =   128 bits (321),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 77/163 (47%), Positives = 102/163 (63%), Gaps = 7/163 (4%)
 Frame = +3

Query  153  MNFLMLRSNqtaapepppaqeiqaeNNYVPKLSTSLDALVAEDPFQHATSSENCgvegyn  332
            MNFL LR+   A  + P   E  +  N V K +T+L+ L++EDP   +  S + G E   
Sbjct  1    MNFL-LRTTHAATIDHPSVPEHTSHQNSVSKQATTLEGLISEDPIPDSPPSVDGGRESGV  59

Query  333  hgnenggaaagangKC----NHVEVTEDEGWIVI--PKKELPDNWSEAPXISSLRSMDRF  494
                 G     A  +     NH +VTEDEGWI+I  P KELPD+W++AP I +LR++DR 
Sbjct  60   SHGSTGDEGQSAKHQLPIVENHSDVTEDEGWIIITVPYKELPDDWNDAPDILTLRALDRS  119

Query  495  FVFPGEQVKILACLSAYREDIEIITPFKVAALMNKNGVDQSSK  623
            FVFPGEQV ILACLS   +D E ITPFKVAA+MNKNG+ ++ +
Sbjct  120  FVFPGEQVHILACLSTSNQDKEFITPFKVAAMMNKNGLQKTKQ  162



>ref|XP_006827133.1| hypothetical protein AMTR_s00010p00249430 [Amborella trichopoda]
 gb|ERM94370.1| hypothetical protein AMTR_s00010p00249430 [Amborella trichopoda]
Length=889

 Score =   127 bits (318),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 72/159 (45%), Positives = 101/159 (64%), Gaps = 2/159 (1%)
 Frame = +3

Query  135  DKICAKMNFLMLRSNqtaapepppaqeiqaeNNYVPKLSTSLDALVAEDPFQHATSSENC  314
            D   + MNFL LR+ Q    +     E+  + +  PK   +L+ L+AEDPF   ++S++ 
Sbjct  26   DTTASTMNFL-LRTAQPTILDSSGVPELPKDTSAAPKRPNTLEGLIAEDPFPTPSTSDDG  84

Query  315  gvegynhgnenggaaagangKCNHVEVTEDEGWIVIPKKELPDNWSEAPXISSLRSMDRF  494
               G   GN  G          NH +VTE+EGWI IP +ELP++W++A  ISS RS+ R 
Sbjct  85   NGFGVASGNAEGLNEKAHVEIENHRDVTEEEGWITIPSRELPEDWADAHEISSFRSLHRS  144

Query  495  FVFPGEQVKILACLSAYRED-IEIITPFKVAALMNKNGV  608
            F+FPGEQ+ IL CLSA ++D +EI+TPF+VAALMNKNG+
Sbjct  145  FIFPGEQLHILVCLSASKQDTVEIVTPFRVAALMNKNGL  183



>ref|XP_009402670.1| PREDICTED: uncharacterized protein LOC103986392 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009402671.1| PREDICTED: uncharacterized protein LOC103986392 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009402672.1| PREDICTED: uncharacterized protein LOC103986392 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=850

 Score =   125 bits (315),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/130 (45%), Positives = 88/130 (68%), Gaps = 1/130 (1%)
 Frame = +3

Query  237  VPKLSTSLDALVAEDPFQHATSSENCgvegynhgnenggaaa-gangKCNHVEVTEDEGW  413
            + + +++L+ L+AEDPFQ  ++ ++   +     +      A  +  + NH +V ED+GW
Sbjct  30   ISRQTSTLEGLIAEDPFQSPSTGDDADTDSDVITDVGSSTPAPTSKNQGNHTDVLEDDGW  89

Query  414  IVIPKKELPDNWSEAPXISSLRSMDRFFVFPGEQVKILACLSAYREDIEIITPFKVAALM  593
            I IP KELPDNW++A  I  LRS+DR F+FPGE + IL CLSA++++ EIITPF+VAA M
Sbjct  90   ITIPYKELPDNWTDAADIQQLRSLDRSFIFPGEHMHILVCLSAWKQESEIITPFRVAAAM  149

Query  594  NKNGVDQSSK  623
            ++NG   S+K
Sbjct  150  SRNGKSSSNK  159



>ref|XP_006438610.1| hypothetical protein CICLE_v10030693mg [Citrus clementina]
 gb|ESR51850.1| hypothetical protein CICLE_v10030693mg [Citrus clementina]
Length=803

 Score =   125 bits (314),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 90/138 (65%), Gaps = 11/138 (8%)
 Frame = +3

Query  228  NNYVPKLSTSLDALVAEDPFQHATSSENCgvegynhgnenggaaagangKC--------N  383
             ++VPK +++L+ L+ EDPF   +SS++              A+  A+  C        N
Sbjct  28   TSFVPKPASTLEGLITEDPFPLYSSSDD---RDGESDGVGAEASGIASSSCKNDTSVVEN  84

Query  384  HVEVTEDEGWIVIPKKELPDNWSEAPXISSLRSMDRFFVFPGEQVKILACLSAYREDIEI  563
            H +V+E+EGWI IP KELPDNW +AP I SL S+DR FVFPGEQ+ +LACLSA ++D E+
Sbjct  85   HTDVSEEEGWITIPYKELPDNWCDAPDIQSLCSLDRPFVFPGEQIHVLACLSACKQDTEV  144

Query  564  ITPFKVAALMNKNGVDQS  617
            ITPFKVAA+M++    QS
Sbjct  145  ITPFKVAAVMSRTSRAQS  162



>ref|XP_006483238.1| PREDICTED: uncharacterized protein LOC102613577 [Citrus sinensis]
Length=860

 Score =   125 bits (314),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 90/138 (65%), Gaps = 11/138 (8%)
 Frame = +3

Query  228  NNYVPKLSTSLDALVAEDPFQHATSSENCgvegynhgnenggaaagangKC--------N  383
             ++VPK +++L+ L+ EDPF   +SS++              A+  A+  C        N
Sbjct  28   TSFVPKPASTLEGLITEDPFPLYSSSDD---RDGESDGVGAEASGIASSSCKNDTSVVEN  84

Query  384  HVEVTEDEGWIVIPKKELPDNWSEAPXISSLRSMDRFFVFPGEQVKILACLSAYREDIEI  563
            H +V+E+EGWI IP KELPDNW +AP I SL S+DR FVFPGEQ+ +LACLSA ++D E+
Sbjct  85   HTDVSEEEGWITIPYKELPDNWCDAPDIQSLCSLDRPFVFPGEQIHVLACLSACKQDTEV  144

Query  564  ITPFKVAALMNKNGVDQS  617
            ITPFKVAA+M++    QS
Sbjct  145  ITPFKVAAVMSRTSRAQS  162



>ref|XP_006438611.1| hypothetical protein CICLE_v10030693mg [Citrus clementina]
 gb|ESR51851.1| hypothetical protein CICLE_v10030693mg [Citrus clementina]
Length=860

 Score =   125 bits (314),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 90/138 (65%), Gaps = 11/138 (8%)
 Frame = +3

Query  228  NNYVPKLSTSLDALVAEDPFQHATSSENCgvegynhgnenggaaagangKC--------N  383
             ++VPK +++L+ L+ EDPF   +SS++              A+  A+  C        N
Sbjct  28   TSFVPKPASTLEGLITEDPFPLYSSSDD---RDGESDGVGAEASGIASSSCKNDTSVVEN  84

Query  384  HVEVTEDEGWIVIPKKELPDNWSEAPXISSLRSMDRFFVFPGEQVKILACLSAYREDIEI  563
            H +V+E+EGWI IP KELPDNW +AP I SL S+DR FVFPGEQ+ +LACLSA ++D E+
Sbjct  85   HTDVSEEEGWITIPYKELPDNWCDAPDIQSLCSLDRPFVFPGEQIHVLACLSACKQDTEV  144

Query  564  ITPFKVAALMNKNGVDQS  617
            ITPFKVAA+M++    QS
Sbjct  145  ITPFKVAAVMSRTSRAQS  162



>ref|XP_010932674.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105053268 
[Elaeis guineensis]
Length=857

 Score =   124 bits (312),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 87/123 (71%), Gaps = 2/123 (2%)
 Frame = +3

Query  243  KLSTSLDALVAEDPFQHATSSENCgvegynhgnenggaaagang-KC-NHVEVTEDEGWI  416
            K +T+L+ L+AEDPF ++ + E+ G  G   G+  G      N   C N  +VTEDEGWI
Sbjct  32   KQATTLEGLIAEDPFPNSRTKEDDGKXGDGVGDGGGETQGLENQFACGNLADVTEDEGWI  91

Query  417  VIPKKELPDNWSEAPXISSLRSMDRFFVFPGEQVKILACLSAYREDIEIITPFKVAALMN  596
             IP KELPDNWS+AP I  LR +DR F+FPGEQ+ IL CLSA ++D EIITPF+VAA+M+
Sbjct  92   TIPCKELPDNWSDAPDILQLRLLDRSFIFPGEQIHILVCLSAAKQDSEIITPFRVAAVMS  151

Query  597  KNG  605
            KNG
Sbjct  152  KNG  154



>gb|KJB50702.1| hypothetical protein B456_008G182900 [Gossypium raimondii]
Length=616

 Score =   122 bits (307),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 61/133 (46%), Positives = 90/133 (68%), Gaps = 1/133 (1%)
 Frame = +3

Query  228  NNYVPKLSTSLDALVAEDPF-QHATSSENCgvegynhgnenggaaagangKCNHVEVTED  404
            ++YVPK  TSL+ L+ +DPF ++ T   +    G    N        A+   +H +++E+
Sbjct  4    SSYVPKSVTSLERLIVQDPFPEYLTVENHGQSNGLLGKNAGAACDKNASVIASHTDISEE  63

Query  405  EGWIVIPKKELPDNWSEAPXISSLRSMDRFFVFPGEQVKILACLSAYREDIEIITPFKVA  584
            +GWI+IP K+LPD+W  AP + SLRS+DR FVFPGEQV +L CLSA  ++ EIITPFKVA
Sbjct  64   DGWIIIPNKDLPDDWDCAPNMRSLRSLDRSFVFPGEQVHVLVCLSACNQETEIITPFKVA  123

Query  585  ALMNKNGVDQSSK  623
             +M+KNG+ + ++
Sbjct  124  EVMSKNGMRKGTE  136



>ref|XP_010683264.1| PREDICTED: uncharacterized protein LOC104897980 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010683265.1| PREDICTED: uncharacterized protein LOC104897980 [Beta vulgaris 
subsp. vulgaris]
Length=840

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = +3

Query  384  HVEVTEDEGWIVIPKKELPDNWSEAPXISSLRSMDRFFVFPGEQVKILACLSAYREDIEI  563
            HV+VTEDEGWI IP K LPD+WS AP I   +S DR FVFPGEQV ILACLSA ++D EI
Sbjct  92   HVDVTEDEGWITIPCKNLPDDWSGAPDIHEFQSFDRSFVFPGEQVHILACLSASKQDTEI  151

Query  564  ITPFKVAALMNKNGVDQSSK  623
            ITPFKVAA+MNKNG    +K
Sbjct  152  ITPFKVAAVMNKNGYGPGAK  171



>gb|KJB50700.1| hypothetical protein B456_008G182900 [Gossypium raimondii]
Length=773

 Score =   122 bits (307),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 62/133 (47%), Positives = 89/133 (67%), Gaps = 1/133 (1%)
 Frame = +3

Query  228  NNYVPKLSTSLDALVAEDPFQHATSSEN-CgvegynhgnenggaaagangKCNHVEVTED  404
            ++YVPK  TSL+ L+ +DPF    + EN     G    N        A+   +H +++E+
Sbjct  4    SSYVPKSVTSLERLIVQDPFPEYLTVENHGQSNGLLGKNAGAACDKNASVIASHTDISEE  63

Query  405  EGWIVIPKKELPDNWSEAPXISSLRSMDRFFVFPGEQVKILACLSAYREDIEIITPFKVA  584
            +GWI+IP K+LPD+W  AP + SLRS+DR FVFPGEQV +L CLSA  ++ EIITPFKVA
Sbjct  64   DGWIIIPNKDLPDDWDCAPNMRSLRSLDRSFVFPGEQVHVLVCLSACNQETEIITPFKVA  123

Query  585  ALMNKNGVDQSSK  623
             +M+KNG+ + ++
Sbjct  124  EVMSKNGMRKGTE  136



>gb|KJB50701.1| hypothetical protein B456_008G182900 [Gossypium raimondii]
Length=830

 Score =   122 bits (307),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 61/133 (46%), Positives = 90/133 (68%), Gaps = 1/133 (1%)
 Frame = +3

Query  228  NNYVPKLSTSLDALVAEDPF-QHATSSENCgvegynhgnenggaaagangKCNHVEVTED  404
            ++YVPK  TSL+ L+ +DPF ++ T   +    G    N        A+   +H +++E+
Sbjct  4    SSYVPKSVTSLERLIVQDPFPEYLTVENHGQSNGLLGKNAGAACDKNASVIASHTDISEE  63

Query  405  EGWIVIPKKELPDNWSEAPXISSLRSMDRFFVFPGEQVKILACLSAYREDIEIITPFKVA  584
            +GWI+IP K+LPD+W  AP + SLRS+DR FVFPGEQV +L CLSA  ++ EIITPFKVA
Sbjct  64   DGWIIIPNKDLPDDWDCAPNMRSLRSLDRSFVFPGEQVHVLVCLSACNQETEIITPFKVA  123

Query  585  ALMNKNGVDQSSK  623
             +M+KNG+ + ++
Sbjct  124  EVMSKNGMRKGTE  136



>ref|XP_008805506.1| PREDICTED: uncharacterized protein LOC103718451 isoform X3 [Phoenix 
dactylifera]
Length=686

 Score =   121 bits (304),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 62/123 (50%), Positives = 81/123 (66%), Gaps = 2/123 (2%)
 Frame = +3

Query  243  KLSTSLDALVAEDPFQHA-TSSENCgvegynhgnenggaaagangKC-NHVEVTEDEGWI  416
            K +T+L+ L+AED F ++ T  ++                +     C N  +VTEDEGWI
Sbjct  32   KQATTLEGLIAEDLFPNSLTEGDDDKDGDGVGDAGGETQGSENQVACGNLTDVTEDEGWI  91

Query  417  VIPKKELPDNWSEAPXISSLRSMDRFFVFPGEQVKILACLSAYREDIEIITPFKVAALMN  596
             IP KELPDNWS+AP I  LR +DR F+FPGEQ+ IL CLSA ++D EIITPF+VAA+M+
Sbjct  92   TIPYKELPDNWSDAPDILQLRLLDRSFIFPGEQIHILVCLSAAKQDTEIITPFRVAAVMS  151

Query  597  KNG  605
            KNG
Sbjct  152  KNG  154



>ref|XP_008805504.1| PREDICTED: uncharacterized protein LOC103718451 isoform X1 [Phoenix 
dactylifera]
Length=851

 Score =   122 bits (306),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 62/123 (50%), Positives = 81/123 (66%), Gaps = 2/123 (2%)
 Frame = +3

Query  243  KLSTSLDALVAEDPFQHA-TSSENCgvegynhgnenggaaagangKC-NHVEVTEDEGWI  416
            K +T+L+ L+AED F ++ T  ++                +     C N  +VTEDEGWI
Sbjct  32   KQATTLEGLIAEDLFPNSLTEGDDDKDGDGVGDAGGETQGSENQVACGNLTDVTEDEGWI  91

Query  417  VIPKKELPDNWSEAPXISSLRSMDRFFVFPGEQVKILACLSAYREDIEIITPFKVAALMN  596
             IP KELPDNWS+AP I  LR +DR F+FPGEQ+ IL CLSA ++D EIITPF+VAA+M+
Sbjct  92   TIPYKELPDNWSDAPDILQLRLLDRSFIFPGEQIHILVCLSAAKQDTEIITPFRVAAVMS  151

Query  597  KNG  605
            KNG
Sbjct  152  KNG  154



>ref|XP_004298449.1| PREDICTED: uncharacterized protein LOC101310896 isoform X1 [Fragaria 
vesca subsp. vesca]
 ref|XP_011463102.1| PREDICTED: uncharacterized protein LOC101310896 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=850

 Score =   122 bits (305),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 64/121 (53%), Positives = 83/121 (69%), Gaps = 0/121 (0%)
 Frame = +3

Query  255  SLDALVAEDPFQHATSSENCgvegynhgnenggaaagangKCNHVEVTEDEGWIVIPKKE  434
            +L+ L+AED +   ++  +   E        GGA   ++    H +V++ EGWI IP KE
Sbjct  38   TLEGLIAEDTYPQYSAIADQVGENEPGVEHGGGAKNDSSSIAKHHDVSDKEGWIAIPYKE  97

Query  435  LPDNWSEAPXISSLRSMDRFFVFPGEQVKILACLSAYREDIEIITPFKVAALMNKNGVDQ  614
            LPDNW++AP I SLRSMDR FVFPGEQV ILA LSA ++D EIITPFK+AA M+KNG+ Q
Sbjct  98   LPDNWNDAPDIQSLRSMDRSFVFPGEQVHILALLSACKQDTEIITPFKLAAAMSKNGLKQ  157

Query  615  S  617
            S
Sbjct  158  S  158



>ref|XP_002266784.1| PREDICTED: uncharacterized protein LOC100254494 [Vitis vinifera]
Length=853

 Score =   121 bits (304),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 102/158 (65%), Gaps = 2/158 (1%)
 Frame = +3

Query  153  MNFLMLRSNqtaapepppaqeiqaeNNYVPKLSTSLDALVAEDPFQHATSSE-NCgvegy  329
            MNFLM R + TA  +  P  EI     +V + +++L+ L+AE+ F +    E    V G 
Sbjct  1    MNFLM-RPSHTAHVDKRPVHEISKGAQHVTEPASTLEGLIAEESFSNNYMDEVKDEVGGE  59

Query  330  nhgnenggaaagangKCNHVEVTEDEGWIVIPKKELPDNWSEAPXISSLRSMDRFFVFPG  509
            N       +   +  + N  +VTE+EGWI IP K LPDNW +AP I S RS+DR FVFPG
Sbjct  60   NGSFAGLSSKRDSPVQDNISDVTEEEGWISIPYKGLPDNWRDAPDICSFRSLDRPFVFPG  119

Query  510  EQVKILACLSAYREDIEIITPFKVAALMNKNGVDQSSK  623
            EQV ILACLS+ +++ EIITPFKVAA+M+KNG+ QS+K
Sbjct  120  EQVHILACLSSSKQETEIITPFKVAAMMSKNGIGQSTK  157



>ref|XP_010264947.1| PREDICTED: uncharacterized protein LOC104602813 [Nelumbo nucifera]
Length=871

 Score =   121 bits (304),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 74/162 (46%), Positives = 98/162 (60%), Gaps = 6/162 (4%)
 Frame = +3

Query  153  MNFLMLRSNqtaapepppaqeiqaeNNYVPKLSTSLDALVAEDPFQHATSS-----ENCg  317
            MNFLM R+ Q    + P   E     N   K + +L+ L+AEDPF  ++ S     E+ G
Sbjct  1    MNFLM-RTAQPVVSDQPAVNEPPLHPNSALKSAMTLEGLIAEDPFPQSSISVDGGKESDG  59

Query  318  vegynhgnenggaaagangKCNHVEVTEDEGWIVIPKKELPDNWSEAPXISSLRSMDRFF  497
            V   +       A        N+  VTEDEGWI IP KELPDNWS++  I +LRS+DR F
Sbjct  60   VGAGSSTVVGQSANLQFPIVENYSVVTEDEGWITIPYKELPDNWSDSSDILTLRSLDRSF  119

Query  498  VFPGEQVKILACLSAYREDIEIITPFKVAALMNKNGVDQSSK  623
            VFPGEQ+ ILACLS   +D E+ITPF++AA+M+K G+ Q +K
Sbjct  120  VFPGEQIHILACLSTSNQDTELITPFRIAAVMSKKGIGQKTK  161



>emb|CBI29239.3| unnamed protein product [Vitis vinifera]
Length=842

 Score =   121 bits (304),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 102/158 (65%), Gaps = 2/158 (1%)
 Frame = +3

Query  153  MNFLMLRSNqtaapepppaqeiqaeNNYVPKLSTSLDALVAEDPFQHATSSE-NCgvegy  329
            MNFLM R + TA  +  P  EI     +V + +++L+ L+AE+ F +    E    V G 
Sbjct  1    MNFLM-RPSHTAHVDKRPVHEISKGAQHVTEPASTLEGLIAEESFSNNYMDEVKDEVGGE  59

Query  330  nhgnenggaaagangKCNHVEVTEDEGWIVIPKKELPDNWSEAPXISSLRSMDRFFVFPG  509
            N       +   +  + N  +VTE+EGWI IP K LPDNW +AP I S RS+DR FVFPG
Sbjct  60   NGSFAGLSSKRDSPVQDNISDVTEEEGWISIPYKGLPDNWRDAPDICSFRSLDRPFVFPG  119

Query  510  EQVKILACLSAYREDIEIITPFKVAALMNKNGVDQSSK  623
            EQV ILACLS+ +++ EIITPFKVAA+M+KNG+ QS+K
Sbjct  120  EQVHILACLSSSKQETEIITPFKVAAMMSKNGIGQSTK  157



>gb|KHN30518.1| hypothetical protein glysoja_045712 [Glycine soja]
Length=858

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = +3

Query  384  HVEVTEDEGWIVIPKKELPDNWSEAPXISSLRSMDRFFVFPGEQVKILACLSAYREDIEI  563
            H++V+EDEGWI IP KELP+NW+    + SLRS+DR F+FPGEQV ILACLSA ++D EI
Sbjct  85   HLDVSEDEGWITIPYKELPENWNHVSDMQSLRSLDRSFLFPGEQVHILACLSACKQDTEI  144

Query  564  ITPFKVAALMNKNGVDQSS  620
            ITPFKVAA+M+KNG+  SS
Sbjct  145  ITPFKVAAVMSKNGMGHSS  163



>ref|XP_003551988.1| PREDICTED: uncharacterized protein LOC100808045 [Glycine max]
Length=858

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = +3

Query  384  HVEVTEDEGWIVIPKKELPDNWSEAPXISSLRSMDRFFVFPGEQVKILACLSAYREDIEI  563
            H++V+EDEGWI IP KELP+NW+    + SLRS+DR F+FPGEQV ILACLSA ++D EI
Sbjct  85   HLDVSEDEGWITIPYKELPENWNHVSDMQSLRSLDRSFLFPGEQVHILACLSACKQDTEI  144

Query  564  ITPFKVAALMNKNGVDQSS  620
            ITPFKVAA+M+KNG+  SS
Sbjct  145  ITPFKVAAVMSKNGMGHSS  163



>gb|KHN13484.1| hypothetical protein glysoja_029585 [Glycine soja]
Length=855

 Score =   119 bits (297),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 64/155 (41%), Positives = 91/155 (59%), Gaps = 4/155 (3%)
 Frame = +3

Query  153  MNFLMLRSNqtaapepppaqeiqaeNNYVPKLSTSLDALVAEDPFQHATSSENCgvegyn  332
            MNFLM  ++   +    P     A        ++SL++L+++DP+      +        
Sbjct  1    MNFLMRSTSHVYSDREKPPSSSTAATTPHADGASSLESLMSDDPYAQVEHFDG----EAE  56

Query  333  hgnenggaaagangKCNHVEVTEDEGWIVIPKKELPDNWSEAPXISSLRSMDRFFVFPGE  512
              N    +         HV+V+EDEGWI IP KE+P+NW+    + SLRS+DR F+FPGE
Sbjct  57   GENGAQSSRNDTPVLAKHVDVSEDEGWITIPYKEIPENWNHVSDMQSLRSLDRSFLFPGE  116

Query  513  QVKILACLSAYREDIEIITPFKVAALMNKNGVDQS  617
            QV ILACLSA ++D+EIITPFKVAA+M+KNG+   
Sbjct  117  QVHILACLSACKQDMEIITPFKVAAVMSKNGMGHG  151



>ref|XP_003530682.2| PREDICTED: uncharacterized protein LOC100796980 [Glycine max]
Length=853

 Score =   118 bits (296),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = +3

Query  384  HVEVTEDEGWIVIPKKELPDNWSEAPXISSLRSMDRFFVFPGEQVKILACLSAYREDIEI  563
            HV+V+EDEGWI IP KE+P+NW+    + SLRS+DR F+FPGEQV ILACLSA ++D+EI
Sbjct  79   HVDVSEDEGWITIPYKEIPENWNHVSDMQSLRSLDRSFLFPGEQVHILACLSACKQDMEI  138

Query  564  ITPFKVAALMNKNGVDQS  617
            ITPFKVAA+M+KNG+   
Sbjct  139  ITPFKVAAVMSKNGMGHG  156



>gb|KGN51885.1| hypothetical protein Csa_5G604300 [Cucumis sativus]
Length=920

 Score =   116 bits (290),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 75/183 (41%), Positives = 98/183 (54%), Gaps = 23/183 (13%)
 Frame = +3

Query  114  SPISDQRDKICAKMNFLMLRSNqtaapepppaqeiqaeNNYVPKLSTSLDALVAEDPFQH  293
            SPIS   D   A MNFL+  ++      P   +       Y PK + +L+ L++EDPF  
Sbjct  71   SPISYSVD---ATMNFLLRSTHTVPQERPSIQETPPPAAYYAPKPAVTLEGLISEDPFPQ  127

Query  294  -------------ATSSENCgvegynhgnenggaaagangKCNHVEVTEDEGWIVIPKKE  434
                         A++ EN  + G+   +   G          H +V+E+EGWI IP K 
Sbjct  128  YSVVDDDNDEEDDASAGENGSIAGHREKSGRAGV-------VKHSDVSEEEGWITIPCKG  180

Query  435  LPDNWSEAPXISSLRSMDRFFVFPGEQVKILACLSAYREDIEIITPFKVAALMNKNGVDQ  614
            LP +W  A  I SL  MDR FVFPGEQ+ ILACLSA ++D E ITPFKVAA+M+KNG   
Sbjct  181  LPSDWKNASDIHSLCRMDRSFVFPGEQICILACLSASKQDTETITPFKVAAVMSKNGKWH  240

Query  615  SSK  623
            S K
Sbjct  241  SPK  243



>ref|XP_006296984.1| hypothetical protein CARUB_v10012978mg [Capsella rubella]
 gb|EOA29882.1| hypothetical protein CARUB_v10012978mg [Capsella rubella]
Length=833

 Score =   115 bits (289),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 86/131 (66%), Gaps = 4/131 (3%)
 Frame = +3

Query  243  KLSTSLDALVAEDPFQHATSSENCgvegynhgnenggaaagangKCNHVE----VTEDEG  410
            K   +L+ L+AE+PF    S E+         +++G   + A    + +E    V+E+EG
Sbjct  33   KSGATLEGLIAEEPFPQYPSVEDLDRVADGSRDDDGSGESNAKSGASCIERFSDVSEEEG  92

Query  411  WIVIPKKELPDNWSEAPXISSLRSMDRFFVFPGEQVKILACLSAYREDIEIITPFKVAAL  590
            WI IP KE+PDNWSE+  I SLRS+DR FVFPGEQ++ILACLS  + D EIITPFKVA +
Sbjct  93   WIAIPYKEIPDNWSESVDIHSLRSLDRSFVFPGEQIQILACLSESKGDTEIITPFKVAEV  152

Query  591  MNKNGVDQSSK  623
            M++ G  ++S+
Sbjct  153  MSRTGQRKASE  163



>ref|XP_008446313.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103489086 
[Cucumis melo]
Length=912

 Score =   115 bits (289),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 75/176 (43%), Positives = 98/176 (56%), Gaps = 9/176 (5%)
 Frame = +3

Query  114  SPISDQRDKICAKMNFLMLRSNqtaapepppaqeiqaeNNYVPKLSTSLDALVAEDPFQH  293
            SPIS   D   A MNFL+  ++      P   +       Y PK + +L+ L++EDPF  
Sbjct  62   SPISYSVD---ATMNFLLRSTHTVPQERPSIQETPPPAAYYAPKPAVTLEGLISEDPFPQ  118

Query  294  ATSSENCgvegynhgnenggaaagangKCN------HVEVTEDEGWIVIPKKELPDNWSE  455
             +  ++   E  +      G+ AG   K        H +V+E+EGWI IP K LP +W  
Sbjct  119  YSVVDDDNDEEADASGGENGSIAGHREKSGRFGVVKHSDVSEEEGWITIPCKGLPSDWKN  178

Query  456  APXISSLRSMDRFFVFPGEQVKILACLSAYREDIEIITPFKVAALMNKNGVDQSSK  623
            A  I SL  MDR FVFPGEQ+ ILACLSA ++D E ITPFKVAA+M+KNG   S K
Sbjct  179  ASDIHSLCRMDRSFVFPGEQICILACLSASKQDTETITPFKVAAVMSKNGKWHSPK  234



>ref|XP_011463103.1| PREDICTED: uncharacterized protein LOC101310896 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=849

 Score =   115 bits (288),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 82/121 (68%), Gaps = 1/121 (1%)
 Frame = +3

Query  255  SLDALVAEDPFQHATSSENCgvegynhgnenggaaagangKCNHVEVTEDEGWIVIPKKE  434
            +L+ L+AED +   ++  +   E        GGA   ++    H +V++ EGWI IP K 
Sbjct  38   TLEGLIAEDTYPQYSAIADQVGENEPGVEHGGGAKNDSSSIAKHHDVSDKEGWIAIPYK-  96

Query  435  LPDNWSEAPXISSLRSMDRFFVFPGEQVKILACLSAYREDIEIITPFKVAALMNKNGVDQ  614
            LPDNW++AP I SLRSMDR FVFPGEQV ILA LSA ++D EIITPFK+AA M+KNG+ Q
Sbjct  97   LPDNWNDAPDIQSLRSMDRSFVFPGEQVHILALLSACKQDTEIITPFKLAAAMSKNGLKQ  156

Query  615  S  617
            S
Sbjct  157  S  157



>ref|XP_008789389.1| PREDICTED: uncharacterized protein LOC103706884 isoform X3 [Phoenix 
dactylifera]
Length=705

 Score =   114 bits (285),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 82/122 (67%), Gaps = 2/122 (2%)
 Frame = +3

Query  243  KLSTSLDALVAEDPFQHATSSENCgvegynhgnenggaaagangKC--NHVEVTEDEGWI  416
            K +T+L+ L+AED F ++ + E+   +    G+         N     NH +VTEDEG I
Sbjct  32   KRATTLEGLIAEDRFPNSPTGEDDDKDNDGAGDVGAETQDSENQVAFGNHTDVTEDEGCI  91

Query  417  VIPKKELPDNWSEAPXISSLRSMDRFFVFPGEQVKILACLSAYREDIEIITPFKVAALMN  596
            +IP KELPDNWS+A  +  L+ +DR FVFPGEQ+ IL CLSA ++D +IITPF+VAA+M+
Sbjct  92   IIPYKELPDNWSDASDVLQLQLLDRSFVFPGEQIHILVCLSASKQDTDIITPFRVAAVMS  151

Query  597  KN  602
            KN
Sbjct  152  KN  153



>ref|XP_009395685.1| PREDICTED: uncharacterized protein LOC103980887 [Musa acuminata 
subsp. malaccensis]
Length=848

 Score =   114 bits (285),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/127 (43%), Positives = 82/127 (65%), Gaps = 4/127 (3%)
 Frame = +3

Query  237  VPKLSTSLDALVAEDPF-QHATSSENCgvegynhgnenggaaagangK---CNHVEVTED  404
            +PK + +L+ L+AE+ F  H+  ++            +    + +  +    NH +V++D
Sbjct  30   IPKPAATLEGLIAEETFSNHSIGNDALTDSEQVGFVGSSAPGSTSKNQFPVGNHTDVSDD  89

Query  405  EGWIVIPKKELPDNWSEAPXISSLRSMDRFFVFPGEQVKILACLSAYREDIEIITPFKVA  584
            +GWI IP KELPDNW++A  I  LRS+DR F+FPGE ++IL CLSA +   E+ITPF+VA
Sbjct  90   DGWITIPYKELPDNWADAADIQQLRSLDRSFIFPGEHIQILVCLSASKHVSEVITPFRVA  149

Query  585  ALMNKNG  605
            A+M+KNG
Sbjct  150  AVMSKNG  156



>ref|XP_008789375.1| PREDICTED: uncharacterized protein LOC103706884 isoform X1 [Phoenix 
dactylifera]
Length=936

 Score =   114 bits (285),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 82/122 (67%), Gaps = 2/122 (2%)
 Frame = +3

Query  243  KLSTSLDALVAEDPFQHATSSENCgvegynhgnenggaaagangKC--NHVEVTEDEGWI  416
            K +T+L+ L+AED F ++ + E+   +    G+         N     NH +VTEDEG I
Sbjct  32   KRATTLEGLIAEDRFPNSPTGEDDDKDNDGAGDVGAETQDSENQVAFGNHTDVTEDEGCI  91

Query  417  VIPKKELPDNWSEAPXISSLRSMDRFFVFPGEQVKILACLSAYREDIEIITPFKVAALMN  596
            +IP KELPDNWS+A  +  L+ +DR FVFPGEQ+ IL CLSA ++D +IITPF+VAA+M+
Sbjct  92   IIPYKELPDNWSDASDVLQLQLLDRSFVFPGEQIHILVCLSASKQDTDIITPFRVAAVMS  151

Query  597  KN  602
            KN
Sbjct  152  KN  153



>ref|XP_004509944.1| PREDICTED: uncharacterized protein LOC101513000 isoform X1 [Cicer 
arietinum]
Length=856

 Score =   114 bits (284),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 50/78 (64%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = +3

Query  384  HVEVTEDEGWIVIPKKELPDNWSEAPXISSLRSMDRFFVFPGEQVKILACLSAYREDIEI  563
            H++V+EDEGWI IP KELP++W+    I SLR +DR F+FPGEQV I+ACLSA ++D EI
Sbjct  81   HLDVSEDEGWIAIPYKELPEDWNNVSDIQSLRPLDRSFLFPGEQVHIVACLSACKQDTEI  140

Query  564  ITPFKVAALMNKNGVDQS  617
            ITPFKVAALM+KN +  S
Sbjct  141  ITPFKVAALMSKNAIGHS  158



>gb|EPS68544.1| hypothetical protein M569_06219, partial [Genlisea aurea]
Length=798

 Score =   112 bits (281),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 49/79 (62%), Positives = 65/79 (82%), Gaps = 0/79 (0%)
 Frame = +3

Query  381  NHVEVTEDEGWIVIPKKELPDNWSEAPXISSLRSMDRFFVFPGEQVKILACLSAYREDIE  560
            +H+++ ED G I+IP  ++ DNW+EAP + SL S+DR F+FPGEQV+I ACLSAY+ D E
Sbjct  46   SHIDIKEDAGSIIIPSDKVLDNWTEAPDMHSLCSLDRSFIFPGEQVQIFACLSAYKHDTE  105

Query  561  IITPFKVAALMNKNGVDQS  617
            IITPFKVAA+MNKNG+ +S
Sbjct  106  IITPFKVAAVMNKNGICKS  124



>ref|XP_004170264.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101226485 
[Cucumis sativus]
Length=838

 Score =   112 bits (281),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 69/163 (42%), Positives = 92/163 (56%), Gaps = 6/163 (4%)
 Frame = +3

Query  153  MNFLMLRSNqtaapepppaqeiqaeNNYVPKLSTSLDALVAEDPFQHATSSENCgvegyn  332
            MNFL+  ++      P   +       Y PK + +L+ L++EDPF   +  ++   E  +
Sbjct  1    MNFLLRSTHTVPQERPSIQETPPPAAYYAPKPAVTLEGLISEDPFPQYSVVDDDNDEEDD  60

Query  333  hgnenggaaagangKCN------HVEVTEDEGWIVIPKKELPDNWSEAPXISSLRSMDRF  494
                  G+ AG   K        H +V+E+EGWI IP K LP +W  A  I SL  MDR 
Sbjct  61   ASAGENGSIAGHREKSGRAGVVKHSDVSEEEGWITIPCKGLPSDWKNASDIHSLCRMDRS  120

Query  495  FVFPGEQVKILACLSAYREDIEIITPFKVAALMNKNGVDQSSK  623
            FVFPGEQ+ ILACLSA ++D E ITPFKVAA+M+KNG   S K
Sbjct  121  FVFPGEQICILACLSASKQDTETITPFKVAAVMSKNGKWHSPK  163



>ref|XP_004135196.1| PREDICTED: uncharacterized protein LOC101203447 [Cucumis sativus]
Length=840

 Score =   112 bits (281),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 69/170 (41%), Positives = 92/170 (54%), Gaps = 20/170 (12%)
 Frame = +3

Query  153  MNFLMLRSNqtaapepppaqeiqaeNNYVPKLSTSLDALVAEDPFQH-------------  293
            MNFL+  ++      P   +       Y PK + +L+ L++EDPF               
Sbjct  1    MNFLLRSTHTVPQERPSIQETPPPAAYYAPKPAVTLEGLISEDPFPQYSVVDDDNDEEDD  60

Query  294  ATSSENCgvegynhgnenggaaagangKCNHVEVTEDEGWIVIPKKELPDNWSEAPXISS  473
            A++ EN  + G+   +   G          H +V+E+EGWI IP K LP +W  A  I S
Sbjct  61   ASAGENGSIAGHREKSGRAGV-------VKHSDVSEEEGWITIPCKGLPSDWKNASDIHS  113

Query  474  LRSMDRFFVFPGEQVKILACLSAYREDIEIITPFKVAALMNKNGVDQSSK  623
            L  MDR FVFPGEQ+ ILACLSA ++D E ITPFKVAA+M+KNG   S K
Sbjct  114  LCRMDRSFVFPGEQICILACLSASKQDTETITPFKVAAVMSKNGKWHSPK  163



>ref|XP_007153848.1| hypothetical protein PHAVU_003G0698001g [Phaseolus vulgaris]
 gb|ESW25842.1| hypothetical protein PHAVU_003G0698001g [Phaseolus vulgaris]
Length=600

 Score =   111 bits (278),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 85/129 (66%), Gaps = 14/129 (11%)
 Frame = +3

Query  249  STSLDALVAEDP------FQHATSSENCgvegynhgnenggaaagangKCNHVEVTEDEG  410
            ++SL++L AEDP      F      EN  V   +  + +  A         H++V+EDEG
Sbjct  42   ASSLESLTAEDPYIQVGHFDGEVDGENGAVPFTSKNDASVLAM--------HLDVSEDEG  93

Query  411  WIVIPKKELPDNWSEAPXISSLRSMDRFFVFPGEQVKILACLSAYREDIEIITPFKVAAL  590
            WI IP KE+P++W+ A  +   RS+DR F+FPGEQV+ILACLSA ++D+EIITPFKVAA+
Sbjct  94   WITIPYKEIPEDWNHASDMQFFRSLDRSFLFPGEQVQILACLSACKQDMEIITPFKVAAV  153

Query  591  MNKNGVDQS  617
            M+K+G+  S
Sbjct  154  MSKSGMCHS  162



>ref|XP_007153849.1| hypothetical protein PHAVU_003G0698001g, partial [Phaseolus vulgaris]
 gb|ESW25843.1| hypothetical protein PHAVU_003G0698001g, partial [Phaseolus vulgaris]
Length=602

 Score =   111 bits (278),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 85/129 (66%), Gaps = 14/129 (11%)
 Frame = +3

Query  249  STSLDALVAEDP------FQHATSSENCgvegynhgnenggaaagangKCNHVEVTEDEG  410
            ++SL++L AEDP      F      EN  V   +  + +  A         H++V+EDEG
Sbjct  42   ASSLESLTAEDPYIQVGHFDGEVDGENGAVPFTSKNDASVLAM--------HLDVSEDEG  93

Query  411  WIVIPKKELPDNWSEAPXISSLRSMDRFFVFPGEQVKILACLSAYREDIEIITPFKVAAL  590
            WI IP KE+P++W+ A  +   RS+DR F+FPGEQV+ILACLSA ++D+EIITPFKVAA+
Sbjct  94   WITIPYKEIPEDWNHASDMQFFRSLDRSFLFPGEQVQILACLSACKQDMEIITPFKVAAV  153

Query  591  MNKNGVDQS  617
            M+K+G+  S
Sbjct  154  MSKSGMCHS  162



>ref|XP_010917702.1| PREDICTED: uncharacterized protein LOC105042268 [Elaeis guineensis]
Length=866

 Score =   112 bits (280),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 79/122 (65%), Gaps = 2/122 (2%)
 Frame = +3

Query  243  KLSTSLDALVAEDPFQHATSSENCgvegynhgnenggaaagangKC--NHVEVTEDEGWI  416
            K +T+L+ L+AED F  + + ++ G +          A    N     NH +VTEDEG I
Sbjct  32   KRATTLEGLIAEDRFPKSPTGKDDGKDNDGASAVGAEAQDSENQVAFGNHTDVTEDEGCI  91

Query  417  VIPKKELPDNWSEAPXISSLRSMDRFFVFPGEQVKILACLSAYREDIEIITPFKVAALMN  596
            +IP  ELPDNWS A  +  LR +DR F+FPGEQ+ IL CLSA ++D EIITPF+VAA+M+
Sbjct  92   IIPNMELPDNWSNASDVLQLRLLDRSFIFPGEQIHILVCLSASKQDTEIITPFRVAAVMS  151

Query  597  KN  602
            KN
Sbjct  152  KN  153



>gb|KEH19840.1| plant/MEB5-like protein [Medicago truncatula]
Length=837

 Score =   110 bits (275),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = +3

Query  384  HVEVTEDEGWIVIPKKELPDNWSEAPXISSLRSMDRFFVFPGEQVKILACLSAYREDIEI  563
            H++V E+EGWI IP KELP++W+    I SLR +DR F+ PGEQV I+ACLSA ++D EI
Sbjct  85   HLDVNEEEGWITIPYKELPEDWNNVSDIQSLRPLDRSFLIPGEQVHIVACLSACKQDTEI  144

Query  564  ITPFKVAALMNKNGVDQS  617
            ITPFKVAA+M+KNG+  S
Sbjct  145  ITPFKVAAVMSKNGIGHS  162



>ref|XP_004489991.1| PREDICTED: uncharacterized protein LOC101501755 isoform X1 [Cicer 
arietinum]
 ref|XP_004489992.1| PREDICTED: uncharacterized protein LOC101501755 isoform X2 [Cicer 
arietinum]
Length=821

 Score =   110 bits (274),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 61/80 (76%), Gaps = 0/80 (0%)
 Frame = +3

Query  384  HVEVTEDEGWIVIPKKELPDNWSEAPXISSLRSMDRFFVFPGEQVKILACLSAYREDIEI  563
            H++V+E+EGWI IP KELP+NW   P I SLR +DR FVFPGEQV +LACLSA ++D +I
Sbjct  75   HIDVSEEEGWITIPCKELPENWDHVPDIQSLRRLDRSFVFPGEQVHMLACLSACKQDTQI  134

Query  564  ITPFKVAALMNKNGVDQSSK  623
             TPFKV+A+ + NG    S+
Sbjct  135  TTPFKVSAMTSNNGTSHISE  154



>ref|XP_002883095.1| hypothetical protein ARALYDRAFT_898144 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59354.1| hypothetical protein ARALYDRAFT_898144 [Arabidopsis lyrata subsp. 
lyrata]
Length=837

 Score =   109 bits (272),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/72 (67%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = +3

Query  390  EVTEDEGWIVIPKKELPDNWSEAPXISSLRSMDRFFVFPGEQVKILACLSAYREDIEIIT  569
            +V+E+EGWI IP KE+PDNWSE+  I SLRS+DR FVFPGEQ++ILACLS  + D EIIT
Sbjct  87   DVSEEEGWIAIPYKEIPDNWSESVDIHSLRSLDRSFVFPGEQIQILACLSESKGDTEIIT  146

Query  570  PFKVAALMNKNG  605
            PFKVA +M++ G
Sbjct  147  PFKVAEVMSRTG  158



>ref|XP_006406675.1| hypothetical protein EUTSA_v10020058mg [Eutrema salsugineum]
 ref|XP_006406676.1| hypothetical protein EUTSA_v10020058mg [Eutrema salsugineum]
 gb|ESQ48128.1| hypothetical protein EUTSA_v10020058mg [Eutrema salsugineum]
 gb|ESQ48129.1| hypothetical protein EUTSA_v10020058mg [Eutrema salsugineum]
Length=844

 Score =   109 bits (272),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 58/120 (48%), Positives = 81/120 (68%), Gaps = 1/120 (1%)
 Frame = +3

Query  249  STSLDALVAEDPF-QHATSSENCgvegynhgnenggaaagangKCNHVEVTEDEGWIVIP  425
              +L+ L+AE+PF Q+ +  ++        GN    A  G +G     +V+E++GWI IP
Sbjct  35   GATLEGLIAEEPFPQYPSVEDHLDRVPDGDGNGESNAMNGGSGMERFSDVSEEDGWIAIP  94

Query  426  KKELPDNWSEAPXISSLRSMDRFFVFPGEQVKILACLSAYREDIEIITPFKVAALMNKNG  605
             KE+PDNWSE+  I SLRS+DR FVFPGEQ++ILACL+  + D EIITPFKVA +M++ G
Sbjct  95   YKEIPDNWSESVDIHSLRSLDRSFVFPGEQIQILACLAESKGDTEIITPFKVAEVMSRTG  154



>dbj|BAJ99760.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=823

 Score =   108 bits (271),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 58/134 (43%), Positives = 86/134 (64%), Gaps = 11/134 (8%)
 Frame = +3

Query  237  VPKLSTSLDALVAEDPFQHATSSE------NCgvegynhgnenggaaagangKCN-----  383
            +P+   +L+ L+A+DPF+ + S+E      N   E       +  AA   + K +     
Sbjct  15   IPEQPKTLEGLIADDPFRVSASAEEDGTASNGAGEIGGDAAASPPAATSPDSKSSAPPGK  74

Query  384  HVEVTEDEGWIVIPKKELPDNWSEAPXISSLRSMDRFFVFPGEQVKILACLSAYREDIEI  563
            H +V++DEGWI IP KELP++WSE   +  LR +DR F+FPGEQV ILACLSA ++D+  
Sbjct  75   HSDVSQDEGWIAIPNKELPEDWSEVSDMLQLRPLDRPFLFPGEQVHILACLSASKQDMTS  134

Query  564  ITPFKVAALMNKNG  605
            I+PF++AA+M+KNG
Sbjct  135  ISPFRIAAVMSKNG  148



>ref|XP_004962963.1| PREDICTED: uncharacterized protein LOC101782397 [Setaria italica]
Length=818

 Score =   108 bits (270),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 56/128 (44%), Positives = 82/128 (64%), Gaps = 5/128 (4%)
 Frame = +3

Query  237  VPKLSTSLDALV-AEDPFQHATS-SENCgvegynhgnenggaaagangKC---NHVEVTE  401
            +PK +T+L+ L+ AED +Q + + SE+  V           A   +        H +V E
Sbjct  25   LPKPATTLEGLIIAEDSYQPSPARSEDGAVNNGPGDVGADSAPLASKSPVQLGTHTDVAE  84

Query  402  DEGWIVIPKKELPDNWSEAPXISSLRSMDRFFVFPGEQVKILACLSAYREDIEIITPFKV  581
            DEGWI IP K LPDNW++   +  LR +DR F+FPGEQV +LACLSA ++D ++I+PF++
Sbjct  85   DEGWITIPYKRLPDNWNDVSEMVQLRPLDRSFLFPGEQVHVLACLSASKQDTQVISPFRI  144

Query  582  AALMNKNG  605
            AA+M+KNG
Sbjct  145  AAVMSKNG  152



>ref|XP_006649417.1| PREDICTED: uncharacterized protein LOC102709155 [Oryza brachyantha]
Length=821

 Score =   108 bits (269),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 78/121 (64%), Gaps = 3/121 (2%)
 Frame = +3

Query  252  TSLDALVAEDPFQHATSSENCgvegynhgnenggaaagangKC---NHVEVTEDEGWIVI  422
            T+L+ L+A+DP+Q + S E+              +   +        H ++++DEGWI I
Sbjct  33   TTLEGLIADDPYQPSASIEDGDANNGAVDTGGDSSDVDSKNPAPAGKHTDISDDEGWITI  92

Query  423  PKKELPDNWSEAPXISSLRSMDRFFVFPGEQVKILACLSAYREDIEIITPFKVAALMNKN  602
            P K+LPD+W+    +  L+ +DR F+FPGEQV ILACLSA ++D ++I+PF++AA+M++N
Sbjct  93   PNKKLPDDWNGLSDMLQLQPLDRSFLFPGEQVHILACLSASKQDAQVISPFRIAAVMSRN  152

Query  603  G  605
            G
Sbjct  153  G  153



>dbj|BAB02713.1| unnamed protein product [Arabidopsis thaliana]
Length=833

 Score =   108 bits (269),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = +3

Query  390  EVTEDEGWIVIPKKELPDNWSEAPXISSLRSMDRFFVFPGEQVKILACLSAYREDIEIIT  569
            +V+E++GWI IP KE+PDNWSE+  I SLRS+DR FVFPGEQ++ILACLS  + D EIIT
Sbjct  87   DVSEEQGWIAIPYKEIPDNWSESVDIHSLRSLDRSFVFPGEQIQILACLSESKGDTEIIT  146

Query  570  PFKVAALMNKNG  605
            PFKVA +M++ G
Sbjct  147  PFKVAEVMSRTG  158



>gb|EEC74537.1| hypothetical protein OsI_10057 [Oryza sativa Indica Group]
Length=859

 Score =   108 bits (269),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 50/119 (42%), Positives = 81/119 (68%), Gaps = 1/119 (1%)
 Frame = +3

Query  252  TSLDALVAEDPFQHATSSENCgvegynhgnenggaaagangKCN-HVEVTEDEGWIVIPK  428
            T+L+ L+A+DP+  +   E+      + G ++  A +  +     H +V +DEGWI IP 
Sbjct  33   TTLEGLIADDPYHPSPEDEDTDNGDVDIGGDSADADSKNSVPTGKHTDVLDDEGWITIPN  92

Query  429  KELPDNWSEAPXISSLRSMDRFFVFPGEQVKILACLSAYREDIEIITPFKVAALMNKNG  605
            KELPDNW++   +  L+ +DR F+FPGEQV ILAC+SA +++ ++I+PF++AA+M+KNG
Sbjct  93   KELPDNWNDLSDMLQLQPLDRPFLFPGEQVHILACMSASKQETQVISPFRIAAVMSKNG  151



>ref|NP_001048995.1| Os03g0152800 [Oryza sativa Japonica Group]
 gb|ABF94027.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF10909.1| Os03g0152800 [Oryza sativa Japonica Group]
Length=859

 Score =   108 bits (269),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 50/119 (42%), Positives = 81/119 (68%), Gaps = 1/119 (1%)
 Frame = +3

Query  252  TSLDALVAEDPFQHATSSENCgvegynhgnenggaaagangKCN-HVEVTEDEGWIVIPK  428
            T+L+ L+A+DP+  +   E+      + G ++  A +  +     H +V +DEGWI IP 
Sbjct  33   TTLEGLIADDPYHPSPEDEDTDNGDVDIGGDSADADSKNSVPTGKHTDVLDDEGWITIPN  92

Query  429  KELPDNWSEAPXISSLRSMDRFFVFPGEQVKILACLSAYREDIEIITPFKVAALMNKNG  605
            KELPDNW++   +  L+ +DR F+FPGEQV ILAC+SA +++ ++I+PF++AA+M+KNG
Sbjct  93   KELPDNWNDLSDMLQLQPLDRPFLFPGEQVHILACMSASKQETQVISPFRIAAVMSKNG  151



>ref|NP_566591.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAK32754.1|AF361586_1 AT3g17900/MEB5_12 [Arabidopsis thaliana]
 gb|AAN28888.1| At3g17900/MEB5_12 [Arabidopsis thaliana]
 gb|AEE76022.1| uncharacterized protein AT3G17900 [Arabidopsis thaliana]
Length=838

 Score =   108 bits (269),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = +3

Query  390  EVTEDEGWIVIPKKELPDNWSEAPXISSLRSMDRFFVFPGEQVKILACLSAYREDIEIIT  569
            +V+E++GWI IP KE+PDNWSE+  I SLRS+DR FVFPGEQ++ILACLS  + D EIIT
Sbjct  87   DVSEEQGWIAIPYKEIPDNWSESVDIHSLRSLDRSFVFPGEQIQILACLSESKGDTEIIT  146

Query  570  PFKVAALMNKNG  605
            PFKVA +M++ G
Sbjct  147  PFKVAEVMSRTG  158



>gb|ABF94028.1| expressed protein [Oryza sativa Japonica Group]
 gb|ABF94030.1| expressed protein [Oryza sativa Japonica Group]
Length=863

 Score =   108 bits (269),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 50/119 (42%), Positives = 81/119 (68%), Gaps = 1/119 (1%)
 Frame = +3

Query  252  TSLDALVAEDPFQHATSSENCgvegynhgnenggaaagangKCN-HVEVTEDEGWIVIPK  428
            T+L+ L+A+DP+  +   E+      + G ++  A +  +     H +V +DEGWI IP 
Sbjct  33   TTLEGLIADDPYHPSPEDEDTDNGDVDIGGDSADADSKNSVPTGKHTDVLDDEGWITIPN  92

Query  429  KELPDNWSEAPXISSLRSMDRFFVFPGEQVKILACLSAYREDIEIITPFKVAALMNKNG  605
            KELPDNW++   +  L+ +DR F+FPGEQV ILAC+SA +++ ++I+PF++AA+M+KNG
Sbjct  93   KELPDNWNDLSDMLQLQPLDRPFLFPGEQVHILACMSASKQETQVISPFRIAAVMSKNG  151



>ref|XP_010465853.1| PREDICTED: uncharacterized protein LOC104746144 [Camelina sativa]
Length=834

 Score =   107 bits (268),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 58/130 (45%), Positives = 83/130 (64%), Gaps = 4/130 (3%)
 Frame = +3

Query  243  KLSTSLDALVAEDPFQHATSSENCgvegynhgnenggaaagangKCNHVE----VTEDEG  410
            K   +L+ L+AE+PF    S E+         +++G   +      + +E    V+E++G
Sbjct  33   KSGATLEGLIAEEPFPQYPSVEDLDRVADGSRDDDGSGESIPKSGASCMERFSDVSEEQG  92

Query  411  WIVIPKKELPDNWSEAPXISSLRSMDRFFVFPGEQVKILACLSAYREDIEIITPFKVAAL  590
            WI IP KE+PDN SE+  I SLRS+DR FVFPGEQ++ILACLS  + D EIITPFKVA +
Sbjct  93   WIAIPYKEIPDNLSESVDIHSLRSLDRSFVFPGEQIQILACLSESKGDAEIITPFKVAEV  152

Query  591  MNKNGVDQSS  620
            M++ G  ++S
Sbjct  153  MSRTGQRKAS  162



>ref|XP_010487691.1| PREDICTED: uncharacterized protein LOC104765639 [Camelina sativa]
 ref|XP_010487692.1| PREDICTED: uncharacterized protein LOC104765639 [Camelina sativa]
 ref|XP_010487693.1| PREDICTED: uncharacterized protein LOC104765639 [Camelina sativa]
Length=832

 Score =   107 bits (268),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 58/130 (45%), Positives = 83/130 (64%), Gaps = 4/130 (3%)
 Frame = +3

Query  243  KLSTSLDALVAEDPFQHATSSENCgvegynhgnenggaaagangKCNHVE----VTEDEG  410
            K   +L+ L+AE+PF    S E+         +++G   +      + +E    V+E++G
Sbjct  33   KSGATLEGLIAEEPFPQYPSVEDLDRVADGSRDDDGSGESIPKSGASCMERFSDVSEEQG  92

Query  411  WIVIPKKELPDNWSEAPXISSLRSMDRFFVFPGEQVKILACLSAYREDIEIITPFKVAAL  590
            WI IP KE+PDN SE+  I SLRS+DR FVFPGEQ++ILACLS  + D EIITPFKVA +
Sbjct  93   WIAIPYKEIPDNLSESVDIHSLRSLDRSFVFPGEQIQILACLSESKGDAEIITPFKVAEV  152

Query  591  MNKNGVDQSS  620
            M++ G  ++S
Sbjct  153  MSRTGQRKAS  162



>emb|CDY51921.1| BnaAnng10980D [Brassica napus]
Length=821

 Score =   107 bits (268),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = +3

Query  390  EVTEDEGWIVIPKKELPDNWSEAPXISSLRSMDRFFVFPGEQVKILACLSAYREDIEIIT  569
            +V+EDEGWI IP KE+PDNWSE+  I SLRS+DR FVFPGEQ++ILACLS  + D EIIT
Sbjct  87   DVSEDEGWISIPYKEIPDNWSESVDIESLRSLDRSFVFPGEQIQILACLSESKGDAEIIT  146

Query  570  PFKVAALMNK  599
            PFKVA +M++
Sbjct  147  PFKVAEVMSR  156



>gb|EEE58339.1| hypothetical protein OsJ_09447 [Oryza sativa Japonica Group]
Length=1194

 Score =   107 bits (268),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 50/119 (42%), Positives = 81/119 (68%), Gaps = 1/119 (1%)
 Frame = +3

Query  252  TSLDALVAEDPFQHATSSENCgvegynhgnenggaaagangKCN-HVEVTEDEGWIVIPK  428
            T+L+ L+A+DP+  +   E+      + G ++  A +  +     H +V +DEGWI IP 
Sbjct  368  TTLEGLIADDPYHPSPEDEDTDNGDVDIGGDSADADSKNSVPTGKHTDVLDDEGWITIPN  427

Query  429  KELPDNWSEAPXISSLRSMDRFFVFPGEQVKILACLSAYREDIEIITPFKVAALMNKNG  605
            KELPDNW++   +  L+ +DR F+FPGEQV ILAC+SA +++ ++I+PF++AA+M+KNG
Sbjct  428  KELPDNWNDLSDMLQLQPLDRPFLFPGEQVHILACMSASKQETQVISPFRIAAVMSKNG  486



>ref|XP_004509945.1| PREDICTED: uncharacterized protein LOC101513000 isoform X2 [Cicer 
arietinum]
Length=855

 Score =   107 bits (267),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 49/78 (63%), Positives = 62/78 (79%), Gaps = 1/78 (1%)
 Frame = +3

Query  384  HVEVTEDEGWIVIPKKELPDNWSEAPXISSLRSMDRFFVFPGEQVKILACLSAYREDIEI  563
            H++V+EDEGWI IP K LP++W+    I SLR +DR F+FPGEQV I+ACLSA ++D EI
Sbjct  81   HLDVSEDEGWIAIPYK-LPEDWNNVSDIQSLRPLDRSFLFPGEQVHIVACLSACKQDTEI  139

Query  564  ITPFKVAALMNKNGVDQS  617
            ITPFKVAALM+KN +  S
Sbjct  140  ITPFKVAALMSKNAIGHS  157



>ref|XP_010506097.1| PREDICTED: uncharacterized protein LOC104782771 [Camelina sativa]
Length=833

 Score =   107 bits (266),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 57/125 (46%), Positives = 80/125 (64%), Gaps = 4/125 (3%)
 Frame = +3

Query  243  KLSTSLDALVAEDPFQHATSSENCgvegynhgnenggaaagangKCNHVE----VTEDEG  410
            K   +L+ L+AE+PF    S E+         +++G   +      + +E    V+E++G
Sbjct  33   KSGATLEGLIAEEPFPQYPSVEDLDRVADGSRDDDGSGESIPKSGGSCMERFSDVSEEQG  92

Query  411  WIVIPKKELPDNWSEAPXISSLRSMDRFFVFPGEQVKILACLSAYREDIEIITPFKVAAL  590
            WI IP KE+PDN SE+  I SLRS+DR FVFPGEQ++ILACLS  + D EIITPFKVA +
Sbjct  93   WIAIPYKEIPDNLSESVDIHSLRSLDRSFVFPGEQIQILACLSESKGDAEIITPFKVAEV  152

Query  591  MNKNG  605
            M++ G
Sbjct  153  MSRTG  157



>ref|XP_002442155.1| hypothetical protein SORBIDRAFT_08g015250 [Sorghum bicolor]
 gb|EES15993.1| hypothetical protein SORBIDRAFT_08g015250 [Sorghum bicolor]
Length=817

 Score =   106 bits (265),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/125 (41%), Positives = 85/125 (68%), Gaps = 4/125 (3%)
 Frame = +3

Query  243  KLSTSLDALVAEDPFQHATS-SENCgvegynhgnenggaaagangKC---NHVEVTEDEG  410
            K +T+L+ L+A+D +Q +++ SE+      +       ++  +        H +VTEDEG
Sbjct  30   KPTTTLEGLIADDSYQPSSARSEDGVANNGSRDTSGDPSSLDSKSLVPLGTHSDVTEDEG  89

Query  411  WIVIPKKELPDNWSEAPXISSLRSMDRFFVFPGEQVKILACLSAYREDIEIITPFKVAAL  590
            WI IP K LP++W++   +  L+++DR F+FPGEQV ILACLSA ++D+++I+PF++AA+
Sbjct  90   WITIPCKALPESWNDISEMVQLQTLDRSFLFPGEQVHILACLSASKQDVQVISPFRIAAV  149

Query  591  MNKNG  605
            M+KNG
Sbjct  150  MSKNG  154



>emb|CDY18479.1| BnaA01g27160D [Brassica napus]
Length=811

 Score =   104 bits (260),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = +3

Query  390  EVTEDEGWIVIPKKELPDNWSEAPXISSLRSMDRFFVFPGEQVKILACLSAYREDIEIIT  569
            +V+E+EGWI IP KE+PDNWSE+  I SLRS+DR FVFPGEQ++I ACLS  + D EIIT
Sbjct  78   DVSEEEGWISIPYKEIPDNWSESVDIQSLRSLDRSFVFPGEQIQIFACLSDSKADTEIIT  137

Query  570  PFKVAALMNKN  602
            PFKVA +M++ 
Sbjct  138  PFKVAEVMSRT  148



>emb|CDX75947.1| BnaC03g40300D [Brassica napus]
Length=816

 Score =   104 bits (260),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = +3

Query  390  EVTEDEGWIVIPKKELPDNWSEAPXISSLRSMDRFFVFPGEQVKILACLSAYREDIEIIT  569
            +V+++EGWI IP KE+PDNWSE+  I SLRS+DR FVFPGEQ++ILACLS  + D EIIT
Sbjct  84   DVSDEEGWISIPYKEIPDNWSESVDIESLRSLDRSFVFPGEQIQILACLSESKGDAEIIT  143

Query  570  PFKVAALMNKN  602
            PFKVA +M++ 
Sbjct  144  PFKVAEVMSRT  154



>ref|XP_009135553.1| PREDICTED: uncharacterized protein LOC103859731 [Brassica rapa]
 ref|XP_009135554.1| PREDICTED: uncharacterized protein LOC103859731 [Brassica rapa]
Length=821

 Score =   104 bits (259),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = +3

Query  390  EVTEDEGWIVIPKKELPDNWSEAPXISSLRSMDRFFVFPGEQVKILACLSAYREDIEIIT  569
            +V+++EGWI IP KE+PDNWSE+  I SLRS+DR FVFPGEQ++ILACLS  + D EIIT
Sbjct  87   DVSDEEGWISIPYKEIPDNWSESVDIESLRSLDRSFVFPGEQIQILACLSESKGDAEIIT  146

Query  570  PFKVAALMNK  599
            PFKVA +M++
Sbjct  147  PFKVAEVMSR  156



>gb|KEH19841.1| plant/MEB5-like protein [Medicago truncatula]
Length=836

 Score =   103 bits (258),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 61/78 (78%), Gaps = 1/78 (1%)
 Frame = +3

Query  384  HVEVTEDEGWIVIPKKELPDNWSEAPXISSLRSMDRFFVFPGEQVKILACLSAYREDIEI  563
            H++V E+EGWI IP K LP++W+    I SLR +DR F+ PGEQV I+ACLSA ++D EI
Sbjct  85   HLDVNEEEGWITIPYK-LPEDWNNVSDIQSLRPLDRSFLIPGEQVHIVACLSACKQDTEI  143

Query  564  ITPFKVAALMNKNGVDQS  617
            ITPFKVAA+M+KNG+  S
Sbjct  144  ITPFKVAAVMSKNGIGHS  161



>ref|XP_003558789.1| PREDICTED: uncharacterized protein LOC100846542 [Brachypodium 
distachyon]
Length=829

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 50/126 (40%), Positives = 81/126 (64%), Gaps = 7/126 (6%)
 Frame = +3

Query  243  KLSTSLDALVAEDPFQHATSSE-------NCgvegynhgnenggaaagangKCNHVEVTE  401
            K + +L+ L+A+DP++   S+E         G  G +  +     +  +     H +V+E
Sbjct  28   KSAKTLEGLIADDPYRTPVSAEEDGAGNNGVGEIGGDAASAASSDSKSSAPTGKHSDVSE  87

Query  402  DEGWIVIPKKELPDNWSEAPXISSLRSMDRFFVFPGEQVKILACLSAYREDIEIITPFKV  581
            DEGWI IP  ELP+NW++   ++ LR +DR F+FPGEQV I+ACLSA ++D ++I+PF++
Sbjct  88   DEGWITIPDTELPENWNDISDMAQLRPLDRCFLFPGEQVHIMACLSASQQDAQVISPFRI  147

Query  582  AALMNK  599
            AA+M+K
Sbjct  148  AAVMSK  153



>ref|XP_010549052.1| PREDICTED: uncharacterized protein LOC104820344 [Tarenaya hassleriana]
 ref|XP_010549053.1| PREDICTED: uncharacterized protein LOC104820344 [Tarenaya hassleriana]
 ref|XP_010549054.1| PREDICTED: uncharacterized protein LOC104820344 [Tarenaya hassleriana]
 ref|XP_010549055.1| PREDICTED: uncharacterized protein LOC104820344 [Tarenaya hassleriana]
Length=843

 Score =   102 bits (254),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 54/124 (44%), Positives = 78/124 (63%), Gaps = 9/124 (7%)
 Frame = +3

Query  249  STSLDALVAEDPFQHATSSENCgvegynhgnenggaaagangKCNHV-----EVTEDEGW  413
            + +L+ L+AE+ F H    E+      +       +A      C  V     +V+E+EGW
Sbjct  34   AATLEGLIAEESFPHYPPVEDHDRVTGDDNGTGDSSAQI----CGPVMDRFSDVSEEEGW  89

Query  414  IVIPKKELPDNWSEAPXISSLRSMDRFFVFPGEQVKILACLSAYREDIEIITPFKVAALM  593
            I IP KE+P+NW++A  I SL  +DR FVFPGEQV++LACLSA + + EIITPFKVA +M
Sbjct  90   IAIPYKEIPENWADAADIHSLLPLDRSFVFPGEQVQVLACLSASKGETEIITPFKVAEVM  149

Query  594  NKNG  605
            +++G
Sbjct  150  SRSG  153



>ref|XP_009113645.1| PREDICTED: uncharacterized protein LOC103838942 isoform X1 [Brassica 
rapa]
Length=817

 Score =   102 bits (253),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = +3

Query  390  EVTEDEGWIVIPKKELPDNWSEAPXISSLRSMDRFFVFPGEQVKILACLSAYREDIEIIT  569
            +V+E+EGWI IP KE+PDNWSE+  I SLRS+DR FVFPGEQ++ILACLS  +   EIIT
Sbjct  78   DVSEEEGWISIPYKEIPDNWSESVDIQSLRSLDRSFVFPGEQIQILACLSDSKVATEIIT  137

Query  570  PFKVAALMNKN  602
            PFKVA +M++ 
Sbjct  138  PFKVAEVMSRT  148



>emb|CDX95569.1| BnaC01g34610D [Brassica napus]
Length=816

 Score =   101 bits (251),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = +3

Query  390  EVTEDEGWIVIPKKELPDNWSEAPXISSLRSMDRFFVFPGEQVKILACLSAYREDIEIIT  569
            +V+E+EGWI IP +E+PDNWSE+  I SLRS+DR FVFPGEQ+++LACLS  + D ++IT
Sbjct  79   DVSEEEGWISIPYQEIPDNWSESVDIQSLRSLDRSFVFPGEQIQMLACLSDSKADTDVIT  138

Query  570  PFKVAALMNKN  602
            PFKVA +M++ 
Sbjct  139  PFKVAEVMSRT  149



>ref|XP_011071030.1| PREDICTED: uncharacterized protein LOC105156561 isoform X2 [Sesamum 
indicum]
Length=774

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = +3

Query  429  KELPDNWSEAPXISSLRSMDRFFVFPGEQVKILACLSAYREDIEIITPFKVAALMNKNGV  608
            +E PDNW+EAP I S RS+DR FVFPGEQ++ILACLSA ++D E+ITPFKVAA+MNKNG+
Sbjct  10   EEFPDNWTEAPDILSYRSLDRSFVFPGEQIRILACLSACKQDTEVITPFKVAAVMNKNGL  69

Query  609  DQSSK  623
              S +
Sbjct  70   RPSPR  74



>ref|XP_003519773.1| PREDICTED: uncharacterized protein LOC100812482 [Glycine max]
 gb|KHN08715.1| hypothetical protein glysoja_024624 [Glycine soja]
Length=814

 Score = 95.5 bits (236),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 58/80 (73%), Gaps = 3/80 (4%)
 Frame = +3

Query  384  HVEVTEDEGWIVIPKKELPDNWSEAPXISSLRSMDRFFVFPGEQVKILACLSAYREDIEI  563
            HV+V EDEGW+ IP KELP+NW+ AP I SL S+DR F+FPGE+V ILAC SA ++D   
Sbjct  63   HVDVAEDEGWVTIPCKELPENWTCAPDIQSLCSLDRSFLFPGERVHILACFSACKQD---  119

Query  564  ITPFKVAALMNKNGVDQSSK  623
             + FKV A+ + NG+  S K
Sbjct  120  TSSFKVDAVTSDNGIGHSPK  139



>gb|AAU89744.1| At3g17900/MEB5_12-like protein [Solanum tuberosum]
Length=278

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 63/151 (42%), Positives = 83/151 (55%), Gaps = 26/151 (17%)
 Frame = +3

Query  153  MNFLMLRSNqtaapepppaqeiqaeNNYVPKLSTSLDALVAEDPFQHATSSENCgvegyn  332
            MNFLMLRSNQTAA E  PA+E+Q+   +  K ST+L+ L+AE+P+  +   +    E  +
Sbjct  1    MNFLMLRSNQTAASEHSPAREVQSVPTHAAKPSTTLEGLIAEEPYTESEKRDGESGEFED  60

Query  333  hgnenggaaagangKCNHVEVTEDEGWIVIPKKELPDNWSEAPXISSLRSMDRFFVFPGE  512
                +      +    NH++V EDEGWI IPK                          GE
Sbjct  61   EDLADINEKNNSQFAANHIDVKEDEGWITIPK--------------------------GE  94

Query  513  QVKILACLSAYREDIEIITPFKVAALMNKNG  605
            QV  LACLSA ++D EIITPFKVAA+M +NG
Sbjct  95   QVHTLACLSACKQDTEIITPFKVAAVMKQNG  125



>ref|XP_003613589.1| hypothetical protein MTR_5g038440 [Medicago truncatula]
 gb|AES96547.1| plant/MEB5-like protein [Medicago truncatula]
Length=805

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 54/78 (69%), Gaps = 6/78 (8%)
 Frame = +3

Query  384  HVEVTEDEGWIVIPKKELPDNWSEAPXISSLRSMDRFFVFPGEQVKILACLSAYREDIEI  563
            HV+V ED+GWI IP KELP+NW   P I SLRS+DR      EQV ILACLSA ++D   
Sbjct  71   HVDVDEDDGWITIPCKELPENWDHVPDIQSLRSLDR------EQVHILACLSACKQDTLF  124

Query  564  ITPFKVAALMNKNGVDQS  617
              PF+VAA  +KNG+D S
Sbjct  125  TAPFEVAATTSKNGIDHS  142



>ref|XP_007157397.1| hypothetical protein PHAVU_002G0667000g, partial [Phaseolus vulgaris]
 gb|ESW29391.1| hypothetical protein PHAVU_002G0667000g, partial [Phaseolus vulgaris]
Length=277

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 56/80 (70%), Gaps = 3/80 (4%)
 Frame = +3

Query  384  HVEVTEDEGWIVIPKKELPDNWSEAPXISSLRSMDRFFVFPGEQVKILACLSAYREDIEI  563
            H +V  +EGWI IP KELP+NW+ AP I SL S+DR F+FPGEQV ILACLSA +++   
Sbjct  65   HSDVDNEEGWISIPCKELPENWNCAPDILSLCSLDRSFLFPGEQVHILACLSACKQE---  121

Query  564  ITPFKVAALMNKNGVDQSSK  623
             + FK+ A +++ G   + K
Sbjct  122  TSSFKIDAAISETGTGHNPK  141



>ref|XP_002976159.1| hypothetical protein SELMODRAFT_416167 [Selaginella moellendorffii]
 gb|EFJ23064.1| hypothetical protein SELMODRAFT_416167 [Selaginella moellendorffii]
Length=762

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 57/77 (74%), Gaps = 1/77 (1%)
 Frame = +3

Query  381  NHVEVTEDEGWIVIPKKELPDNWSEAPXISSLRSMDRFFVFPGEQVKILACLSAYREDI-  557
             H +V+ +EG +++P KELP+ W+ AP ++ L  +DR FVFPGEQ+KIL  +S+    + 
Sbjct  59   GHADVSSNEGSVLVPGKELPNEWNAAPDLTHLSHLDRGFVFPGEQIKILVTVSSRDLTVP  118

Query  558  EIITPFKVAALMNKNGV  608
            EIITPFKVAA++NKN +
Sbjct  119  EIITPFKVAAVINKNAL  135



>ref|XP_008655682.1| PREDICTED: uncharacterized protein LOC103634878 [Zea mays]
Length=132

 Score = 79.0 bits (193),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 41/115 (36%), Positives = 68/115 (59%), Gaps = 5/115 (4%)
 Frame = +3

Query  228  NNYVPKLSTSLDALVAEDPFQHATSSENCgvegynhgnenggaaagangKC-----NHVE  392
             N + K +++L+ L+A+D     +S+ +      N   +  G ++  + K       H +
Sbjct  18   QNALQKTTSTLEGLIADDSHHQPSSAHSEDGAANNGSRDISGDSSSVDLKSPVPLGTHAD  77

Query  393  VTEDEGWIVIPKKELPDNWSEAPXISSLRSMDRFFVFPGEQVKILACLSAYREDI  557
            V EDEGWI IP K  P++W++   +  L+++DR F+FPGEQV ILACLSA ++D+
Sbjct  78   VMEDEGWITIPCKAFPESWNDISEMVQLQALDRSFLFPGEQVPILACLSASKQDV  132



>gb|KEH27799.1| plant/MEB5-like protein [Medicago truncatula]
Length=741

 Score = 57.0 bits (136),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +3

Query  495  FVFPGEQVKILACLSAYREDIEIITPFKVAALMNKNGVDQS  617
            F FPGEQV ILACLSA ++D     PF+VAA  +KNG+D S
Sbjct  38   FFFPGEQVHILACLSACKQDTLFTAPFEVAATTSKNGIDHS  78


 Score = 37.7 bits (86),  Expect(2) = 3e-11, Method: Composition-based stats.
 Identities = 19/39 (49%), Positives = 21/39 (54%), Gaps = 0/39 (0%)
 Frame = +1

Query  388  LRLLKMKDG*LFRKRSFLIIGVRHPIYLHCAQWIASLFF  504
            L L+KM DG  F  R+FL  G    IY HCA  I   FF
Sbjct  2    LMLMKMMDGSPFHARNFLKTGTMCQIYSHCALLIVPFFF  40



>gb|EMT27599.1| hypothetical protein F775_14275 [Aegilops tauschii]
Length=728

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 47/63 (75%), Gaps = 4/63 (6%)
 Frame = +3

Query  429  KELPDNWSEAPXISSLRSMDRFFVFP----GEQVKILACLSAYREDIEIITPFKVAALMN  596
            +ELP++W E   +  LR +DR F+FP    GEQV ILACLSA ++D+  I+PF++AA+M+
Sbjct  54   EELPEDWGEVSDMLQLRPLDRPFLFPVRLSGEQVHILACLSASKQDMTSISPFRIAAVMS  113

Query  597  KNG  605
            K+G
Sbjct  114  KSG  116



>gb|KEH27800.1| plant/MEB5-like protein [Medicago truncatula]
Length=574

 Score = 57.4 bits (137),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +3

Query  495  FVFPGEQVKILACLSAYREDIEIITPFKVAALMNKNGVDQS  617
            F FPGEQV ILACLSA ++D     PF+VAA  +KNG+D S
Sbjct  38   FFFPGEQVHILACLSACKQDTLFTAPFEVAATTSKNGIDHS  78


 Score = 35.4 bits (80),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 19/39 (49%), Positives = 21/39 (54%), Gaps = 0/39 (0%)
 Frame = +1

Query  388  LRLLKMKDG*LFRKRSFLIIGVRHPIYLHCAQWIASLFF  504
            L L+KM DG  F  R+FL  G    IY HCA  I   FF
Sbjct  2    LMLMKMMDGSPFHARNFLKTGTMCQIYSHCALLIVPFFF  40



>emb|CAN67950.1| hypothetical protein VITISV_014439 [Vitis vinifera]
Length=351

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +3

Query  504  PGEQVKILACLSAYREDIEIITPFKVAALMNKNGVDQSSK  623
            PGEQV ILACLS+ +++ EIITPFKVAA+M+KNG+ QS+K
Sbjct  21   PGEQVHILACLSSSKQETEIITPFKVAAMMSKNGIGQSTK  60



>emb|CAN68661.1| hypothetical protein VITISV_004406 [Vitis vinifera]
Length=885

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +3

Query  504  PGEQVKILACLSAYREDIEIITPFKVAALMNKNGVDQSSK  623
            PGEQV ILACLS+ +++ +IITPFKVAA+M+KNG+ QS+K
Sbjct  21   PGEQVHILACLSSSKQETQIITPFKVAAMMSKNGIGQSTK  60



>ref|XP_002311800.2| hypothetical protein POPTR_0008s19910g [Populus trichocarpa]
 gb|EEE89167.2| hypothetical protein POPTR_0008s19910g [Populus trichocarpa]
Length=630

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +3

Query  489  RFFVFPGEQVKILACLSAYREDIEIITPFKVAALMNKNGVDQS  617
             +  + GEQV ILA LSAY++D+EIITPFKVAA+M+KNG+ QS
Sbjct  11   HYIPWIGEQVHILASLSAYKQDMEIITPFKVAAVMSKNGIGQS  53



>tpg|DAA35353.1| TPA: hypothetical protein ZEAMMB73_291463 [Zea mays]
Length=650

 Score = 61.6 bits (148),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 44/135 (33%), Positives = 72/135 (53%), Gaps = 14/135 (10%)
 Frame = +3

Query  231  NYVPKLSTSLDALVAEDPFQHATSSENCgvegynhgnenggaaagangKC-----NHVEV  395
            N + K +++L+ L+A+D     +S+        N   +  G ++  + K       H +V
Sbjct  25   NALQKTTSTLEGLIADDSHHQPSSAHIEDGAANNGSRDISGDSSSVDLKSPVPLGTHADV  84

Query  396  TEDEGWIVIP---KKELPDNWSEAPXIS-SLRSMDRFFVFPGEQVKILACLSAYREDIEI  563
             EDEGWI IP   +  L    +     S  L ++  FF     QV ILACLSA ++D+++
Sbjct  85   MEDEGWITIPCSLRHFLKVGTTYQKWFSCRLWTVPSFF-----QVPILACLSASKQDVQV  139

Query  564  ITPFKVAALMNKNGV  608
            I+PF++AA+M+KNG 
Sbjct  140  ISPFRIAAVMSKNGT  154



>ref|XP_002444307.1| hypothetical protein SORBIDRAFT_07g019960 [Sorghum bicolor]
 gb|EES13802.1| hypothetical protein SORBIDRAFT_07g019960 [Sorghum bicolor]
Length=129

 Score = 56.2 bits (134),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +3

Query  381  NHVEVTEDEGWIVIPKKELPDNWSEAPXISSLRSMDRFFVFPGEQVKILA  530
             H +V EDEGWI IP K LP++W++   +  L+++DR F+FPG+ V I+ 
Sbjct  80   THTDVAEDEGWITIPYKALPESWNDISEMVQLQALDRSFLFPGKCVFIVT  129



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 897347644380