BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002B06

Length=559
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011094913.1|  PREDICTED: aldo-keto reductase family 4 memb...    249   6e-79   Sesamum indicum [beniseed]
gb|AFK48248.1|  unknown                                                 249   1e-78   Lotus japonicus
ref|XP_009602752.1|  PREDICTED: aldo-keto reductase family 4 memb...    246   9e-78   Nicotiana tomentosiformis
ref|XP_002529872.1|  aldo-keto reductase, putative                      246   1e-77   
ref|XP_009621148.1|  PREDICTED: aldo-keto reductase family 4 memb...    246   2e-77   
ref|XP_009791583.1|  PREDICTED: aldo-keto reductase family 4 memb...    245   2e-77   Nicotiana sylvestris
emb|CDY64988.1|  BnaA05g34870D                                          245   3e-77   Brassica napus [oilseed rape]
ref|XP_010505375.1|  PREDICTED: aldo-keto reductase family 4 memb...    245   3e-77   
dbj|BAJ33839.1|  unnamed protein product                                245   4e-77   Eutrema halophilum
ref|XP_006410968.1|  hypothetical protein EUTSA_v10016962mg             245   4e-77   Eutrema salsugineum [saltwater cress]
emb|CDY59481.1|  BnaC03g72040D                                          243   1e-76   Brassica napus [oilseed rape]
gb|KDP24556.1|  hypothetical protein JCGZ_25120                         243   2e-76   Jatropha curcas
gb|EYU41765.1|  hypothetical protein MIMGU_mgv1a010335mg                243   2e-76   Erythranthe guttata [common monkey flower]
ref|XP_009133204.1|  PREDICTED: aldo-keto reductase family 4 memb...    243   2e-76   Brassica rapa
gb|EYU41763.1|  hypothetical protein MIMGU_mgv1a010332mg                243   2e-76   Erythranthe guttata [common monkey flower]
emb|CDY07771.1|  BnaA03g17400D                                          243   2e-76   Brassica napus [oilseed rape]
ref|XP_010509276.1|  PREDICTED: aldo-keto reductase family 4 memb...    243   3e-76   
ref|NP_181313.3|  aldo-keto reductase family 4 member C9                240   9e-76   Arabidopsis thaliana [mouse-ear cress]
gb|AAC23647.1|  putative alcohol dehydrogenase                          240   1e-75   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002273035.1|  PREDICTED: aldo-keto reductase family 4 memb...    241   2e-75   Vitis vinifera
ref|NP_001031505.1|  aldo-keto reductase family 4 member C9             241   2e-75   Arabidopsis thaliana [mouse-ear cress]
emb|CDX74934.1|  BnaA05g06800D                                          240   2e-75   
ref|XP_009143450.1|  PREDICTED: aldo-keto reductase family 4 memb...    240   2e-75   Brassica rapa
ref|XP_002879708.1|  oxidoreductase                                     240   3e-75   
ref|XP_010256789.1|  PREDICTED: aldo-keto reductase family 4 memb...    240   3e-75   Nelumbo nucifera [Indian lotus]
ref|XP_006294635.1|  hypothetical protein CARUB_v10023673mg             240   3e-75   Capsella rubella
ref|XP_009143448.1|  PREDICTED: aldo-keto reductase family 4 memb...    239   4e-75   Brassica rapa
pdb|3H7U|A  Chain A, Crystal Structure Of The Plant Stress-Respon...    240   5e-75   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011094911.1|  PREDICTED: aldo-keto reductase family 4 memb...    239   5e-75   Sesamum indicum [beniseed]
emb|CDY57141.1|  BnaC04g53480D                                          240   5e-75   Brassica napus [oilseed rape]
gb|KFK36672.1|  hypothetical protein AALP_AA4G154800                    239   7e-75   Arabis alpina [alpine rockcress]
ref|XP_003516897.1|  PREDICTED: aldo-keto reductase family 4 memb...    239   8e-75   Glycine max [soybeans]
gb|KJB76793.1|  hypothetical protein B456_012G107500                    235   1e-74   Gossypium raimondii
ref|NP_001240076.1|  uncharacterized protein LOC100781137               238   2e-74   Glycine max [soybeans]
ref|XP_009133205.1|  PREDICTED: aldo-keto reductase family 4 memb...    238   2e-74   Brassica rapa
gb|KHN22181.1|  Aldo-keto reductase family 4 member C9                  238   3e-74   Glycine soja [wild soybean]
ref|XP_004253294.1|  PREDICTED: aldo-keto reductase family 4 memb...    234   3e-74   
ref|XP_010509278.1|  PREDICTED: aldo-keto reductase family 4 memb...    238   3e-74   Camelina sativa [gold-of-pleasure]
ref|XP_010517055.1|  PREDICTED: aldo-keto reductase family 4 memb...    237   4e-74   Camelina sativa [gold-of-pleasure]
ref|XP_008387820.1|  PREDICTED: aldo-keto reductase family 4 memb...    237   5e-74   
gb|EPS58903.1|  hypothetical protein M569_15909                         237   5e-74   Genlisea aurea
ref|XP_004509601.1|  PREDICTED: aldo-keto reductase family 4 memb...    237   6e-74   Cicer arietinum [garbanzo]
ref|XP_002862967.1|  hypothetical protein ARALYDRAFT_333154             238   7e-74   
ref|XP_010517053.1|  PREDICTED: aldo-keto reductase family 4 memb...    236   8e-74   Camelina sativa [gold-of-pleasure]
ref|XP_004302710.1|  PREDICTED: aldo-keto reductase family 4 memb...    236   8e-74   Fragaria vesca subsp. vesca
ref|XP_007205595.1|  hypothetical protein PRUPE_ppa008899mg             236   8e-74   
ref|XP_009358775.1|  PREDICTED: aldo-keto reductase family 4 memb...    236   9e-74   Pyrus x bretschneideri [bai li]
gb|KFK36670.1|  hypothetical protein AALP_AA4G154600                    236   1e-73   Arabis alpina [alpine rockcress]
ref|XP_008350456.1|  PREDICTED: aldo-keto reductase family 4 memb...    237   1e-73   
emb|CDP17857.1|  unnamed protein product                                236   1e-73   Coffea canephora [robusta coffee]
gb|EYU41764.1|  hypothetical protein MIMGU_mgv1a010256mg                236   1e-73   Erythranthe guttata [common monkey flower]
ref|XP_011094910.1|  PREDICTED: aldo-keto reductase family 4 memb...    235   3e-73   Sesamum indicum [beniseed]
ref|XP_006294573.1|  hypothetical protein CARUB_v10023609mg             235   3e-73   
ref|XP_010038915.1|  PREDICTED: aldo-keto reductase family 4 memb...    234   4e-73   
ref|XP_006410971.1|  hypothetical protein EUTSA_v10016967mg             234   4e-73   Eutrema salsugineum [saltwater cress]
gb|KJB76792.1|  hypothetical protein B456_012G107500                    234   5e-73   Gossypium raimondii
gb|KJB76791.1|  hypothetical protein B456_012G107500                    234   5e-73   Gossypium raimondii
ref|NP_181315.2|  aldo-keto reductase family 4 member C10               234   8e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004166957.1|  PREDICTED: aldo-keto reductase family 4 memb...    233   2e-72   
emb|CAC32834.1|  aldose reductase                                       233   2e-72   Digitalis purpurea
gb|KCW84681.1|  hypothetical protein EUGRSUZ_B01498                     232   2e-72   Eucalyptus grandis [rose gum]
ref|XP_011466525.1|  PREDICTED: aldo-keto reductase family 4 memb...    233   2e-72   Fragaria vesca subsp. vesca
emb|CDY57148.1|  BnaC04g53540D                                          241   2e-72   Brassica napus [oilseed rape]
ref|XP_002272909.1|  PREDICTED: aldo-keto reductase family 4 memb...    233   2e-72   Vitis vinifera
ref|XP_010038908.1|  PREDICTED: aldo-keto reductase family 4 memb...    233   3e-72   Eucalyptus grandis [rose gum]
ref|XP_010529793.1|  PREDICTED: aldo-keto reductase family 4 memb...    233   3e-72   Tarenaya hassleriana [spider flower]
ref|XP_010529794.1|  PREDICTED: aldo-keto reductase family 4 memb...    234   3e-72   Tarenaya hassleriana [spider flower]
emb|CAC32835.1|  aldose reductase                                       232   3e-72   Digitalis purpurea
ref|XP_006429181.1|  hypothetical protein CICLE_v10012243mg             231   7e-72   Citrus clementina [clementine]
ref|XP_009358774.1|  PREDICTED: aldo-keto reductase family 4 memb...    231   8e-72   Pyrus x bretschneideri [bai li]
gb|KDO48136.1|  hypothetical protein CISIN_1g021241mg                   231   8e-72   Citrus sinensis [apfelsine]
ref|XP_006429178.1|  hypothetical protein CICLE_v10012242mg             231   8e-72   Citrus clementina [clementine]
ref|XP_009346418.1|  PREDICTED: aldo-keto reductase family 4 memb...    231   9e-72   Pyrus x bretschneideri [bai li]
gb|KDO48137.1|  hypothetical protein CISIN_1g021264mg                   231   1e-71   Citrus sinensis [apfelsine]
ref|XP_010038899.1|  PREDICTED: aldo-keto reductase family 4 memb...    231   1e-71   Eucalyptus grandis [rose gum]
ref|XP_006493578.1|  PREDICTED: aldo-keto reductase family 4 memb...    231   1e-71   Citrus sinensis [apfelsine]
ref|XP_010505374.1|  PREDICTED: aldo-keto reductase family 4 memb...    231   1e-71   Camelina sativa [gold-of-pleasure]
gb|KJB76786.1|  hypothetical protein B456_012G107200                    228   1e-71   Gossypium raimondii
ref|XP_008448265.1|  PREDICTED: LOW QUALITY PROTEIN: aldo-keto re...    231   2e-71   Cucumis melo [Oriental melon]
ref|XP_004302706.1|  PREDICTED: aldo-keto reductase family 4 memb...    230   2e-71   Fragaria vesca subsp. vesca
ref|XP_010509274.1|  PREDICTED: aldo-keto reductase family 4 memb...    230   2e-71   Camelina sativa [gold-of-pleasure]
ref|XP_007134074.1|  hypothetical protein PHAVU_010G017400g             230   2e-71   Phaseolus vulgaris [French bean]
ref|XP_007026918.1|  NAD(P)-linked oxidoreductase superfamily pro...    229   4e-71   
ref|XP_008387824.1|  PREDICTED: aldo-keto reductase family 4 memb...    229   5e-71   
gb|AAO42123.1|  putative aldo/keto reductase                            229   5e-71   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004302708.2|  PREDICTED: aldo-keto reductase family 4 memb...    229   7e-71   Fragaria vesca subsp. vesca
ref|XP_008240395.1|  PREDICTED: aldo-keto reductase family 4 memb...    229   9e-71   Prunus mume [ume]
ref|XP_007134071.1|  hypothetical protein PHAVU_010G017100g             228   9e-71   Phaseolus vulgaris [French bean]
dbj|BAG97587.1|  unnamed protein product                                229   1e-70   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004302704.1|  PREDICTED: aldo-keto reductase family 4 memb...    228   1e-70   Fragaria vesca subsp. vesca
gb|EMT09404.1|  Aldose reductase                                        228   2e-70   
ref|XP_008448277.1|  PREDICTED: aldo-keto reductase family 4 memb...    228   2e-70   Cucumis melo [Oriental melon]
ref|XP_011466526.1|  PREDICTED: aldo-keto reductase family 4 memb...    228   2e-70   Fragaria vesca subsp. vesca
ref|XP_007134066.1|  hypothetical protein PHAVU_010G016600g             227   2e-70   Phaseolus vulgaris [French bean]
ref|XP_008240406.1|  PREDICTED: aldo-keto reductase family 4 memb...    228   3e-70   Prunus mume [ume]
ref|NP_001055731.2|  Os05g0456300                                       227   3e-70   
gb|KJB76785.1|  hypothetical protein B456_012G107200                    228   3e-70   Gossypium raimondii
ref|XP_006410969.1|  hypothetical protein EUTSA_v10017980mg             227   3e-70   Eutrema salsugineum [saltwater cress]
ref|XP_006403644.1|  hypothetical protein EUTSA_v10010554mg             227   3e-70   Eutrema salsugineum [saltwater cress]
gb|KCW84679.1|  hypothetical protein EUGRSUZ_B01497                     227   3e-70   Eucalyptus grandis [rose gum]
ref|XP_010088583.1|  Aldo-keto reductase family 4 member C9             226   3e-70   
ref|XP_002529871.1|  aldo-keto reductase, putative                      227   4e-70   
ref|XP_006340994.1|  PREDICTED: aldo-keto reductase family 4 memb...    226   9e-70   Solanum tuberosum [potatoes]
gb|KHG05402.1|  Aldo-keto reductase family 4 member C9                  226   1e-69   Gossypium arboreum [tree cotton]
gb|ACJ84357.1|  unknown                                                 222   2e-69   Medicago truncatula
ref|XP_010262633.1|  PREDICTED: aldo-keto reductase family 4 memb...    225   2e-69   Nelumbo nucifera [Indian lotus]
gb|KGN54282.1|  hypothetical protein Csa_4G296840                       224   2e-69   Cucumis sativus [cucumbers]
ref|XP_007205596.1|  hypothetical protein PRUPE_ppa008905mg             225   2e-69   Prunus persica
emb|CBI30495.3|  unnamed protein product                                224   2e-69   Vitis vinifera
ref|XP_004166956.1|  PREDICTED: aldo-keto reductase family 4 memb...    225   3e-69   
ref|XP_004142054.1|  PREDICTED: aldo-keto reductase family 4 memb...    225   3e-69   
gb|AFK44784.1|  unknown                                                 224   4e-69   Medicago truncatula
ref|XP_010517051.1|  PREDICTED: aldo-keto reductase family 4 memb...    224   4e-69   Camelina sativa [gold-of-pleasure]
ref|XP_010517052.1|  PREDICTED: aldo-keto reductase family 4 memb...    224   4e-69   Camelina sativa [gold-of-pleasure]
ref|XP_003520967.1|  PREDICTED: aldo-keto reductase family 4 memb...    224   5e-69   Glycine max [soybeans]
gb|KJB76789.1|  hypothetical protein B456_012G107300                    221   5e-69   Gossypium raimondii
ref|XP_011012443.1|  PREDICTED: aldo-keto reductase family 4 memb...    224   8e-69   Populus euphratica
gb|KHN43834.1|  Aldo-keto reductase family 4 member C9                  223   8e-69   Glycine soja [wild soybean]
ref|XP_004172647.1|  PREDICTED: aldo-keto reductase family 4 memb...    224   8e-69   
ref|XP_003516896.1|  PREDICTED: aldo-keto reductase family 4 memb...    223   9e-69   Glycine max [soybeans]
ref|XP_009358771.1|  PREDICTED: aldo-keto reductase family 4 memb...    223   1e-68   Pyrus x bretschneideri [bai li]
ref|XP_004142055.1|  PREDICTED: aldo-keto reductase family 4 memb...    223   1e-68   
gb|KGN54281.1|  hypothetical protein Csa_4G296830                       223   1e-68   Cucumis sativus [cucumbers]
ref|XP_007134069.1|  hypothetical protein PHAVU_010G016900g             223   1e-68   Phaseolus vulgaris [French bean]
ref|XP_002529870.1|  aldo-keto reductase, putative                      223   2e-68   Ricinus communis
ref|XP_004166958.1|  PREDICTED: aldo-keto reductase family 4 memb...    223   2e-68   
ref|XP_003604914.1|  Aldose reductase                                   221   2e-68   
ref|XP_006373911.1|  hypothetical protein POPTR_0016s10390g             223   2e-68   
ref|XP_009358772.1|  PREDICTED: aldo-keto reductase family 4 memb...    222   3e-68   Pyrus x bretschneideri [bai li]
ref|XP_010528536.1|  PREDICTED: aldo-keto reductase family 4 memb...    222   4e-68   Tarenaya hassleriana [spider flower]
ref|XP_006340995.1|  PREDICTED: aldo-keto reductase family 4 memb...    222   4e-68   Solanum tuberosum [potatoes]
ref|XP_004506627.1|  PREDICTED: aldo-keto reductase family 4 memb...    221   5e-68   
ref|XP_004142056.1|  PREDICTED: LOW QUALITY PROTEIN: aldo-keto re...    221   5e-68   
ref|XP_004246435.1|  PREDICTED: aldo-keto reductase family 4 memb...    221   5e-68   
gb|ACJ84681.1|  unknown                                                 221   5e-68   Medicago truncatula
ref|XP_003604913.1|  Aldose reductase                                   221   5e-68   Medicago truncatula
ref|XP_008387821.1|  PREDICTED: aldo-keto reductase family 4 memb...    223   6e-68   
gb|KHG06616.1|  Aldo-keto reductase family 4 member C9                  220   8e-68   Gossypium arboreum [tree cotton]
ref|XP_007134070.1|  hypothetical protein PHAVU_010G017000g             221   8e-68   Phaseolus vulgaris [French bean]
ref|XP_008387823.1|  PREDICTED: aldo-keto reductase family 4 memb...    221   9e-68   
ref|XP_004506626.1|  PREDICTED: aldo-keto reductase family 4 memb...    221   1e-67   Cicer arietinum [garbanzo]
gb|KHN04060.1|  Aldo-keto reductase family 4 member C9                  220   1e-67   Glycine soja [wild soybean]
ref|XP_008448252.1|  PREDICTED: aldo-keto reductase family 4 memb...    220   1e-67   Cucumis melo [Oriental melon]
ref|XP_004302707.1|  PREDICTED: aldo-keto reductase family 4 memb...    220   2e-67   Fragaria vesca subsp. vesca
gb|KJB76787.1|  hypothetical protein B456_012G107300                    220   2e-67   Gossypium raimondii
ref|XP_003520905.1|  PREDICTED: aldo-keto reductase family 4 memb...    220   2e-67   
ref|XP_007026920.1|  NAD(P)-linked oxidoreductase superfamily pro...    234   2e-67   
ref|XP_007026919.1|  NAD(P)-linked oxidoreductase superfamily pro...    234   3e-67   
ref|XP_011466527.1|  PREDICTED: aldo-keto reductase family 4 memb...    219   3e-67   Fragaria vesca subsp. vesca
gb|KCW86006.1|  hypothetical protein EUGRSUZ_B02711                     216   4e-67   Eucalyptus grandis [rose gum]
ref|XP_010038893.1|  PREDICTED: aldo-keto reductase family 4 memb...    219   4e-67   Eucalyptus grandis [rose gum]
ref|NP_001242750.1|  uncharacterized protein LOC100788951               219   4e-67   
emb|CDY07770.1|  BnaA03g17410D                                          219   5e-67   Brassica napus [oilseed rape]
ref|XP_008350454.1|  PREDICTED: aldo-keto reductase family 4 memb...    219   6e-67   
ref|XP_007134068.1|  hypothetical protein PHAVU_010G016800g             219   6e-67   Phaseolus vulgaris [French bean]
ref|XP_006645007.1|  PREDICTED: aldo-keto reductase family 4 memb...    218   7e-67   Oryza brachyantha
gb|KDP24554.1|  hypothetical protein JCGZ_25118                         219   7e-67   Jatropha curcas
ref|XP_007205608.1|  hypothetical protein PRUPE_ppa009057mg             218   1e-66   Prunus persica
ref|XP_009402310.1|  PREDICTED: aldo-keto reductase family 4 memb...    218   1e-66   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010937542.1|  PREDICTED: aldo-keto reductase family 4 memb...    218   2e-66   Elaeis guineensis
ref|XP_010088585.1|  Aldo-keto reductase family 4 member C9             218   2e-66   Morus notabilis
ref|XP_009358773.1|  PREDICTED: aldo-keto reductase family 4 memb...    217   3e-66   Pyrus x bretschneideri [bai li]
ref|XP_009143449.1|  PREDICTED: aldo-keto reductase family 4 memb...    217   3e-66   Brassica rapa
ref|XP_010088587.1|  Aldo-keto reductase family 4 member C10            217   3e-66   Morus notabilis
ref|XP_002456633.1|  hypothetical protein SORBIDRAFT_03g039770          216   4e-66   Sorghum bicolor [broomcorn]
dbj|BAJ94780.1|  predicted protein                                      216   4e-66   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CBI30496.3|  unnamed protein product                                216   5e-66   Vitis vinifera
ref|XP_002323523.1|  hypothetical protein POPTR_0016s10400g             216   5e-66   
ref|XP_006846375.1|  hypothetical protein AMTR_s00012p00262860          216   6e-66   Amborella trichopoda
gb|KGN54280.1|  hypothetical protein Csa_4G296820                       216   6e-66   Cucumis sativus [cucumbers]
ref|XP_004172864.1|  PREDICTED: aldo-keto reductase family 4 memb...    214   6e-66   
ref|XP_008240418.1|  PREDICTED: aldo-keto reductase family 4 memb...    216   8e-66   Prunus mume [ume]
ref|XP_010043997.1|  PREDICTED: aldo-keto reductase family 4 memb...    216   9e-66   Eucalyptus grandis [rose gum]
ref|XP_008387819.1|  PREDICTED: aldo-keto reductase family 4 memb...    216   1e-65   
ref|XP_008350448.1|  PREDICTED: aldo-keto reductase family 4 memb...    215   1e-65   
ref|XP_008369939.1|  PREDICTED: aldo-keto reductase family 4 memb...    215   2e-65   Malus domestica [apple tree]
emb|CAA66205.1|  orf                                                    214   3e-65   Medicago sativa [alfalfa]
emb|CDM85016.1|  unnamed protein product                                214   4e-65   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004142195.1|  PREDICTED: aldo-keto reductase family 4 memb...    215   5e-65   
dbj|BAB64275.1|  putative aldose reductase                              214   5e-65   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010044002.1|  PREDICTED: aldo-keto reductase family 4 memb...    213   8e-65   Eucalyptus grandis [rose gum]
ref|NP_001044799.1|  Os01g0847700                                       213   9e-65   
ref|XP_009346417.1|  PREDICTED: aldo-keto reductase family 4 memb...    213   9e-65   Pyrus x bretschneideri [bai li]
ref|XP_002441210.1|  hypothetical protein SORBIDRAFT_09g022370          215   1e-64   
ref|XP_002863483.1|  predicted protein                                  215   1e-64   
ref|XP_004970568.1|  PREDICTED: aldo-keto reductase family 4 memb...    213   1e-64   Setaria italica
ref|XP_006654504.1|  PREDICTED: aldo-keto reductase family 4 memb...    212   2e-64   Oryza brachyantha
gb|EMS47119.1|  Aldo-keto reductase family 4 member C10                 212   2e-64   Triticum urartu
emb|CDY54027.1|  BnaA09g54910D                                          212   2e-64   Brassica napus [oilseed rape]
ref|XP_009116084.1|  PREDICTED: aldo-keto reductase family 4 memb...    212   3e-64   Brassica rapa
emb|CDX73517.1|  BnaC08g24860D                                          212   3e-64   
ref|XP_006429176.1|  hypothetical protein CICLE_v10012267mg             211   3e-64   Citrus clementina [clementine]
ref|NP_001105982.1|  aldo-keto reductase family 1, member B1            212   3e-64   Zea mays [maize]
gb|EEC71799.1|  hypothetical protein OsI_04428                          212   3e-64   Oryza sativa Indica Group [Indian rice]
gb|ACN37066.1|  unknown                                                 207   5e-64   Zea mays [maize]
ref|XP_006429175.1|  hypothetical protein CICLE_v10012267mg             211   5e-64   Citrus clementina [clementine]
gb|KEH20249.1|  aldo/keto reductase family oxidoreductase               211   1e-63   Medicago truncatula
gb|ACG39768.1|  aldose reductase                                        210   1e-63   Zea mays [maize]
gb|ACN27137.1|  unknown                                                 207   1e-63   Zea mays [maize]
dbj|BAB64273.1|  putative aldose reductase                              210   2e-63   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002272736.1|  PREDICTED: aldo-keto reductase family 4 memb...    210   2e-63   Vitis vinifera
ref|XP_010232559.1|  PREDICTED: aldo-keto reductase family 4 memb...    209   2e-63   Brachypodium distachyon [annual false brome]
emb|CBI30497.3|  unnamed protein product                                211   2e-63   Vitis vinifera
ref|XP_008674825.1|  PREDICTED: aldo-keto reductase family 4 memb...    209   3e-63   
ref|XP_006493576.1|  PREDICTED: aldo-keto reductase family 4 memb...    209   3e-63   Citrus sinensis [apfelsine]
emb|CDM80750.1|  unnamed protein product                                209   5e-63   Triticum aestivum [Canadian hard winter wheat]
dbj|BAJ90871.1|  predicted protein                                      208   5e-63   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AFW78248.1|  putative oxidoreductase, aldo/keto reductase fami...    207   5e-63   
ref|XP_002876230.1|  aldo/keto reductase family protein                 208   8e-63   Arabidopsis lyrata subsp. lyrata
ref|XP_009345431.1|  PREDICTED: aldo-keto reductase family 4 memb...    208   8e-63   Pyrus x bretschneideri [bai li]
ref|XP_006429180.1|  hypothetical protein CICLE_v10012214mg             208   1e-62   Citrus clementina [clementine]
gb|AFW78251.1|  putative oxidoreductase, aldo/keto reductase fami...    207   1e-62   
ref|XP_006291519.1|  hypothetical protein CARUB_v10017668mg             207   1e-62   Capsella rubella
ref|NP_001145887.1|  uncharacterized protein LOC100279403               207   2e-62   Zea mays [maize]
ref|XP_008369943.1|  PREDICTED: aldo-keto reductase family 4 memb...    207   2e-62   
ref|XP_006493579.1|  PREDICTED: aldo-keto reductase family 4 memb...    207   3e-62   Citrus sinensis [apfelsine]
ref|XP_006294644.1|  hypothetical protein CARUB_v10023681mg             206   3e-62   Capsella rubella
gb|AFK33934.1|  unknown                                                 202   4e-62   Medicago truncatula
ref|XP_010427047.1|  PREDICTED: aldo-keto reductase family 4 memb...    206   5e-62   Camelina sativa [gold-of-pleasure]
gb|KJB36675.1|  hypothetical protein B456_006G170400                    206   6e-62   Gossypium raimondii
gb|KJB36676.1|  hypothetical protein B456_006G170400                    206   9e-62   Gossypium raimondii
gb|AFW78250.1|  putative oxidoreductase, aldo/keto reductase fami...    207   1e-61   
ref|XP_002529867.1|  aldo-keto reductase, putative                      205   2e-61   Ricinus communis
ref|NP_190956.1|  aldo-keto reductase family 4 member C11               204   2e-61   Arabidopsis thaliana [mouse-ear cress]
gb|KJB36677.1|  hypothetical protein B456_006G170400                    206   2e-61   Gossypium raimondii
ref|XP_007205574.1|  hypothetical protein PRUPE_ppa008802mg             204   2e-61   Prunus persica
gb|EMT22693.1|  Alcohol dehydrogenase (NADP+) A                         204   3e-61   
gb|ACG28331.1|  aldose reductase                                        203   3e-61   Zea mays [maize]
gb|EEC71798.1|  hypothetical protein OsI_04426                          202   4e-61   Oryza sativa Indica Group [Indian rice]
ref|XP_011006382.1|  PREDICTED: aldo-keto reductase family 4 memb...    204   5e-61   Populus euphratica
ref|XP_002308181.2|  aldo/keto reductase family protein                 204   5e-61   
emb|CDY57149.1|  BnaC04g53550D                                          203   7e-61   Brassica napus [oilseed rape]
ref|XP_010515893.1|  PREDICTED: aldo-keto reductase family 4 memb...    203   7e-61   Camelina sativa [gold-of-pleasure]
gb|ABL61257.1|  aldo-keto reductase                                     202   1e-60   Aloe arborescens
gb|EMS64418.1|  Aldo-keto reductase family 4 member C9                  202   2e-60   Triticum urartu
ref|XP_009621149.1|  PREDICTED: aldo-keto reductase family 4 memb...    201   2e-60   Nicotiana tomentosiformis
ref|XP_002456632.1|  hypothetical protein SORBIDRAFT_03g039760          202   2e-60   Sorghum bicolor [broomcorn]
ref|XP_003604919.1|  Aldose reductase                                   202   2e-60   Medicago truncatula
gb|AFK39472.1|  unknown                                                 199   2e-60   Lotus japonicus
ref|XP_006429179.1|  hypothetical protein CICLE_v10012214mg             202   2e-60   Citrus clementina [clementine]
ref|XP_010505373.1|  PREDICTED: aldo-keto reductase family 4 memb...    202   2e-60   
ref|XP_010231310.1|  PREDICTED: aldo-keto reductase family 4 memb...    201   3e-60   Brachypodium distachyon [annual false brome]
ref|XP_004305184.1|  PREDICTED: aldo-keto reductase family 4 memb...    202   3e-60   Fragaria vesca subsp. vesca
gb|AFK37060.1|  unknown                                                 201   3e-60   Lotus japonicus
ref|XP_006410967.1|  hypothetical protein EUTSA_v10016976mg             201   3e-60   Eutrema salsugineum [saltwater cress]
ref|XP_010529798.1|  PREDICTED: aldo-keto reductase family 4 memb...    201   3e-60   Tarenaya hassleriana [spider flower]
ref|XP_006576246.1|  PREDICTED: uncharacterized protein LOC100809...    201   4e-60   
ref|XP_006493580.1|  PREDICTED: aldo-keto reductase family 4 memb...    201   4e-60   Citrus sinensis [apfelsine]
ref|XP_010529797.1|  PREDICTED: aldo-keto reductase family 4 memb...    201   4e-60   Tarenaya hassleriana [spider flower]
ref|XP_010037792.1|  PREDICTED: aldo-keto reductase family 4 memb...    201   5e-60   Eucalyptus grandis [rose gum]
ref|XP_008240372.1|  PREDICTED: aldo-keto reductase family 4 memb...    201   6e-60   Prunus mume [ume]
ref|XP_004970567.1|  PREDICTED: aldo-keto reductase family 4 memb...    201   6e-60   Setaria italica
gb|KDP24551.1|  hypothetical protein JCGZ_25115                         201   6e-60   Jatropha curcas
ref|XP_006846379.1|  hypothetical protein AMTR_s00012p00263360          201   8e-60   Amborella trichopoda
ref|XP_010509279.1|  PREDICTED: aldo-keto reductase family 4 memb...    200   8e-60   Camelina sativa [gold-of-pleasure]
ref|XP_009143451.1|  PREDICTED: aldo-keto reductase family 4 memb...    200   1e-59   Brassica rapa
ref|XP_007134067.1|  hypothetical protein PHAVU_010G016700g             200   1e-59   Phaseolus vulgaris [French bean]
gb|KFK34635.1|  hypothetical protein AALP_AA5G171600                    200   1e-59   Arabis alpina [alpine rockcress]
gb|KJB46605.1|  hypothetical protein B456_007G377100                    197   2e-59   Gossypium raimondii
gb|KHG23083.1|  Aldo-keto reductase family 4 member C9                  199   2e-59   Gossypium arboreum [tree cotton]
gb|KHG23082.1|  Aldo-keto reductase family 4 member C8                  200   2e-59   Gossypium arboreum [tree cotton]
ref|XP_010672422.1|  PREDICTED: aldo-keto reductase family 4 memb...    199   2e-59   Beta vulgaris subsp. vulgaris [field beet]
gb|EMS66725.1|  Aldo-keto reductase family 4 member C10                 198   4e-59   Triticum urartu
emb|CDM85015.1|  unnamed protein product                                198   5e-59   Triticum aestivum [Canadian hard winter wheat]
ref|XP_007134073.1|  hypothetical protein PHAVU_010G017300g             198   5e-59   Phaseolus vulgaris [French bean]
emb|CDY57151.1|  BnaC04g53560D                                          197   7e-59   Brassica napus [oilseed rape]
ref|XP_010517056.1|  PREDICTED: aldo-keto reductase family 4 memb...    197   8e-59   Camelina sativa [gold-of-pleasure]
ref|XP_010088579.1|  Aldo-keto reductase family 4 member C9             198   8e-59   Morus notabilis
emb|CDY69395.1|  BnaAnng30320D                                          197   9e-59   Brassica napus [oilseed rape]
gb|EMT09403.1|  Aldose reductase                                        197   1e-58   
ref|XP_003604924.1|  Alcohol dehydrogenase                              197   1e-58   Medicago truncatula
emb|CDY64989.1|  BnaA05g34880D                                          197   1e-58   Brassica napus [oilseed rape]
gb|EMT21856.1|  Alcohol dehydrogenase (NADP+) A                         197   1e-58   
ref|XP_006493577.1|  PREDICTED: aldo-keto reductase family 4 memb...    197   1e-58   Citrus sinensis [apfelsine]
gb|EEC79337.1|  hypothetical protein OsI_20196                          197   1e-58   Oryza sativa Indica Group [Indian rice]
ref|XP_006493583.1|  PREDICTED: aldo-keto reductase family 4 memb...    197   2e-58   Citrus sinensis [apfelsine]
ref|NP_001118465.1|  aldo-keto reductase family 4 member C8             196   2e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008803139.1|  PREDICTED: aldo-keto reductase family 4 memb...    197   2e-58   Phoenix dactylifera
ref|NP_973627.1|  aldo-keto reductase family 4 member C8                196   2e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010235188.1|  PREDICTED: aldo-keto reductase family 4 memb...    197   3e-58   
gb|KJB46604.1|  hypothetical protein B456_007G377100                    196   4e-58   
ref|XP_002879707.1|  aldo/keto reductase family protein                 196   4e-58   
ref|XP_007134072.1|  hypothetical protein PHAVU_010G017200g             196   4e-58   
ref|XP_006493575.1|  PREDICTED: aldo-keto reductase family 4 memb...    196   4e-58   
ref|XP_002441207.1|  hypothetical protein SORBIDRAFT_09g022350          195   5e-58   
ref|NP_565871.1|  aldo-keto reductase family 4 member C8                196   5e-58   
ref|XP_004970569.1|  PREDICTED: aldo-keto reductase family 4 memb...    195   6e-58   
gb|KDO48134.1|  hypothetical protein CISIN_1g041263mg                   196   6e-58   
ref|XP_004515026.1|  PREDICTED: aldo-keto reductase family 4 memb...    195   7e-58   
ref|XP_003564605.1|  PREDICTED: aldo-keto reductase family 4 memb...    195   8e-58   
gb|ACG36524.1|  aldose reductase                                        195   8e-58   
ref|XP_006429183.1|  hypothetical protein CICLE_v10013858mg             195   1e-57   
pdb|3H7R|A  Chain A, Crystal Structure Of The Plant Stress-Respon...    196   1e-57   
ref|XP_004961878.1|  PREDICTED: aldo-keto reductase family 4 memb...    194   1e-57   
ref|XP_008673076.1|  PREDICTED: uncharacterized protein LOC100381...    194   1e-57   
ref|XP_008673074.1|  PREDICTED: uncharacterized protein LOC100381...    194   2e-57   
gb|KJB36674.1|  hypothetical protein B456_006G170300                    194   2e-57   
ref|XP_008673075.1|  PREDICTED: uncharacterized protein LOC100381...    194   2e-57   
ref|XP_010529795.1|  PREDICTED: aldo-keto reductase family 4 memb...    194   2e-57   
ref|XP_004142053.1|  PREDICTED: aldo-keto reductase family 4 memb...    194   3e-57   
ref|XP_004516040.1|  PREDICTED: aldo-keto reductase family 4 memb...    191   3e-57   
ref|NP_001241957.1|  uncharacterized protein LOC100809492               194   5e-57   
ref|XP_006645006.1|  PREDICTED: aldo-keto reductase family 4 memb...    192   8e-57   
ref|XP_008448286.1|  PREDICTED: aldo-keto reductase family 4 memb...    192   1e-56   
gb|EMS58684.1|  Aldo-keto reductase family 4 member C9                  191   1e-56   
gb|EMS64419.1|  Aldo-keto reductase family 4 member C9                  199   2e-56   
ref|NP_001132855.1|  uncharacterized protein LOC100194348               192   2e-56   
ref|XP_002962356.1|  hypothetical protein SELMODRAFT_78063              192   2e-56   
gb|KHG02299.1|  Aldo-keto reductase family 4 member C9                  192   2e-56   
gb|EMT22694.1|  Aldose reductase                                        194   2e-56   
ref|XP_001778870.1|  predicted protein                                  191   3e-56   
ref|XP_002962921.1|  hypothetical protein SELMODRAFT_141212             191   3e-56   
ref|XP_010923220.1|  PREDICTED: aldo-keto reductase family 4 memb...    191   3e-56   
ref|XP_002441209.1|  hypothetical protein SORBIDRAFT_09g022360          191   4e-56   
ref|XP_010677556.1|  PREDICTED: aldo-keto reductase family 4 memb...    191   4e-56   
ref|XP_001771685.1|  predicted protein                                  191   5e-56   
gb|EMS64420.1|  Aldo-keto reductase family 4 member C9                  190   6e-56   
gb|EMS47118.1|  Aldo-keto reductase family 4 member C9                  197   7e-56   
ref|XP_004504536.1|  PREDICTED: aldo-keto reductase family 4 memb...    190   9e-56   
ref|XP_002273139.1|  PREDICTED: aldo-keto reductase family 4 memb...    189   3e-55   
ref|XP_003552198.1|  PREDICTED: aldo-keto reductase family 4 memb...    188   5e-55   
gb|EMS64417.1|  Aldo-keto reductase family 4 member C10                 188   6e-55   
gb|KHN04058.1|  Aldo-keto reductase family 4 member C9                  188   6e-55   
ref|XP_010677557.1|  PREDICTED: aldo-keto reductase family 4 memb...    187   7e-55   
emb|CAN73301.1|  hypothetical protein VITISV_029327                     189   8e-55   
gb|EMT09402.1|  Alcohol dehydrogenase (NADP+) A                         187   9e-55   
gb|EMS61074.1|  Aldo-keto reductase family 4 member C10                 187   1e-54   
ref|XP_010262638.1|  PREDICTED: aldo-keto reductase family 4 memb...    187   2e-54   
gb|EMT09399.1|  Alcohol dehydrogenase (NADP+)                           185   2e-54   
gb|KFK36668.1|  hypothetical protein AALP_AA4G154400                    186   3e-54   
gb|ACS94043.1|  aldo-keto reductase                                     185   5e-54   
ref|XP_011012439.1|  PREDICTED: aldo-keto reductase family 4 memb...    186   6e-54   
ref|XP_007026917.1|  NAD(P)-linked oxidoreductase superfamily pro...    185   6e-54   
ref|XP_008649709.1|  PREDICTED: aldo-keto reductase family 4 memb...    185   1e-53   
ref|XP_008803159.1|  PREDICTED: aldo-keto reductase family 4 memb...    184   1e-53   
ref|XP_002322921.1|  hypothetical protein POPTR_0016s10370g             183   3e-53   
ref|XP_006645009.1|  PREDICTED: aldo-keto reductase family 4 memb...    183   4e-53   
gb|KJB76788.1|  hypothetical protein B456_012G107300                    179   7e-53   
gb|KHN44003.1|  Aldo-keto reductase family 4 member C9                  181   1e-52   
gb|EEC71800.1|  hypothetical protein OsI_04429                          181   3e-52   
ref|XP_002456634.1|  hypothetical protein SORBIDRAFT_03g039780          180   4e-52   
gb|EMT18107.1|  Alcohol dehydrogenase (NADP+)                           181   4e-52   
ref|XP_004961879.1|  PREDICTED: aldo-keto reductase family 4 memb...    181   5e-52   
gb|EMT10823.1|  Aldose reductase                                        181   1e-51   
ref|XP_002991432.1|  hypothetical protein SELMODRAFT_429709             177   5e-51   
ref|XP_002988328.1|  hypothetical protein SELMODRAFT_159380             171   2e-48   
gb|EYU41766.1|  hypothetical protein MIMGU_mgv11b014930mg               167   2e-48   
gb|KHN40264.1|  Aldo-keto reductase family 4 member C9                  168   5e-48   
ref|XP_010937782.1|  PREDICTED: aldo-keto reductase family 4 memb...    173   6e-48   
gb|ABK23442.1|  unknown                                                 168   1e-47   
gb|EMT29335.1|  Alcohol dehydrogenase (NADP+)                           167   7e-47   
gb|KJB76794.1|  hypothetical protein B456_012G107600                    166   1e-46   
ref|XP_010937543.1|  PREDICTED: aldo-keto reductase family 4 memb...    163   7e-46   
ref|XP_004491996.1|  PREDICTED: aldo-keto reductase family 4 memb...    163   2e-45   
gb|KEH23000.1|  aldo/keto reductase family oxidoreductase               164   2e-45   
gb|AFK35539.1|  unknown                                                 156   3e-44   
ref|XP_003604920.1|  Aldose reductase                                   157   1e-43   
ref|XP_004348808.1|  aldehyde reductase                                 158   2e-43   
ref|XP_008785509.1|  PREDICTED: aldo-keto reductase family 4 memb...    151   3e-43   
ref|WP_035245404.1|  aldehyde oxidoreductase                            157   4e-43   
ref|XP_002323797.2|  hypothetical protein POPTR_0017s10680g             156   5e-43   
gb|KCW86007.1|  hypothetical protein EUGRSUZ_B02712                     156   5e-43   
ref|XP_008785508.1|  PREDICTED: aldo-keto reductase family 4 memb...    150   8e-43   
ref|WP_002695791.1|  aldehyde oxidoreductase                            156   9e-43   
ref|WP_044207365.1|  aldehyde oxidoreductase                            155   2e-42   
ref|XP_005706925.1|  aldo/keto reductase                                155   2e-42   
dbj|BAD90688.1|  erythrose reductase 2                                  155   4e-42   
dbj|BAD90687.1|  erythrose reductase 1                                  155   4e-42   
emb|CAN73300.1|  hypothetical protein VITISV_029324                     141   5e-42   
ref|XP_010910606.1|  PREDICTED: aldo-keto reductase family 4 memb...    153   7e-42   
gb|KDQ20256.1|  hypothetical protein BOTBODRAFT_142790                  154   1e-41   
gb|KDO36593.1|  hypothetical protein CISIN_1g032577mg                   147   4e-41   
ref|WP_008612916.1|  aldehyde oxidoreductase                            152   5e-41   
ref|WP_044227051.1|  aldehyde oxidoreductase                            150   1e-40   
ref|WP_028947934.1|  aldehyde oxidoreductase                            150   2e-40   
gb|AIE74584.1|  Aldo-keto reductase family 1 member B10                 150   3e-40   
ref|WP_010873023.1|  aldehyde oxidoreductase                            150   4e-40   
ref|WP_007148509.1|  aldehyde oxidoreductase                            149   4e-40   
emb|CDY59483.1|  BnaC03g72060D                                          147   5e-40   
dbj|BAM54879.1|  aldehyde reductase                                     149   6e-40   
ref|XP_006633906.1|  PREDICTED: aldose reductase-like                   147   7e-40   
ref|XP_002185454.1|  predicted protein                                  149   1e-39   
gb|EHJ74152.1|  hypothetical protein KGM_09075                          147   1e-39   
ref|XP_001914456.1|  alcohol dehydrogenase                              144   1e-39   
ref|WP_019245247.1|  hypothetical protein                               147   1e-39   
gb|ERS99301.1|  hypothetical protein HMPREF1624_04500                   148   1e-39   
ref|WP_014992762.1|  aldehyde oxidoreductase                            147   2e-39   
ref|XP_001914269.1|  alcohol dehydrogenase                              144   2e-39   
gb|AGB07593.1|  erythrose reductase 3                                   147   4e-39   
ref|XP_004341974.1|  oxidoreductase, aldo/keto reductase, putative      146   5e-39   
gb|KIH94370.1|  hypothetical protein SPBR_06022                         147   5e-39   
ref|XP_006934756.1|  PREDICTED: alcohol dehydrogenase [NADP(+)]         147   5e-39   
ref|WP_006514380.1|  aldo/keto reductase, diketogulonate reductase      146   5e-39   
ref|XP_007077335.1|  PREDICTED: alcohol dehydrogenase [NADP(+)]         146   5e-39   
ref|XP_010505376.1|  PREDICTED: aldo-keto reductase family 4 memb...    145   6e-39   
gb|EFB27516.1|  hypothetical protein PANDA_008132                       146   7e-39   
ref|XP_007700322.1|  hypothetical protein COCSADRAFT_190646             146   7e-39   
gb|EKG17921.1|  Aldo/keto reductase                                     146   7e-39   
ref|WP_026235816.1|  aldehyde oxidoreductase                            146   7e-39   
ref|XP_010039182.1|  PREDICTED: aldo-keto reductase family 4 memb...    145   9e-39   
ref|XP_008042632.1|  Aldo/keto reductase                                146   9e-39   
ref|XP_002341089.1|  aldehyde reductase I (ARI), putative               146   1e-38   
dbj|BAP15325.1|  aldehyde reductase                                     145   1e-38   
gb|EMS58685.1|  Aldo-keto reductase family 4 member C10                 148   1e-38   
ref|WP_011589688.1|  MULTISPECIES: aldehyde oxidoreductase              145   1e-38   
dbj|BAD90689.1|  erythrose reductase 3                                  145   1e-38   
gb|KDN46461.1|  erythrose reductase 3                                   145   1e-38   
ref|XP_002919499.1|  PREDICTED: alcohol dehydrogenase [NADP(+)] i...    145   1e-38   
ref|XP_008697503.1|  PREDICTED: alcohol dehydrogenase [NADP(+)] i...    145   1e-38   
gb|EUN25149.1|  hypothetical protein COCVIDRAFT_104285                  145   2e-38   
ref|XP_007716858.1|  hypothetical protein COCCADRAFT_40703              145   2e-38   
ref|XP_003384280.1|  PREDICTED: aldo-keto reductase family 4 memb...    145   2e-38   
ref|WP_022996948.1|  MULTISPECIES: aldehyde oxidoreductase              145   2e-38   
ref|WP_013455794.1|  aldehyde oxidoreductase                            145   2e-38   
gb|KFX53598.1|  putative oxidoreductase C26F1.07                        143   2e-38   
ref|XP_001559222.1|  hypothetical protein BC1G_02386                    144   3e-38   
ref|XP_009656469.1|  GCY protein                                        145   3e-38   
gb|ACB50133.1|  aldo/keto reductase                                     145   3e-38   
emb|CCD56823.1|  BcPIO12, similar to aldo/keto reductase                144   3e-38   
ref|XP_007164613.1|  PREDICTED: alcohol dehydrogenase [NADP(+)]         146   3e-38   
ref|XP_003007099.1|  GCY                                                144   3e-38   
ref|XP_007677637.1|  hypothetical protein BAUCODRAFT_518265             144   4e-38   
gb|ELK06104.1|  Alcohol dehydrogenase [NADP+]                           145   4e-38   
gb|AGQ45612.1|  aldo-keto reductase                                     144   4e-38   
gb|KIJ51265.1|  hypothetical protein M422DRAFT_223741                   144   4e-38   
ref|WP_006975403.1|  aldehyde oxidoreductase                            144   4e-38   
ref|WP_037981021.1|  aldehyde oxidoreductase                            144   4e-38   
ref|WP_007311851.1|  aldehyde oxidoreductase                            144   4e-38   
ref|XP_008149425.1|  PREDICTED: alcohol dehydrogenase [NADP(+)]         144   4e-38   
ref|XP_004400653.1|  PREDICTED: alcohol dehydrogenase [NADP(+)] i...    144   4e-38   
gb|KFZ24915.1|  hypothetical protein V502_00592                         144   4e-38   
ref|XP_006729090.1|  PREDICTED: alcohol dehydrogenase [NADP(+)]         144   5e-38   
ref|WP_019600044.1|  hypothetical protein                               144   5e-38   
gb|EHK20978.1|  hypothetical protein TRIVIDRAFT_59414                   144   5e-38   
ref|XP_007693292.1|  hypothetical protein COCMIDRAFT_109442             144   5e-38   
gb|KFY94726.1|  hypothetical protein V500_03089                         144   5e-38   
ref|WP_009546022.1|  MULTISPECIES: aldehyde oxidoreductase              144   5e-38   
ref|XP_008835844.1|  PREDICTED: alcohol dehydrogenase [NADP(+)]         144   7e-38   
ref|XP_006919196.1|  PREDICTED: alcohol dehydrogenase [NADP(+)] i...    144   7e-38   
dbj|BAN37950.1|  aldose reductase, putative                             143   7e-38   
emb|CBY14032.1|  unnamed protein product                                143   7e-38   
ref|XP_001213633.1|  hypothetical protein ATEG_04455                    143   7e-38   
ref|XP_009033997.1|  hypothetical protein AURANDRAFT_59872              144   7e-38   
ref|XP_011365895.1|  PREDICTED: alcohol dehydrogenase [NADP(+)]         144   8e-38   
ref|XP_004925118.1|  PREDICTED: aldose reductase-like isoform X1        143   8e-38   
ref|XP_648383.1|  aldose reductase                                      143   8e-38   
ref|XP_007450429.1|  PREDICTED: alcohol dehydrogenase [NADP(+)] i...    145   8e-38   
ref|WP_026097570.1|  aldehyde oxidoreductase                            143   8e-38   
ref|XP_004442077.1|  PREDICTED: alcohol dehydrogenase [NADP(+)] i...    143   9e-38   
ref|XP_005705628.1|  aldo/keto reductase                                143   1e-37   
ref|WP_029915284.1|  aldehyde oxidoreductase                            143   1e-37   
ref|XP_003801456.1|  PREDICTED: alcohol dehydrogenase [NADP(+)]         143   1e-37   
ref|XP_969601.1|  PREDICTED: aldose reductase                           143   1e-37   
ref|XP_007108664.1|  PREDICTED: alcohol dehydrogenase [NADP(+)]         143   1e-37   
ref|WP_015267323.1|  aldo/keto reductase, diketogulonate reductase      142   1e-37   
ref|XP_001588521.1|  hypothetical protein SS1G_10068                    142   1e-37   
ref|XP_005595650.1|  PREDICTED: alcohol dehydrogenase [NADP(+)]-l...    142   1e-37   
ref|XP_007977145.1|  PREDICTED: alcohol dehydrogenase [NADP(+)] i...    142   1e-37   
ref|XP_002565934.1|  Pc22g20340                                         142   1e-37   
ref|XP_006986628.1|  PREDICTED: alcohol dehydrogenase [NADP(+)] i...    143   2e-37   
gb|KEQ79116.1|  putative aldehyde reductase I                           143   2e-37   
ref|XP_001628474.1|  predicted protein                                  142   2e-37   
ref|XP_007727346.1|  alcohol dehydrogenase                              142   2e-37   
ref|WP_022007190.1|  aldo/keto reductase family protein                 142   2e-37   
ref|XP_007587416.1|  putative glycerol protein                          143   2e-37   
ref|XP_653766.1|  aldose reductase                                      142   2e-37   
emb|CBQ68613.1|  related to GCY1-galactose-induced protein of ald...    142   2e-37   
ref|XP_010862467.1|  PREDICTED: alcohol dehydrogenase [NADP(+)] i...    143   2e-37   
ref|WP_023076620.1|  aldehyde oxidoreductase                            142   2e-37   
ref|NP_001126792.1|  alcohol dehydrogenase [NADP(+)]                    142   2e-37   
ref|XP_004740488.1|  PREDICTED: alcohol dehydrogenase [NADP(+)]         142   2e-37   
ref|XP_004639243.1|  PREDICTED: alcohol dehydrogenase [NADP(+)]         142   2e-37   
ref|XP_010608475.1|  PREDICTED: alcohol dehydrogenase [NADP(+)]         142   2e-37   
gb|ACI33815.1|  Alcohol dehydrogenase                                   142   2e-37   
ref|XP_008999383.1|  PREDICTED: alcohol dehydrogenase [NADP(+)]         142   2e-37   
ref|XP_002144446.1|  aldehyde reductase I (ARI), putative               142   2e-37   
ref|XP_006633892.1|  PREDICTED: aldose reductase-like                   142   2e-37   
ref|XP_003936949.1|  PREDICTED: alcohol dehydrogenase [NADP(+)]         142   2e-37   
ref|NP_001290761.1|  aldo-keto reductase family 1, member A1 (ald...    142   2e-37   
ref|NP_001248287.1|  aldo-keto reductase family 1, member A1 (ald...    142   2e-37   
ref|XP_002715183.1|  PREDICTED: alcohol dehydrogenase [NADP(+)]         142   2e-37   
ref|XP_007977142.1|  PREDICTED: alcohol dehydrogenase [NADP(+)] i...    142   2e-37   
ref|XP_006986629.1|  PREDICTED: alcohol dehydrogenase [NADP(+)] i...    142   2e-37   
ref|XP_006986627.1|  PREDICTED: alcohol dehydrogenase [NADP(+)] i...    143   2e-37   
ref|XP_003278712.1|  PREDICTED: alcohol dehydrogenase [NADP(+)] i...    142   2e-37   
gb|EKV09479.1|  Glycerol dehydrogenase, putative                        142   2e-37   
ref|WP_042277573.1|  aldehyde oxidoreductase                            142   2e-37   
gb|EMD88517.1|  hypothetical protein COCHEDRAFT_1142171                 142   2e-37   
dbj|GAA95234.1|  hypothetical protein E5Q_01890                         141   2e-37   
pdb|3CV7|A  Chain A, Crystal Structure Of Porcine Aldehyde Reduct...    142   3e-37   
ref|XP_003708584.1|  PREDICTED: aldose reductase-like                   142   3e-37   
ref|XP_004707878.1|  PREDICTED: aldose reductase                        142   3e-37   
gb|EOB00363.1|  Alcohol dehydrogenase [NADP+]                           142   3e-37   
ref|XP_004699528.1|  PREDICTED: alcohol dehydrogenase [NADP(+)]         142   3e-37   
gb|EPS28840.1|  hypothetical protein PDE_03786                          142   3e-37   
ref|XP_006145056.1|  PREDICTED: aldose reductase                        143   3e-37   
ref|XP_005082444.1|  PREDICTED: aldose reductase                        142   3e-37   
ref|XP_006839767.1|  PREDICTED: alcohol dehydrogenase [NADP(+)]         142   3e-37   
gb|EYE97216.1|  Aldo/keto reductase                                     142   3e-37   
ref|XP_005881330.1|  PREDICTED: alcohol dehydrogenase [NADP(+)] i...    142   3e-37   



>ref|XP_011094913.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Sesamum 
indicum]
Length=315

 Score =   249 bits (637),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 132/161 (82%), Positives = 144/161 (89%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            M   +  F LNTGAKIPSVGLGTWQAEPGVVGQAVE AIK GYRHIDCAR YGNEKEIG 
Sbjct  1    MVQEIGYFELNTGAKIPSVGLGTWQAEPGVVGQAVEVAIKSGYRHIDCARAYGNEKEIGV  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLKKLF DG+VKRE+LFITSKL   DHAPEDVPVALN+TL++LQLDY+DLYL+HWPV MK
Sbjct  61   VLKKLFDDGIVKREELFITSKLRNNDHAPEDVPVALNKTLEELQLDYVDLYLVHWPVRMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            KD+VGF+PENL+P +IP TWKAMEALYDSGKARAIGVSNFS
Sbjct  121  KDAVGFSPENLLPTDIPGTWKAMEALYDSGKARAIGVSNFS  161



>gb|AFK48248.1| unknown [Lotus japonicus]
Length=315

 Score =   249 bits (635),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 133/161 (83%), Positives = 146/161 (91%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            M+  ++ F LNTGAKIPSVGLGTWQ++PGVVGQAV AAIK+GYRHIDCA+ YGNEKEIG 
Sbjct  1    MSNEIQFFQLNTGAKIPSVGLGTWQSDPGVVGQAVAAAIKIGYRHIDCAQIYGNEKEIGS  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLKKLF DGVVKREDL+ITSKLW TDHAPEDVP+AL++TLKDLQLDY+DLYLIHWP PMK
Sbjct  61   VLKKLFEDGVVKREDLWITSKLWNTDHAPEDVPLALDRTLKDLQLDYVDLYLIHWPAPMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K S GF PENL+  NIPATWKAMEALYDSGKARAIGVSNFS
Sbjct  121  KGSQGFKPENLVQPNIPATWKAMEALYDSGKARAIGVSNFS  161



>ref|XP_009602752.1| PREDICTED: aldo-keto reductase family 4 member C10-like [Nicotiana 
tomentosiformis]
Length=315

 Score =   246 bits (629),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 128/161 (80%), Positives = 145/161 (90%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA A++ F LNTGAK+PSVGLGTWQ++PGVVGQAVE AIKVGYRHIDCAR Y NEKEIGE
Sbjct  1    MAAAIRYFELNTGAKMPSVGLGTWQSDPGVVGQAVEFAIKVGYRHIDCARIYKNEKEIGE  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            +LK+LF DGV+KRE+LF+TSKLW TDH+PEDVPVALN+TL+DLQLDY+DLYLIHWPV MK
Sbjct  61   ILKRLFKDGVIKREELFVTSKLWNTDHSPEDVPVALNKTLEDLQLDYVDLYLIHWPVSMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
              S  F PENL+P NIP+TW+AME LYDSGKARAIGVSNFS
Sbjct  121  PGSTDFKPENLMPTNIPSTWQAMEKLYDSGKARAIGVSNFS  161



>ref|XP_002529872.1| aldo-keto reductase, putative [Ricinus communis]
 gb|EEF32522.1| aldo-keto reductase, putative [Ricinus communis]
Length=301

 Score =   246 bits (627),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 131/161 (81%), Positives = 143/161 (89%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA A++ F LNTGAKIPSVGLGTWQAEPGVVGQAV  AIK GYRHIDCA  YGNEKEIG 
Sbjct  1    MAKAIRFFELNTGAKIPSVGLGTWQAEPGVVGQAVSTAIKAGYRHIDCASVYGNEKEIGS  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
             LKKLFADGVVKREDL++TSKLWCTDHAPEDVP AL++TL++LQLDY+DLYLIHWPV MK
Sbjct  61   SLKKLFADGVVKREDLWVTSKLWCTDHAPEDVPQALDRTLRELQLDYVDLYLIHWPVSMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K SVGF  ENL   +IP+TW+AMEALYDSGKARAIGVSNFS
Sbjct  121  KASVGFKAENLTRPDIPSTWRAMEALYDSGKARAIGVSNFS  161



>ref|XP_009621148.1| PREDICTED: aldo-keto reductase family 4 member C9-like isoform 
X1 [Nicotiana tomentosiformis]
Length=309

 Score =   246 bits (627),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 128/161 (80%), Positives = 143/161 (89%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA A++ F LNTGAKIPSVGLGTWQ++PG+VGQA+E AIKVGYRHIDCA+ YGNEKEIG+
Sbjct  1    MAEAIQYFELNTGAKIPSVGLGTWQSDPGIVGQAIETAIKVGYRHIDCAQVYGNEKEIGQ  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLK+LF DGVVKREDLFITSKLWCTDHAPEDVP A  +TL DLQLDYIDLYL+HWPV MK
Sbjct  61   VLKRLFKDGVVKREDLFITSKLWCTDHAPEDVPAAFRKTLDDLQLDYIDLYLMHWPVRMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
              + GF PENLIP +IP+TW+AME LYDS KARAIGVSNFS
Sbjct  121  NAADGFKPENLIPGDIPSTWQAMEKLYDSTKARAIGVSNFS  161



>ref|XP_009791583.1| PREDICTED: aldo-keto reductase family 4 member C10-like [Nicotiana 
sylvestris]
Length=315

 Score =   245 bits (626),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 128/161 (80%), Positives = 144/161 (89%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA A++ F LNTGAK+PSVGLGTWQ++PGVVG AVE AIKVGYRHIDCAR Y NEKEIGE
Sbjct  1    MAAAIRYFELNTGAKMPSVGLGTWQSDPGVVGHAVEIAIKVGYRHIDCARIYKNEKEIGE  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLKKLF DGVVKRE+LF+TSKLW TDHAPEDVP+ALN+TL+DLQLDY+DLYL+HWPV +K
Sbjct  61   VLKKLFKDGVVKREELFVTSKLWNTDHAPEDVPLALNRTLEDLQLDYVDLYLMHWPVTLK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
              S  F PENL+P NIP+TW+AME LYDSGKARAIGVSNFS
Sbjct  121  PGSADFKPENLMPTNIPSTWQAMEKLYDSGKARAIGVSNFS  161



>emb|CDY64988.1| BnaA05g34870D [Brassica napus]
Length=315

 Score =   245 bits (626),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 129/161 (80%), Positives = 144/161 (89%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA A++ F LNTGAKIPSVGLGTWQA PG+VG AV AA+K+GYRHIDCA+ YGNEKEIG 
Sbjct  1    MANAIRYFELNTGAKIPSVGLGTWQASPGLVGDAVAAAVKIGYRHIDCAQIYGNEKEIGT  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLKKLF D VVKRE+LFITSKLWCTDH P+DVP ALN+TL+DLQLDY+DLYL+HWPV MK
Sbjct  61   VLKKLFEDNVVKREELFITSKLWCTDHDPQDVPEALNRTLQDLQLDYVDLYLMHWPVRMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K SVG  PENL+P +IP+TWKAMEALYDSGKARAIGVSNFS
Sbjct  121  KGSVGAKPENLLPVDIPSTWKAMEALYDSGKARAIGVSNFS  161



>ref|XP_010505375.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Camelina 
sativa]
Length=316

 Score =   245 bits (625),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 128/161 (80%), Positives = 140/161 (87%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA  VKCF LNTGAKIPSVGLGTWQA PG+VG AV AA+K+GYRHIDCA+ YGNEKEIG 
Sbjct  1    MANEVKCFELNTGAKIPSVGLGTWQASPGLVGDAVAAAVKIGYRHIDCAKLYGNEKEIGA  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLKKLF D VVKRE+LFITSKLWCTDH PEDVP ALN+TL+DLQL Y+DLYL+HWP  MK
Sbjct  61   VLKKLFEDNVVKREELFITSKLWCTDHDPEDVPEALNKTLQDLQLGYVDLYLMHWPARMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K SVG   EN +P +IP+TWKAMEALYDSGKARAIGVSNFS
Sbjct  121  KGSVGIKAENFLPVDIPSTWKAMEALYDSGKARAIGVSNFS  161



>dbj|BAJ33839.1| unnamed protein product [Thellungiella halophila]
Length=315

 Score =   245 bits (625),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 129/161 (80%), Positives = 144/161 (89%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA A++ F LNTGAKIPSVGLGTWQA PG+VG AV AA+K+GYRHIDCA+ YGNEKEIG 
Sbjct  1    MANAIRFFELNTGAKIPSVGLGTWQASPGLVGDAVAAAVKLGYRHIDCAQIYGNEKEIGT  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLKKLF D VVKRE+LFITSKLWCTDH P+DVP ALN+TL+DLQLDY+DLYL+HWPV MK
Sbjct  61   VLKKLFEDSVVKREELFITSKLWCTDHDPQDVPEALNRTLQDLQLDYVDLYLMHWPVRMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K SVG  PENL+P +IP+TWKAMEALYDSGKARAIGVSNFS
Sbjct  121  KGSVGAKPENLLPVDIPSTWKAMEALYDSGKARAIGVSNFS  161



>ref|XP_006410968.1| hypothetical protein EUTSA_v10016962mg [Eutrema salsugineum]
 gb|ESQ52421.1| hypothetical protein EUTSA_v10016962mg [Eutrema salsugineum]
Length=315

 Score =   245 bits (625),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 129/161 (80%), Positives = 144/161 (89%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA A++ F LNTGAKIPSVGLGTWQA PG+VG AV AA+K+GYRHIDCA+ YGNEKEIG 
Sbjct  1    MANAIRFFELNTGAKIPSVGLGTWQASPGLVGDAVAAAVKLGYRHIDCAQIYGNEKEIGT  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLKKLF D VVKRE+LFITSKLWCTDH P+DVP ALN+TL+DLQLDY+DLYL+HWPV MK
Sbjct  61   VLKKLFEDSVVKREELFITSKLWCTDHDPQDVPEALNRTLQDLQLDYVDLYLMHWPVRMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K SVG  PENL+P +IP+TWKAMEALYDSGKARAIGVSNFS
Sbjct  121  KGSVGAKPENLLPVDIPSTWKAMEALYDSGKARAIGVSNFS  161



>emb|CDY59481.1| BnaC03g72040D [Brassica napus]
Length=315

 Score =   243 bits (621),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 129/161 (80%), Positives = 143/161 (89%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA A++ F LNTGAKIPSVGLGTWQA PG+VG AV AA+K+GYRHIDCA+ YGNEKEIG 
Sbjct  1    MANAIRFFELNTGAKIPSVGLGTWQASPGLVGDAVAAAVKIGYRHIDCAQIYGNEKEIGS  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLKKLF D VVKRE+LFITSKLWCTDH P+DVP AL +TL+DLQLDY+DLYLIHWPV MK
Sbjct  61   VLKKLFEDNVVKREELFITSKLWCTDHDPQDVPEALKRTLQDLQLDYVDLYLIHWPVRMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K SVG  PENL+P +IP+TWKAMEALYDSGKARAIGVSNFS
Sbjct  121  KGSVGAKPENLMPVDIPSTWKAMEALYDSGKARAIGVSNFS  161



>gb|KDP24556.1| hypothetical protein JCGZ_25120 [Jatropha curcas]
Length=315

 Score =   243 bits (621),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 129/161 (80%), Positives = 141/161 (88%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA A++ F LNTGAKIPSVGLGTWQ+EP VVG AV AAIK GYRHIDCA  YGNEKE+G 
Sbjct  1    MANAIRFFTLNTGAKIPSVGLGTWQSEPSVVGDAVTAAIKAGYRHIDCASVYGNEKEVGL  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
             LKKLF DGVVKRE+L+ITSKLWCTDH PEDVPVALN+TL+DLQL+Y+DLYLIHWP  MK
Sbjct  61   ALKKLFDDGVVKREELWITSKLWCTDHDPEDVPVALNRTLQDLQLEYLDLYLIHWPASMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K SVGF PENL   NIP+TWKAMEALYDSGKARAIGVSNF+
Sbjct  121  KGSVGFKPENLTRPNIPSTWKAMEALYDSGKARAIGVSNFT  161



>gb|EYU41765.1| hypothetical protein MIMGU_mgv1a010335mg [Erythranthe guttata]
Length=315

 Score =   243 bits (621),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 128/161 (80%), Positives = 142/161 (88%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA  +  F LNTGAKIPSVGLGTWQ+EPG+VGQAVEAAIK GYRHIDCAR Y NEKEIG 
Sbjct  1    MANEILYFELNTGAKIPSVGLGTWQSEPGLVGQAVEAAIKSGYRHIDCARAYNNEKEIGL  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLKKLF DGVVKRE+LFITSKLWC DHAPEDV  AL++TL++LQL Y+DL+LIHWPV MK
Sbjct  61   VLKKLFDDGVVKREELFITSKLWCNDHAPEDVLAALDKTLEELQLGYVDLFLIHWPVRMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K +VGF PENLI  +IP+TWKAME+LYDSGKARAIGVSNFS
Sbjct  121  KGAVGFLPENLIATDIPSTWKAMESLYDSGKARAIGVSNFS  161



>ref|XP_009133204.1| PREDICTED: aldo-keto reductase family 4 member C9 [Brassica rapa]
Length=315

 Score =   243 bits (620),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 129/161 (80%), Positives = 143/161 (89%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA A++ F LNTGAKIPSVGLGTWQA PG+VG AV AA+K+GYRHIDCA+ YGNEKEIG 
Sbjct  1    MANAIRFFELNTGAKIPSVGLGTWQASPGLVGDAVAAAVKIGYRHIDCAQIYGNEKEIGS  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLKKLF D VVKRE+LFITSKLWCTDH P+DVP AL +TL+DLQLDY+DLYLIHWPV MK
Sbjct  61   VLKKLFEDNVVKREELFITSKLWCTDHDPQDVPEALKRTLQDLQLDYVDLYLIHWPVRMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K SVG  PENL+P +IP+TWKAMEALYDSGKARAIGVSNFS
Sbjct  121  KGSVGAKPENLMPVDIPSTWKAMEALYDSGKARAIGVSNFS  161



>gb|EYU41763.1| hypothetical protein MIMGU_mgv1a010332mg [Erythranthe guttata]
Length=315

 Score =   243 bits (620),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 126/161 (78%), Positives = 144/161 (89%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA A++ F LN GAKIPSVGLGTW+A PGVVG A+ AAIK GYRHIDCA+RYGNEKEIG+
Sbjct  1    MARAIRSFELNPGAKIPSVGLGTWKAAPGVVGDAITAAIKAGYRHIDCAQRYGNEKEIGD  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLKKL  +GVVKREDL+ITSKLWCTDHAPEDVP+ALN+TL DL+LDY+DLYL+HWPV MK
Sbjct  61   VLKKLLEEGVVKREDLWITSKLWCTDHAPEDVPLALNRTLNDLKLDYVDLYLMHWPVRMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K SV F PENL+  +IP+TW+AMEALYD+GKARAIGVSNFS
Sbjct  121  KGSVRFEPENLVETDIPSTWRAMEALYDAGKARAIGVSNFS  161



>emb|CDY07771.1| BnaA03g17400D [Brassica napus]
Length=315

 Score =   243 bits (620),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 129/161 (80%), Positives = 143/161 (89%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA A++ F LNTGAKIPSVGLGTWQA PG+VG AV AA+K+GYRHIDCA+ YGNEKEIG 
Sbjct  1    MANAIRFFELNTGAKIPSVGLGTWQASPGLVGDAVAAAVKIGYRHIDCAQIYGNEKEIGS  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLKKLF D VVKRE+LFITSKLWCTDH P+DVP AL +TL+DLQLDY+DLYLIHWPV MK
Sbjct  61   VLKKLFEDNVVKREELFITSKLWCTDHDPQDVPEALKRTLQDLQLDYVDLYLIHWPVRMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K SVG  PENL+P +IP+TWKAMEALYDSGKARAIGVSNFS
Sbjct  121  KGSVGAKPENLMPVDIPSTWKAMEALYDSGKARAIGVSNFS  161



>ref|XP_010509276.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Camelina 
sativa]
 ref|XP_010509277.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Camelina 
sativa]
Length=316

 Score =   243 bits (619),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 127/161 (79%), Positives = 141/161 (88%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA  VKCF LNTGAKIPSVGLGTWQA PG+VG AV AA+K+GYRHIDCA+ YGNEKEIG 
Sbjct  1    MANEVKCFELNTGAKIPSVGLGTWQASPGLVGDAVAAAVKIGYRHIDCAKLYGNEKEIGA  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLK+LF D VVKRE+LFITSKLWCTDH P+DVP ALN+TL+DLQLDY+DLYL+HWP  MK
Sbjct  61   VLKQLFEDNVVKREELFITSKLWCTDHDPQDVPEALNRTLQDLQLDYVDLYLMHWPARMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K SVG   EN +P +IP+TWKAMEALYDSGKARAIGVSNFS
Sbjct  121  KGSVGIKAENFLPVDIPSTWKAMEALYDSGKARAIGVSNFS  161



>ref|NP_181313.3| aldo-keto reductase family 4 member C9 [Arabidopsis thaliana]
 gb|AEC09448.1| aldo-keto reductase family 4 member C9 [Arabidopsis thaliana]
Length=283

 Score =   240 bits (613),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 128/161 (80%), Positives = 141/161 (88%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA A+  F LNTGAK PSVGLGTWQA PG+VG AV AA+K+GYRHIDCA+ YGNEKEIG 
Sbjct  1    MANAITFFKLNTGAKFPSVGLGTWQASPGLVGDAVAAAVKIGYRHIDCAQIYGNEKEIGA  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLKKLF D VVKREDLFITSKLWCTDH P+DVP ALN+TLKDLQL+Y+DLYLIHWP  +K
Sbjct  61   VLKKLFEDRVVKREDLFITSKLWCTDHDPQDVPEALNRTLKDLQLEYVDLYLIHWPARIK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K SVG  PENL+P +IP+TWKAMEALYDSGKARAIGVSNFS
Sbjct  121  KGSVGIKPENLLPVDIPSTWKAMEALYDSGKARAIGVSNFS  161



>gb|AAC23647.1| putative alcohol dehydrogenase [Arabidopsis thaliana]
Length=290

 Score =   240 bits (613),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 128/161 (80%), Positives = 141/161 (88%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA A+  F LNTGAK PSVGLGTWQA PG+VG AV AA+K+GYRHIDCA+ YGNEKEIG 
Sbjct  1    MANAITFFKLNTGAKFPSVGLGTWQASPGLVGDAVAAAVKIGYRHIDCAQIYGNEKEIGA  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLKKLF D VVKREDLFITSKLWCTDH P+DVP ALN+TLKDLQL+Y+DLYLIHWP  +K
Sbjct  61   VLKKLFEDRVVKREDLFITSKLWCTDHDPQDVPEALNRTLKDLQLEYVDLYLIHWPARIK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K SVG  PENL+P +IP+TWKAMEALYDSGKARAIGVSNFS
Sbjct  121  KGSVGIKPENLLPVDIPSTWKAMEALYDSGKARAIGVSNFS  161



>ref|XP_002273035.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Vitis 
vinifera]
Length=315

 Score =   241 bits (614),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 129/161 (80%), Positives = 145/161 (90%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            M+  ++ F LNTGAK+PSVGLGTWQ++PG+VGQAV  AIKVGYRHIDCA+ YGNE+EIG 
Sbjct  1    MSDDIRFFQLNTGAKMPSVGLGTWQSDPGLVGQAVAIAIKVGYRHIDCAQVYGNEEEIGI  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLKKLF DGVVKREDL+ITSKLWCTDHAPEDVP ALN+TLKDLQLDY+DLYLIHWP+ MK
Sbjct  61   VLKKLFDDGVVKREDLWITSKLWCTDHAPEDVPEALNRTLKDLQLDYVDLYLIHWPMSMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K SVGF PENL   +IP+TW+AMEALYDSGKARAIGVSNFS
Sbjct  121  KGSVGFKPENLAQPDIPSTWRAMEALYDSGKARAIGVSNFS  161



>ref|NP_001031505.1| aldo-keto reductase family 4 member C9 [Arabidopsis thaliana]
 ref|XP_004253292.1| PREDICTED: aldo-keto reductase family 4 member C9 [Solanum lycopersicum]
 sp|Q0PGJ6.1|AKRC9_ARATH RecName: Full=Aldo-keto reductase family 4 member C9 [Arabidopsis 
thaliana]
 gb|ABH07515.1| aldo-keto reductase [Arabidopsis thaliana]
 gb|AEC09449.1| aldo-keto reductase family 4 member C9 [Arabidopsis thaliana]
Length=315

 Score =   241 bits (614),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 128/161 (80%), Positives = 141/161 (88%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA A+  F LNTGAK PSVGLGTWQA PG+VG AV AA+K+GYRHIDCA+ YGNEKEIG 
Sbjct  1    MANAITFFKLNTGAKFPSVGLGTWQASPGLVGDAVAAAVKIGYRHIDCAQIYGNEKEIGA  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLKKLF D VVKREDLFITSKLWCTDH P+DVP ALN+TLKDLQL+Y+DLYLIHWP  +K
Sbjct  61   VLKKLFEDRVVKREDLFITSKLWCTDHDPQDVPEALNRTLKDLQLEYVDLYLIHWPARIK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K SVG  PENL+P +IP+TWKAMEALYDSGKARAIGVSNFS
Sbjct  121  KGSVGIKPENLLPVDIPSTWKAMEALYDSGKARAIGVSNFS  161



>emb|CDX74934.1| BnaA05g06800D [Brassica napus]
Length=315

 Score =   240 bits (613),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 123/161 (76%), Positives = 145/161 (90%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA  ++ F LNTGAKIPSVGLGTWQ++PG+VG AVEAA+K+GYRHIDCA+ YGNEKEIG 
Sbjct  1    MAEEIRFFELNTGAKIPSVGLGTWQSDPGLVGNAVEAAVKIGYRHIDCAQIYGNEKEIGL  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLKKLF DGVVKRE++FITSKLWCTDH P+DVPVALN+TL+DL+LDY+DLYLIHWPV +K
Sbjct  61   VLKKLFDDGVVKREEIFITSKLWCTDHDPQDVPVALNRTLQDLRLDYVDLYLIHWPVSLK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K S    PEN++P +IP+TWKAMEAL+D+GKARAIGVSNFS
Sbjct  121  KGSTDLKPENILPTDIPSTWKAMEALFDAGKARAIGVSNFS  161



>ref|XP_009143450.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Brassica 
rapa]
Length=310

 Score =   240 bits (613),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 126/161 (78%), Positives = 141/161 (88%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA A++ F LNTGAKIPSVGLGTWQA PG+VG AV AA+K+GYRHIDCA+ YGNEKEIG 
Sbjct  1    MANAIRYFELNTGAKIPSVGLGTWQASPGLVGDAVAAAVKIGYRHIDCAQIYGNEKEIGT  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLKKLF D VVKRE+LFITSKLWCTDH P+DVP  LN+TL+DLQLDY+DLYL+HWPV MK
Sbjct  61   VLKKLFEDNVVKREELFITSKLWCTDHDPQDVPETLNRTLQDLQLDYVDLYLMHWPVRMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K SVG  PENL+P +IP+TWKAME LYDSGKA AIGVSNFS
Sbjct  121  KGSVGAKPENLLPVDIPSTWKAMETLYDSGKALAIGVSNFS  161



>ref|XP_002879708.1| oxidoreductase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55967.1| oxidoreductase [Arabidopsis lyrata subsp. lyrata]
Length=315

 Score =   240 bits (613),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 128/161 (80%), Positives = 141/161 (88%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA A+  F LNTGAK PSVGLGTWQA PG+VG AV AAIK+GYRHIDCA+ YGNEKEIG 
Sbjct  1    MANAITFFELNTGAKFPSVGLGTWQASPGLVGDAVAAAIKIGYRHIDCAQIYGNEKEIGA  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLKKLF D VVKR+DLFITSKLWCTDH P+DVP ALN+TLKDLQLDY+DLYL+HWP  MK
Sbjct  61   VLKKLFEDRVVKRDDLFITSKLWCTDHDPQDVPEALNRTLKDLQLDYVDLYLMHWPARMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K SVG  PEN++P +IP+TWKAMEALYDSGKARAIGVSNFS
Sbjct  121  KGSVGIKPENILPVDIPSTWKAMEALYDSGKARAIGVSNFS  161



>ref|XP_010256789.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Nelumbo 
nucifera]
 ref|XP_010256790.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Nelumbo 
nucifera]
Length=315

 Score =   240 bits (612),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 126/161 (78%), Positives = 143/161 (89%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA  ++ F LNTGAKIPSVGLGTWQ+EPG+VG AV AAIK GYRHIDCAR Y NEKEIG 
Sbjct  1    MATEIRYFELNTGAKIPSVGLGTWQSEPGLVGDAVAAAIKAGYRHIDCARVYANEKEIGL  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLKKLF DG+V+REDL+ITSKLWCTDH PEDVP AL++TL++LQLDY+DLYLIHWPV MK
Sbjct  61   VLKKLFGDGLVRREDLWITSKLWCTDHVPEDVPEALDKTLQELQLDYVDLYLIHWPVRMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            + +VGF PENLI  +IP+TW+AMEALYDSGKARAIGVSNFS
Sbjct  121  RGAVGFKPENLIQHDIPSTWRAMEALYDSGKARAIGVSNFS  161



>ref|XP_006294635.1| hypothetical protein CARUB_v10023673mg [Capsella rubella]
 gb|EOA27533.1| hypothetical protein CARUB_v10023673mg [Capsella rubella]
Length=314

 Score =   240 bits (612),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 124/161 (77%), Positives = 143/161 (89%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA  ++ F LNTGAKIPSVGLGTWQA+PG+VG  VEAA+K+GYRHIDCA+ YGNEKEIG 
Sbjct  1    MADEIRYFELNTGAKIPSVGLGTWQADPGLVGNTVEAAVKIGYRHIDCAQIYGNEKEIGL  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLKKLF DGVVKRED+FITSKLWCTDH P+DVP AL  TL+DLQLDY+DLYLIHWPV +K
Sbjct  61   VLKKLFDDGVVKREDMFITSKLWCTDHDPQDVPEALKSTLQDLQLDYVDLYLIHWPVTLK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K S GF PEN++P +IP+TWKAME+L+D+GKARAIGVSNFS
Sbjct  121  KGSSGFKPENILPTDIPSTWKAMESLFDAGKARAIGVSNFS  161



>ref|XP_009143448.1| PREDICTED: aldo-keto reductase family 4 member C10 [Brassica 
rapa]
Length=314

 Score =   239 bits (611),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 124/161 (77%), Positives = 144/161 (89%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA  ++ F LNTGAKIPSVGLGTWQ++PG+VG AVEAA+K+GYRHIDCA+ YGNEKEIG 
Sbjct  1    MAEEIRFFELNTGAKIPSVGLGTWQSDPGLVGNAVEAAVKIGYRHIDCAQIYGNEKEIGL  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLKKLF DGVVKRE++FITSKLWCTDH P+DVPVALN+TL+DLQLDY+DLYLIHWPV +K
Sbjct  61   VLKKLFDDGVVKREEIFITSKLWCTDHDPQDVPVALNRTLQDLQLDYVDLYLIHWPVSLK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K S    PEN++P +IP TWKAMEAL+D+GKARAIGVSNFS
Sbjct  121  KGSTDLKPENILPTDIPNTWKAMEALFDAGKARAIGVSNFS  161



>pdb|3H7U|A Chain A, Crystal Structure Of The Plant Stress-Response Enzyme 
Akr4c9
Length=335

 Score =   240 bits (613),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 128/161 (80%), Positives = 141/161 (88%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA A+  F LNTGAK PSVGLGTWQA PG+VG AV AA+K+GYRHIDCA+ YGNEKEIG 
Sbjct  21   MANAITFFKLNTGAKFPSVGLGTWQASPGLVGDAVAAAVKIGYRHIDCAQIYGNEKEIGA  80

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLKKLF D VVKREDLFITSKLWCTDH P+DVP ALN+TLKDLQL+Y+DLYLIHWP  +K
Sbjct  81   VLKKLFEDRVVKREDLFITSKLWCTDHDPQDVPEALNRTLKDLQLEYVDLYLIHWPARIK  140

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K SVG  PENL+P +IP+TWKAMEALYDSGKARAIGVSNFS
Sbjct  141  KGSVGIKPENLLPVDIPSTWKAMEALYDSGKARAIGVSNFS  181



>ref|XP_011094911.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Sesamum 
indicum]
 ref|XP_011094912.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Sesamum 
indicum]
Length=315

 Score =   239 bits (611),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 128/161 (80%), Positives = 141/161 (88%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA  +K F LNTGAKIPSVGLGTWQAEPGVVGQ++EAA+K GYRHIDCA  YGNEKEIG 
Sbjct  1    MAKEIKYFELNTGAKIPSVGLGTWQAEPGVVGQSIEAAVKNGYRHIDCAPVYGNEKEIGV  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLKKLF + VVKREDLFITSKLWCTDHAPEDVPVAL +TL+DLQL Y+DLYLIHWPV  K
Sbjct  61   VLKKLFDEKVVKREDLFITSKLWCTDHAPEDVPVALGKTLEDLQLQYVDLYLIHWPVRFK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K + G  P+N++  +IPATWKAMEALYDSGKARAIGVSNFS
Sbjct  121  KGTTGIKPDNIVKPDIPATWKAMEALYDSGKARAIGVSNFS  161



>emb|CDY57141.1| BnaC04g53480D [Brassica napus]
Length=322

 Score =   240 bits (612),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 124/161 (77%), Positives = 145/161 (90%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA  ++ F LNTGAKIPSVGLGTWQ++PG+VG AVEAA+K+GYRHIDCA+ YGNEKEIG 
Sbjct  1    MAEEIRFFELNTGAKIPSVGLGTWQSDPGLVGNAVEAAVKIGYRHIDCAQIYGNEKEIGL  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLKKLF DGVVKRE++FITSKLWCTDH P+DVPVALN+TL+DLQLDY+DLYLIHWPV +K
Sbjct  61   VLKKLFDDGVVKREEIFITSKLWCTDHDPQDVPVALNRTLQDLQLDYVDLYLIHWPVSLK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K S  F PEN++P +IP TWKA+EAL+D+GKARAIGVSNFS
Sbjct  121  KGSTDFKPENILPTDIPNTWKAVEALFDAGKARAIGVSNFS  161



>gb|KFK36672.1| hypothetical protein AALP_AA4G154800 [Arabis alpina]
Length=314

 Score =   239 bits (610),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 126/161 (78%), Positives = 144/161 (89%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA  +K F LNTGAKIPSVGLGTWQ++PG+VG AVEAAIK+GYRHIDCA+ YGNEKEIG 
Sbjct  1    MADEIKFFELNTGAKIPSVGLGTWQSDPGLVGNAVEAAIKIGYRHIDCAQIYGNEKEIGL  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLKKLF DGVVKRE++FITSKLWCT H P+DV  ALN+TL+DLQLDY+DLYLIHWPV +K
Sbjct  61   VLKKLFDDGVVKREEMFITSKLWCTYHDPQDVAEALNRTLQDLQLDYVDLYLIHWPVSLK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K S GF PEN++P +IP+TWKAMEAL+DSGKARAIGVSNFS
Sbjct  121  KGSTGFKPENILPTDIPSTWKAMEALFDSGKARAIGVSNFS  161



>ref|XP_003516897.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Glycine 
max]
Length=315

 Score =   239 bits (610),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 129/161 (80%), Positives = 143/161 (89%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            M+  +  F LNTGAKIPSVGLGTWQ++PG+V QAV AAIKVGYRHIDCA+ YGNEKEIG 
Sbjct  1    MSNDIGFFDLNTGAKIPSVGLGTWQSDPGLVAQAVAAAIKVGYRHIDCAQIYGNEKEIGS  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            +LKKLF +GVVKREDL+ITSKLW TDHAPEDVP+AL++TLKDLQLDY+DLYLIHWP  MK
Sbjct  61   MLKKLFEEGVVKREDLWITSKLWNTDHAPEDVPLALDRTLKDLQLDYVDLYLIHWPTSMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K SVGF PENL+  NIP TWKAMEALYDSGKARAIGVSNFS
Sbjct  121  KGSVGFNPENLVQPNIPNTWKAMEALYDSGKARAIGVSNFS  161



>gb|KJB76793.1| hypothetical protein B456_012G107500 [Gossypium raimondii]
Length=221

 Score =   235 bits (600),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 128/161 (80%), Positives = 143/161 (89%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA A+K F LNTGAKIPSVGLGTWQ+EPG+VG AV AA+K+GYRHIDCA+ YGNEKEIG 
Sbjct  1    MANAIKFFELNTGAKIPSVGLGTWQSEPGLVGAAVAAAVKIGYRHIDCAQVYGNEKEIGV  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            V KKLF DGVVKRE+LFITSKLWCTDH+PEDVP AL +TL+DLQLDY+DLYLIHWPV MK
Sbjct  61   VFKKLFEDGVVKREELFITSKLWCTDHSPEDVPAALERTLRDLQLDYVDLYLIHWPVRMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K S GF PEN I  +IP+TW+AMEALYDSGKARA+GVSNFS
Sbjct  121  KGSAGFKPENFIQPDIPSTWRAMEALYDSGKARALGVSNFS  161



>ref|NP_001240076.1| uncharacterized protein LOC100781137 [Glycine max]
 gb|ACU18305.1| unknown [Glycine max]
 gb|KHN17833.1| Aldo-keto reductase family 4 member C9 [Glycine soja]
Length=315

 Score =   238 bits (607),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 127/161 (79%), Positives = 142/161 (88%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA  ++ F LNTGAKIPSVGLGTWQ++PG+V +AV AAIKVGYRHIDCA+ YGNEKEIG 
Sbjct  1    MAKDIRFFDLNTGAKIPSVGLGTWQSDPGLVAEAVAAAIKVGYRHIDCAQIYGNEKEIGS  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            +LK LF +GVVKREDL+ITSKLW TDHAPEDVP+AL++TLKDLQLDY+DLYLIHWP PMK
Sbjct  61   LLKNLFEEGVVKREDLWITSKLWNTDHAPEDVPLALDRTLKDLQLDYVDLYLIHWPAPMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K S GF PENL+  NIP TWKAMEALYDSGKAR IGVSNFS
Sbjct  121  KGSAGFKPENLVQPNIPNTWKAMEALYDSGKARTIGVSNFS  161



>ref|XP_009133205.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Brassica 
rapa]
Length=315

 Score =   238 bits (606),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 124/161 (77%), Positives = 139/161 (86%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA  +K F LNTGAKIPSVGLGTWQA PGVVG AV  A+K+GYRHIDCA+ Y NEKEIG 
Sbjct  1    MANPIKVFELNTGAKIPSVGLGTWQASPGVVGDAVTTAVKIGYRHIDCAQMYDNEKEIGA  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
             LKKLF + VVKRE+LFITSKLWCTDH P+DVP AL +TL++LQLDY+DLYL+HWPV MK
Sbjct  61   ALKKLFEEDVVKREELFITSKLWCTDHDPQDVPEALTRTLQNLQLDYVDLYLMHWPVRMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K SVG  PENL+P +IP+TWKAMEALYDSGKARAIGVSNFS
Sbjct  121  KGSVGLDPENLLPVDIPSTWKAMEALYDSGKARAIGVSNFS  161



>gb|KHN22181.1| Aldo-keto reductase family 4 member C9 [Glycine soja]
Length=315

 Score =   238 bits (606),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 128/161 (80%), Positives = 143/161 (89%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            M+  +  F LNTGAKIPSVGLGTWQ++PG+V +AV AAIKVGYRHIDCA+ YGNEKEIG 
Sbjct  1    MSNDIGFFDLNTGAKIPSVGLGTWQSDPGLVAEAVAAAIKVGYRHIDCAQIYGNEKEIGS  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            +LKKLF +GVVKREDL+ITSKLW TDHAPEDVP+AL++TLKDLQLDY+DLYLIHWP  MK
Sbjct  61   MLKKLFEEGVVKREDLWITSKLWNTDHAPEDVPLALDRTLKDLQLDYVDLYLIHWPTSMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K SVGF PENL+  NIP TWKAMEALYDSGKARAIGVSNFS
Sbjct  121  KGSVGFNPENLVQPNIPNTWKAMEALYDSGKARAIGVSNFS  161



>ref|XP_004253294.1| PREDICTED: aldo-keto reductase family 4 member C10, partial [Solanum 
lycopersicum]
Length=204

 Score =   234 bits (596),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 144/161 (89%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA  ++ F LNTGAKIPSVGLGTWQA+PG+VG AV+AA+K+GYRHIDCA+ YGNEKEIG 
Sbjct  1    MAEEIRFFELNTGAKIPSVGLGTWQADPGLVGNAVDAAVKIGYRHIDCAQIYGNEKEIGL  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLKKLF  GVVKRE++FITSKLWCT H P++VP ALN+TL+DLQLDY+DLYLIHWPV +K
Sbjct  61   VLKKLFDGGVVKREEMFITSKLWCTYHDPQEVPEALNRTLQDLQLDYVDLYLIHWPVSLK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K S GF PEN++P +IP+TWKAME+L+DSGKARAIGVSNFS
Sbjct  121  KGSTGFKPENILPTDIPSTWKAMESLFDSGKARAIGVSNFS  161



>ref|XP_010509278.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Camelina 
sativa]
Length=315

 Score =   238 bits (606),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 125/161 (78%), Positives = 142/161 (88%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA A+KCF LNTGAKIPSVGLGTWQ+ PG+VG AV AA+K+GYRHIDCA+ Y NEKEIG 
Sbjct  1    MANAIKCFELNTGAKIPSVGLGTWQSSPGLVGDAVAAAVKIGYRHIDCAKLYDNEKEIGA  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLKKLF D VVKRE+LFITSKLWC DH P+DVP ALN+TL+DLQLDY+DLYLIHWP+ +K
Sbjct  61   VLKKLFEDNVVKREELFITSKLWCNDHDPQDVPEALNKTLQDLQLDYVDLYLIHWPLRVK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K SVG   E+L+P +IP+TWKAMEALYDSGKARAIGVSNFS
Sbjct  121  KGSVGVKMEDLLPTDIPSTWKAMEALYDSGKARAIGVSNFS  161



>ref|XP_010517055.1| PREDICTED: aldo-keto reductase family 4 member C9-like isoform 
X1 [Camelina sativa]
Length=316

 Score =   237 bits (605),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 127/161 (79%), Positives = 140/161 (87%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA  VKCF LNTGAKIPSVGLGTWQA PG+VG AV AA+K+GYRH DCA+ YGNEK IG 
Sbjct  1    MANEVKCFELNTGAKIPSVGLGTWQASPGLVGNAVAAAVKIGYRHTDCAKLYGNEKVIGA  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLKKLF D VVK E+LFITSKLWCTDH P+DVP ALN+TL+DLQLDY+DLYLIHWPV +K
Sbjct  61   VLKKLFEDNVVKHEELFITSKLWCTDHDPKDVPEALNKTLQDLQLDYVDLYLIHWPVRVK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K SVG   ENL+P +IP+TWKAMEALYDSGKARAIGVSNFS
Sbjct  121  KGSVGLKMENLLPTDIPSTWKAMEALYDSGKARAIGVSNFS  161



>ref|XP_008387820.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Malus 
domestica]
 ref|XP_008387826.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Malus 
domestica]
Length=315

 Score =   237 bits (604),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 126/161 (78%), Positives = 142/161 (88%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA  +  F LNTGAKIPS+GLGTWQA PG+VG++V AAIK GYRHIDCA+ YGNEKEIG 
Sbjct  1    MADDIXFFELNTGAKIPSIGLGTWQASPGLVGESVHAAIKAGYRHIDCAQIYGNEKEIGL  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLKKLF DGVVKREDL+ITSKLW TDHAPEDVP AL++TL+DLQLDY+DLYL+HWPV MK
Sbjct  61   VLKKLFEDGVVKREDLWITSKLWNTDHAPEDVPEALDRTLRDLQLDYVDLYLMHWPVRMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K SVGF PEN+I  ++PATW+AME LYDSGKARAIGVSNFS
Sbjct  121  KGSVGFKPENIIDPDVPATWRAMETLYDSGKARAIGVSNFS  161



>gb|EPS58903.1| hypothetical protein M569_15909, partial [Genlisea aurea]
Length=320

 Score =   237 bits (604),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 123/157 (78%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = +2

Query  89   VKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGEVLKK  268
            ++ FVLNTGAK+PS+GLGTWQ+EPG+VG+AV+ AI+ GYRHIDCAR Y NEKEIG  L+K
Sbjct  1    IRFFVLNTGAKMPSIGLGTWQSEPGLVGKAVQVAIQSGYRHIDCARVYRNEKEIGLALRK  60

Query  269  LFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMKKDSV  448
            LF DGVVKREDLFITSKLW  DH+PEDVPVAL +TL DLQLDY+DLYLIHWPV MK++S 
Sbjct  61   LFEDGVVKREDLFITSKLWNDDHSPEDVPVALQKTLDDLQLDYVDLYLIHWPVRMKRNSG  120

Query  449  GFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            GF+PENLIP +IP TWKAMEALYDSGKA+AIGVSNFS
Sbjct  121  GFSPENLIPTDIPGTWKAMEALYDSGKAKAIGVSNFS  157



>ref|XP_004509601.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Cicer 
arietinum]
Length=315

 Score =   237 bits (604),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 126/161 (78%), Positives = 142/161 (88%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            M+  ++ F+LNTGAKIPSVGLGTWQ++PG+VGQAV AAIK GYRHIDCA+ YGNEKEIG 
Sbjct  1    MSNDIQFFILNTGAKIPSVGLGTWQSDPGLVGQAVAAAIKAGYRHIDCAQVYGNEKEIGS  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLKKLF +GVVKREDL+ITSKLW TDHAPEDVP+AL++TL DLQLDY+DLYLIHWP PMK
Sbjct  61   VLKKLFDEGVVKREDLWITSKLWNTDHAPEDVPLALDRTLADLQLDYVDLYLIHWPAPMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K S GF  ENL+  NI +TW AMEALYDSGKARAIGVSNFS
Sbjct  121  KGSAGFKVENLVQPNIASTWSAMEALYDSGKARAIGVSNFS  161



>ref|XP_002862967.1| hypothetical protein ARALYDRAFT_333154 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39226.1| hypothetical protein ARALYDRAFT_333154 [Arabidopsis lyrata subsp. 
lyrata]
Length=350

 Score =   238 bits (606),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 123/161 (76%), Positives = 145/161 (90%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA  ++ F LNTGAKIPSVGLGTWQA+PG+VG AV+AA+K+GYRHIDCA+ YGNEKEIG 
Sbjct  1    MAEEIRFFELNTGAKIPSVGLGTWQADPGLVGNAVDAAVKIGYRHIDCAQIYGNEKEIGL  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLKKLF DGVVKRE++FITSKLWCT H P++VP ALN+TL+DLQLDY+DLYLIHWPV +K
Sbjct  61   VLKKLFDDGVVKREEMFITSKLWCTYHDPQEVPEALNRTLQDLQLDYVDLYLIHWPVSLK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K S GF PEN++P +IP+TWKAMEAL+D+GKARAIGVSNFS
Sbjct  121  KGSTGFKPENILPTDIPSTWKAMEALFDAGKARAIGVSNFS  161



>ref|XP_010517053.1| PREDICTED: aldo-keto reductase family 4 member C10 isoform X3 
[Camelina sativa]
 ref|XP_010517054.1| PREDICTED: aldo-keto reductase family 4 member C10 isoform X4 
[Camelina sativa]
Length=314

 Score =   236 bits (603),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 123/161 (76%), Positives = 145/161 (90%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA  ++ F LNTGAKIPSVGLGTWQA+PG+VG AVEAA+K+GYRHIDCA+ YGNEKEIG 
Sbjct  1    MADEIRYFELNTGAKIPSVGLGTWQADPGLVGNAVEAAVKIGYRHIDCAQIYGNEKEIGL  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLKKLF DGVVKRE++FITSKLWCT H P++VP ALN+TL+DLQLDY+DLYLIHWPV +K
Sbjct  61   VLKKLFDDGVVKREEMFITSKLWCTCHDPQEVPEALNRTLQDLQLDYVDLYLIHWPVSLK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K S GF PEN++P +IP+TWKAME+L+D+GKARAIGVSNFS
Sbjct  121  KGSTGFKPENILPTDIPSTWKAMESLFDAGKARAIGVSNFS  161



>ref|XP_004302710.1| PREDICTED: aldo-keto reductase family 4 member C10-like [Fragaria 
vesca subsp. vesca]
Length=315

 Score =   236 bits (603),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 127/161 (79%), Positives = 141/161 (88%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA A++ F LNTGAKIP+VGLGTWQAEPGVVG AV AAIKVGYRHIDCA+ YGNEKEIG 
Sbjct  1    MAKAIRFFELNTGAKIPAVGLGTWQAEPGVVGDAVTAAIKVGYRHIDCAQIYGNEKEIGC  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
             LKKL+ DGVVKREDL+ITSKLWC+ HAPEDVP AL+ TL+DLQ DY+DLYLIHWPV MK
Sbjct  61   ALKKLYDDGVVKREDLWITSKLWCSKHAPEDVPKALDSTLQDLQTDYLDLYLIHWPVSMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K SVGF PENL   ++P+TWK MEALYDSGKA+AIGVSNFS
Sbjct  121  KGSVGFKPENLSQPDLPSTWKVMEALYDSGKAKAIGVSNFS  161



>ref|XP_007205595.1| hypothetical protein PRUPE_ppa008899mg [Prunus persica]
 gb|EMJ06794.1| hypothetical protein PRUPE_ppa008899mg [Prunus persica]
Length=315

 Score =   236 bits (603),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 127/161 (79%), Positives = 141/161 (88%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA  ++ F LNTGAKIPSVGLGTWQ+ PG+VG AV+AAIK GYRHIDCA+ Y NEKEIG 
Sbjct  1    MAYDIRFFELNTGAKIPSVGLGTWQSSPGLVGDAVDAAIKAGYRHIDCAQLYANEKEIGS  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLKKLF DGVVKREDL+ITSKLWCTDHAPEDVP AL++TL+DLQLD +DLYLIHWP  MK
Sbjct  61   VLKKLFEDGVVKREDLWITSKLWCTDHAPEDVPEALDRTLRDLQLDCVDLYLIHWPARMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K SVGF  ENLI  +IPATW+AME+LYDSGKARAIGVSNFS
Sbjct  121  KGSVGFKHENLIDPDIPATWRAMESLYDSGKARAIGVSNFS  161



>ref|XP_009358775.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Pyrus 
x bretschneideri]
Length=315

 Score =   236 bits (603),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 124/161 (77%), Positives = 140/161 (87%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA  ++ F LNTG+KIPSVGLGTWQ+ PG+VG AV AAIK GYRHIDCA+RYGNEKEIG 
Sbjct  1    MADDMRFFQLNTGSKIPSVGLGTWQSSPGLVGDAVAAAIKAGYRHIDCAQRYGNEKEIGL  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLKKLF DGVVKREDLFITSKLWCTDHAPEDV  A+++T +DLQLDY+DLYL+HWPV +K
Sbjct  61   VLKKLFEDGVVKREDLFITSKLWCTDHAPEDVLAAMDRTFRDLQLDYVDLYLMHWPVRLK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K S  F PENL+  +IP TW+AMEALYDSGKARAIGVSNFS
Sbjct  121  KGSASFDPENLVQPDIPCTWRAMEALYDSGKARAIGVSNFS  161



>gb|KFK36670.1| hypothetical protein AALP_AA4G154600 [Arabis alpina]
Length=315

 Score =   236 bits (602),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 124/161 (77%), Positives = 140/161 (87%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA A+K F LNTGAKIPSVGLGTWQ+ PG+VG AV  A+K+GYRHIDCA+ YGNEKEIG 
Sbjct  1    MANAIKFFELNTGAKIPSVGLGTWQSSPGLVGDAVATAVKIGYRHIDCAQIYGNEKEIGA  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLKKLF D VVKRE+LFITSKLWCTDH P+DVP AL +TL+DLQLDY+DLYL+HWP   K
Sbjct  61   VLKKLFEDSVVKREELFITSKLWCTDHDPQDVPEALKRTLQDLQLDYVDLYLMHWPARTK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K SVG  PENL+P +IP+TWKAMEAL+DSGKARAIGVSNFS
Sbjct  121  KGSVGIKPENLLPVDIPSTWKAMEALHDSGKARAIGVSNFS  161



>ref|XP_008350456.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Malus 
domestica]
Length=347

 Score =   237 bits (605),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 126/161 (78%), Positives = 142/161 (88%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA  +  F LNTGAKIPS+GLGTWQA PG+VG++V AAIK GYRHIDCA+ YGNEKEIG 
Sbjct  33   MADDIXFFELNTGAKIPSIGLGTWQASPGLVGESVHAAIKAGYRHIDCAQIYGNEKEIGL  92

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLKKLF DGVVKREDL+ITSKLW TDHAPEDVP AL++TL+DLQLDY+DLYL+HWPV MK
Sbjct  93   VLKKLFEDGVVKREDLWITSKLWNTDHAPEDVPEALDRTLRDLQLDYVDLYLMHWPVRMK  152

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K SVGF PEN+I  ++PATW+AME LYDSGKARAIGVSNFS
Sbjct  153  KGSVGFKPENIIDPDVPATWRAMETLYDSGKARAIGVSNFS  193



>emb|CDP17857.1| unnamed protein product [Coffea canephora]
Length=315

 Score =   236 bits (602),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 124/161 (77%), Positives = 143/161 (89%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA  +  F LNTGAKIP++GLGTWQA+PGVVGQAVE AIKVGYRHIDCAR Y NEKEIG 
Sbjct  1    MAKDIHFFELNTGAKIPAIGLGTWQADPGVVGQAVEIAIKVGYRHIDCARAYENEKEIGS  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLKK+  DG VKRE+LFITSKL  +DHAPEDVP AL+QTL+DLQLDY+DLYL+HWPV  +
Sbjct  61   VLKKILEDGAVKREELFITSKLRSSDHAPEDVPAALDQTLQDLQLDYVDLYLVHWPVRRR  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            KDSVGF PE+L+PA+IP+TW+AME+LY+SGKARAIGVSNFS
Sbjct  121  KDSVGFKPEDLLPADIPSTWRAMESLYNSGKARAIGVSNFS  161



>gb|EYU41764.1| hypothetical protein MIMGU_mgv1a010256mg [Erythranthe guttata]
Length=318

 Score =   236 bits (602),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 127/161 (79%), Positives = 139/161 (86%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA  +  F LNTGAKIPSVGLGTWQ+EPG+VGQAVEAAIK GYRHIDCAR Y NEKEIG 
Sbjct  1    MAHEILYFELNTGAKIPSVGLGTWQSEPGLVGQAVEAAIKNGYRHIDCARAYVNEKEIGS  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLKKLF DGVVKR+DLFITSKLWC DHAPEDV  AL++TL++LQL Y+DL+LIH P  MK
Sbjct  61   VLKKLFDDGVVKRDDLFITSKLWCADHAPEDVLAALDKTLEELQLGYVDLFLIHCPARMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K SVGF PEN I  +IP+TWKAMEALYDSGKARAIGVSNFS
Sbjct  121  KGSVGFKPENFIATDIPSTWKAMEALYDSGKARAIGVSNFS  161



>ref|XP_011094910.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Sesamum 
indicum]
Length=315

 Score =   235 bits (599),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 123/161 (76%), Positives = 143/161 (89%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            M+ A++ F LN GA+IPSVGLGTW+AEPGVVG A+ AAIK GYRHIDCA++Y NEKEIG+
Sbjct  1    MSKAIRFFELNNGARIPSVGLGTWKAEPGVVGDAITAAIKAGYRHIDCAQKYANEKEIGD  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
             LKKLF +G+VKREDL+ITSKLWC+DHAPEDVP+ALN+TL DLQLDYIDLYLIHWPV MK
Sbjct  61   ALKKLFENGIVKREDLWITSKLWCSDHAPEDVPLALNRTLNDLQLDYIDLYLIHWPVSMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K SVGF P+NL   +IP+TW+AMEAL D+GKARAIGVSNFS
Sbjct  121  KGSVGFEPQNLTKVDIPSTWRAMEALCDAGKARAIGVSNFS  161



>ref|XP_006294573.1| hypothetical protein CARUB_v10023609mg [Capsella rubella]
 gb|EOA27471.1| hypothetical protein CARUB_v10023609mg [Capsella rubella]
Length=328

 Score =   235 bits (600),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 125/161 (78%), Positives = 141/161 (88%), Gaps = 3/161 (2%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA  +KCF LNTGAKIPSVGLGTWQ+ PG+VG AV AA+K+GYRHIDCA+ Y NEKEIG 
Sbjct  16   MASPIKCFELNTGAKIPSVGLGTWQSSPGLVGDAVAAAVKIGYRHIDCAQLYANEKEIGA  75

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLKKLF D VVKRE+LFITSKLWCTDH P+DVP ALN+TL+DLQLDY+DLYL+HWPV MK
Sbjct  76   VLKKLFEDNVVKREELFITSKLWCTDHDPQDVPEALNKTLQDLQLDYVDLYLMHWPVRMK  135

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K +VG    NL+P +IP+TWKAMEALYDSGKARAIGVSNFS
Sbjct  136  KGAVGI---NLLPVDIPSTWKAMEALYDSGKARAIGVSNFS  173



>ref|XP_010038915.1| PREDICTED: aldo-keto reductase family 4 member C9-like isoform 
X2 [Eucalyptus grandis]
Length=281

 Score =   234 bits (596),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 141/161 (88%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA A++ F LNTGAKIPS+GLGTWQA+PGVV +AV  A K GYRHIDCA+ Y NEKEIG 
Sbjct  1    MAKAIRFFELNTGAKIPSIGLGTWQADPGVVAEAVTTATKAGYRHIDCAQAYYNEKEIGT  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
             L+KLF++GVVKREDL+ITSKLWCTDHAPEDVP A+++TL++LQL+Y+DLYLIHWPV MK
Sbjct  61   ALQKLFSEGVVKREDLWITSKLWCTDHAPEDVPKAIDRTLENLQLEYLDLYLIHWPVSMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K SVGF PENL   +IP+TWKAMEALY SGKARAIGVSNFS
Sbjct  121  KGSVGFKPENLTQPDIPSTWKAMEALYRSGKARAIGVSNFS  161



>ref|XP_006410971.1| hypothetical protein EUTSA_v10016967mg [Eutrema salsugineum]
 gb|ESQ52424.1| hypothetical protein EUTSA_v10016967mg [Eutrema salsugineum]
Length=314

 Score =   234 bits (598),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 124/161 (77%), Positives = 142/161 (88%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA  +  F LNTGAKIPSVGLGTWQA+PG+VG AVEAA+K+GYRHIDCA+ YGNEKEIG 
Sbjct  1    MAEEIGLFELNTGAKIPSVGLGTWQADPGLVGNAVEAAVKIGYRHIDCAQIYGNEKEIGL  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLKKLF DGVVKRE++FITSKLWCT H P+DVP AL +TL+DLQLDY+DLYLIHWPV +K
Sbjct  61   VLKKLFDDGVVKREEIFITSKLWCTYHDPQDVPEALYRTLQDLQLDYVDLYLIHWPVSLK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K S GF PEN++P +IP+TWKAMEAL+D GKARAIGVSNFS
Sbjct  121  KGSTGFKPENILPTDIPSTWKAMEALFDLGKARAIGVSNFS  161



>gb|KJB76792.1| hypothetical protein B456_012G107500 [Gossypium raimondii]
Length=310

 Score =   234 bits (598),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 128/161 (80%), Positives = 143/161 (89%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA A+K F LNTGAKIPSVGLGTWQ+EPG+VG AV AA+K+GYRHIDCA+ YGNEKEIG 
Sbjct  1    MANAIKFFELNTGAKIPSVGLGTWQSEPGLVGAAVAAAVKIGYRHIDCAQVYGNEKEIGV  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            V KKLF DGVVKRE+LFITSKLWCTDH+PEDVP AL +TL+DLQLDY+DLYLIHWPV MK
Sbjct  61   VFKKLFEDGVVKREELFITSKLWCTDHSPEDVPAALERTLRDLQLDYVDLYLIHWPVRMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K S GF PEN I  +IP+TW+AMEALYDSGKARA+GVSNFS
Sbjct  121  KGSAGFKPENFIQPDIPSTWRAMEALYDSGKARALGVSNFS  161



>gb|KJB76791.1| hypothetical protein B456_012G107500 [Gossypium raimondii]
Length=315

 Score =   234 bits (598),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 128/161 (80%), Positives = 143/161 (89%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA A+K F LNTGAKIPSVGLGTWQ+EPG+VG AV AA+K+GYRHIDCA+ YGNEKEIG 
Sbjct  1    MANAIKFFELNTGAKIPSVGLGTWQSEPGLVGAAVAAAVKIGYRHIDCAQVYGNEKEIGV  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            V KKLF DGVVKRE+LFITSKLWCTDH+PEDVP AL +TL+DLQLDY+DLYLIHWPV MK
Sbjct  61   VFKKLFEDGVVKREELFITSKLWCTDHSPEDVPAALERTLRDLQLDYVDLYLIHWPVRMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K S GF PEN I  +IP+TW+AMEALYDSGKARA+GVSNFS
Sbjct  121  KGSAGFKPENFIQPDIPSTWRAMEALYDSGKARALGVSNFS  161



>ref|NP_181315.2| aldo-keto reductase family 4 member C10 [Arabidopsis thaliana]
 sp|Q84TF0.1|AKRCA_ARATH RecName: Full=Aldo-keto reductase family 4 member C10 [Arabidopsis 
thaliana]
 gb|AAO64797.1| At2g37790 [Arabidopsis thaliana]
 dbj|BAE99364.1| putative alcohol dehydrogenase [Arabidopsis thaliana]
 gb|ABH07516.1| aldo-keto reductase [Arabidopsis thaliana]
 gb|AEC09451.1| aldo-keto reductase family 4 member C10 [Arabidopsis thaliana]
Length=314

 Score =   234 bits (596),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 144/161 (89%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA  ++ F LNTGAKIPSVGLGTWQA+PG+VG AV+AA+K+GYRHIDCA+ YGNEKEIG 
Sbjct  1    MAEEIRFFELNTGAKIPSVGLGTWQADPGLVGNAVDAAVKIGYRHIDCAQIYGNEKEIGL  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLKKLF  GVVKRE++FITSKLWCT H P++VP ALN+TL+DLQLDY+DLYLIHWPV +K
Sbjct  61   VLKKLFDGGVVKREEMFITSKLWCTYHDPQEVPEALNRTLQDLQLDYVDLYLIHWPVSLK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K S GF PEN++P +IP+TWKAME+L+DSGKARAIGVSNFS
Sbjct  121  KGSTGFKPENILPTDIPSTWKAMESLFDSGKARAIGVSNFS  161



>ref|XP_004166957.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Cucumis 
sativus]
Length=315

 Score =   233 bits (594),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 126/161 (78%), Positives = 140/161 (87%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA  +  F LNTGAKIPSVGLGTWQA  G+VG AV AA+K GYRHIDCA+ YGNEKEIG 
Sbjct  1    MASPISFFQLNTGAKIPSVGLGTWQAAEGLVGNAVAAAVKFGYRHIDCAQIYGNEKEIGS  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLKKLF DGVVKREDL+ITSKLWCTDHAPE+VP AL++TLKDLQLDY+DLYLIHWPV MK
Sbjct  61   VLKKLFEDGVVKREDLWITSKLWCTDHAPEEVPAALDRTLKDLQLDYLDLYLIHWPVRMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
              S GFAPEN +  +IP+TW+AMEAL+DSGKARAIGVSNFS
Sbjct  121  HGSTGFAPENFLAPDIPSTWRAMEALFDSGKARAIGVSNFS  161



>emb|CAC32834.1| aldose reductase [Digitalis purpurea]
Length=315

 Score =   233 bits (594),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 129/161 (80%), Positives = 138/161 (86%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA  ++ F LNTGAKIPSVGLGTWQ+ PG   QAVE AIK GYRHID AR Y NEKEIG 
Sbjct  1    MAEEIRFFKLNTGAKIPSVGLGTWQSSPGDAAQAVEVAIKCGYRHIDGARLYENEKEIGV  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLKKLF DGVVKREDLFITSKLW TDHAPEDVPVAL++TL+DLQLDYIDLYLIHWPV +K
Sbjct  61   VLKKLFDDGVVKREDLFITSKLWSTDHAPEDVPVALDKTLEDLQLDYIDLYLIHWPVRLK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K SVG  PEN IP +IP TWKAMEALYDSGKARAIGVSNF+
Sbjct  121  KGSVGLDPENFIPTDIPGTWKAMEALYDSGKARAIGVSNFT  161



>gb|KCW84681.1| hypothetical protein EUGRSUZ_B01498 [Eucalyptus grandis]
Length=289

 Score =   232 bits (591),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 124/161 (77%), Positives = 141/161 (88%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA A++ F LNTGAKIPSVGLGTWQA+PGVV  AV  AIKVGYRHIDCA+ Y NEKEIG 
Sbjct  1    MAKAIRFFELNTGAKIPSVGLGTWQADPGVVADAVTTAIKVGYRHIDCAQAYQNEKEIGT  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
             L+KLF++GVVKREDL+ITSKL CTDHAPEDVP AL++TL++LQL+Y+DLYLIHWPV M+
Sbjct  61   ALQKLFSEGVVKREDLWITSKLACTDHAPEDVPKALDRTLENLQLEYLDLYLIHWPVSMR  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K SVGF PENL   +IP+TWKAMEALY SGKARAIGVSNFS
Sbjct  121  KGSVGFKPENLTQPDIPSTWKAMEALYRSGKARAIGVSNFS  161



>ref|XP_011466525.1| PREDICTED: aldo-keto reductase family 4 member C9-like isoform 
X2 [Fragaria vesca subsp. vesca]
Length=315

 Score =   233 bits (593),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 123/161 (76%), Positives = 142/161 (88%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA  ++ F LNTGAKIPS+GLGTWQA PG+VG AV AAIK GYRHIDCA+RYGNEKEIG 
Sbjct  1    MADEIRFFELNTGAKIPSLGLGTWQASPGLVGDAVAAAIKAGYRHIDCAQRYGNEKEIGL  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLKKLF  GVVKRE+L+ITSKLWCTDHAPEDV VAL +TL+DLQLDY+DL+L+HWPV +K
Sbjct  61   VLKKLFEHGVVKREELWITSKLWCTDHAPEDVTVALEKTLRDLQLDYVDLHLMHWPVRLK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K SV F+PENL+  +IPATW+AME+L+D GKARAIGVSNFS
Sbjct  121  KGSVDFSPENLMQPDIPATWRAMESLFDLGKARAIGVSNFS  161



>emb|CDY57148.1| BnaC04g53540D [Brassica napus]
Length=600

 Score =   241 bits (614),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 127/161 (79%), Positives = 143/161 (89%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA A++ F LNTGAKIPSVGLGTWQA PG+VG AV AA+K+GYRHIDCA+ YGNEKEIG 
Sbjct  1    MANALRYFELNTGAKIPSVGLGTWQASPGLVGDAVAAAVKIGYRHIDCAQIYGNEKEIGT  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLKKLF D VVKRE+LFITSKLWCTDH P+DVP AL +TL+DLQLDY+DLYL+HWPV MK
Sbjct  61   VLKKLFEDNVVKREELFITSKLWCTDHDPQDVPEALKRTLQDLQLDYVDLYLMHWPVRMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K SVG  PENL+P +IP+TWKAMEAL+DSGKARAIGVSNFS
Sbjct  121  KGSVGAKPENLLPVDIPSTWKAMEALHDSGKARAIGVSNFS  161


 Score =   181 bits (459),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 97/121 (80%), Positives = 109/121 (90%), Gaps = 0/121 (0%)
 Frame = +2

Query  197  VGYRHIDCARRYGNEKEIGEVLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTl  376
            +GYRHIDCA+ YGNEKEIG VLKKLF D VVKRE+LFITSKLWCTDH P+DVP AL +TL
Sbjct  326  IGYRHIDCAQIYGNEKEIGTVLKKLFEDNVVKREELFITSKLWCTDHDPQDVPEALKRTL  385

Query  377  kdlqldyidlyliHWPVPMKKDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNF  556
            +DLQLDY+DLYL+HWPV MKK SVG  PENL+P +IP+TWKAMEAL+DSGKARAIGVSNF
Sbjct  386  QDLQLDYVDLYLMHWPVRMKKGSVGAKPENLLPVDIPSTWKAMEALHDSGKARAIGVSNF  445

Query  557  S  559
            S
Sbjct  446  S  446



>ref|XP_002272909.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Vitis 
vinifera]
Length=315

 Score =   233 bits (593),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 125/161 (78%), Positives = 142/161 (88%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            M+  ++ F LNTGAK+P VGLGTWQ++PG+VG+AV  AIKVGYRHIDCA+ YGNEKEIG 
Sbjct  1    MSDDIRFFELNTGAKMPYVGLGTWQSDPGLVGEAVAIAIKVGYRHIDCAQVYGNEKEIGI  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLKK+F DG+VKREDL+ITSKLWCTDH PEDVP ALN+TL+DLQLDYIDLYLIHWPV MK
Sbjct  61   VLKKMFEDGIVKREDLWITSKLWCTDHGPEDVPEALNRTLRDLQLDYIDLYLIHWPVRMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K SVGF PENL   +IP+TW+AMEAL DSGKARAIGVSNFS
Sbjct  121  KGSVGFKPENLTQPDIPSTWRAMEALCDSGKARAIGVSNFS  161



>ref|XP_010038908.1| PREDICTED: aldo-keto reductase family 4 member C9-like isoform 
X1 [Eucalyptus grandis]
 gb|KCW84684.1| hypothetical protein EUGRSUZ_B01501 [Eucalyptus grandis]
Length=315

 Score =   233 bits (593),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 141/161 (88%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA A++ F LNTGAKIPS+GLGTWQA+PGVV +AV  A K GYRHIDCA+ Y NEKEIG 
Sbjct  1    MAKAIRFFELNTGAKIPSIGLGTWQADPGVVAEAVTTATKAGYRHIDCAQAYYNEKEIGT  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
             L+KLF++GVVKREDL+ITSKLWCTDHAPEDVP A+++TL++LQL+Y+DLYLIHWPV MK
Sbjct  61   ALQKLFSEGVVKREDLWITSKLWCTDHAPEDVPKAIDRTLENLQLEYLDLYLIHWPVSMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K SVGF PENL   +IP+TWKAMEALY SGKARAIGVSNFS
Sbjct  121  KGSVGFKPENLTQPDIPSTWKAMEALYRSGKARAIGVSNFS  161



>ref|XP_010529793.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Tarenaya 
hassleriana]
Length=315

 Score =   233 bits (593),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 138/161 (86%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA  ++ F LN G KIPSVGLGTWQA PGV+G AV AA+K+GYRHIDCA+RYGNEKEIG 
Sbjct  1    MADEIRFFELNNGEKIPSVGLGTWQASPGVIGDAVAAAVKIGYRHIDCAQRYGNEKEIGS  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLKKLF DG  KR DLFITSKLW TD  P+DVP AL +TL+DLQLDY+DLYLIHWPV +K
Sbjct  61   VLKKLFEDGTAKRGDLFITSKLWLTDQDPQDVPEALARTLQDLQLDYVDLYLIHWPVKLK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K SV F+PENL+P +IP+TWKAMEALYDSG+ARAIGVSNFS
Sbjct  121  KGSVDFSPENLMPTDIPSTWKAMEALYDSGQARAIGVSNFS  161



>ref|XP_010529794.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Tarenaya 
hassleriana]
Length=363

 Score =   234 bits (597),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 125/161 (78%), Positives = 138/161 (86%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA  ++ F LNTG KIPSVGLGTWQA PG+VG AV AA+K+GYRHIDCAR YGNEKEIG 
Sbjct  49   MAKDIRFFELNTGTKIPSVGLGTWQAAPGLVGDAVTAAVKIGYRHIDCARIYGNEKEIGT  108

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
             LKKLF DGVVKRE+LFITSKLWCTDH P DVP A N TL+DLQLDY+DLYLIHWPV MK
Sbjct  109  ALKKLFEDGVVKREELFITSKLWCTDHDPRDVPEAFNSTLQDLQLDYVDLYLIHWPVRMK  168

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K SVG  PEN++PA+IP+TWK+MEALYDSGKA AIGV NFS
Sbjct  169  KGSVGVNPENILPADIPSTWKSMEALYDSGKAGAIGVCNFS  209



>emb|CAC32835.1| aldose reductase [Digitalis purpurea]
Length=315

 Score =   232 bits (592),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 128/161 (80%), Positives = 138/161 (86%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA  ++ F LNTGAKIPSVGLGTWQ+ PG   QAVE AIK GYRHID AR Y NEKEIG 
Sbjct  1    MAEEIRFFELNTGAKIPSVGLGTWQSSPGDAAQAVEVAIKCGYRHIDGARLYENEKEIGV  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLKKLF DGVVKREDLFITSKLW TDHAPEDVPVAL++TL+DLQLDYIDLYLIHWPV +K
Sbjct  61   VLKKLFDDGVVKREDLFITSKLWSTDHAPEDVPVALDKTLEDLQLDYIDLYLIHWPVRLK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K SVG  PEN +P +IP TWKAMEALYDSGKARAIGVSNF+
Sbjct  121  KGSVGLDPENFVPTDIPGTWKAMEALYDSGKARAIGVSNFT  161



>ref|XP_006429181.1| hypothetical protein CICLE_v10012243mg [Citrus clementina]
 ref|XP_006493581.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Citrus 
sinensis]
 gb|ESR42421.1| hypothetical protein CICLE_v10012243mg [Citrus clementina]
Length=315

 Score =   231 bits (590),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 125/161 (78%), Positives = 139/161 (86%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA  ++ FVLNTGAKIPSVGLGTWQ++PGVVG AV AAIK GYRHIDCA+ YGNEKEIG 
Sbjct  1    MANEIRHFVLNTGAKIPSVGLGTWQSDPGVVGNAVAAAIKAGYRHIDCAQIYGNEKEIGL  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLKK F D VVKREDL+ITSKLW   H PEDVP AL++TL+DLQ+DY+DLYL+HWPV MK
Sbjct  61   VLKKFFEDAVVKREDLWITSKLWNAYHEPEDVPEALDRTLRDLQIDYLDLYLMHWPVKMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K SVGF PENL   +IP+TWKAMEALYDSGKARAIGVSNFS
Sbjct  121  KGSVGFKPENLDKPDIPSTWKAMEALYDSGKARAIGVSNFS  161



>ref|XP_009358774.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Pyrus 
x bretschneideri]
Length=315

 Score =   231 bits (590),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 124/161 (77%), Positives = 140/161 (87%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA  ++ F LNTGAKIPS+GLGTWQA PG+VG AV  AIK GYRHIDCA+ YGNE+EIG 
Sbjct  1    MADDIRFFELNTGAKIPSIGLGTWQASPGLVGDAVHTAIKAGYRHIDCAQIYGNEEEIGL  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLKKLF DGVVKREDL+ITSKLW TDHAPEDV  AL++TL+DLQLDY+DLYL+HWPV MK
Sbjct  61   VLKKLFEDGVVKREDLWITSKLWNTDHAPEDVLEALDRTLRDLQLDYVDLYLVHWPVRMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K SVGF PEN+I  ++PATW+AME LYDSGKARAIGVSNFS
Sbjct  121  KGSVGFKPENVIDPDVPATWRAMETLYDSGKARAIGVSNFS  161



>gb|KDO48136.1| hypothetical protein CISIN_1g021241mg [Citrus sinensis]
Length=315

 Score =   231 bits (590),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 125/161 (78%), Positives = 139/161 (86%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA  ++ FVLNTGAKIPSVGLGTWQ++PGVVG AV AAIK GYRHIDCA+ YGNEKEIG 
Sbjct  1    MANEIRQFVLNTGAKIPSVGLGTWQSDPGVVGNAVAAAIKAGYRHIDCAQIYGNEKEIGL  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLKK F D VVKREDL+ITSKLW   H PEDVP AL++TL+DLQ+DY+DLYL+HWPV MK
Sbjct  61   VLKKFFEDAVVKREDLWITSKLWNAYHEPEDVPEALDRTLRDLQIDYLDLYLMHWPVKMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K SVGF PENL   +IP+TWKAMEALYDSGKARAIGVSNFS
Sbjct  121  KGSVGFKPENLDKPDIPSTWKAMEALYDSGKARAIGVSNFS  161



>ref|XP_006429178.1| hypothetical protein CICLE_v10012242mg [Citrus clementina]
 gb|ESR42418.1| hypothetical protein CICLE_v10012242mg [Citrus clementina]
Length=315

 Score =   231 bits (590),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 126/161 (78%), Positives = 139/161 (86%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA     F LNTGAK+PSVGLGTWQA+PGVVG AV+ AIK GYRHIDCAR Y NEKEIG 
Sbjct  1    MANENGYFELNTGAKMPSVGLGTWQADPGVVGNAVDVAIKAGYRHIDCARLYLNEKEIGF  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLKKLF DGVVKREDL+ITSKLWCTD AP+DVP AL+ TL+DLQ+DY+DLYLIHWP  MK
Sbjct  61   VLKKLFEDGVVKREDLWITSKLWCTDLAPKDVPEALDNTLQDLQIDYVDLYLIHWPARMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K SVGF PENL+P +IP+TW+AMEALYDSGKARAIGV NFS
Sbjct  121  KGSVGFNPENLLPLDIPSTWRAMEALYDSGKARAIGVCNFS  161



>ref|XP_009346418.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Pyrus 
x bretschneideri]
Length=315

 Score =   231 bits (589),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 125/161 (78%), Positives = 140/161 (87%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA  ++ F LNTGAKIPSVGLGTWQ+ PG+VG AV AA+K G RHIDCA+ YGNEKE+G 
Sbjct  1    MADDIRFFELNTGAKIPSVGLGTWQSSPGLVGDAVHAAVKAGCRHIDCAQFYGNEKEVGL  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLKKLF +GVVKREDL+ITSKLWCTDHAPEDVP AL++TL+DLQLDY+DLYLIHWPV MK
Sbjct  61   VLKKLFENGVVKREDLWITSKLWCTDHAPEDVPEALDRTLRDLQLDYVDLYLIHWPVRMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K SVGF PENL   +IPATW+AME LYDSGKARAIGV NFS
Sbjct  121  KGSVGFKPENLTDTDIPATWRAMETLYDSGKARAIGVCNFS  161



>gb|KDO48137.1| hypothetical protein CISIN_1g021264mg [Citrus sinensis]
Length=315

 Score =   231 bits (589),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 125/161 (78%), Positives = 139/161 (86%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA     F LNTGAK+PSVGLGTWQA+PG+VG AV+ AIK GYRHIDCAR Y NEKEIG 
Sbjct  1    MANENGYFELNTGAKMPSVGLGTWQADPGIVGNAVDVAIKAGYRHIDCARLYLNEKEIGF  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLKKLF DGVVKREDL+ITSKLWCTD AP+DVP AL+ TL+DLQ+DY+DLYLIHWP  MK
Sbjct  61   VLKKLFEDGVVKREDLWITSKLWCTDLAPKDVPEALDNTLQDLQIDYVDLYLIHWPARMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K SVGF PENL+P +IP+TW+AMEALYDSGKARAIGV NFS
Sbjct  121  KGSVGFNPENLLPLDIPSTWRAMEALYDSGKARAIGVCNFS  161



>ref|XP_010038899.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Eucalyptus 
grandis]
 gb|KCW84680.1| hypothetical protein EUGRSUZ_B01498 [Eucalyptus grandis]
Length=315

 Score =   231 bits (589),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 124/161 (77%), Positives = 141/161 (88%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA A++ F LNTGAKIPSVGLGTWQA+PGVV  AV  AIKVGYRHIDCA+ Y NEKEIG 
Sbjct  1    MAKAIRFFELNTGAKIPSVGLGTWQADPGVVADAVTTAIKVGYRHIDCAQAYQNEKEIGT  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
             L+KLF++GVVKREDL+ITSKL CTDHAPEDVP AL++TL++LQL+Y+DLYLIHWPV M+
Sbjct  61   ALQKLFSEGVVKREDLWITSKLACTDHAPEDVPKALDRTLENLQLEYLDLYLIHWPVSMR  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K SVGF PENL   +IP+TWKAMEALY SGKARAIGVSNFS
Sbjct  121  KGSVGFKPENLTQPDIPSTWKAMEALYRSGKARAIGVSNFS  161



>ref|XP_006493578.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Citrus 
sinensis]
Length=315

 Score =   231 bits (589),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 125/161 (78%), Positives = 139/161 (86%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA     F LNTGAK+PSVGLGTWQA+PG+VG AV+ AIK GYRHIDCAR Y NEKEIG 
Sbjct  1    MANENGYFELNTGAKMPSVGLGTWQADPGIVGNAVDVAIKAGYRHIDCARLYLNEKEIGF  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLKKLF DGVVKREDL+ITSKLWCTD AP+DVP AL+ TL+DLQ+DY+DLYLIHWP  MK
Sbjct  61   VLKKLFEDGVVKREDLWITSKLWCTDLAPKDVPEALDNTLQDLQIDYVDLYLIHWPARMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K SVGF PENL+P +IP+TW+AMEALYDSGKARAIGV NFS
Sbjct  121  KGSVGFNPENLLPLDIPSTWRAMEALYDSGKARAIGVCNFS  161



>ref|XP_010505374.1| PREDICTED: aldo-keto reductase family 4 member C10-like [Camelina 
sativa]
Length=314

 Score =   231 bits (589),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 119/161 (74%), Positives = 143/161 (89%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA  ++ F LNTGAKIPS+GLGTWQA+PG+VG AVEAA+K+GYRHIDCA+ YGNEKEIG 
Sbjct  1    MADEIRYFELNTGAKIPSIGLGTWQADPGLVGNAVEAAVKIGYRHIDCAQIYGNEKEIGL  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLKKLF DGVVKRE++FITSKLWCT H P++VP AL + L+DLQLDY+DLYLIHWPV +K
Sbjct  61   VLKKLFDDGVVKREEMFITSKLWCTCHDPQEVPEALKRALQDLQLDYVDLYLIHWPVSLK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K S GF PEN++P +IP+TWKAME+L+D+GKARA+GVSNFS
Sbjct  121  KGSTGFKPENILPTDIPSTWKAMESLFDTGKARAVGVSNFS  161



>gb|KJB76786.1| hypothetical protein B456_012G107200 [Gossypium raimondii]
Length=230

 Score =   228 bits (581),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 131/161 (81%), Positives = 142/161 (88%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA A++ F LNTGAKIPSVGLGTWQA PGVVG AV AAIK+GYRHIDCA+ Y NEKEIG 
Sbjct  4    MAQAIRYFELNTGAKIPSVGLGTWQASPGVVGAAVAAAIKIGYRHIDCAQAYDNEKEIGS  63

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLKKLF DGVV+REDL+ITSKLWCT+HAPEDVPVALN TL DLQLDY+DLYLIHWP  MK
Sbjct  64   VLKKLFQDGVVRREDLWITSKLWCTNHAPEDVPVALNNTLHDLQLDYLDLYLIHWPASMK  123

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K SVGF PENL   +IP+TWKA+EALYDSGKARAIGVSNFS
Sbjct  124  KGSVGFKPENLTKPDIPSTWKAIEALYDSGKARAIGVSNFS  164



>ref|XP_008448265.1| PREDICTED: LOW QUALITY PROTEIN: aldo-keto reductase family 4 
member C9-like [Cucumis melo]
Length=315

 Score =   231 bits (588),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 125/161 (78%), Positives = 139/161 (86%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            M   +  F LNTGAKIPSVGLGTWQA  G+VG AV AA+K GYRHIDCA+ YGNEKEIG 
Sbjct  1    MDSPISFFQLNTGAKIPSVGLGTWQAAEGLVGNAVAAAVKFGYRHIDCAQIYGNEKEIGS  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLKKLF DGVVKRED++ITSKLWCTDHAPE+VP AL++TLKDLQLDY+DLYLIHWPV MK
Sbjct  61   VLKKLFEDGVVKREDMWITSKLWCTDHAPEEVPAALDRTLKDLQLDYLDLYLIHWPVRMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
              S GFAPEN +  +IP+TWKAMEAL+DSGKARAIGVSNFS
Sbjct  121  HGSTGFAPENFLAPDIPSTWKAMEALFDSGKARAIGVSNFS  161



>ref|XP_004302706.1| PREDICTED: aldo-keto reductase family 4 member C9-like isoform 
X1 [Fragaria vesca subsp. vesca]
Length=315

 Score =   230 bits (587),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 121/161 (75%), Positives = 141/161 (88%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA  ++ F LNTGAKIPS+GLGTWQ+ PGVVG AV  A+K GYRHIDCA+RYGNEKEIG 
Sbjct  1    MAHEIQFFELNTGAKIPSLGLGTWQSSPGVVGDAVATAVKAGYRHIDCAQRYGNEKEIGL  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLKKLF  GVVKRE+L+ITSKLWCTDHAPEDV VAL +TL+DLQLDY+DL+L+HWPV +K
Sbjct  61   VLKKLFEHGVVKREELWITSKLWCTDHAPEDVTVALEKTLRDLQLDYVDLHLMHWPVRLK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K SV F+PENL+  +IPATW+AME+L+D GKARAIGVSNFS
Sbjct  121  KGSVDFSPENLMQPDIPATWRAMESLFDLGKARAIGVSNFS  161



>ref|XP_010509274.1| PREDICTED: aldo-keto reductase family 4 member C10-like [Camelina 
sativa]
Length=314

 Score =   230 bits (587),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 142/161 (88%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA  +  F LNTGAKIPSVGLGTWQA+PG+VG AVEAA+K+GYRHIDCA+ YGNEKEIG 
Sbjct  1    MADEIGYFELNTGAKIPSVGLGTWQADPGLVGNAVEAAVKIGYRHIDCAQIYGNEKEIGL  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLKKLF D VVKRE++FITSKLWCT H P++VP ALN+TL+DLQLDY+DLYLIHWPV +K
Sbjct  61   VLKKLFDDVVVKREEMFITSKLWCTCHDPQEVPNALNRTLQDLQLDYVDLYLIHWPVSLK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K S GF PEN++P +IP TWKAME+L+D+GKARAIGVSNFS
Sbjct  121  KGSTGFKPENILPTDIPNTWKAMESLFDAGKARAIGVSNFS  161



>ref|XP_007134074.1| hypothetical protein PHAVU_010G017400g [Phaseolus vulgaris]
 gb|ESW06068.1| hypothetical protein PHAVU_010G017400g [Phaseolus vulgaris]
Length=315

 Score =   230 bits (587),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 139/161 (86%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            M+  +  F LNTGAKIPS+ LGTWQ++PG+V QAV AAIK GYRHIDCA+ Y NEKEIG 
Sbjct  1    MSNDIPFFELNTGAKIPSIALGTWQSDPGLVSQAVAAAIKTGYRHIDCAQIYENEKEIGS  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            +LKKLF +GVVKREDL+ITSKLW TDHAPEDVP AL +TL+DLQLDY+DLYLIHWP PMK
Sbjct  61   MLKKLFEEGVVKREDLWITSKLWNTDHAPEDVPQALERTLRDLQLDYVDLYLIHWPTPMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K ++GF PENL+  NIP TWKAMEAL+DSGKARAIGVSNFS
Sbjct  121  KGTLGFNPENLVQPNIPNTWKAMEALFDSGKARAIGVSNFS  161



>ref|XP_007026918.1| NAD(P)-linked oxidoreductase superfamily protein [Theobroma cacao]
 gb|EOY07420.1| NAD(P)-linked oxidoreductase superfamily protein [Theobroma cacao]
Length=315

 Score =   229 bits (585),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 127/161 (79%), Positives = 146/161 (91%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA  ++ F LNTGAKIPSVGLGTWQ+EPG++G AV AA+K+GYRHIDCA+ YGNEKEIG 
Sbjct  1    MASEIRFFELNTGAKIPSVGLGTWQSEPGLLGAAVAAAVKIGYRHIDCAQIYGNEKEIGL  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLKKLF DGVVKRE+LFITSKLWCTDHAPEDVP AL++TL+DLQLDY+DLYLIHWP+ MK
Sbjct  61   VLKKLFEDGVVKREELFITSKLWCTDHAPEDVPAALDRTLQDLQLDYVDLYLIHWPIRMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K SVGF PENL+  +IP+TW+AMEALYDSGKARA+GVSNFS
Sbjct  121  KGSVGFKPENLLQPDIPSTWRAMEALYDSGKARALGVSNFS  161



>ref|XP_008387824.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Malus 
domestica]
Length=315

 Score =   229 bits (584),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 138/161 (86%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA  ++ F LNTG+KIPSVGLGTWQ+  G+VG AV AAIK GYRHIDCA+RYGNEKEIG 
Sbjct  1    MADDIRFFRLNTGSKIPSVGLGTWQSSXGLVGDAVAAAIKAGYRHIDCAQRYGNEKEIGL  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLKKLF DG VKREDLFITSKLW TDHAPEDV VA+++TL+DLQLDY+DLYL+HWPV +K
Sbjct  61   VLKKLFEDGXVKREDLFITSKLWSTDHAPEDVLVAMDRTLRDLQLDYVDLYLMHWPVRLK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K S  F PENL+  +IP TW+AME LYDSGKARAIGVSNFS
Sbjct  121  KGSASFDPENLVQPDIPCTWRAMETLYDSGKARAIGVSNFS  161



>gb|AAO42123.1| putative aldo/keto reductase [Arabidopsis thaliana]
Length=304

 Score =   229 bits (583),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 122/150 (81%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = +2

Query  110  TGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGEVLKKLFADGVV  289
            TGAK PSVGLGTWQA PG+VG AV AA+K+GYRHIDCA+ YGNEKEIG VLKKLF D VV
Sbjct  1    TGAKFPSVGLGTWQASPGLVGDAVAAAVKIGYRHIDCAQIYGNEKEIGAVLKKLFEDRVV  60

Query  290  KREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMKKDSVGFAPENL  469
            KREDLFITSKLWCTDH P+DVP ALN+TLKDLQL+Y+DLYLIHWP  +KK SVG  PENL
Sbjct  61   KREDLFITSKLWCTDHDPQDVPEALNRTLKDLQLEYVDLYLIHWPARIKKGSVGIKPENL  120

Query  470  IPANIPATWKAMEALYDSGKARAIGVSNFS  559
            +P +IP+TWKAMEALYDSGKARAIGVSNFS
Sbjct  121  LPVDIPSTWKAMEALYDSGKARAIGVSNFS  150



>ref|XP_004302708.2| PREDICTED: aldo-keto reductase family 4 member C9-like isoform 
X2 [Fragaria vesca subsp. vesca]
Length=315

 Score =   229 bits (583),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 140/161 (87%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA  ++ F LNTGAK+PS+GLGTWQ+ PG+VG+AV  AIK GYRHIDCA+ YGNEKEIG 
Sbjct  1    MANDIRFFELNTGAKMPSLGLGTWQSSPGLVGEAVATAIKAGYRHIDCAQAYGNEKEIGL  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VL+KLF DGVVKRE+L+ITSKLWCTDHAPEDV  AL++TL+DLQL+YIDLYLIHWPV MK
Sbjct  61   VLRKLFEDGVVKREELWITSKLWCTDHAPEDVLEALDRTLRDLQLEYIDLYLIHWPVRMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K SVGF PENL+  +IP TW+AME LYDS KARAIGVSNFS
Sbjct  121  KGSVGFKPENLVEPDIPGTWRAMETLYDSCKARAIGVSNFS  161



>ref|XP_008240395.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Prunus 
mume]
Length=315

 Score =   229 bits (583),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 124/161 (77%), Positives = 137/161 (85%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA  ++ F LNTGAKIPSVGLGTWQ+ PG+VG AV      GYRHIDCA+ Y NEKEIG 
Sbjct  1    MADDIRFFELNTGAKIPSVGLGTWQSSPGLVGDAVGXXXXAGYRHIDCAQLYANEKEIGS  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLKKLF DGVVKREDL+ITSKLWCTDHAPEDVP AL++TL+DLQLDY+DLYLIHWP  MK
Sbjct  61   VLKKLFEDGVVKREDLWITSKLWCTDHAPEDVPEALDRTLRDLQLDYVDLYLIHWPARMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K SVGF  ENLI  +IPATW+AME+LYDSGKARAIGVSNFS
Sbjct  121  KGSVGFKHENLIDPDIPATWRAMESLYDSGKARAIGVSNFS  161



>ref|XP_007134071.1| hypothetical protein PHAVU_010G017100g [Phaseolus vulgaris]
 gb|ESW06065.1| hypothetical protein PHAVU_010G017100g [Phaseolus vulgaris]
Length=313

 Score =   228 bits (582),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 123/161 (76%), Positives = 139/161 (86%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA  ++ F L TGAKIPSVGLGTWQAEPGVV +A+  AI+VGYRHIDCA+ Y N+ EIG 
Sbjct  1    MAKLIQFFELKTGAKIPSVGLGTWQAEPGVVAKAITTAIQVGYRHIDCAQAYNNQAEIGS  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
             LKK+F DGVVKREDL+ITSKLWCTDHAPEDVP AL++TL+DLQLDY+DLYLIHWPV MK
Sbjct  61   ALKKVFDDGVVKREDLWITSKLWCTDHAPEDVPKALDKTLQDLQLDYLDLYLIHWPVRMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
              SVGF  ENLI  +IP+TW+AMEALYDSGKARAIGVSNFS
Sbjct  121  SGSVGFKKENLIQPDIPSTWRAMEALYDSGKARAIGVSNFS  161



>dbj|BAG97587.1| unnamed protein product [Oryza sativa Japonica Group]
Length=326

 Score =   229 bits (583),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 140/164 (85%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   CVAMAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKE  247
            C+      +CFVLNTGAKIPSVGLGTWQAEPGVVG AV AA+K GYRHIDCA+ Y NEKE
Sbjct  9    CLQQNTMARCFVLNTGAKIPSVGLGTWQAEPGVVGNAVYAAVKAGYRHIDCAQAYFNEKE  68

Query  248  IGEVLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPV  427
            IG  LKK+F +G+VKRED+FITSKLWCT+HAPEDVPVAL+ TL+DLQ DY+DLYLIHWPV
Sbjct  69   IGVALKKVFDEGIVKREDIFITSKLWCTNHAPEDVPVALDSTLQDLQTDYVDLYLIHWPV  128

Query  428  PMKKDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
             MKK + GF  +N++P +IPATW AME L+DSGKARAIGVSNFS
Sbjct  129  RMKKGA-GFGGQNVLPTDIPATWAAMEKLHDSGKARAIGVSNFS  171



>ref|XP_004302704.1| PREDICTED: aldo-keto reductase family 4 member C9-like isoform 
X1 [Fragaria vesca subsp. vesca]
Length=315

 Score =   228 bits (581),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 121/161 (75%), Positives = 140/161 (87%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA  ++ F LNTGAK+PS+GLGTWQ+ PG+VG+AV  AIK GYRHIDCA+ YGNEKEIG 
Sbjct  1    MANDIRFFELNTGAKMPSLGLGTWQSSPGLVGEAVATAIKAGYRHIDCAQVYGNEKEIGL  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VL+KLF DGVVKRE+L+ITSKLWCTDHAPEDV  AL++TL+DLQL+YIDL+LIHWPV MK
Sbjct  61   VLRKLFEDGVVKREELWITSKLWCTDHAPEDVLEALDRTLRDLQLEYIDLFLIHWPVRMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K SVGF PENL+  +IP TW+AME LYDS KARAIGVSNFS
Sbjct  121  KGSVGFKPENLVEPDIPGTWRAMETLYDSCKARAIGVSNFS  161



>gb|EMT09404.1| Aldose reductase [Aegilops tauschii]
Length=309

 Score =   228 bits (580),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 120/154 (78%), Positives = 138/154 (90%), Gaps = 1/154 (1%)
 Frame = +2

Query  98   FVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGEVLKKLFA  277
            FVL+TGAKIPSVGLGTWQ+EPGVVG AV AA+K GYRHIDCA+ YGNEKEIG  LKK+F 
Sbjct  5    FVLSTGAKIPSVGLGTWQSEPGVVGDAVYAAVKAGYRHIDCAQVYGNEKEIGFALKKVFD  64

Query  278  DGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMKKDSVGFA  457
            +G+  R+DLFITSKLWCT+HAPEDVPVAL+ TL+DLQ DY+DLYL+HWP+ MKK + GF+
Sbjct  65   EGITSRQDLFITSKLWCTNHAPEDVPVALDGTLQDLQTDYVDLYLVHWPIRMKKGA-GFS  123

Query  458  PENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            PEN+IPA+IPATW AME LYDSGKARAIGVSNFS
Sbjct  124  PENVIPADIPATWAAMEGLYDSGKARAIGVSNFS  157



>ref|XP_008448277.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Cucumis 
melo]
Length=317

 Score =   228 bits (581),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 120/163 (74%), Positives = 137/163 (84%), Gaps = 0/163 (0%)
 Frame = +2

Query  71   VAMAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEI  250
            +A    +  F LNTGA IPS+GLGTWQA  G+VG AV AAIK+GYRHIDCAR YGNEKEI
Sbjct  1    MASESQISFFSLNTGANIPSIGLGTWQATEGLVGNAVAAAIKIGYRHIDCARDYGNEKEI  60

Query  251  GEVLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVP  430
            G VLK+LF +GVVKREDLFITSKLWCTDHAPEDVP AL++TL+DLQLDY+DLYLIHWP+ 
Sbjct  61   GSVLKQLFEEGVVKREDLFITSKLWCTDHAPEDVPAALDRTLEDLQLDYLDLYLIHWPIR  120

Query  431  MKKDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            +K  S G APEN +  +IP+TWKAME L+DSGKARAIGVSN S
Sbjct  121  LKHGSTGLAPENFLAPDIPSTWKAMEELFDSGKARAIGVSNLS  163



>ref|XP_011466526.1| PREDICTED: aldo-keto reductase family 4 member C9-like isoform 
X3 [Fragaria vesca subsp. vesca]
Length=315

 Score =   228 bits (580),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 140/161 (87%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA  ++ F LNTGAKIPS+GLGTWQA PG+VG AV AAIK GYRHIDCA  YGNEKEIG 
Sbjct  1    MADEIRFFELNTGAKIPSLGLGTWQASPGLVGDAVAAAIKAGYRHIDCAPVYGNEKEIGL  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLKKLF  GVVKRE+L+ITSKLWCTDHAPEDV VAL +TL+DLQLDY+DL+L+HWPV +K
Sbjct  61   VLKKLFEHGVVKREELWITSKLWCTDHAPEDVTVALEKTLRDLQLDYVDLHLMHWPVRLK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K SV F+PENL+  +IPATW+AME+L+D GKARAIGVSNFS
Sbjct  121  KGSVDFSPENLMQPDIPATWRAMESLFDLGKARAIGVSNFS  161



>ref|XP_007134066.1| hypothetical protein PHAVU_010G016600g [Phaseolus vulgaris]
 gb|ESW06060.1| hypothetical protein PHAVU_010G016600g [Phaseolus vulgaris]
Length=311

 Score =   227 bits (579),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 120/161 (75%), Positives = 138/161 (86%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            M   ++ F L TGAKIPS+GLGTWQAEPGVV +AV  AI+VGYRHIDCA+ Y N+ EIG 
Sbjct  1    MTNLIQSFELKTGAKIPSIGLGTWQAEPGVVAKAVTTAIQVGYRHIDCAQAYDNQAEIGS  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
             LKK+F DGVVKREDL+ITSKLWC+DHAPEDVP AL++TL+DLQLDY+DLYLIHWPV MK
Sbjct  61   ALKKVFEDGVVKREDLWITSKLWCSDHAPEDVPKALDKTLQDLQLDYLDLYLIHWPVRMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
              SVGF  ENLI  +IP+TW+AMEALYDSGKARA+GVSNFS
Sbjct  121  SGSVGFKKENLIQPDIPSTWRAMEALYDSGKARAVGVSNFS  161



>ref|XP_008240406.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Prunus 
mume]
Length=315

 Score =   228 bits (580),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 119/161 (74%), Positives = 138/161 (86%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA  +  F LNTGA+IPS+GLGTWQ+ PG+VG AV  A+K GYRHIDCA+RYGNEKEIG 
Sbjct  1    MADDIHSFELNTGARIPSLGLGTWQSSPGLVGDAVATAVKAGYRHIDCAQRYGNEKEIGL  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLKKLF DGV  REDL++TSKLWCT+HAPEDV  AL++TL+DLQLDY+DLYL+HWPV +K
Sbjct  61   VLKKLFEDGVANREDLWVTSKLWCTNHAPEDVLEALDRTLRDLQLDYVDLYLMHWPVRLK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K SV FAPENL+  +IP TW+AME LYDSGKARAIGVSNFS
Sbjct  121  KGSVSFAPENLVEPDIPCTWRAMETLYDSGKARAIGVSNFS  161



>ref|NP_001055731.2| Os05g0456300 [Oryza sativa Japonica Group]
 gb|AAU90220.1| putative aldose reductase [Oryza sativa Japonica Group]
 gb|EEC79338.1| hypothetical protein OsI_20197 [Oryza sativa Indica Group]
 gb|EEE63961.1| hypothetical protein OsJ_18786 [Oryza sativa Japonica Group]
 dbj|BAF17645.2| Os05g0456300 [Oryza sativa Japonica Group]
Length=312

 Score =   227 bits (579),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 121/156 (78%), Positives = 138/156 (88%), Gaps = 1/156 (1%)
 Frame = +2

Query  92   KCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGEVLKKL  271
            +CFVLNTGAKIPSVGLGTWQAEPGVVG AV AA+K GYRHIDCA+ Y NEKEIG  LKK+
Sbjct  3    RCFVLNTGAKIPSVGLGTWQAEPGVVGNAVYAAVKAGYRHIDCAQAYFNEKEIGVALKKV  62

Query  272  FADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMKKDSVG  451
            F +G+VKRED+FITSKLWCT+HAPEDVPVAL+ TL+DLQ DY+DLYLIHWPV MKK + G
Sbjct  63   FDEGIVKREDIFITSKLWCTNHAPEDVPVALDSTLQDLQTDYVDLYLIHWPVRMKKGA-G  121

Query  452  FAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            F  +N++P +IPATW AME L+DSGKARAIGVSNFS
Sbjct  122  FGGQNVLPTDIPATWAAMEKLHDSGKARAIGVSNFS  157



>gb|KJB76785.1| hypothetical protein B456_012G107200 [Gossypium raimondii]
Length=318

 Score =   228 bits (580),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 131/161 (81%), Positives = 142/161 (88%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA A++ F LNTGAKIPSVGLGTWQA PGVVG AV AAIK+GYRHIDCA+ Y NEKEIG 
Sbjct  4    MAQAIRYFELNTGAKIPSVGLGTWQASPGVVGAAVAAAIKIGYRHIDCAQAYDNEKEIGS  63

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLKKLF DGVV+REDL+ITSKLWCT+HAPEDVPVALN TL DLQLDY+DLYLIHWP  MK
Sbjct  64   VLKKLFQDGVVRREDLWITSKLWCTNHAPEDVPVALNNTLHDLQLDYLDLYLIHWPASMK  123

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K SVGF PENL   +IP+TWKA+EALYDSGKARAIGVSNFS
Sbjct  124  KGSVGFKPENLTKPDIPSTWKAIEALYDSGKARAIGVSNFS  164



>ref|XP_006410969.1| hypothetical protein EUTSA_v10017980mg [Eutrema salsugineum]
 gb|ESQ52422.1| hypothetical protein EUTSA_v10017980mg [Eutrema salsugineum]
Length=315

 Score =   227 bits (579),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 121/161 (75%), Positives = 138/161 (86%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA A++ F LNTGAKIPSVGLGTWQA PG+VG AV  A+K+GYRHIDCA+ YGNE EIG 
Sbjct  1    MANAMRFFELNTGAKIPSVGLGTWQASPGLVGDAVATAVKIGYRHIDCAQMYGNENEIGA  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLKKLF D VVKRE+LFITSKLWC DH P+DVP AL++TL+DLQLDY+DLYL+HWPV MK
Sbjct  61   VLKKLFEDSVVKREELFITSKLWCADHDPQDVPEALDRTLQDLQLDYLDLYLMHWPVRMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K SV    ENL+P +IP TWKAMEAL++SGKARAIGVSNFS
Sbjct  121  KGSVELNLENLLPVDIPRTWKAMEALHESGKARAIGVSNFS  161



>ref|XP_006403644.1| hypothetical protein EUTSA_v10010554mg [Eutrema salsugineum]
 gb|ESQ45097.1| hypothetical protein EUTSA_v10010554mg [Eutrema salsugineum]
Length=315

 Score =   227 bits (579),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 138/161 (86%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA  +  F LNTGAKIPSVGLGTWQA PG+VG AV AA+K+GY+HIDCA RYGNE EIG+
Sbjct  1    MANEIGYFELNTGAKIPSVGLGTWQAAPGIVGDAVAAAVKIGYQHIDCASRYGNEMEIGK  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLKKLF DGVVKRE LFITSK+W TD  P DV  ALN+TL+DLQLDY+DLYL+HWPV +K
Sbjct  61   VLKKLFEDGVVKREKLFITSKIWLTDLDPPDVQEALNRTLQDLQLDYVDLYLMHWPVRLK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K +V F PENL+P +IP+TWKAMEALYDSGKARAIGVSNFS
Sbjct  121  KGTVEFKPENLMPIDIPSTWKAMEALYDSGKARAIGVSNFS  161



>gb|KCW84679.1| hypothetical protein EUGRSUZ_B01497 [Eucalyptus grandis]
Length=315

 Score =   227 bits (579),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 120/161 (75%), Positives = 140/161 (87%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA A+  F LNTGAKIPSVGLGTWQ++PGVV  AV  A+KVGYRH+DCA+ Y NEKE+G 
Sbjct  1    MAKAICFFELNTGAKIPSVGLGTWQSDPGVVADAVITAVKVGYRHVDCAQIYNNEKEVGT  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
             L+KLF++GVVKREDL+ITSKLWC DHAPEDVP A+++TL++LQL+Y+DLYLIHWPV MK
Sbjct  61   ALQKLFSEGVVKREDLWITSKLWCNDHAPEDVPKAIDRTLENLQLEYLDLYLIHWPVSMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K SVGF PENL   +IP+TWKAMEALY SGKARAIGVSNFS
Sbjct  121  KGSVGFKPENLTQPDIPSTWKAMEALYRSGKARAIGVSNFS  161



>ref|XP_010088583.1| Aldo-keto reductase family 4 member C9 [Morus notabilis]
 gb|EXB36724.1| Aldo-keto reductase family 4 member C9 [Morus notabilis]
Length=280

 Score =   226 bits (576),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 124/161 (77%), Positives = 134/161 (83%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            M   +  F LNTGAKIPS+GLGTWQ+ PG+V  AV AAI VGYRHIDCA+ YGNEKEIG 
Sbjct  1    MGDDILYFELNTGAKIPSMGLGTWQSSPGLVADAVTAAITVGYRHIDCAQVYGNEKEIGS  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
             LKKLF DGVVKREDLFITSKLW TDHAPEDVP AL +TL DLQLDY+DLYLIHWPV MK
Sbjct  61   ALKKLFEDGVVKREDLFITSKLWNTDHAPEDVPKALERTLGDLQLDYVDLYLIHWPVRMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K SVGF PENL   +IP TW AMEALYD+GKA+AIGVSNFS
Sbjct  121  KGSVGFKPENLDQLDIPGTWSAMEALYDAGKAKAIGVSNFS  161



>ref|XP_002529871.1| aldo-keto reductase, putative [Ricinus communis]
 gb|EEF32521.1| aldo-keto reductase, putative [Ricinus communis]
Length=326

 Score =   227 bits (579),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 123/161 (76%), Positives = 138/161 (86%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA  ++ F LNTGAK+PSVGLGTWQAEPG+VG AV+AAIK+GYRHIDCA+ Y NEKEIG 
Sbjct  1    MANEIRFFELNTGAKMPSVGLGTWQAEPGLVGAAVDAAIKIGYRHIDCAQAYNNEKEIGS  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLKKLF DGVVKREDLFITSKLWC++H PEDV  AL  TL+DLQLDYIDLYLIHWPV MK
Sbjct  61   VLKKLFEDGVVKREDLFITSKLWCSNHDPEDVVKALEGTLQDLQLDYIDLYLIHWPVKMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K+SV   PEN    +IP TW+AMEALY+SGKARAIG+SNFS
Sbjct  121  KESVTLEPENFDQPDIPRTWRAMEALYNSGKARAIGLSNFS  161



>ref|XP_006340994.1| PREDICTED: aldo-keto reductase family 4 member C10-like [Solanum 
tuberosum]
Length=317

 Score =   226 bits (576),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 120/163 (74%), Positives = 139/163 (85%), Gaps = 0/163 (0%)
 Frame = +2

Query  71   VAMAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEI  250
            +A A  +  F LNTG  IP+VGLGTWQ++PGVVG+AVE AIK+GYRHIDCA+ Y NEKEI
Sbjct  1    MAEATEMPYFKLNTGFSIPAVGLGTWQSDPGVVGKAVETAIKMGYRHIDCAQIYKNEKEI  60

Query  251  GEVLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVP  430
            GEVL +LF DGVVKR+DLFITSKLW T+HAPEDVPV L++TLKDLQL+Y+DLYLIHWPV 
Sbjct  61   GEVLSRLFKDGVVKRQDLFITSKLWNTNHAPEDVPVTLDKTLKDLQLEYVDLYLIHWPVS  120

Query  431  MKKDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            MK  SV F PENL+P NIP+ W+AME +YDSGKAR IGVSNFS
Sbjct  121  MKPGSVDFKPENLMPTNIPSIWEAMEKVYDSGKARVIGVSNFS  163



>gb|KHG05402.1| Aldo-keto reductase family 4 member C9 [Gossypium arboreum]
Length=318

 Score =   226 bits (575),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 130/161 (81%), Positives = 142/161 (88%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA A++ F LNTGAKIPSVGLGTWQA PGVVG AV AAIK+GYRHIDCA+ Y NEKEIG 
Sbjct  4    MAQAIRYFELNTGAKIPSVGLGTWQASPGVVGAAVAAAIKIGYRHIDCAQAYDNEKEIGS  63

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLKKLF DGVV+REDL+ITSKLWCT+HAPEDVPVALN TL+DLQLDY+DLYLIHWP  MK
Sbjct  64   VLKKLFEDGVVRREDLWITSKLWCTNHAPEDVPVALNNTLQDLQLDYLDLYLIHWPASMK  123

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K SVGF PENL   +IP+TWKA+EALYDSGK RAIGVSNFS
Sbjct  124  KGSVGFKPENLTKPDIPSTWKAIEALYDSGKTRAIGVSNFS  164



>gb|ACJ84357.1| unknown [Medicago truncatula]
 gb|AFK33435.1| unknown [Medicago truncatula]
Length=219

 Score =   222 bits (566),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 125/161 (78%), Positives = 142/161 (88%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            M+  ++ F LNTGAKIPSVGLGTWQ++PG+V QAV AAIK GYRHIDCA+ YGNEKEIG 
Sbjct  1    MSNEIRFFSLNTGAKIPSVGLGTWQSDPGLVAQAVAAAIKAGYRHIDCAQVYGNEKEIGS  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            +LKKLFA+GVVKREDL+ITSKLW TDHAPEDVP+AL++TL DLQLDY+DLYLIHWP PMK
Sbjct  61   ILKKLFAEGVVKREDLWITSKLWNTDHAPEDVPLALDRTLTDLQLDYVDLYLIHWPAPMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K SVGF  ENL+  N+ +TWKAME LYDSGKARAIGVSNFS
Sbjct  121  KGSVGFKAENLVQPNLASTWKAMEVLYDSGKARAIGVSNFS  161



>ref|XP_010262633.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Nelumbo 
nucifera]
Length=315

 Score =   225 bits (574),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 123/161 (76%), Positives = 138/161 (86%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            M   ++ F LNTGAKIPS+GLGTWQAEPG+VG AV AAIK GY HIDCA+ YGNEKEIG 
Sbjct  1    MVTEIRYFELNTGAKIPSLGLGTWQAEPGLVGDAVAAAIKAGYGHIDCAQIYGNEKEIGL  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VL KLF DG+VKREDL+ITSKLWCTDHAPEDV  AL++TL+DLQLDY+DLYLIHWPV MK
Sbjct  61   VLTKLFKDGIVKREDLWITSKLWCTDHAPEDVLKALDRTLQDLQLDYVDLYLIHWPVRMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K S+GF  EN+I  +IP TW+AMEALYDS KARAIGVSNFS
Sbjct  121  KGSIGFNVENVIEPDIPNTWRAMEALYDSRKARAIGVSNFS  161



>gb|KGN54282.1| hypothetical protein Csa_4G296840 [Cucumis sativus]
Length=291

 Score =   224 bits (572),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 120/163 (74%), Positives = 136/163 (83%), Gaps = 0/163 (0%)
 Frame = +2

Query  71   VAMAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEI  250
            +A    +  F LNT AKIPSVGLGTWQA  G+VG AV AAIK+GYRHIDCAR YGNEKEI
Sbjct  1    MASESQISFFTLNTAAKIPSVGLGTWQAAEGLVGNAVAAAIKIGYRHIDCARDYGNEKEI  60

Query  251  GEVLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVP  430
            G VLK+LF +GVVKREDL+ITSKLWC+DHAPEDVP AL++TL+DLQLDY+DLYLIHWPV 
Sbjct  61   GSVLKQLFEEGVVKREDLWITSKLWCSDHAPEDVPAALDRTLEDLQLDYLDLYLIHWPVR  120

Query  431  MKKDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            +K  S   APEN +  +IP+TWKAME LYDSGKARAIGVSN S
Sbjct  121  LKHGSTDLAPENFVAPDIPSTWKAMEELYDSGKARAIGVSNLS  163



>ref|XP_007205596.1| hypothetical protein PRUPE_ppa008905mg [Prunus persica]
 gb|EMJ06795.1| hypothetical protein PRUPE_ppa008905mg [Prunus persica]
Length=315

 Score =   225 bits (574),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 124/161 (77%), Positives = 136/161 (84%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA A++ F LNTGAKIPS+GLGTWQAEPGVV  AV  AIKVGYRHIDCA+ YGNEKEIG 
Sbjct  1    MAKAIRFFELNTGAKIPSLGLGTWQAEPGVVAAAVTTAIKVGYRHIDCAQAYGNEKEIGF  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
             LKKL+ DGVVKREDL+ITSKLWC +H PEDVP AL+ TL+DLQLDY+DLYLIHWPV MK
Sbjct  61   ALKKLYDDGVVKREDLWITSKLWCNNHEPEDVPKALDSTLQDLQLDYLDLYLIHWPVKMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K S GF  ENL   +I +TWKAMEALYDS KARAIGVSNFS
Sbjct  121  KGSTGFKTENLARPDIASTWKAMEALYDSRKARAIGVSNFS  161



>emb|CBI30495.3| unnamed protein product [Vitis vinifera]
Length=275

 Score =   224 bits (570),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 121/146 (83%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = +2

Query  122  IPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGEVLKKLFADGVVKRED  301
            +PSVGLGTWQ++PG+VGQAV  AIKVGYRHIDCA+ YGNE+EIG VLKKLF DGVVKRED
Sbjct  1    MPSVGLGTWQSDPGLVGQAVAIAIKVGYRHIDCAQVYGNEEEIGIVLKKLFDDGVVKRED  60

Query  302  LFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMKKDSVGFAPENLIPAN  481
            L+ITSKLWCTDHAPEDVP ALN+TLKDLQLDY+DLYLIHWP+ MKK SVGF PENL   +
Sbjct  61   LWITSKLWCTDHAPEDVPEALNRTLKDLQLDYVDLYLIHWPMSMKKGSVGFKPENLAQPD  120

Query  482  IPATWKAMEALYDSGKARAIGVSNFS  559
            IP+TW+AMEALYDSGKARAIGVSNFS
Sbjct  121  IPSTWRAMEALYDSGKARAIGVSNFS  146



>ref|XP_004166956.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Cucumis 
sativus]
Length=317

 Score =   225 bits (573),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 120/163 (74%), Positives = 136/163 (83%), Gaps = 0/163 (0%)
 Frame = +2

Query  71   VAMAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEI  250
            +A    +  F LNT AKIPSVGLGTWQA  G+VG AV AAIK+GYRHIDCAR YGNEKEI
Sbjct  1    MASESQISFFTLNTAAKIPSVGLGTWQAAEGLVGNAVAAAIKIGYRHIDCARDYGNEKEI  60

Query  251  GEVLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVP  430
            G VLK+LF +GVVKREDL+ITSKLWC+DHAPEDVP AL++TL+DLQLDY+DLYLIHWPV 
Sbjct  61   GSVLKQLFEEGVVKREDLWITSKLWCSDHAPEDVPAALDRTLEDLQLDYLDLYLIHWPVR  120

Query  431  MKKDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            +K  S   APEN +  +IP+TWKAME LYDSGKARAIGVSN S
Sbjct  121  LKHGSTDLAPENFVAPDIPSTWKAMEELYDSGKARAIGVSNLS  163



>ref|XP_004142054.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Cucumis 
sativus]
Length=317

 Score =   225 bits (573),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 120/163 (74%), Positives = 136/163 (83%), Gaps = 0/163 (0%)
 Frame = +2

Query  71   VAMAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEI  250
            +A    +  F LNT AKIPSVGLGTWQA  G+VG AV AAIK+GYRHIDCAR YGNEKEI
Sbjct  1    MASESQISFFTLNTAAKIPSVGLGTWQAAEGLVGNAVAAAIKIGYRHIDCARDYGNEKEI  60

Query  251  GEVLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVP  430
            G VLK+LF +GVVKREDL+ITSKLWC+DHAPEDVP AL++TL+DLQLDY+DLYLIHWPV 
Sbjct  61   GSVLKQLFEEGVVKREDLWITSKLWCSDHAPEDVPAALDRTLEDLQLDYLDLYLIHWPVR  120

Query  431  MKKDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            +K  S   APEN +  +IP+TWKAME LYDSGKARAIGVSN S
Sbjct  121  LKHGSTDLAPENFVAPDIPSTWKAMEELYDSGKARAIGVSNLS  163



>gb|AFK44784.1| unknown [Medicago truncatula]
 gb|KEH20251.1| aldo/keto reductase family oxidoreductase [Medicago truncatula]
Length=315

 Score =   224 bits (572),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 126/161 (78%), Positives = 143/161 (89%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            M+  ++ F LNTGAKIPSVGLGTWQ++PG+V QAV AAIK GYRHIDCA+ YGNEKEIG 
Sbjct  1    MSNEIRFFSLNTGAKIPSVGLGTWQSDPGLVAQAVAAAIKAGYRHIDCAQVYGNEKEIGS  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            +LKKLFA+GVVKREDL+ITSKLW TDHAPEDVP+AL++TL DLQLDY+DLYLIHWP PMK
Sbjct  61   ILKKLFAEGVVKREDLWITSKLWNTDHAPEDVPLALDRTLTDLQLDYVDLYLIHWPAPMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K SVGF  ENL+  N+ +TWKAMEALYDSGKARAIGVSNFS
Sbjct  121  KGSVGFKAENLVQPNLASTWKAMEALYDSGKARAIGVSNFS  161



>ref|XP_010517051.1| PREDICTED: aldo-keto reductase family 4 member C9 isoform X1 
[Camelina sativa]
Length=315

 Score =   224 bits (572),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 129/161 (80%), Positives = 143/161 (89%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA A+KCF LNTGAKIPSVGLGTWQ+ PGVVG AV AA+K GYRHIDCA+ YGNEKEIG 
Sbjct  1    MANAIKCFELNTGAKIPSVGLGTWQSSPGVVGDAVAAAVKNGYRHIDCAKLYGNEKEIGA  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLKKLF D VVKRE+LFITSKLWCTDH P+DVP ALN+TL+DLQLDY+DLYLIHWPV +K
Sbjct  61   VLKKLFEDNVVKREELFITSKLWCTDHDPQDVPEALNKTLQDLQLDYVDLYLIHWPVRVK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K SVG   E+L+P +IP+TWKAMEALYDSGKARAIGVSNFS
Sbjct  121  KGSVGLKMEDLLPTDIPSTWKAMEALYDSGKARAIGVSNFS  161



>ref|XP_010517052.1| PREDICTED: aldo-keto reductase family 4 member C9 isoform X2 
[Camelina sativa]
Length=314

 Score =   224 bits (571),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 129/161 (80%), Positives = 143/161 (89%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA A+KCF LNTGAKIPSVGLGTWQ+ PGVVG AV AA+K GYRHIDCA+ YGNEKEIG 
Sbjct  1    MANAIKCFELNTGAKIPSVGLGTWQSSPGVVGDAVAAAVKNGYRHIDCAKLYGNEKEIGA  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLKKLF D VVKRE+LFITSKLWCTDH P+DVP ALN+TL+DLQLDY+DLYLIHWPV +K
Sbjct  61   VLKKLFEDNVVKREELFITSKLWCTDHDPQDVPEALNKTLQDLQLDYVDLYLIHWPVRVK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K SVG   E+L+P +IP+TWKAMEALYDSGKARAIGVSNFS
Sbjct  121  KGSVGLKMEDLLPTDIPSTWKAMEALYDSGKARAIGVSNFS  161



>ref|XP_003520967.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Glycine 
max]
Length=313

 Score =   224 bits (571),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 137/161 (85%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA  +K F LNTGAKIPSVGLGTWQAEPGVV +AV  AI+VGYRHIDCA+ Y N+ EIG 
Sbjct  1    MAKLIKFFELNTGAKIPSVGLGTWQAEPGVVAKAVTIAIQVGYRHIDCAQAYNNQAEIGS  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
             LKKLF +GVVKREDL+ITSKLWC+DH PEDVP AL++TL+DL+LDY+DLYLIHWPV MK
Sbjct  61   ALKKLFDEGVVKREDLWITSKLWCSDHVPEDVPKALDKTLQDLKLDYLDLYLIHWPVRMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
              SVGF  E L   +IP+TWKAMEALYDSGKARAIGVSNFS
Sbjct  121  SGSVGFKKEYLDQPDIPSTWKAMEALYDSGKARAIGVSNFS  161



>gb|KJB76789.1| hypothetical protein B456_012G107300 [Gossypium raimondii]
Length=217

 Score =   221 bits (562),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 122/163 (75%), Positives = 138/163 (85%), Gaps = 0/163 (0%)
 Frame = +2

Query  71   VAMAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEI  250
            V MA A++ F LNTGAKIPSVGLGTWQA PGVVG AV  AIK GYRHIDCA+ YGNEKEI
Sbjct  7    VKMAAAIRYFDLNTGAKIPSVGLGTWQAAPGVVGNAVATAIKHGYRHIDCAQVYGNEKEI  66

Query  251  GEVLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVP  430
            G VLKKL  DGVVKRE+L+ITSKLW T+HAPEDVP ALN TL+DLQLDY+DLYL+HWP+ 
Sbjct  67   GLVLKKLSEDGVVKREELWITSKLWNTNHAPEDVPEALNGTLQDLQLDYVDLYLMHWPIS  126

Query  431  MKKDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            M K +VGF  ++L   +I +TW+AMEALYDSGKARAIGVSNFS
Sbjct  127  MIKGAVGFEQKDLTQPDITSTWRAMEALYDSGKARAIGVSNFS  169



>ref|XP_011012443.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Populus 
euphratica]
 ref|XP_011012444.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Populus 
euphratica]
Length=318

 Score =   224 bits (570),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 136/161 (84%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA A+  F LNTGAKIPSVGLGTW+A+PG V  AV AAIK GYRHIDCAR Y NEKE+G 
Sbjct  1    MAKAIPFFELNTGAKIPSVGLGTWRADPGAVADAVTAAIKAGYRHIDCARLYRNEKEVGC  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
             LK LF +GVVKR +++ITSKLWCTDHAPEDVP +L +TL+DLQLDY+DLYLIHWPV MK
Sbjct  61   ALKNLFDNGVVKRGEVWITSKLWCTDHAPEDVPESLEKTLQDLQLDYVDLYLIHWPVSMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K S G+ PENL   NIPATW+AMEALYDSGKARAIGVSNFS
Sbjct  121  KGSEGYKPENLTETNIPATWRAMEALYDSGKARAIGVSNFS  161



>gb|KHN43834.1| Aldo-keto reductase family 4 member C9 [Glycine soja]
Length=312

 Score =   223 bits (569),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 124/161 (77%), Positives = 136/161 (84%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA  +K F LNTGAKIPSVGLGTWQAEPGVV +AV  AI VGYRHIDCA+ Y N+ EIG 
Sbjct  1    MAKLIKFFELNTGAKIPSVGLGTWQAEPGVVAKAVTTAILVGYRHIDCAQAYNNQAEIGS  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
             LKKLF DGVVKREDL+ITSKLWC+DHA EDVP AL++TL+DLQLDY+DLYLIHWPV MK
Sbjct  61   ALKKLFDDGVVKREDLWITSKLWCSDHASEDVPKALDKTLQDLQLDYLDLYLIHWPVRMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
              SVGF  E L   +IP+TWKAMEALYDSGKARAIGVSNFS
Sbjct  121  SGSVGFKKEYLDQPDIPSTWKAMEALYDSGKARAIGVSNFS  161



>ref|XP_004172647.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Cucumis 
sativus]
Length=316

 Score =   224 bits (570),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 118/161 (73%), Positives = 137/161 (85%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA  +  F LNTGA IPS+GLGTWQA  G++  A+ AA+K+GYRHIDC+  YGNEKEIG 
Sbjct  1    MASQISSFPLNTGANIPSLGLGTWQATEGLLTNAISAALKIGYRHIDCSPVYGNEKEIGS  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLKKLF +GVVKREDL+ITSKLWCTDHAPEDVP AL++TLK LQLDY+DLYLIHWPV MK
Sbjct  61   VLKKLFEEGVVKREDLWITSKLWCTDHAPEDVPKALDRTLKILQLDYLDLYLIHWPVRMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
              S  FAPENL+  +IP+TW+AMEAL+DSGKARAIGVSNF+
Sbjct  121  HGSTDFAPENLVTPDIPSTWRAMEALFDSGKARAIGVSNFT  161



>ref|XP_003516896.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Glycine 
max]
Length=313

 Score =   223 bits (569),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 124/161 (77%), Positives = 136/161 (84%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA  +K F LNTGAKIPSVGLGTWQAEPGVV +AV  AI VGYRHIDCA+ Y N+ EIG 
Sbjct  1    MAKLIKFFELNTGAKIPSVGLGTWQAEPGVVAKAVTTAILVGYRHIDCAQAYNNQAEIGS  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
             LKKLF DGVVKREDL+ITSKLWC+DHA EDVP AL++TL+DLQLDY+DLYLIHWPV MK
Sbjct  61   ALKKLFDDGVVKREDLWITSKLWCSDHASEDVPKALDKTLQDLQLDYLDLYLIHWPVRMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
              SVGF  E L   +IP+TWKAMEALYDSGKARAIGVSNFS
Sbjct  121  SGSVGFKKEYLDQPDIPSTWKAMEALYDSGKARAIGVSNFS  161



>ref|XP_009358771.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Pyrus 
x bretschneideri]
Length=316

 Score =   223 bits (569),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 123/162 (76%), Positives = 138/162 (85%), Gaps = 1/162 (1%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA  ++ F LNTGAKIPS+GLGTWQ+ PGVVG AV AA+K GYRHIDCA+ YGNEKEIG 
Sbjct  1    MADDIRFFELNTGAKIPSIGLGTWQSSPGVVGDAVHAAVKAGYRHIDCAQIYGNEKEIGL  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLKKLF +GVVKREDL+ITSKLW TDHAPEDVP AL++TL+DLQLDY+DLYLIHWP+ MK
Sbjct  61   VLKKLFEEGVVKREDLWITSKLWNTDHAPEDVPEALDRTLRDLQLDYVDLYLIHWPIRMK  120

Query  437  K-DSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K  S  F  EN I  +IPATW+AME LYDSGKARAIGVSNFS
Sbjct  121  KGSSASFNLENFIDPDIPATWRAMETLYDSGKARAIGVSNFS  162



>ref|XP_004142055.1| PREDICTED: aldo-keto reductase family 4 member C10-like [Cucumis 
sativus]
Length=318

 Score =   223 bits (568),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 116/161 (72%), Positives = 138/161 (86%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA  +  F LNTGA IPS+GLGTWQA   ++  A+ AA+K+GYRHIDCA+ YGNEKEIG 
Sbjct  1    MASQISFFPLNTGANIPSLGLGTWQATGDLLTNAIAAALKIGYRHIDCAQLYGNEKEIGS  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLKKLF +G+VKREDL+ITSKLWCTDHAPEDVP AL++TLK+LQLDY+DLYL+HWPV MK
Sbjct  61   VLKKLFEEGIVKREDLWITSKLWCTDHAPEDVPKALDRTLKNLQLDYLDLYLMHWPVRMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
              S GFAPEN +  +IP+TW+AMEAL+DSGKARAIGVSNF+
Sbjct  121  HGSTGFAPENFVTPDIPSTWRAMEALFDSGKARAIGVSNFT  161



>gb|KGN54281.1| hypothetical protein Csa_4G296830 [Cucumis sativus]
Length=296

 Score =   223 bits (567),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 118/161 (73%), Positives = 138/161 (86%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA  +  F LNTGA IPS+GLGTWQA   ++  A+ AA+K+GYRHIDCA+ YGNEKEIG 
Sbjct  1    MASQISFFPLNTGANIPSLGLGTWQATGDLLTNAIAAALKIGYRHIDCAQLYGNEKEIGS  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLKKLF +G+VKREDL+ITSKLWCTDHAPE+VP AL++TLKDLQLDY+DLYLIHWPV MK
Sbjct  61   VLKKLFEEGIVKREDLWITSKLWCTDHAPEEVPAALDRTLKDLQLDYLDLYLIHWPVRMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
              S GFAPEN +  +IP+TW+AMEAL+DSGKARAIGVSNFS
Sbjct  121  HGSTGFAPENFLAPDIPSTWRAMEALFDSGKARAIGVSNFS  161



>ref|XP_007134069.1| hypothetical protein PHAVU_010G016900g [Phaseolus vulgaris]
 gb|ESW06063.1| hypothetical protein PHAVU_010G016900g [Phaseolus vulgaris]
Length=313

 Score =   223 bits (568),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 120/161 (75%), Positives = 137/161 (85%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            M   ++ F LNTGAKIPS+GLGTWQAEPGVV +A+  AI+VGYRHIDCA+ Y N+ EIG 
Sbjct  1    MGKLIQFFELNTGAKIPSIGLGTWQAEPGVVVKAITTAIQVGYRHIDCAQFYDNQAEIGS  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
             LKK+F DGVVKREDL+ITSKLWCTDHAPEDVP AL++TL+DLQLDY+DLYLIHWPV MK
Sbjct  61   ALKKVFDDGVVKREDLWITSKLWCTDHAPEDVPKALDKTLQDLQLDYLDLYLIHWPVRMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
              SV F  ENLI  +IP+TW+AMEALYDSGKARAIGV NFS
Sbjct  121  SGSVEFKNENLIQPDIPSTWRAMEALYDSGKARAIGVRNFS  161



>ref|XP_002529870.1| aldo-keto reductase, putative [Ricinus communis]
 gb|EEF32520.1| aldo-keto reductase, putative [Ricinus communis]
Length=315

 Score =   223 bits (567),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 121/161 (75%), Positives = 135/161 (84%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA  ++CF LNTGAK+PSVGLGTWQAEPG+VG AVEAAIK+GYRHIDCA+ Y NEKEIG 
Sbjct  1    MANEIRCFELNTGAKMPSVGLGTWQAEPGLVGAAVEAAIKIGYRHIDCAQAYNNEKEIGS  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLKKL  DGVVKR DLFITSKL C++H PEDV  AL  TL+DLQLDY+DLYLIHWPV MK
Sbjct  61   VLKKLLEDGVVKRGDLFITSKLGCSNHDPEDVVKALEGTLQDLQLDYVDLYLIHWPVKMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K S GF PEN    +IP TW+AME+ +DSGKARAIGVSNFS
Sbjct  121  KGSAGFKPENFDHPDIPRTWRAMESFFDSGKARAIGVSNFS  161



>ref|XP_004166958.1| PREDICTED: aldo-keto reductase family 4 member C10-like [Cucumis 
sativus]
Length=316

 Score =   223 bits (567),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 117/161 (73%), Positives = 138/161 (86%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA  +  F LNTGA IPS+GLGTWQA   ++  A+ AA+K+GYRHIDCA+ YGNEKEIG 
Sbjct  1    MASQISFFPLNTGANIPSLGLGTWQATGDLLTNAIAAALKIGYRHIDCAQLYGNEKEIGS  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLKKLF +G+VKREDL+ITSKLWCTDHAPEDVP AL++TLK+LQLDY+DLYLIHWPV MK
Sbjct  61   VLKKLFEEGIVKREDLWITSKLWCTDHAPEDVPKALDRTLKNLQLDYLDLYLIHWPVRMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
              S GFAPEN +  +IP+TW+AMEAL+DSGKARAIGVSNF+
Sbjct  121  HGSTGFAPENFVTPDIPSTWRAMEALFDSGKARAIGVSNFT  161



>ref|XP_003604914.1| Aldose reductase [Medicago truncatula]
 gb|AES87111.1| aldo/keto reductase family oxidoreductase [Medicago truncatula]
Length=288

 Score =   221 bits (564),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 119/161 (74%), Positives = 137/161 (85%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA A+K F LNTGAKIPSVGLGTWQAEPGVV +AV  A++VGYRHIDCA  Y N+ EIG 
Sbjct  1    MATAIKFFQLNTGAKIPSVGLGTWQAEPGVVAKAVTTAVQVGYRHIDCAEAYKNQSEIGS  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
             LKKLF DGV+KRE+L+ITSKLWC+DH PEDVP AL++TL DLQLDY+DLYLIHWPV MK
Sbjct  61   ALKKLFEDGVIKREELWITSKLWCSDHHPEDVPKALDKTLNDLQLDYLDLYLIHWPVSMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            + +  F  ENL  A+IP+TWKA+EALYDSGKA+AIGVSNFS
Sbjct  121  RGTGEFKAENLDRADIPSTWKALEALYDSGKAKAIGVSNFS  161



>ref|XP_006373911.1| hypothetical protein POPTR_0016s10390g [Populus trichocarpa]
 gb|ERP51708.1| hypothetical protein POPTR_0016s10390g [Populus trichocarpa]
Length=331

 Score =   223 bits (568),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 136/161 (84%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA A+  F LNTGAKIPSVGLGTW+A+PG V  AV AAIK GYRHIDCAR Y NEKE+G 
Sbjct  1    MAKAIPFFELNTGAKIPSVGLGTWRADPGAVADAVTAAIKAGYRHIDCARLYCNEKEVGC  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
             LKKLF +GVVKR +++ITSKLWC DHAPEDVP +L +TL+DLQLDY+DLYLIHWPV MK
Sbjct  61   ALKKLFDNGVVKRGEVWITSKLWCNDHAPEDVPESLGKTLQDLQLDYVDLYLIHWPVSMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K S G+ PENL   NIPATW+AMEALYDSGKARAIGVSNFS
Sbjct  121  KGSEGYKPENLTQTNIPATWRAMEALYDSGKARAIGVSNFS  161



>ref|XP_009358772.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Pyrus 
x bretschneideri]
Length=307

 Score =   222 bits (565),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 118/161 (73%), Positives = 136/161 (84%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA A++ F LNTGAKIPSVGLGT++A+  VV   + AAIK+GYRHIDCAR YGNEKEIG 
Sbjct  1    MANAIRVFELNTGAKIPSVGLGTYRADTHVVSDVITAAIKIGYRHIDCARLYGNEKEIGG  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
             LKKLF DGVVKRED++ITSKLWC+DH PEDVP A+++TL+DLQLDY+DL L+HWPV MK
Sbjct  61   ALKKLFNDGVVKREDIWITSKLWCSDHEPEDVPKAIDKTLQDLQLDYLDLCLVHWPVSMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K SVG  P NL   NIP+TWKAMEAL+DSGKARAIGV NFS
Sbjct  121  KGSVGSDPHNLTQPNIPSTWKAMEALFDSGKARAIGVCNFS  161



>ref|XP_010528536.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Tarenaya 
hassleriana]
Length=316

 Score =   222 bits (565),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 128/161 (80%), Positives = 142/161 (88%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA  +  F LNTGAKIPSVGLGTWQA+PGVVG AV AA+K+GYRHIDCAR YGNEKEIG 
Sbjct  1    MAKQIGFFDLNTGAKIPSVGLGTWQADPGVVGNAVAAAVKIGYRHIDCARMYGNEKEIGS  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLK LF DGVVKRE+LFITSKL  TDH P+DVP ALN+TL+DLQLDY+DLYLIHWPV +K
Sbjct  61   VLKSLFEDGVVKREELFITSKLRSTDHDPQDVPEALNKTLQDLQLDYVDLYLIHWPVRLK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K SVGF+PEN++P +IP TWKAMEALYDSGKARAIGVSNFS
Sbjct  121  KGSVGFSPENILPTDIPGTWKAMEALYDSGKARAIGVSNFS  161



>ref|XP_006340995.1| PREDICTED: aldo-keto reductase family 4 member C10-like [Solanum 
tuberosum]
Length=317

 Score =   222 bits (565),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 120/163 (74%), Positives = 138/163 (85%), Gaps = 0/163 (0%)
 Frame = +2

Query  71   VAMAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEI  250
            +A A  +  F LNTG  IP+VGLGTWQ++PGVVG+AVE AIK+GYRHIDCA+ Y NEKEI
Sbjct  1    MAEATEMPYFKLNTGFSIPAVGLGTWQSDPGVVGKAVETAIKMGYRHIDCAQVYKNEKEI  60

Query  251  GEVLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVP  430
            GEVL +LF DGVVKR DLFITSKL  T+HAPEDVPVAL++TLKDLQL+Y+DLYLIHWPV 
Sbjct  61   GEVLSRLFKDGVVKRRDLFITSKLSNTNHAPEDVPVALDKTLKDLQLEYVDLYLIHWPVS  120

Query  431  MKKDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            MK  SV F PENL+P NIP+ W+AME +YDSGKAR IGVSNFS
Sbjct  121  MKPGSVDFKPENLMPTNIPSIWEAMEKVYDSGKARVIGVSNFS  163



>ref|XP_004506627.1| PREDICTED: aldo-keto reductase family 4 member C9-like isoform 
X2 [Cicer arietinum]
Length=287

 Score =   221 bits (562),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 120/161 (75%), Positives = 135/161 (84%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            M  A+K F LNTGAKIPSVGLGTWQAEPGVV +AV  AI+VGYRHIDCA  Y N+ EIG 
Sbjct  1    MGTAIKFFQLNTGAKIPSVGLGTWQAEPGVVAEAVNTAIQVGYRHIDCAEAYRNQAEIGS  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
             LKKLF DGVVKRE+L+ITSKLWC+DH PEDVP AL++TL DLQLDY+DLYLIHWPV MK
Sbjct  61   ALKKLFEDGVVKREELWITSKLWCSDHHPEDVPKALDKTLHDLQLDYLDLYLIHWPVSMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            + +  F  ENL   +IP+TWKAMEALYDSGKA+AIGVSNFS
Sbjct  121  RGTGEFKAENLDHPDIPSTWKAMEALYDSGKAKAIGVSNFS  161



>ref|XP_004142056.1| PREDICTED: LOW QUALITY PROTEIN: aldo-keto reductase family 4 
member C9-like [Cucumis sativus]
Length=315

 Score =   221 bits (564),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 117/161 (73%), Positives = 136/161 (84%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA  +  F LNTGA IPS+GLGTWQA  G++  A+ AA+K+GYRHIDC+  YGNEKEIG 
Sbjct  1    MASQISSFPLNTGANIPSLGLGTWQATEGLLTNAISAALKIGYRHIDCSPVYGNEKEIGS  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLKKLF +GVVKREDL+IT KLWCTDHAPEDVP AL++TLK LQLDY+DLYLIHWPV MK
Sbjct  61   VLKKLFEEGVVKREDLWITXKLWCTDHAPEDVPKALDRTLKILQLDYLDLYLIHWPVRMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
              S  FAPENL+  +IP+TW+AMEAL+DSGKARAIGVSNF+
Sbjct  121  HGSTDFAPENLVTPDIPSTWRAMEALFDSGKARAIGVSNFT  161



>ref|XP_004246435.1| PREDICTED: aldo-keto reductase family 4 member C10-like [Solanum 
lycopersicum]
Length=317

 Score =   221 bits (564),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 118/163 (72%), Positives = 137/163 (84%), Gaps = 0/163 (0%)
 Frame = +2

Query  71   VAMAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEI  250
            +A A  +    LNTG  IP+VGLGTWQ++PGVVG+AVE AIK+GYRHIDCA+ Y NEKEI
Sbjct  1    MAEATEMPYIELNTGFSIPAVGLGTWQSDPGVVGKAVETAIKMGYRHIDCAQIYKNEKEI  60

Query  251  GEVLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVP  430
            GEVL +LF DGVVKR +LFITSKLW T+HAPEDVPVAL++TL+DLQL+Y+DLYLIHWPV 
Sbjct  61   GEVLSRLFKDGVVKRRELFITSKLWNTNHAPEDVPVALDKTLQDLQLEYVDLYLIHWPVS  120

Query  431  MKKDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            MK  SV F PENL+P NIP  W+AME +YDSGKAR IGVSNFS
Sbjct  121  MKPGSVDFKPENLMPTNIPRIWEAMEKVYDSGKARVIGVSNFS  163



>gb|ACJ84681.1| unknown [Medicago truncatula]
Length=313

 Score =   221 bits (564),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 119/161 (74%), Positives = 137/161 (85%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA A+K F LNTGAKIPSVGLGTWQAEPGVV +AV  A++VGYRHIDCA  Y N+ EIG 
Sbjct  1    MATAIKFFQLNTGAKIPSVGLGTWQAEPGVVAKAVTTAVQVGYRHIDCAEAYKNQSEIGS  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
             LKKLF DGV+KRE+L+ITSKLWC+DH PEDVP AL++TL DLQLDY+DLYLIHWPV MK
Sbjct  61   ALKKLFEDGVIKREELWITSKLWCSDHHPEDVPKALDKTLNDLQLDYLDLYLIHWPVSMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            + +  F  ENL  A+IP+TWKA+EALYDSGKA+AIGVSNFS
Sbjct  121  RGTGEFKAENLDRADIPSTWKALEALYDSGKAKAIGVSNFS  161



>ref|XP_003604913.1| Aldose reductase [Medicago truncatula]
 gb|AES87110.1| aldo/keto reductase family oxidoreductase [Medicago truncatula]
 gb|AFK38211.1| unknown [Medicago truncatula]
Length=313

 Score =   221 bits (564),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 119/161 (74%), Positives = 137/161 (85%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA A+K F LNTGAKIPSVGLGTWQAEPGVV +AV  A++VGYRHIDCA  Y N+ EIG 
Sbjct  1    MATAIKFFQLNTGAKIPSVGLGTWQAEPGVVAKAVTTAVQVGYRHIDCAEAYKNQSEIGS  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
             LKKLF DGV+KRE+L+ITSKLWC+DH PEDVP AL++TL DLQLDY+DLYLIHWPV MK
Sbjct  61   ALKKLFEDGVIKREELWITSKLWCSDHHPEDVPKALDKTLNDLQLDYLDLYLIHWPVSMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            + +  F  ENL  A+IP+TWKA+EALYDSGKA+AIGVSNFS
Sbjct  121  RGTGEFKAENLDRADIPSTWKALEALYDSGKAKAIGVSNFS  161



>ref|XP_008387821.1| PREDICTED: aldo-keto reductase family 4 member C9-like isoform 
X1 [Malus domestica]
Length=352

 Score =   223 bits (567),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 118/166 (71%), Positives = 138/166 (83%), Gaps = 0/166 (0%)
 Frame = +2

Query  62   RLCVAMAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNE  241
            R  + MA A++ F LNTGAKIPSVGLGT++A+  VV   + AAIK+GYRHIDCA+ YGNE
Sbjct  41   REKLKMANAIRFFELNTGAKIPSVGLGTYRADTHVVSDVIAAAIKIGYRHIDCAQMYGNE  100

Query  242  KEIGEVLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHW  421
            KEIG+ LKKLF DGVVKRED++ITSKLWC+DH PEDVP A ++T +DLQLDY+DLYL+HW
Sbjct  101  KEIGDALKKLFNDGVVKREDIWITSKLWCSDHEPEDVPKAFDKTXQDLQLDYLDLYLVHW  160

Query  422  PVPMKKDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            PV MKK SVG  P NL   NIP+TWKAMEAL+DSGKARAIGV NFS
Sbjct  161  PVSMKKGSVGSDPHNLTQPNIPSTWKAMEALFDSGKARAIGVCNFS  206



>gb|KHG06616.1| Aldo-keto reductase family 4 member C9 [Gossypium arboreum]
Length=288

 Score =   220 bits (561),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 123/161 (76%), Positives = 137/161 (85%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA A++ F LNTGAKIPSVGLGTWQA PGVVG AV  AIK GYRHIDCA+ YGNEKEIG 
Sbjct  1    MAAAIRYFDLNTGAKIPSVGLGTWQAAPGVVGNAVATAIKHGYRHIDCAQVYGNEKEIGL  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLKKL  DGVVKRE+L+ITSKLW T+HAPEDVP ALN TL+DLQLDYIDLYL+HWPV M 
Sbjct  61   VLKKLSEDGVVKREELWITSKLWNTNHAPEDVPEALNGTLQDLQLDYIDLYLMHWPVSMG  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K +VGF  ++L   +I +TW+AMEALYDSGKARAIGVSNFS
Sbjct  121  KKAVGFEQKDLTQPDITSTWRAMEALYDSGKARAIGVSNFS  161



>ref|XP_007134070.1| hypothetical protein PHAVU_010G017000g [Phaseolus vulgaris]
 gb|ESW06064.1| hypothetical protein PHAVU_010G017000g [Phaseolus vulgaris]
Length=313

 Score =   221 bits (563),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 121/161 (75%), Positives = 138/161 (86%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            M   ++ F LNTGAKIPS+GLGT +AEPGVV +AV  AI+VGYRHIDCA+ Y N+ EIG 
Sbjct  1    MGKLIQFFELNTGAKIPSIGLGTAKAEPGVVPKAVTTAIQVGYRHIDCAQFYDNQAEIGS  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
             LKK+F DGVVKREDL+ITSKLWCTDHAPEDVP AL++TL+DLQLDY+DLYLIHWPV MK
Sbjct  61   ALKKVFDDGVVKREDLWITSKLWCTDHAPEDVPKALDKTLQDLQLDYLDLYLIHWPVRMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
              SVGF  ENLI  +IP+TW+AMEALYDSGKARAIGVSNFS
Sbjct  121  SGSVGFKNENLIQPDIPSTWRAMEALYDSGKARAIGVSNFS  161



>ref|XP_008387823.1| PREDICTED: aldo-keto reductase family 4 member C9-like isoform 
X2 [Malus domestica]
Length=307

 Score =   221 bits (562),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 117/161 (73%), Positives = 136/161 (84%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA A++ F LNTGAKIPSVGLGT++A+  VV   + AAIK+GYRHIDCA+ YGNEKEIG+
Sbjct  1    MANAIRFFELNTGAKIPSVGLGTYRADTHVVSDVIAAAIKIGYRHIDCAQMYGNEKEIGD  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
             LKKLF DGVVKRED++ITSKLWC+DH PEDVP A ++T +DLQLDY+DLYL+HWPV MK
Sbjct  61   ALKKLFNDGVVKREDIWITSKLWCSDHEPEDVPKAFDKTXQDLQLDYLDLYLVHWPVSMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K SVG  P NL   NIP+TWKAMEAL+DSGKARAIGV NFS
Sbjct  121  KGSVGSDPHNLTQPNIPSTWKAMEALFDSGKARAIGVCNFS  161



>ref|XP_004506626.1| PREDICTED: aldo-keto reductase family 4 member C9-like isoform 
X1 [Cicer arietinum]
Length=313

 Score =   221 bits (562),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 120/161 (75%), Positives = 135/161 (84%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            M  A+K F LNTGAKIPSVGLGTWQAEPGVV +AV  AI+VGYRHIDCA  Y N+ EIG 
Sbjct  1    MGTAIKFFQLNTGAKIPSVGLGTWQAEPGVVAEAVNTAIQVGYRHIDCAEAYRNQAEIGS  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
             LKKLF DGVVKRE+L+ITSKLWC+DH PEDVP AL++TL DLQLDY+DLYLIHWPV MK
Sbjct  61   ALKKLFEDGVVKREELWITSKLWCSDHHPEDVPKALDKTLHDLQLDYLDLYLIHWPVSMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            + +  F  ENL   +IP+TWKAMEALYDSGKA+AIGVSNFS
Sbjct  121  RGTGEFKAENLDHPDIPSTWKAMEALYDSGKAKAIGVSNFS  161



>gb|KHN04060.1| Aldo-keto reductase family 4 member C9 [Glycine soja]
Length=312

 Score =   220 bits (561),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 118/161 (73%), Positives = 139/161 (86%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            M+  ++ F LNTGA IPS+GLGTW A+PGVVG  +  A++VGYRHIDCA+ YGN++EIG 
Sbjct  1    MSNEIRFFELNTGANIPSLGLGTWLADPGVVGDVIAHAVEVGYRHIDCAQIYGNQEEIGL  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
             LKKLF +GVVKREDL+ITSKLWCTDHAPEDVP AL++TL+DLQLDYIDLYLIHWP+ MK
Sbjct  61   ALKKLFEEGVVKREDLWITSKLWCTDHAPEDVPEALDRTLRDLQLDYIDLYLIHWPIRMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K SVGF  EN++P++IP TWKAMEAL  SGKARAIGVSNFS
Sbjct  121  KGSVGFKAENIVPSDIPNTWKAMEALNKSGKARAIGVSNFS  161



>ref|XP_008448252.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Cucumis 
melo]
Length=316

 Score =   220 bits (561),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 118/161 (73%), Positives = 137/161 (85%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA  +  F LNTGA IPS+GLGTWQA   ++  A+  A+K+GYRHIDCA+ YGNEKEIG 
Sbjct  1    MASHISFFPLNTGANIPSLGLGTWQATDALLINAIATALKIGYRHIDCAQFYGNEKEIGS  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLK+LF +GVVKREDLFITSKLWC+DHAPEDVP AL++TLKDLQLDY+DLYLIHWPV MK
Sbjct  61   VLKQLFEEGVVKREDLFITSKLWCSDHAPEDVPKALDRTLKDLQLDYLDLYLIHWPVRMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
              S  FAPENLI  +IP+TW+AMEAL+DSGKARAIGVSNF+
Sbjct  121  HGSTDFAPENLITPDIPSTWRAMEALFDSGKARAIGVSNFT  161



>ref|XP_004302707.1| PREDICTED: aldo-keto reductase family 4 member C9-like isoform 
X2 [Fragaria vesca subsp. vesca]
Length=307

 Score =   220 bits (560),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 115/161 (71%), Positives = 137/161 (85%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            M  A++ F LNTGAK+PSVGLGT++++  +VG  + +A+K+GYRHIDCA+ YGNEKEIG+
Sbjct  1    MGSAIRFFELNTGAKMPSVGLGTYRSDTHLVGDVLTSAVKMGYRHIDCAQMYGNEKEIGD  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
             LKKL  DG+VKREDL+ITSKLWCTDH PEDVP A ++TL+DLQLDY+DLYL+HWPV MK
Sbjct  61   ALKKLSNDGIVKREDLWITSKLWCTDHEPEDVPKAFDKTLQDLQLDYLDLYLMHWPVSMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K SVG  PEN    NIP+TWKAMEALYDSGKARAIGVSNFS
Sbjct  121  KGSVGSDPENFTTPNIPSTWKAMEALYDSGKARAIGVSNFS  161



>gb|KJB76787.1| hypothetical protein B456_012G107300 [Gossypium raimondii]
Length=323

 Score =   220 bits (561),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 138/164 (84%), Gaps = 0/164 (0%)
 Frame = +2

Query  68   CVAMAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKE  247
             V MA A++ F LNTGAKIPSVGLGTWQA PGVVG AV  AIK GYRHIDCA+ YGNEKE
Sbjct  6    VVKMAAAIRYFDLNTGAKIPSVGLGTWQAAPGVVGNAVATAIKHGYRHIDCAQVYGNEKE  65

Query  248  IGEVLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPV  427
            IG VLKKL  DGVVKRE+L+ITSKLW T+HAPEDVP ALN TL+DLQLDY+DLYL+HWP+
Sbjct  66   IGLVLKKLSEDGVVKREELWITSKLWNTNHAPEDVPEALNGTLQDLQLDYVDLYLMHWPI  125

Query  428  PMKKDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
             M K +VGF  ++L   +I +TW+AMEALYDSGKARAIGVSNFS
Sbjct  126  SMIKGAVGFEQKDLTQPDITSTWRAMEALYDSGKARAIGVSNFS  169



>ref|XP_003520905.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Glycine 
max]
Length=313

 Score =   220 bits (560),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 118/161 (73%), Positives = 135/161 (84%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA ++K F LNTGAKIPS+GLGTWQAEPGVV +A+  AI+VGYRHIDCA  Y N+ EIG 
Sbjct  1    MAKSIKFFELNTGAKIPSLGLGTWQAEPGVVAEALTTAIQVGYRHIDCASAYKNQAEIGS  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
             LKKLF DGVVKREDL+ITSKLWC+DHAPEDVP AL++TL++LQLDY+DLYLIHWPV MK
Sbjct  61   ALKKLFDDGVVKREDLWITSKLWCSDHAPEDVPKALDKTLQELQLDYLDLYLIHWPVRMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
              + GF  E L   +IP TW+AMEALYDS KARAIGVSNFS
Sbjct  121  SGTFGFNKEYLEQPDIPNTWRAMEALYDSDKARAIGVSNFS  161



>ref|XP_007026920.1| NAD(P)-linked oxidoreductase superfamily protein, putative isoform 
2 [Theobroma cacao]
 gb|EOY07422.1| NAD(P)-linked oxidoreductase superfamily protein, putative isoform 
2 [Theobroma cacao]
Length=1231

 Score =   234 bits (596),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 127/161 (79%), Positives = 138/161 (86%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA A++ F LNTGAKIPSVGLGTWQA PGVVG AV AAIK+GYRHIDCA  Y N+KEIG 
Sbjct  647  MAEAIRYFELNTGAKIPSVGLGTWQAAPGVVGNAVAAAIKLGYRHIDCAEAYENQKEIGS  706

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLKKLF DGVVKREDL+ITSKLWC  HAPE VP ALN TL+DLQLDY+DLYLIHWP  MK
Sbjct  707  VLKKLFDDGVVKREDLWITSKLWCNSHAPEVVPEALNNTLQDLQLDYLDLYLIHWPASMK  766

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K +VGF PENL   +IP+TW+AMEALYDSGKARAIGVSNFS
Sbjct  767  KGAVGFKPENLTQPDIPSTWRAMEALYDSGKARAIGVSNFS  807


 Score =   233 bits (593),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 126/161 (78%), Positives = 139/161 (86%), Gaps = 0/161 (0%)
 Frame = +2

Query  77    MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
             MA A++ F LNTGAKIPSVGLGTWQA PGVVG AV  AIK+GYRHIDCA+ YGNEKEIG 
Sbjct  1026  MAQAIRYFELNTGAKIPSVGLGTWQAAPGVVGDAVATAIKLGYRHIDCAQVYGNEKEIGS  1085

Query  257   VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
             VLKKLF DGVVKREDL+ITSKLW T+HAPEDV  ALN TL+DL L+Y+DLYLIHWPV MK
Sbjct  1086  VLKKLFEDGVVKREDLWITSKLWNTNHAPEDVQEALNSTLEDLHLNYLDLYLIHWPVSMK  1145

Query  437   KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
             K +VGF  E+L   +IPATW+AMEALYDSGKARAIGVSNFS
Sbjct  1146  KGAVGFNGEDLTQPDIPATWRAMEALYDSGKARAIGVSNFS  1186


 Score =   209 bits (532),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 115/162 (71%), Positives = 133/162 (82%), Gaps = 1/162 (1%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQA-EPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIG  253
            MA  ++ F LNTGAKIPSVGLGT+ A + GV+   V  AIKVGYRHIDCA  YGNEKEIG
Sbjct  1    MADDIRFFELNTGAKIPSVGLGTYGAKQHGVIQNTVTTAIKVGYRHIDCASLYGNEKEIG  60

Query  254  EVLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPM  433
              LKKLF +G+V+REDL+ITSKLWC+DH PEDVP ALN+TL+DLQLDY+DLYLIHWPV +
Sbjct  61   SALKKLFNEGIVRREDLWITSKLWCSDHLPEDVPKALNKTLQDLQLDYVDLYLIHWPVSL  120

Query  434  KKDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            KK S+   PE+    +IP TW+AMEALYDSGKARAIGVSNFS
Sbjct  121  KKGSIVVTPESFTQPDIPGTWRAMEALYDSGKARAIGVSNFS  162


 Score =   193 bits (491),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 107/149 (72%), Positives = 123/149 (83%), Gaps = 0/149 (0%)
 Frame = +2

Query  113  GAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGEVLKKLFADGVVK  292
            GAKIPSVGLGT+ A+ GV+   V  AIKVGYRHIDCA  YGNEKEIG  LKKLF +G+V+
Sbjct  314  GAKIPSVGLGTYGAKHGVIQNTVITAIKVGYRHIDCASLYGNEKEIGSALKKLFNEGIVR  373

Query  293  REDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMKKDSVGFAPENLI  472
            REDL+ITSKLWC+DH PEDV  ALN+TL+DLQLDY+DLYLIHWPV +KK S+   PE+  
Sbjct  374  REDLWITSKLWCSDHLPEDVSKALNKTLQDLQLDYVDLYLIHWPVSLKKGSIVVKPESFT  433

Query  473  PANIPATWKAMEALYDSGKARAIGVSNFS  559
              +IP TW+AMEAL DSGKARAIGVSNFS
Sbjct  434  QPDIPGTWRAMEALNDSGKARAIGVSNFS  462



>ref|XP_007026919.1| NAD(P)-linked oxidoreductase superfamily protein, putative isoform 
1 [Theobroma cacao]
 gb|EOY07421.1| NAD(P)-linked oxidoreductase superfamily protein, putative isoform 
1 [Theobroma cacao]
Length=1340

 Score =   234 bits (596),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 127/161 (79%), Positives = 138/161 (86%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA A++ F LNTGAKIPSVGLGTWQA PGVVG AV AAIK+GYRHIDCA  Y N+KEIG 
Sbjct  647  MAEAIRYFELNTGAKIPSVGLGTWQAAPGVVGNAVAAAIKLGYRHIDCAEAYENQKEIGS  706

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLKKLF DGVVKREDL+ITSKLWC  HAPE VP ALN TL+DLQLDY+DLYLIHWP  MK
Sbjct  707  VLKKLFDDGVVKREDLWITSKLWCNSHAPEVVPEALNNTLQDLQLDYLDLYLIHWPASMK  766

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K +VGF PENL   +IP+TW+AMEALYDSGKARAIGVSNFS
Sbjct  767  KGAVGFKPENLTQPDIPSTWRAMEALYDSGKARAIGVSNFS  807


 Score =   233 bits (594),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 126/161 (78%), Positives = 139/161 (86%), Gaps = 0/161 (0%)
 Frame = +2

Query  77    MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
             MA A++ F LNTGAKIPSVGLGTWQA PGVVG AV  AIK+GYRHIDCA+ YGNEKEIG 
Sbjct  1026  MAQAIRYFELNTGAKIPSVGLGTWQAAPGVVGDAVATAIKLGYRHIDCAQVYGNEKEIGS  1085

Query  257   VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
             VLKKLF DGVVKREDL+ITSKLW T+HAPEDV  ALN TL+DL L+Y+DLYLIHWPV MK
Sbjct  1086  VLKKLFEDGVVKREDLWITSKLWNTNHAPEDVQEALNSTLEDLHLNYLDLYLIHWPVSMK  1145

Query  437   KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
             K +VGF  E+L   +IPATW+AMEALYDSGKARAIGVSNFS
Sbjct  1146  KGAVGFNGEDLTQPDIPATWRAMEALYDSGKARAIGVSNFS  1186


 Score =   209 bits (533),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 115/162 (71%), Positives = 133/162 (82%), Gaps = 1/162 (1%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQA-EPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIG  253
            MA  ++ F LNTGAKIPSVGLGT+ A + GV+   V  AIKVGYRHIDCA  YGNEKEIG
Sbjct  1    MADDIRFFELNTGAKIPSVGLGTYGAKQHGVIQNTVTTAIKVGYRHIDCASLYGNEKEIG  60

Query  254  EVLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPM  433
              LKKLF +G+V+REDL+ITSKLWC+DH PEDVP ALN+TL+DLQLDY+DLYLIHWPV +
Sbjct  61   SALKKLFNEGIVRREDLWITSKLWCSDHLPEDVPKALNKTLQDLQLDYVDLYLIHWPVSL  120

Query  434  KKDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            KK S+   PE+    +IP TW+AMEALYDSGKARAIGVSNFS
Sbjct  121  KKGSIVVTPESFTQPDIPGTWRAMEALYDSGKARAIGVSNFS  162


 Score =   193 bits (491),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 107/149 (72%), Positives = 123/149 (83%), Gaps = 0/149 (0%)
 Frame = +2

Query  113  GAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGEVLKKLFADGVVK  292
            GAKIPSVGLGT+ A+ GV+   V  AIKVGYRHIDCA  YGNEKEIG  LKKLF +G+V+
Sbjct  314  GAKIPSVGLGTYGAKHGVIQNTVITAIKVGYRHIDCASLYGNEKEIGSALKKLFNEGIVR  373

Query  293  REDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMKKDSVGFAPENLI  472
            REDL+ITSKLWC+DH PEDV  ALN+TL+DLQLDY+DLYLIHWPV +KK S+   PE+  
Sbjct  374  REDLWITSKLWCSDHLPEDVSKALNKTLQDLQLDYVDLYLIHWPVSLKKGSIVVKPESFT  433

Query  473  PANIPATWKAMEALYDSGKARAIGVSNFS  559
              +IP TW+AMEAL DSGKARAIGVSNFS
Sbjct  434  QPDIPGTWRAMEALNDSGKARAIGVSNFS  462



>ref|XP_011466527.1| PREDICTED: aldo-keto reductase family 4 member C9-like isoform 
X1 [Fragaria vesca subsp. vesca]
Length=318

 Score =   219 bits (559),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 115/161 (71%), Positives = 137/161 (85%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            M  A++ F LNTGAK+PSVGLGT++++  +VG  + +A+K+GYRHIDCA+ YGNEKEIG+
Sbjct  1    MGSAIRFFELNTGAKMPSVGLGTYRSDTHLVGDVLTSAVKMGYRHIDCAQMYGNEKEIGD  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
             LKKL  DG+VKREDL+ITSKLWCTDH PEDVP A ++TL+DLQLDY+DLYL+HWPV MK
Sbjct  61   ALKKLSNDGIVKREDLWITSKLWCTDHEPEDVPKAFDKTLQDLQLDYLDLYLMHWPVSMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K SVG  PEN    NIP+TWKAMEALYDSGKARAIGVSNFS
Sbjct  121  KGSVGSDPENFTTPNIPSTWKAMEALYDSGKARAIGVSNFS  161



>gb|KCW86006.1| hypothetical protein EUGRSUZ_B02711 [Eucalyptus grandis]
Length=225

 Score =   216 bits (551),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 115/161 (71%), Positives = 134/161 (83%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA A++ F LNTGAKIPSVGLGTWQ++PG+VG+AV  AI+ GYRHIDCA+ Y NE EIG 
Sbjct  1    MANAIRYFELNTGAKIPSVGLGTWQSDPGLVGKAVNIAIRHGYRHIDCAQVYANEAEIGA  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            V K L  + VVKREDLFITSKLW TDH PEDVPVAL +TL+DLQLDY+DLYL+HWP+ MK
Sbjct  61   VFKNLIKERVVKREDLFITSKLWNTDHLPEDVPVALERTLRDLQLDYVDLYLMHWPLRMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K + GF PEN+   +IP+TW+AME LYDSGKARAIGV NFS
Sbjct  121  KGTEGFNPENIEQHDIPSTWRAMELLYDSGKARAIGVCNFS  161



>ref|XP_010038893.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Eucalyptus 
grandis]
 gb|KCW84682.1| hypothetical protein EUGRSUZ_B01499 [Eucalyptus grandis]
Length=313

 Score =   219 bits (558),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 121/161 (75%), Positives = 135/161 (84%), Gaps = 2/161 (1%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA A++ F LNTGAKIPSVGLGTWQ   GV   AV  AIKVGYRHIDCA+ Y NEKEIG 
Sbjct  1    MAKAIRFFELNTGAKIPSVGLGTWQTGDGV--DAVTTAIKVGYRHIDCAQAYQNEKEIGT  58

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
             L KLF++GVVKREDL+ITSKLWC DHAPEDVP AL +TL++LQL+Y+DLYLIHWPV M+
Sbjct  59   ALLKLFSEGVVKREDLWITSKLWCADHAPEDVPKALERTLENLQLEYLDLYLIHWPVSMR  118

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K SVGF PENL   +IP+TWKAMEALY SGKARAIGVSNFS
Sbjct  119  KGSVGFKPENLTQPDIPSTWKAMEALYRSGKARAIGVSNFS  159



>ref|NP_001242750.1| uncharacterized protein LOC100788951 [Glycine max]
 gb|ACU17797.1| unknown [Glycine max]
Length=312

 Score =   219 bits (558),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 117/161 (73%), Positives = 138/161 (86%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            M+  ++ F LNTGA IPS+GLGTW A+PGVVG  +  A++ GYRHIDCA+ YGN++EIG 
Sbjct  1    MSNEIRFFELNTGANIPSLGLGTWLADPGVVGDVIAHAVEAGYRHIDCAQIYGNQEEIGL  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
             LKKLF +GVVKREDL+ITSKLWCTDHAPEDVP AL++TL+DLQLDYIDLYLIHWP+ MK
Sbjct  61   ALKKLFEEGVVKREDLWITSKLWCTDHAPEDVPEALDRTLRDLQLDYIDLYLIHWPIRMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K SVGF  EN++P++IP TWKAMEAL  SGKARAIGVSNFS
Sbjct  121  KGSVGFKAENIVPSDIPNTWKAMEALNKSGKARAIGVSNFS  161



>emb|CDY07770.1| BnaA03g17410D [Brassica napus]
Length=306

 Score =   219 bits (557),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 114/153 (75%), Positives = 129/153 (84%), Gaps = 0/153 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA  +  F LNTGAKIPSVGLGTWQA PGVVG AV  A+K+GYRHIDCA+ Y NEKEIG 
Sbjct  1    MANPITVFELNTGAKIPSVGLGTWQASPGVVGDAVTTAVKIGYRHIDCAQMYDNEKEIGA  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
             LKKLF + VVKRE+LFITSKLWCTDH P+DVP AL +TL++LQLDY+DLYL+HWPV MK
Sbjct  61   ALKKLFEEDVVKREELFITSKLWCTDHDPQDVPEALTRTLQNLQLDYVDLYLMHWPVRMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKAR  535
            K SVG  PENL+P +IP+TWKAME LYDSGKAR
Sbjct  121  KGSVGLDPENLLPVDIPSTWKAMETLYDSGKAR  153



>ref|XP_008350454.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Malus 
domestica]
Length=316

 Score =   219 bits (557),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 122/162 (75%), Positives = 135/162 (83%), Gaps = 1/162 (1%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA  ++ F LNTGAKIPS+GLGTWQ+ PGVVG AV AA+K GYRHIDCA+ YGNEKEIG 
Sbjct  1    MADDIRFFELNTGAKIPSIGLGTWQSSPGVVGDAVHAAVKAGYRHIDCAQIYGNEKEIGL  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLKKLF DGVVKREDL+ITS LW TDHAPEDVP AL+ TL+DLQLDY+DLYLIHWP+ MK
Sbjct  61   VLKKLFEDGVVKREDLWITSXLWNTDHAPEDVPEALDXTLRDLQLDYVDLYLIHWPIRMK  120

Query  437  KDS-VGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K S   F  EN I  +IPATW+AME LYDSGKARAIGV NFS
Sbjct  121  KGSGASFNLENFIDPDIPATWRAMETLYDSGKARAIGVCNFS  162



>ref|XP_007134068.1| hypothetical protein PHAVU_010G016800g [Phaseolus vulgaris]
 gb|ESW06062.1| hypothetical protein PHAVU_010G016800g [Phaseolus vulgaris]
Length=311

 Score =   219 bits (557),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 118/161 (73%), Positives = 136/161 (84%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            M   ++ F LNTGAKIPS+GLGT QAEPG+V +A+  AI+VGYRHIDCA+ Y N+ EIG 
Sbjct  1    MGKLIQFFELNTGAKIPSIGLGTGQAEPGIVAKAITTAIQVGYRHIDCAQAYDNQAEIGS  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
             LKK+F DGVVKREDL+ITSKLWCTDH PEDVP AL++TL+DLQLDY+DLYLIHWPV MK
Sbjct  61   ALKKVFDDGVVKREDLWITSKLWCTDHGPEDVPKALDKTLQDLQLDYLDLYLIHWPVRMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
              SV F  ENLI  +IP+TW+AMEALYDSGKARAIGVSNFS
Sbjct  121  SGSVEFKNENLIQPDIPSTWRAMEALYDSGKARAIGVSNFS  161



>ref|XP_006645007.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Oryza 
brachyantha]
Length=310

 Score =   218 bits (556),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 119/156 (76%), Positives = 131/156 (84%), Gaps = 1/156 (1%)
 Frame = +2

Query  92   KCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGEVLKKL  271
            K FVLNTGAKIPSVGLGTWQA+PGVVG AV AA+K GYRHIDCA+ Y NEKE+G  LKKL
Sbjct  3    KHFVLNTGAKIPSVGLGTWQADPGVVGNAVYAAVKAGYRHIDCAKAYNNEKEVGLALKKL  62

Query  272  FADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMKKDSVG  451
            F +GVVKREDLFITSKLWC  HAPEDVP AL++TL DLQL+Y+DLYLIHWP  +KK S  
Sbjct  63   FEEGVVKREDLFITSKLWCDRHAPEDVPEALDETLTDLQLEYLDLYLIHWPFRIKKGS-S  121

Query  452  FAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
              PEN IP +IP+TW AME LYDSGK RAIGVSNFS
Sbjct  122  INPENYIPPDIPSTWGAMEKLYDSGKTRAIGVSNFS  157



>gb|KDP24554.1| hypothetical protein JCGZ_25118 [Jatropha curcas]
Length=315

 Score =   219 bits (557),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 121/161 (75%), Positives = 136/161 (84%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            M   ++ F LNTGAK+PSVGLGTWQAEPG+VG AV AA+K+GYRHIDCA+ Y NEKEIG 
Sbjct  1    MVNEIRFFELNTGAKMPSVGLGTWQAEPGLVGAAVAAAVKIGYRHIDCAQAYSNEKEIGA  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VL KLF DGVVKRE+LFITSKLWC +H PEDV  AL  TL+DLQLDY++LYLIHWP+ MK
Sbjct  61   VLNKLFEDGVVKREELFITSKLWCNNHEPEDVVKALEGTLRDLQLDYVNLYLIHWPLKMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K SVGF PEN    +IP+TWKAMEALYDSGKARAIGVSNFS
Sbjct  121  KGSVGFKPENFEQPDIPSTWKAMEALYDSGKARAIGVSNFS  161



>ref|XP_007205608.1| hypothetical protein PRUPE_ppa009057mg [Prunus persica]
 gb|EMJ06807.1| hypothetical protein PRUPE_ppa009057mg [Prunus persica]
Length=308

 Score =   218 bits (555),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 117/161 (73%), Positives = 137/161 (85%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA A + F LNTGAK+PSVGLGT++A+  ++G  + AAIKVGYR IDCA+ YGNEKEIG 
Sbjct  1    MANAFQFFELNTGAKMPSVGLGTYRADTHLIGDVLSAAIKVGYRQIDCAQMYGNEKEIGF  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
             LKKLF+DG VKREDL+ITSKLWCTDH P+DVP A ++TL++LQLDY+DLYLIHWPV MK
Sbjct  61   ALKKLFSDGAVKREDLWITSKLWCTDHEPDDVPKAFDKTLEELQLDYLDLYLIHWPVSMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K SVG  P+NL   NIP+TWKAMEAL+DSGKARAIGVSNFS
Sbjct  121  KGSVGSDPQNLTQPNIPSTWKAMEALFDSGKARAIGVSNFS  161



>ref|XP_009402310.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Musa 
acuminata subsp. malaccensis]
Length=311

 Score =   218 bits (554),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 119/156 (76%), Positives = 134/156 (86%), Gaps = 1/156 (1%)
 Frame = +2

Query  92   KCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGEVLKKL  271
            K F LNTGAKIPSVGLGTWQ+ PG+VG AV AA+K GYRHIDCAR Y NEKE+G  LKKL
Sbjct  3    KFFTLNTGAKIPSVGLGTWQSAPGLVGAAVIAAVKAGYRHIDCARVYNNEKEVGSALKKL  62

Query  272  FADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMKKDSVG  451
            F +GVVKRE+LFITSKLWC+DHAPEDVPVA++ TLKDLQLDY+DLYLIHWP  +KK S  
Sbjct  63   FDEGVVKREELFITSKLWCSDHAPEDVPVAIDLTLKDLQLDYVDLYLIHWPFRVKKGS-S  121

Query  452  FAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
             +PEN +P +IPATW AME +YDSGKARAIGVSNFS
Sbjct  122  ISPENFLPPDIPATWGAMEKVYDSGKARAIGVSNFS  157



>ref|XP_010937542.1| PREDICTED: aldo-keto reductase family 4 member C9-like isoform 
X1 [Elaeis guineensis]
Length=311

 Score =   218 bits (554),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 118/156 (76%), Positives = 133/156 (85%), Gaps = 1/156 (1%)
 Frame = +2

Query  92   KCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGEVLKKL  271
            + F LNTGA+IPSVGLGTWQAEPGVVG AV AA+K GYRHIDCAR Y NE+E+G  LKKL
Sbjct  3    RFFTLNTGAQIPSVGLGTWQAEPGVVGDAVIAAVKAGYRHIDCARAYSNEEEVGLALKKL  62

Query  272  FADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMKKDSVG  451
            F +GVVKREDLFITSKLW +DHAPEDVPVA++ TL +LQLDY+DLYLIHWPV +KK S  
Sbjct  63   FDEGVVKREDLFITSKLWSSDHAPEDVPVAMDLTLSELQLDYVDLYLIHWPVRVKKGS-R  121

Query  452  FAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
             +PEN +  +IPATW AME LYDSGKARAIGVSNFS
Sbjct  122  ISPENFVQLDIPATWGAMEKLYDSGKARAIGVSNFS  157



>ref|XP_010088585.1| Aldo-keto reductase family 4 member C9 [Morus notabilis]
 gb|EXB36726.1| Aldo-keto reductase family 4 member C9 [Morus notabilis]
Length=315

 Score =   218 bits (554),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 120/161 (75%), Positives = 134/161 (83%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA  +  F LNTGAK+PSVGLGTWQ+ PG+V  AV AAIK+GYRHIDCAR Y NE EIG 
Sbjct  1    MADDILYFELNTGAKMPSVGLGTWQSSPGLVADAVTAAIKIGYRHIDCARLYRNEAEIGS  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
             LKKLF DGVVKREDL+ITSKLW TD APE V  AL+ TL+DLQLDY+DLYLIHWPV MK
Sbjct  61   ALKKLFEDGVVKREDLWITSKLWSTDFAPEYVQEALDSTLRDLQLDYVDLYLIHWPVRMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K+SVGF PENL+  +IP TW+ MEAL+DSGKARAIGVSNFS
Sbjct  121  KESVGFHPENLLVPDIPGTWREMEALFDSGKARAIGVSNFS  161



>ref|XP_009358773.1| PREDICTED: aldo-keto reductase family 4 member C10-like [Pyrus 
x bretschneideri]
Length=315

 Score =   217 bits (553),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 125/161 (78%), Positives = 140/161 (87%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA A++ F L+TGAKIPSVGLGTWQAE GVV  AV AAIK+GYRHIDCA+ YGNEKEIG 
Sbjct  1    MAKAIRFFELSTGAKIPSVGLGTWQAEHGVVAAAVTAAIKLGYRHIDCAQAYGNEKEIGF  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
             LKKL+ DGVVKREDL+ITSKLWC++HAPEDVP AL+ TL+DLQLDY+DLYLIHWPV MK
Sbjct  61   ALKKLYDDGVVKREDLWITSKLWCSNHAPEDVPKALDSTLQDLQLDYLDLYLIHWPVKMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
              SVGF PENL   +IP+TWKA+EA YDSGKARAIGVSNFS
Sbjct  121  SGSVGFKPENLDQPDIPSTWKALEAAYDSGKARAIGVSNFS  161



>ref|XP_009143449.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Brassica 
rapa]
Length=313

 Score =   217 bits (552),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 124/161 (77%), Positives = 140/161 (87%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            M  A+  F LNTGAKIPSVGLGTWQA PGVVG AV AA+K+GYRHIDCA+ YGNEKEIG 
Sbjct  1    MLNAIGFFELNTGAKIPSVGLGTWQASPGVVGDAVAAAVKIGYRHIDCAQLYGNEKEIGT  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
             LKKL   G+VKRE+LFITSKLWCTDH P+DVP ALN+T++DLQLDY+DLYLIHWPV MK
Sbjct  61   ALKKLCEKGIVKREELFITSKLWCTDHDPQDVPEALNRTIQDLQLDYVDLYLIHWPVRMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K SVG +PEN +P +IP+TWK+MEALYDSGKARAIGVSNFS
Sbjct  121  KGSVGVSPENFLPVDIPSTWKSMEALYDSGKARAIGVSNFS  161



>ref|XP_010088587.1| Aldo-keto reductase family 4 member C10 [Morus notabilis]
 gb|EXB36728.1| Aldo-keto reductase family 4 member C10 [Morus notabilis]
Length=307

 Score =   217 bits (552),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 134/159 (84%), Gaps = 0/159 (0%)
 Frame = +2

Query  83   GAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGEVL  262
            G ++ F LNTGAKIPSVGLGT+ AE  ++   + AAIK+GYRHIDCA+ YGNEKEIG  L
Sbjct  2    GDIRFFELNTGAKIPSVGLGTYAAESSLIDSTISAAIKLGYRHIDCAQMYGNEKEIGSAL  61

Query  263  KKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMKKD  442
            KKLF DGVVKRE+L+ITSKLWCTDH PEDVP AL++TL+DLQLDY+DLYLIHWPV ++K 
Sbjct  62   KKLFDDGVVKREELWITSKLWCTDHEPEDVPKALDKTLQDLQLDYVDLYLIHWPVSIRKW  121

Query  443  SVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            S  F PENL   NIP+TWKAMEALYD GKARAIGVSNFS
Sbjct  122  SGSFRPENLTQPNIPSTWKAMEALYDCGKARAIGVSNFS  160



>ref|XP_002456633.1| hypothetical protein SORBIDRAFT_03g039770 [Sorghum bicolor]
 gb|EES01753.1| hypothetical protein SORBIDRAFT_03g039770 [Sorghum bicolor]
Length=310

 Score =   216 bits (551),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 118/156 (76%), Positives = 133/156 (85%), Gaps = 1/156 (1%)
 Frame = +2

Query  92   KCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGEVLKKL  271
            + FVLNTGAKIPSVGLGTWQ++PGVVG AV AA+K GYRHIDCAR YGNEKEIG  LKKL
Sbjct  3    RHFVLNTGAKIPSVGLGTWQSDPGVVGNAVYAAVKAGYRHIDCARVYGNEKEIGVALKKL  62

Query  272  FADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMKKDSVG  451
            F +GVVKREDLFITSKLW   HAPEDVP ALN++L DLQL+Y+DLYLIHWPV +KK +  
Sbjct  63   FEEGVVKREDLFITSKLWNDHHAPEDVPEALNESLNDLQLEYLDLYLIHWPVRVKKGT-N  121

Query  452  FAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
             +PEN +  +IPATW AME LYD+GKARAIGVSNFS
Sbjct  122  HSPENFVTPDIPATWGAMEKLYDAGKARAIGVSNFS  157



>dbj|BAJ94780.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ95659.1| predicted protein, partial [Hordeum vulgare subsp. vulgare]
 dbj|BAJ89077.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=313

 Score =   216 bits (551),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 117/160 (73%), Positives = 132/160 (83%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   AGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGEV  259
            AG    FVLNTGAKIPSVGLGTWQ++PGVVG+AV AA+K GYRHIDCAR Y NEKE+G  
Sbjct  1    AGMATHFVLNTGAKIPSVGLGTWQSDPGVVGEAVYAAVKAGYRHIDCARAYNNEKEVGLA  60

Query  260  LKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMKK  439
            LKKLF +GVVKREDLFITSKLWC  HAPEDVP AL  +L DLQL+Y+DLYLIHWP  +KK
Sbjct  61   LKKLFDEGVVKREDLFITSKLWCGHHAPEDVPEALGDSLSDLQLEYLDLYLIHWPFKIKK  120

Query  440  DSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
             +    PEN +P +IPATW AME L+D+GKARAIGVSNFS
Sbjct  121  GTSIGNPENFLPPDIPATWGAMEKLHDAGKARAIGVSNFS  160



>emb|CBI30496.3| unnamed protein product [Vitis vinifera]
Length=300

 Score =   216 bits (550),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 117/146 (80%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = +2

Query  122  IPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGEVLKKLFADGVVKRED  301
            +P VGLGTWQ++PG+VG+AV  AIKVGYRHIDCA+ YGNEKEIG VLKK+F DG+VKRED
Sbjct  1    MPYVGLGTWQSDPGLVGEAVAIAIKVGYRHIDCAQVYGNEKEIGIVLKKMFEDGIVKRED  60

Query  302  LFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMKKDSVGFAPENLIPAN  481
            L+ITSKLWCTDH PEDVP ALN+TL+DLQLDYIDLYLIHWPV MKK SVGF PENL   +
Sbjct  61   LWITSKLWCTDHGPEDVPEALNRTLRDLQLDYIDLYLIHWPVRMKKGSVGFKPENLTQPD  120

Query  482  IPATWKAMEALYDSGKARAIGVSNFS  559
            IP+TW+AMEAL DSGKARAIGVSNFS
Sbjct  121  IPSTWRAMEALCDSGKARAIGVSNFS  146



>ref|XP_002323523.1| hypothetical protein POPTR_0016s10400g [Populus trichocarpa]
 gb|EEF05284.1| hypothetical protein POPTR_0016s10400g [Populus trichocarpa]
Length=318

 Score =   216 bits (551),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 121/161 (75%), Positives = 134/161 (83%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA A+  F LNTGAKIPSVGLGT  A+PG V  AV AAIK GYRHIDCAR Y NEKE+G 
Sbjct  1    MAKAIPFFELNTGAKIPSVGLGTGGADPGAVADAVTAAIKAGYRHIDCARLYCNEKEVGC  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
             LKKLF +GVVKR +++ITSKLWC DHAPEDVP +L +TL+DLQLDY+DLYLIHWPV MK
Sbjct  61   ALKKLFDNGVVKRGEVWITSKLWCNDHAPEDVPESLGKTLQDLQLDYVDLYLIHWPVSMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K S G+ PENL   NIPATW+AMEALYDSGKARAIGVSNFS
Sbjct  121  KGSEGYKPENLTQTNIPATWRAMEALYDSGKARAIGVSNFS  161



>ref|XP_006846375.1| hypothetical protein AMTR_s00012p00262860 [Amborella trichopoda]
 gb|ERN08050.1| hypothetical protein AMTR_s00012p00262860 [Amborella trichopoda]
Length=319

 Score =   216 bits (551),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 116/154 (75%), Positives = 130/154 (84%), Gaps = 0/154 (0%)
 Frame = +2

Query  98   FVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGEVLKKLFA  277
            F   TGAKIPSVGLGTWQA PGVVG AV AA+K GYRHIDCAR Y NE EIG  LKKLF 
Sbjct  12   FERKTGAKIPSVGLGTWQAPPGVVGDAVTAAVKAGYRHIDCARAYDNEAEIGRALKKLFE  71

Query  278  DGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMKKDSVGFA  457
            DGVVKRE+++ITSKLWC+DHAPEDVP+AL+QTL+DLQLDY+DLYLIHWP   KK   GF 
Sbjct  72   DGVVKREEMWITSKLWCSDHAPEDVPLALDQTLQDLQLDYVDLYLIHWPFRCKKGKRGFN  131

Query  458  PENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            P +  P +IP+TWKAME++YDSGKARAIGVSNFS
Sbjct  132  PSDFAPVDIPSTWKAMESVYDSGKARAIGVSNFS  165



>gb|KGN54280.1| hypothetical protein Csa_4G296820 [Cucumis sativus]
Length=305

 Score =   216 bits (550),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 117/162 (72%), Positives = 136/162 (84%), Gaps = 1/162 (1%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA  +  F LNTGA IPS+GLGTWQA  G++  A+ AA+K+GYRHIDC+  YGNEKEIG 
Sbjct  1    MAYQISSFPLNTGANIPSLGLGTWQATEGLLTNAISAALKIGYRHIDCSPVYGNEKEIGS  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLKKLF +GVVKREDL+ITSKLWCTDHAPEDVP AL++TLK LQLDY+DLYLIHWPV MK
Sbjct  61   VLKKLFEEGVVKREDLWITSKLWCTDHAPEDVPKALDRTLKILQLDYLDLYLIHWPVRMK  120

Query  437  KDSVG-FAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
              S   F PENL+  +IP+TW+AMEAL+DSGKARAIGVSNF+
Sbjct  121  HGSTDFFDPENLVTPDIPSTWRAMEALFDSGKARAIGVSNFT  162



>ref|XP_004172864.1| PREDICTED: aldo-keto reductase family 4 member C9-like, partial 
[Cucumis sativus]
Length=255

 Score =   214 bits (546),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 118/162 (73%), Positives = 137/162 (85%), Gaps = 1/162 (1%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA  +  F LNTGA IPS+GLGTWQA  G++  A+ AA+K+GYRHIDC+  YGNEKEIG 
Sbjct  1    MAYQISSFPLNTGANIPSLGLGTWQATEGLLTNAIPAALKIGYRHIDCSPVYGNEKEIGS  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLKKLF +GVVKREDL+ITSKLWCTDHAPEDVP AL++TLKDLQLDY+DLYLIHWPV MK
Sbjct  61   VLKKLFEEGVVKREDLWITSKLWCTDHAPEDVPKALDRTLKDLQLDYLDLYLIHWPVRMK  120

Query  437  KDSVG-FAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
              S   F PENL+  +IP+TW+AMEAL+DSGKARAIGVSNF+
Sbjct  121  HGSTDFFDPENLVTPDIPSTWRAMEALFDSGKARAIGVSNFT  162



>ref|XP_008240418.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Prunus 
mume]
Length=308

 Score =   216 bits (549),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 117/161 (73%), Positives = 137/161 (85%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA A++ F LNTGAK+PSVGLGT++A+  ++G  + AAIKVGYR IDCA+ YGNEKEIG 
Sbjct  1    MANAIQFFELNTGAKMPSVGLGTYRADTHLIGDVLSAAIKVGYRQIDCAQMYGNEKEIGF  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
             LKKLF+DG VKREDL+ITSKLWCTDH P+DVP A ++TL+DLQLDY+DLYLIHWPV MK
Sbjct  61   ALKKLFSDGAVKREDLWITSKLWCTDHEPDDVPKAFDKTLEDLQLDYLDLYLIHWPVSMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K SVG  P+ L   NIP+TWKAMEAL+DSGKARAIGVSNFS
Sbjct  121  KGSVGSDPQILTQPNIPSTWKAMEALFDSGKARAIGVSNFS  161



>ref|XP_010043997.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Eucalyptus 
grandis]
 gb|KCW86005.1| hypothetical protein EUGRSUZ_B02711 [Eucalyptus grandis]
Length=315

 Score =   216 bits (549),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 115/161 (71%), Positives = 134/161 (83%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA A++ F LNTGAKIPSVGLGTWQ++PG+VG+AV  AI+ GYRHIDCA+ Y NE EIG 
Sbjct  1    MANAIRYFELNTGAKIPSVGLGTWQSDPGLVGKAVNIAIRHGYRHIDCAQVYANEAEIGA  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            V K L  + VVKREDLFITSKLW TDH PEDVPVAL +TL+DLQLDY+DLYL+HWP+ MK
Sbjct  61   VFKNLIKERVVKREDLFITSKLWNTDHLPEDVPVALERTLRDLQLDYVDLYLMHWPLRMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K + GF PEN+   +IP+TW+AME LYDSGKARAIGV NFS
Sbjct  121  KGTEGFNPENIEQHDIPSTWRAMELLYDSGKARAIGVCNFS  161



>ref|XP_008387819.1| PREDICTED: aldo-keto reductase family 4 member C10-like [Malus 
domestica]
Length=328

 Score =   216 bits (549),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 124/161 (77%), Positives = 139/161 (86%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA A++ F L+TGAKIPSVGLGTWQAEPGVV  AV AAIK+GYRHIDCA+ YGNEKEIG 
Sbjct  1    MAKAIRFFELSTGAKIPSVGLGTWQAEPGVVAAAVTAAIKIGYRHIDCAQAYGNEKEIGF  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
             LKKL+ DGVVKREDL+ITSKLWC++HAPEDVP AL+ TL+DLQLDY+DLYLIHWPV MK
Sbjct  61   ALKKLYDDGVVKREDLWITSKLWCSNHAPEDVPKALDSTLQDLQLDYLDLYLIHWPVKMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
              SVGF PENL   +IP+TWKA+EA Y SGKA AIGVSNFS
Sbjct  121  SGSVGFKPENLDQPDIPSTWKALEAAYXSGKAXAIGVSNFS  161



>ref|XP_008350448.1| PREDICTED: aldo-keto reductase family 4 member C10-like [Malus 
domestica]
Length=315

 Score =   215 bits (548),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 124/161 (77%), Positives = 139/161 (86%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA A++ F L+TGAKIPSVGLGTWQAEPGVV  AV AAIK+GYRHIDCA+ YGNEKEIG 
Sbjct  1    MAKAIRFFELSTGAKIPSVGLGTWQAEPGVVAAAVTAAIKIGYRHIDCAQAYGNEKEIGF  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
             LKKL+ DGVVKREDL+ITSKLWC++HAPEDVP AL+ TL+DLQLDY+DLYLIHWPV MK
Sbjct  61   ALKKLYDDGVVKREDLWITSKLWCSNHAPEDVPKALDSTLQDLQLDYLDLYLIHWPVKMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
              SVGF PENL   +IP+TWKA+EA Y SGKA AIGVSNFS
Sbjct  121  SGSVGFKPENLDQPDIPSTWKALEAAYXSGKAXAIGVSNFS  161



>ref|XP_008369939.1| PREDICTED: aldo-keto reductase family 4 member C10-like [Malus 
domestica]
Length=315

 Score =   215 bits (547),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 126/161 (78%), Positives = 141/161 (88%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA A++ F LNTGAKIPSVGLGTWQAEPGVV  AV AA+KVGYRHIDCA+ YGNEKEIG 
Sbjct  1    MAEAIRFFELNTGAKIPSVGLGTWQAEPGVVAAAVTAAVKVGYRHIDCAQAYGNEKEIGF  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
             LKKL+ADGVVKREDL+ITSKLWC++HAPEDV  A++ TL+DLQLDY+DLYLIHWPV MK
Sbjct  61   ALKKLYADGVVKREDLWITSKLWCSNHAPEDVRKAIDSTLQDLQLDYLDLYLIHWPVKMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K S GF PENL   +IP+TWKA+EA YDSGKARAIGVSNFS
Sbjct  121  KGSAGFKPENLDQPDIPSTWKALEAAYDSGKARAIGVSNFS  161



>emb|CAA66205.1| orf [Medicago sativa]
Length=313

 Score =   214 bits (545),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 118/161 (73%), Positives = 135/161 (84%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA A+K F LNTGAKIPSVGLGTWQAEPGVV +AV  A++VGYRHIDCA  Y N+ EIG 
Sbjct  1    MATAIKFFQLNTGAKIPSVGLGTWQAEPGVVAKAVTTAVQVGYRHIDCAEAYKNQSEIGS  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
             LKKL  DGVVKRE+L+ITSKLWC+DH PEDVP AL++TL DLQLDY+DLYLIHWPV MK
Sbjct  61   ALKKLCEDGVVKREELWITSKLWCSDHHPEDVPKALDKTLNDLQLDYLDLYLIHWPVSMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            + +  F  ENL  A+IP+TWKA+ ALYDSGKA+AIGVSNFS
Sbjct  121  RGTGEFMGENLDHADIPSTWKALGALYDSGKAKAIGVSNFS  161



>emb|CDM85016.1| unnamed protein product [Triticum aestivum]
Length=311

 Score =   214 bits (545),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 116/154 (75%), Positives = 130/154 (84%), Gaps = 0/154 (0%)
 Frame = +2

Query  98   FVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGEVLKKLFA  277
            FVLNTGAKIPSVGLGTWQ++PGVVG+AV AA+K GYRHIDCAR Y NEKE+G  LKKLF 
Sbjct  5    FVLNTGAKIPSVGLGTWQSDPGVVGEAVYAAVKAGYRHIDCARAYNNEKEVGLALKKLFE  64

Query  278  DGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMKKDSVGFA  457
            +GVVKREDLFITSKLWC  HAPEDVP AL  +L DLQLDY+DLYLIHWP  +KK +    
Sbjct  65   EGVVKREDLFITSKLWCGHHAPEDVPEALGDSLNDLQLDYLDLYLIHWPFKIKKGTSIGN  124

Query  458  PENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            PEN +P +IPATW AME L+D+GKARAIGVSNFS
Sbjct  125  PENFLPPDIPATWGAMEKLHDAGKARAIGVSNFS  158



>ref|XP_004142195.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Cucumis 
sativus]
Length=344

 Score =   215 bits (547),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 125/196 (64%), Positives = 140/196 (71%), Gaps = 35/196 (18%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIK--------------------  196
            MA  +  F LNTGAKIPSVGLGTWQA  G+VG AV AA+K                    
Sbjct  1    MASPISFFQLNTGAKIPSVGLGTWQAAEGLVGNAVAAAVKNEFKDASGQKSHQSTRAVAE  60

Query  197  ---------------VGYRHIDCARRYGNEKEIGEVLKKLFADGVVKREDLFITSKLWCT  331
                            GYRHIDCA+ YGNEKEIG VLKKLF +GVVKREDL+ITSKLWCT
Sbjct  61   FFRQLQWEKRLARSLFGYRHIDCAQIYGNEKEIGSVLKKLFEEGVVKREDLWITSKLWCT  120

Query  332  DHAPEDVPVALNQTlkdlqldyidlyliHWPVPMKKDSVGFAPENLIPANIPATWKAMEA  511
            DHAPE+VP AL++TLKDLQLDY+DLYLIHWPV MK  S GFAPEN +  +IP+TW+AMEA
Sbjct  121  DHAPEEVPAALDRTLKDLQLDYLDLYLIHWPVRMKHGSTGFAPENFLAPDIPSTWRAMEA  180

Query  512  LYDSGKARAIGVSNFS  559
            L+DSGKARAIGVSNFS
Sbjct  181  LFDSGKARAIGVSNFS  196



>dbj|BAB64275.1| putative aldose reductase [Oryza sativa Japonica Group]
 gb|EAZ41983.1| hypothetical protein OsJ_26532 [Oryza sativa Japonica Group]
 dbj|BAG96231.1| unnamed protein product [Oryza sativa Japonica Group]
Length=311

 Score =   214 bits (544),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 116/156 (74%), Positives = 129/156 (83%), Gaps = 0/156 (0%)
 Frame = +2

Query  92   KCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGEVLKKL  271
            K FVLNTGAKIPSVGLGTWQ++PGVVG AV AA+K GYRHIDCA  Y NEKE+G  LKKL
Sbjct  3    KHFVLNTGAKIPSVGLGTWQSDPGVVGNAVYAAVKAGYRHIDCASAYNNEKEVGLALKKL  62

Query  272  FADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMKKDSVG  451
            F +GVVKREDLFITSKLWC  HAPEDVP AL+ TL DLQL+Y+DLYLIHWP   KK S  
Sbjct  63   FEEGVVKREDLFITSKLWCDHHAPEDVPEALDATLNDLQLEYLDLYLIHWPFRTKKGSSI  122

Query  452  FAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
              PE+ +P +IP+TW AME LYDSGK+RAIGVSNFS
Sbjct  123  GKPESYLPPDIPSTWAAMEKLYDSGKSRAIGVSNFS  158



>ref|XP_010044002.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Eucalyptus 
grandis]
Length=310

 Score =   213 bits (543),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 119/161 (74%), Positives = 132/161 (82%), Gaps = 5/161 (3%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            M   ++ F LNTGAKIPSVGLGTWQA+PG+VG AVE AIK GYRHIDCAR YGNE EIG 
Sbjct  1    MGKDIRYFELNTGAKIPSVGLGTWQADPGLVGNAVEIAIKHGYRHIDCARLYGNEAEIGV  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
             LKKLF DGVVKREDLFITSKLW +DHAPEDVP+A  +TL+DLQLDY+DLYLIHWPV +K
Sbjct  61   ALKKLFEDGVVKREDLFITSKLWNSDHAPEDVPLAFERTLQDLQLDYVDLYLIHWPVRIK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K S  F        +IP+TW+AME LYDSGKARAIGVSNFS
Sbjct  121  KGSKEFE-----QPDIPSTWRAMEVLYDSGKARAIGVSNFS  156



>ref|NP_001044799.1| Os01g0847700 [Oryza sativa Japonica Group]
 dbj|BAF06713.1| Os01g0847700, partial [Oryza sativa Japonica Group]
Length=324

 Score =   213 bits (543),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 117/160 (73%), Positives = 130/160 (81%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   AGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGEV  259
            A   K FVLNTGAKIPSVGLGTWQ++PGVVG AV AA+K GYRHIDCA  Y NEKE+G  
Sbjct  12   AEMAKHFVLNTGAKIPSVGLGTWQSDPGVVGNAVYAAVKAGYRHIDCASAYNNEKEVGLA  71

Query  260  LKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMKK  439
            LKKLF +GVVKREDLFITSKLWC  HAPEDVP AL+ TL DLQL+Y+DLYLIHWP   KK
Sbjct  72   LKKLFEEGVVKREDLFITSKLWCDHHAPEDVPEALDATLNDLQLEYLDLYLIHWPFRTKK  131

Query  440  DSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
             S    PE+ +P +IP+TW AME LYDSGK+RAIGVSNFS
Sbjct  132  GSSIGKPESYLPPDIPSTWAAMEKLYDSGKSRAIGVSNFS  171



>ref|XP_009346417.1| PREDICTED: aldo-keto reductase family 4 member C10-like [Pyrus 
x bretschneideri]
Length=315

 Score =   213 bits (543),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 126/161 (78%), Positives = 141/161 (88%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA A++ F LNTGAKIPSVGLGTWQAEPGVV  AV AA+KVGYRHIDCA+ YGNEKEIG 
Sbjct  1    MAEAIRFFELNTGAKIPSVGLGTWQAEPGVVAAAVTAAVKVGYRHIDCAQAYGNEKEIGF  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
             LKKL+ADGVVKREDL+ITSKLWC++HAPEDV  A++ TL+DLQLDY+DLYLIHWPV MK
Sbjct  61   ALKKLYADGVVKREDLWITSKLWCSNHAPEDVRKAIDSTLQDLQLDYLDLYLIHWPVKMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K S GF PENL   +IP+TWKA+EA YDSGKARAIGVSNFS
Sbjct  121  KGSGGFKPENLDQPDIPSTWKALEAAYDSGKARAIGVSNFS  161



>ref|XP_002441210.1| hypothetical protein SORBIDRAFT_09g022370 [Sorghum bicolor]
 gb|EES19640.1| hypothetical protein SORBIDRAFT_09g022370 [Sorghum bicolor]
Length=385

 Score =   215 bits (547),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 115/154 (75%), Positives = 136/154 (88%), Gaps = 1/154 (1%)
 Frame = +2

Query  98   FVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGEVLKKLFA  277
            FVLNTGAKIPSVGLGTWQ++ G+VG AV AA+K GYRHIDCA+ Y NEKE+G  LKK+  
Sbjct  64   FVLNTGAKIPSVGLGTWQSDNGLVGDAVYAAVKAGYRHIDCAQAYNNEKEVGFGLKKVLD  123

Query  278  DGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMKKDSVGFA  457
            +G+VKREDLFITSKLW T+HAPEDVPVAL+ TLK+LQ DY+DLYLIHWPV MKKD+ GF 
Sbjct  124  EGIVKREDLFITSKLWNTNHAPEDVPVALDGTLKNLQTDYVDLYLIHWPVRMKKDA-GFG  182

Query  458  PENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            P++++P++IPATW AME LYD+GKARAIGVSNFS
Sbjct  183  PQSVVPSDIPATWAAMEKLYDAGKARAIGVSNFS  216



>ref|XP_002863483.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH39742.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=384

 Score =   215 bits (547),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 116/162 (72%), Positives = 135/162 (83%), Gaps = 0/162 (0%)
 Frame = +2

Query  74   AMAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIG  253
             +A  ++ F LNTGA IPSVGLGTWQA+PG+VG AVEAA+K+GYRHIDCA+ YGNEKEIG
Sbjct  56   TLADEIRFFKLNTGAMIPSVGLGTWQADPGLVGNAVEAAVKIGYRHIDCAQIYGNEKEIG  115

Query  254  EVLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPM  433
             VLKKLF DGVVKRE++FITSKL CT H P+DVP ALN+TL+DLQLDY+DLYLI WPV +
Sbjct  116  LVLKKLFDDGVVKREEIFITSKLCCTSHNPQDVPDALNRTLQDLQLDYVDLYLIDWPVSL  175

Query  434  KKDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K+ S GF PEN +P + P+TWK MEAL D  KARAIGV NFS
Sbjct  176  KEGSTGFKPENNLPTDTPSTWKEMEALVDVRKARAIGVINFS  217



>ref|XP_004970568.1| PREDICTED: aldo-keto reductase family 4 member C10-like [Setaria 
italica]
Length=310

 Score =   213 bits (541),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 118/156 (76%), Positives = 131/156 (84%), Gaps = 1/156 (1%)
 Frame = +2

Query  92   KCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGEVLKKL  271
            + FVLNTGAKIPSVGLGTWQ++PGVVG AV AA+K GYRHIDCAR YGNEKEIG  LKKL
Sbjct  3    RHFVLNTGAKIPSVGLGTWQSDPGVVGNAVYAAVKAGYRHIDCARVYGNEKEIGLALKKL  62

Query  272  FADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMKKDSVG  451
            F +GVVKREDLFITSKLW   HAPEDVP ALN++L DLQLDY+DLYLIHWP  +KK +  
Sbjct  63   FEEGVVKREDLFITSKLWNDHHAPEDVPEALNESLNDLQLDYLDLYLIHWPFRVKKGT-N  121

Query  452  FAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
             +PEN I  +IPATW AME LYD+GKA AIGVSNFS
Sbjct  122  ISPENFITPDIPATWAAMEKLYDAGKAHAIGVSNFS  157



>ref|XP_006654504.1| PREDICTED: aldo-keto reductase family 4 member C10-like [Oryza 
brachyantha]
Length=312

 Score =   212 bits (540),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 112/156 (72%), Positives = 132/156 (85%), Gaps = 1/156 (1%)
 Frame = +2

Query  92   KCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGEVLKKL  271
            +CFVLNTGAKIPSVGLGTWQ+EPG VG AV AA+K GYRHIDCA+ Y N+KEIG  LKK+
Sbjct  3    RCFVLNTGAKIPSVGLGTWQSEPGAVGDAVYAAVKAGYRHIDCAQAYANQKEIGVALKKV  62

Query  272  FADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMKKDSVG  451
            F +G++KREDLFITSKLWCT+H PEDVPVAL  TL+DLQ DY+DLYLIHWP+ MKK +  
Sbjct  63   FDEGIIKREDLFITSKLWCTNHDPEDVPVALGSTLQDLQTDYVDLYLIHWPIKMKKGA-P  121

Query  452  FAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            F    ++P++IPATW AME L++SGK RAIGVSNFS
Sbjct  122  FGAAGIVPSDIPATWAAMERLHESGKVRAIGVSNFS  157



>gb|EMS47119.1| Aldo-keto reductase family 4 member C10 [Triticum urartu]
Length=311

 Score =   212 bits (540),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 115/154 (75%), Positives = 130/154 (84%), Gaps = 0/154 (0%)
 Frame = +2

Query  98   FVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGEVLKKLFA  277
            FVLNTGAKIPSVGLGTWQ++PGVVG+AV AA+K GYRHIDCAR Y NEKE+G  LKKLF 
Sbjct  5    FVLNTGAKIPSVGLGTWQSDPGVVGEAVYAAVKAGYRHIDCARAYNNEKEVGLALKKLFE  64

Query  278  DGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMKKDSVGFA  457
            +GVVKREDLFITSKLWC  HAPEDVP AL  +L DLQLDY+DLYLIHWP  +KK +    
Sbjct  65   EGVVKREDLFITSKLWCGHHAPEDVPEALGDSLNDLQLDYLDLYLIHWPFRVKKGTSIGN  124

Query  458  PENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            PEN +P +IPATW AME L+D+GKARAIGVSNF+
Sbjct  125  PENFLPPDIPATWGAMEKLHDAGKARAIGVSNFA  158



>emb|CDY54027.1| BnaA09g54910D [Brassica napus]
Length=311

 Score =   212 bits (539),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 140/161 (87%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA  +  F LNTGAKIPSVGLGTWQA PGVVG AV AA+K+GY+HIDCA RYGNE EIG+
Sbjct  1    MANDIGSFELNTGAKIPSVGLGTWQAAPGVVGDAVAAAVKIGYQHIDCAARYGNEAEIGK  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLKKLF DGVVKRE+LFITSK+W T+  P DVP ALN+TL+DLQLDY+DLYL+HWPV +K
Sbjct  61   VLKKLFEDGVVKRENLFITSKIWLTELDPPDVPEALNRTLQDLQLDYVDLYLMHWPVRLK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K SV F PEN++P +IP+TWKAMEALYDSGKARAIG+SNFS
Sbjct  121  KGSVEFKPENIMPIDIPSTWKAMEALYDSGKARAIGISNFS  161



>ref|XP_009116084.1| PREDICTED: aldo-keto reductase family 4 member C11 [Brassica 
rapa]
Length=315

 Score =   212 bits (539),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 140/161 (87%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA  +  F LNTGAKIPSVGLGTWQA PGVVG AV AA+K+GY+HIDCA RYGNE EIG+
Sbjct  1    MANDIGSFELNTGAKIPSVGLGTWQAAPGVVGDAVAAAVKIGYQHIDCAARYGNEAEIGK  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLKKLF DGVVKRE+LFITSK+W T+  P DVP ALN+TL+DLQLDY+DLYL+HWPV +K
Sbjct  61   VLKKLFEDGVVKRENLFITSKIWLTELDPPDVPEALNRTLQDLQLDYVDLYLMHWPVRLK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K SV F PEN++P +IP+TWKAMEALYDSGKARAIG+SNFS
Sbjct  121  KGSVEFKPENIMPIDIPSTWKAMEALYDSGKARAIGISNFS  161



>emb|CDX73517.1| BnaC08g24860D [Brassica napus]
Length=311

 Score =   212 bits (539),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 124/161 (77%), Positives = 139/161 (86%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA  +  F LNTGAKIPSVGLGTWQA PGVVG AV AA+K+GY+HIDCA RYGNE EIG+
Sbjct  1    MANDIGSFELNTGAKIPSVGLGTWQAAPGVVGDAVAAAVKIGYQHIDCASRYGNEAEIGK  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLKKLF DGVVKRE LFITSK+W T+  P DVP ALN+TL+DLQLDY+DLYLIHWPV +K
Sbjct  61   VLKKLFEDGVVKREKLFITSKIWLTELDPPDVPEALNRTLQDLQLDYVDLYLIHWPVRLK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K SV F PEN++P +IP+TWKAMEALYDSGKARAIGVSNFS
Sbjct  121  KGSVEFKPENIMPIDIPSTWKAMEALYDSGKARAIGVSNFS  161



>ref|XP_006429176.1| hypothetical protein CICLE_v10012267mg [Citrus clementina]
 gb|ESR42416.1| hypothetical protein CICLE_v10012267mg [Citrus clementina]
Length=287

 Score =   211 bits (537),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 119/161 (74%), Positives = 133/161 (83%), Gaps = 1/161 (1%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            M    + F LNTGAKIPS+GLGTW A P VVG A+ AA+KVGYRHIDCA+ YGNEK IG 
Sbjct  1    MEEGFRFFKLNTGAKIPSLGLGTWAAAPDVVGDAIAAAVKVGYRHIDCAQIYGNEKGIGS  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
             LKKLF DGVVKREDL+ITSKLWC +H PEDVP AL++TL+DLQLDY+DLYLIHWPV +K
Sbjct  61   ALKKLFDDGVVKREDLWITSKLWCNNHLPEDVPKALDRTLQDLQLDYVDLYLIHWPVSIK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K S    PENL   +IP+TWKAMEALYDSGKARAIGVSNFS
Sbjct  121  KGSDA-KPENLTRPDIPSTWKAMEALYDSGKARAIGVSNFS  160



>ref|NP_001105982.1| aldo-keto reductase family 1, member B1 [Zea mays]
 gb|ABF61890.1| aldose reductase [Zea mays]
 gb|ACF78216.1| unknown [Zea mays]
 gb|ACF85314.1| unknown [Zea mays]
 gb|ACG32378.1| aldose reductase [Zea mays]
Length=310

 Score =   212 bits (539),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 116/156 (74%), Positives = 130/156 (83%), Gaps = 1/156 (1%)
 Frame = +2

Query  92   KCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGEVLKKL  271
            + FVLNTGAKIPSVGLGTWQ++PGVVG AV AA+K GYRHIDCAR YGNEKEIG  LKKL
Sbjct  3    RHFVLNTGAKIPSVGLGTWQSDPGVVGNAVYAAVKAGYRHIDCARVYGNEKEIGLALKKL  62

Query  272  FADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMKKDSVG  451
            F +GVVKREDLFITSKLW   HAPEDVP ALN +L DLQL+Y+DLYLIHWP  +KK +  
Sbjct  63   FEEGVVKREDLFITSKLWNDHHAPEDVPEALNDSLNDLQLEYLDLYLIHWPFRVKKGT-N  121

Query  452  FAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
             +PEN +  + PATW AME LYD+GKARAIGVSNFS
Sbjct  122  TSPENFVTPDFPATWGAMEKLYDAGKARAIGVSNFS  157



>gb|EEC71799.1| hypothetical protein OsI_04428 [Oryza sativa Indica Group]
 gb|ACS92968.1| aldo-keto reductase [Oryza sativa Indica Group]
Length=311

 Score =   212 bits (539),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 115/156 (74%), Positives = 128/156 (82%), Gaps = 0/156 (0%)
 Frame = +2

Query  92   KCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGEVLKKL  271
            K  VLNTGAKIPSVGLGTWQ++PGVVG AV AA+K GYRHIDCA  Y NEKE+G  LKKL
Sbjct  3    KHLVLNTGAKIPSVGLGTWQSDPGVVGNAVYAAVKAGYRHIDCASAYNNEKEVGLALKKL  62

Query  272  FADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMKKDSVG  451
            F +GVVKREDLFITSKLWC  HAPEDVP AL+ TL DLQL+Y+DLYLIHWP   KK S  
Sbjct  63   FEEGVVKREDLFITSKLWCDHHAPEDVPEALDATLNDLQLEYLDLYLIHWPFRTKKGSSI  122

Query  452  FAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
              PE+ +P +IP+TW AME LYDSGK+RAIGVSNFS
Sbjct  123  GKPESYLPPDIPSTWAAMEKLYDSGKSRAIGVSNFS  158



>gb|ACN37066.1| unknown [Zea mays]
Length=205

 Score =   207 bits (528),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 112/154 (73%), Positives = 131/154 (85%), Gaps = 1/154 (1%)
 Frame = +2

Query  98   FVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGEVLKKLFA  277
            FVLNTGAKIPSVGLGTWQA+ G+VG AV AA+K GYRHIDCA+ Y NEKE+G  L+++  
Sbjct  5    FVLNTGAKIPSVGLGTWQADNGLVGDAVYAAVKAGYRHIDCAQAYNNEKEVGFGLRRVLD  64

Query  278  DGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMKKDSVGFA  457
            +G+VKREDLFITSKLW  +HA EDVPVALN TLKDLQ DY+DLYL+HWPV MKK + GF 
Sbjct  65   EGIVKREDLFITSKLWDINHAAEDVPVALNGTLKDLQTDYVDLYLMHWPVRMKKGA-GFG  123

Query  458  PENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            P  ++P++IPATW AME LYD+GKARAIGVSNFS
Sbjct  124  PHAVVPSDIPATWAAMEELYDAGKARAIGVSNFS  157



>ref|XP_006429175.1| hypothetical protein CICLE_v10012267mg [Citrus clementina]
 gb|ESR42415.1| hypothetical protein CICLE_v10012267mg [Citrus clementina]
Length=311

 Score =   211 bits (537),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 119/161 (74%), Positives = 133/161 (83%), Gaps = 1/161 (1%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            M    + F LNTGAKIPS+GLGTW A P VVG A+ AA+KVGYRHIDCA+ YGNEK IG 
Sbjct  1    MEEGFRFFKLNTGAKIPSLGLGTWAAAPDVVGDAIAAAVKVGYRHIDCAQIYGNEKGIGS  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
             LKKLF DGVVKREDL+ITSKLWC +H PEDVP AL++TL+DLQLDY+DLYLIHWPV +K
Sbjct  61   ALKKLFDDGVVKREDLWITSKLWCNNHLPEDVPKALDRTLQDLQLDYVDLYLIHWPVSIK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K S    PENL   +IP+TWKAMEALYDSGKARAIGVSNFS
Sbjct  121  KGSDA-KPENLTRPDIPSTWKAMEALYDSGKARAIGVSNFS  160



>gb|KEH20249.1| aldo/keto reductase family oxidoreductase [Medicago truncatula]
Length=319

 Score =   211 bits (536),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 137/167 (82%), Gaps = 6/167 (4%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAE--PGVVGQAVEAAIKVGYRHIDCARRYGNEKEI  250
            M+ A++ F LNTGAKIPSVGLGTWQAE  PG+V +AV  AIK GYRHIDCA+ YGN+KEI
Sbjct  1    MSKAIQFFDLNTGAKIPSVGLGTWQAEDDPGLVAEAVATAIKAGYRHIDCAQLYGNQKEI  60

Query  251  GEVLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVP  430
            G VLKKLF +GVVKREDL+ITSKLW TDHAPEDVP+AL +TL + QLDY+DLYLIHWPV 
Sbjct  61   GLVLKKLFDEGVVKREDLWITSKLWNTDHAPEDVPLALEKTLAEFQLDYVDLYLIHWPVA  120

Query  431  MKKDSVGFA----PENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            +KK  +G       E+L+  N+  TWKAMEALYDSGKARAIGVSNFS
Sbjct  121  IKKGPIGAEFTAKAEDLLIPNLAGTWKAMEALYDSGKARAIGVSNFS  167



>gb|ACG39768.1| aldose reductase [Zea mays]
Length=310

 Score =   210 bits (534),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 115/156 (74%), Positives = 128/156 (82%), Gaps = 1/156 (1%)
 Frame = +2

Query  92   KCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGEVLKKL  271
            + FVLNTGAKIPSVGLGTWQ++PGVVG AV AA+K GYRHIDCAR YGNEKEIG  LKKL
Sbjct  3    RHFVLNTGAKIPSVGLGTWQSDPGVVGNAVYAAVKAGYRHIDCARVYGNEKEIGLALKKL  62

Query  272  FADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMKKDSVG  451
            F +GVVKREDLFITSKLW   HAPEDVP ALN +L DLQL+Y+DLYLIHWP  + K    
Sbjct  63   FEEGVVKREDLFITSKLWNDHHAPEDVPEALNDSLNDLQLEYLDLYLIHWPFRVNK-GTN  121

Query  452  FAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
             +PEN +  + PATW AME LYD+GKARAIGVSNFS
Sbjct  122  TSPENFVTPDFPATWGAMEKLYDAGKARAIGVSNFS  157



>gb|ACN27137.1| unknown [Zea mays]
Length=215

 Score =   207 bits (526),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 112/154 (73%), Positives = 130/154 (84%), Gaps = 1/154 (1%)
 Frame = +2

Query  98   FVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGEVLKKLFA  277
            FVLNTGAKIPSVGLGTWQA+ G+VG AV AA+K GYRHIDCA+ Y NEKE+G  L+++  
Sbjct  5    FVLNTGAKIPSVGLGTWQADNGLVGDAVYAAVKAGYRHIDCAQAYNNEKEVGFGLRRVLD  64

Query  278  DGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMKKDSVGFA  457
            +G+VKREDLFITSKLW  +HA EDVPVALN TLKDLQ DY+DLYL+HWPV MKK   GF 
Sbjct  65   EGIVKREDLFITSKLWDINHAAEDVPVALNGTLKDLQTDYVDLYLMHWPVRMKK-GAGFG  123

Query  458  PENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            P  ++P++IPATW AME LYD+GKARAIGVSNFS
Sbjct  124  PHAVVPSDIPATWAAMEELYDAGKARAIGVSNFS  157



>dbj|BAB64273.1| putative aldose reductase [Oryza sativa Japonica Group]
 gb|EAZ41984.1| hypothetical protein OsJ_26534 [Oryza sativa Japonica Group]
 dbj|BAH01375.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|ACS92967.1| aldo-keto reductase [Oryza sativa Indica Group]
Length=311

 Score =   210 bits (534),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 115/156 (74%), Positives = 130/156 (83%), Gaps = 0/156 (0%)
 Frame = +2

Query  92   KCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGEVLKKL  271
            K FVLNTGAKIPSVGLGTWQ++PGVVG AV AA+K GYRHIDCAR Y NE E+G  LKKL
Sbjct  3    KHFVLNTGAKIPSVGLGTWQSDPGVVGDAVYAAVKAGYRHIDCARMYKNENEVGIALKKL  62

Query  272  FADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMKKDSVG  451
            F +GVVKREDLFITSKLWC  HAPEDVP +L++TL DLQL+Y+DLYLIHWP  +KK S  
Sbjct  63   FEEGVVKREDLFITSKLWCDCHAPEDVPESLDKTLSDLQLEYLDLYLIHWPFRVKKGSGI  122

Query  452  FAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
               E+ IP +IP+TW AME LYDSGK+RAIGVSNFS
Sbjct  123  SNTEDYIPPDIPSTWGAMEKLYDSGKSRAIGVSNFS  158



>ref|XP_002272736.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Vitis 
vinifera]
Length=313

 Score =   210 bits (534),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 110/154 (71%), Positives = 132/154 (86%), Gaps = 0/154 (0%)
 Frame = +2

Query  98   FVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGEVLKKLFA  277
            F LN GAKIPSVGLGTW+A+ G++G A+  AIKVGYRHIDCA+ Y NE+EIG  LKK+F 
Sbjct  5    FELNIGAKIPSVGLGTWRADHGLIGDALATAIKVGYRHIDCAQLYENEEEIGFALKKIFE  64

Query  278  DGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMKKDSVGFA  457
            DG+VKREDL+ITSKLWC+DH+PEDVP AL +TL++LQLDY+DLYLIHWPV +K+  +GF 
Sbjct  65   DGIVKREDLWITSKLWCSDHSPEDVPKALERTLRNLQLDYLDLYLIHWPVSLKRGLIGFK  124

Query  458  PENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            PE L   +IP+TW+AME LYDSGKARAIGVSNFS
Sbjct  125  PEYLTQPDIPSTWRAMETLYDSGKARAIGVSNFS  158



>ref|XP_010232559.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Brachypodium 
distachyon]
Length=311

 Score =   209 bits (533),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 112/154 (73%), Positives = 129/154 (84%), Gaps = 0/154 (0%)
 Frame = +2

Query  98   FVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGEVLKKLFA  277
            FVLNTGAK+P+VGLGTWQ++PGVVG+AV AA+K GYRHIDCAR Y NEKE+G  LKKLF 
Sbjct  5    FVLNTGAKMPAVGLGTWQSDPGVVGEAVYAAVKAGYRHIDCARAYNNEKEVGLALKKLFE  64

Query  278  DGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMKKDSVGFA  457
            +G VKREDLFITSKLWC  HAPEDVP A+  +L DLQL+Y+DLYLIHWP  +KK +    
Sbjct  65   EGTVKREDLFITSKLWCGHHAPEDVPEAIGDSLNDLQLEYLDLYLIHWPFRVKKGTSINN  124

Query  458  PENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            PEN IP +IPATW AME L+D+GKARAIGVSNFS
Sbjct  125  PENYIPPDIPATWGAMEKLHDAGKARAIGVSNFS  158



>emb|CBI30497.3| unnamed protein product [Vitis vinifera]
Length=368

 Score =   211 bits (537),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 110/154 (71%), Positives = 132/154 (86%), Gaps = 0/154 (0%)
 Frame = +2

Query  98   FVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGEVLKKLFA  277
            F LN GAKIPSVGLGTW+A+ G++G A+  AIKVGYRHIDCA+ Y NE+EIG  LKK+F 
Sbjct  61   FELNIGAKIPSVGLGTWRADHGLIGDALATAIKVGYRHIDCAQLYENEEEIGFALKKIFE  120

Query  278  DGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMKKDSVGFA  457
            DG+VKREDL+ITSKLWC+DH+PEDVP AL +TL++LQLDY+DLYLIHWPV +K+  +GF 
Sbjct  121  DGIVKREDLWITSKLWCSDHSPEDVPKALERTLRNLQLDYLDLYLIHWPVSLKRGLIGFK  180

Query  458  PENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            PE L   +IP+TW+AME LYDSGKARAIGVSNFS
Sbjct  181  PEYLTQPDIPSTWRAMETLYDSGKARAIGVSNFS  214



>ref|XP_008674825.1| PREDICTED: aldo-keto reductase family 4 member C10 [Zea mays]
Length=310

 Score =   209 bits (532),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 130/156 (83%), Gaps = 1/156 (1%)
 Frame = +2

Query  92   KCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGEVLKKL  271
            + FVLNTGAK+PSVGLGTWQ++PG+VG AV AA+K G+RHIDCAR YGNEKEIG  LKKL
Sbjct  3    RHFVLNTGAKVPSVGLGTWQSDPGIVGNAVYAAVKAGFRHIDCARVYGNEKEIGLALKKL  62

Query  272  FADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMKKDSVG  451
            F +GVVKREDLFITSKLW   HAPEDVP ALN +L DLQL+Y+DLYLIHWP  +KK +  
Sbjct  63   FEEGVVKREDLFITSKLWNDHHAPEDVPEALNDSLNDLQLEYLDLYLIHWPFRVKKGT-N  121

Query  452  FAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
             +PEN +  + PATW AME LYD+GKARAIGVSNFS
Sbjct  122  TSPENFVTPDFPATWGAMEKLYDAGKARAIGVSNFS  157



>ref|XP_006493576.1| PREDICTED: aldo-keto reductase family 4 member C9-like isoform 
X2 [Citrus sinensis]
Length=311

 Score =   209 bits (532),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 118/161 (73%), Positives = 132/161 (82%), Gaps = 1/161 (1%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            M    + F LN GAKIPS+GLGTW A P VVG A+ AA+KVGYRHIDCA+ YGNEK IG 
Sbjct  1    MEEGFRFFKLNAGAKIPSLGLGTWAAAPDVVGDAIAAAVKVGYRHIDCAQIYGNEKGIGS  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
             LKKLF DGVVKREDL+ITSKLWC +H PEDVP AL++TL+DLQLDY+DLYLIHWPV +K
Sbjct  61   ALKKLFDDGVVKREDLWITSKLWCNNHLPEDVPKALDRTLQDLQLDYVDLYLIHWPVSVK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K S    PENL   +IP+TWKAMEALYDSGKARAIGVSNFS
Sbjct  121  KGSDA-KPENLTRPDIPSTWKAMEALYDSGKARAIGVSNFS  160



>emb|CDM80750.1| unnamed protein product [Triticum aestivum]
Length=310

 Score =   209 bits (531),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 116/156 (74%), Positives = 131/156 (84%), Gaps = 1/156 (1%)
 Frame = +2

Query  92   KCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGEVLKKL  271
            + F+LNTGAKIPSVGLGTWQA+PGVVG AV AA+K GYRHIDCAR YGNEKEIG  LKKL
Sbjct  3    RHFLLNTGAKIPSVGLGTWQADPGVVGDAVYAAVKAGYRHIDCARVYGNEKEIGLALKKL  62

Query  272  FADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMKKDSVG  451
            F +GVVKREDLFITSKLW   HAPEDVP ALN++L DLQLDY+DLYLIHWP  +KK +  
Sbjct  63   FEEGVVKREDLFITSKLWNDHHAPEDVPEALNESLNDLQLDYLDLYLIHWPFRVKKGT-N  121

Query  452  FAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
              PEN +  ++PATW AME L+D+GKARAIGVSNFS
Sbjct  122  NNPENFVTPDLPATWGAMEKLHDAGKARAIGVSNFS  157



>dbj|BAJ90871.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=310

 Score =   208 bits (530),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 116/156 (74%), Positives = 130/156 (83%), Gaps = 1/156 (1%)
 Frame = +2

Query  92   KCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGEVLKKL  271
            + F+LNTGAKIPSVGLGTWQA+PGVVG AV AA+K GYRHIDCAR YGNEKEIG  LKKL
Sbjct  3    RHFLLNTGAKIPSVGLGTWQADPGVVGDAVYAAVKAGYRHIDCARVYGNEKEIGLALKKL  62

Query  272  FADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMKKDSVG  451
            F +GVVKR+DLFITSKLW   HAPEDVP ALN++L DLQLDY+DLYLIHWP  +KK    
Sbjct  63   FEEGVVKRDDLFITSKLWNDHHAPEDVPEALNESLNDLQLDYLDLYLIHWPFRVKK-GTN  121

Query  452  FAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
              PEN +  +IPATW AME L+D+GKARAIGVSNFS
Sbjct  122  NNPENFVTPDIPATWGAMEKLHDAGKARAIGVSNFS  157



>gb|AFW78248.1| putative oxidoreductase, aldo/keto reductase family protein isoform 
1 [Zea mays]
 gb|AFW78249.1| putative oxidoreductase, aldo/keto reductase family protein isoform 
2 [Zea mays]
Length=274

 Score =   207 bits (527),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 112/154 (73%), Positives = 131/154 (85%), Gaps = 1/154 (1%)
 Frame = +2

Query  98   FVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGEVLKKLFA  277
            FVLNTGAKIPSVGLGTWQA+ G+VG AV AA+K GYRHIDCA+ Y NEKE+G  L+++  
Sbjct  74   FVLNTGAKIPSVGLGTWQADNGLVGDAVYAAVKAGYRHIDCAQAYNNEKEVGFGLRRVLD  133

Query  278  DGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMKKDSVGFA  457
            +G+VKREDLFITSKLW  +HA EDVPVALN TLKDLQ DY+DLYL+HWPV MKK + GF 
Sbjct  134  EGIVKREDLFITSKLWDINHAAEDVPVALNGTLKDLQTDYVDLYLMHWPVRMKKGA-GFG  192

Query  458  PENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            P  ++P++IPATW AME LYD+GKARAIGVSNFS
Sbjct  193  PHAVVPSDIPATWAAMEELYDAGKARAIGVSNFS  226



>ref|XP_002876230.1| aldo/keto reductase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52489.1| aldo/keto reductase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=315

 Score =   208 bits (530),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 138/161 (86%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA  +  F LNTGAKIPSVGLGTWQA PGVVG AV AA+K+GY+HIDCA RYGNE EIG+
Sbjct  1    MADEIGFFQLNTGAKIPSVGLGTWQAAPGVVGDAVAAAVKIGYQHIDCASRYGNEIEIGK  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLKKLF DGVVKRE LFITSK+W TD  P DV  ALN+TL+DLQLDY+DLYL+HWPV +K
Sbjct  61   VLKKLFDDGVVKREKLFITSKIWLTDLDPPDVQEALNRTLQDLQLDYVDLYLMHWPVRLK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K +V F PEN++P +IP+TWKAMEALYDSGKARAIGVSNFS
Sbjct  121  KGAVDFKPENIMPIDIPSTWKAMEALYDSGKARAIGVSNFS  161



>ref|XP_009345431.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Pyrus 
x bretschneideri]
 ref|XP_009345432.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Pyrus 
x bretschneideri]
Length=317

 Score =   208 bits (530),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 113/154 (73%), Positives = 133/154 (86%), Gaps = 0/154 (0%)
 Frame = +2

Query  98   FVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGEVLKKLFA  277
            F LNTGAKIPSVGLGTW+AEPGVVGQAV AA+K GYRHIDCA  YGNEKE+G  LK+LF+
Sbjct  11   FDLNTGAKIPSVGLGTWKAEPGVVGQAVIAAVKNGYRHIDCASVYGNEKEVGVALKELFS  70

Query  278  DGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMKKDSVGFA  457
             GVV+R +LFITSKLWC+DHAPEDV  AL++TL+DLQLDYIDLYLIH+P+  K+ SVGFA
Sbjct  71   TGVVQRSELFITSKLWCSDHAPEDVSKALSKTLEDLQLDYIDLYLIHYPLRTKRGSVGFA  130

Query  458  PENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            PE ++P  +P TW AME LY SG+ARA+GVSN+S
Sbjct  131  PEVMVPLCLPETWNAMEGLYASGQARAVGVSNYS  164



>ref|XP_006429180.1| hypothetical protein CICLE_v10012214mg [Citrus clementina]
 gb|ESR42420.1| hypothetical protein CICLE_v10012214mg [Citrus clementina]
Length=321

 Score =   208 bits (529),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 112/158 (71%), Positives = 132/158 (84%), Gaps = 1/158 (1%)
 Frame = +2

Query  89   VKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIK-VGYRHIDCARRYGNEKEIGEVLK  265
            V+ F LN GAK+P +GLGTWQA+P VV +A+  AIK  GYRHIDCA  YGNEKEIG  LK
Sbjct  9    VQYFELNNGAKMPPIGLGTWQAKPSVVAEAIAIAIKQAGYRHIDCAYFYGNEKEIGTELK  68

Query  266  KLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMKKDS  445
            KLF DGV+KREDL+ITSKLWC DHAPEDVP A+++TL+DLQ+DY+DLYL+HWPV  KK  
Sbjct  69   KLFEDGVIKREDLWITSKLWCCDHAPEDVPKAMDRTLQDLQIDYVDLYLVHWPVRTKKGF  128

Query  446  VGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            +   PE+L+  +IP+TWKAMEALYDSGKARAIGVSNFS
Sbjct  129  ISLNPEDLLQPDIPSTWKAMEALYDSGKARAIGVSNFS  166



>gb|AFW78251.1| putative oxidoreductase, aldo/keto reductase family protein [Zea 
mays]
Length=284

 Score =   207 bits (526),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 112/154 (73%), Positives = 130/154 (84%), Gaps = 1/154 (1%)
 Frame = +2

Query  98   FVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGEVLKKLFA  277
            FVLNTGAKIPSVGLGTWQA+ G+VG AV AA+K GYRHIDCA+ Y NEKE+G  L+++  
Sbjct  74   FVLNTGAKIPSVGLGTWQADNGLVGDAVYAAVKAGYRHIDCAQAYNNEKEVGFGLRRVLD  133

Query  278  DGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMKKDSVGFA  457
            +G+VKREDLFITSKLW  +HA EDVPVALN TLKDLQ DY+DLYL+HWPV MKK   GF 
Sbjct  134  EGIVKREDLFITSKLWDINHAAEDVPVALNGTLKDLQTDYVDLYLMHWPVRMKK-GAGFG  192

Query  458  PENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            P  ++P++IPATW AME LYD+GKARAIGVSNFS
Sbjct  193  PHAVVPSDIPATWAAMEELYDAGKARAIGVSNFS  226



>ref|XP_006291519.1| hypothetical protein CARUB_v10017668mg [Capsella rubella]
 gb|EOA24417.1| hypothetical protein CARUB_v10017668mg [Capsella rubella]
Length=315

 Score =   207 bits (528),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 138/161 (86%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA  +  F LNTGAKIPSVGLGTWQA PGVVG AV AA+K+GY+HIDCA RYGNE EIG+
Sbjct  1    MADELGFFELNTGAKIPSVGLGTWQAAPGVVGDAVAAAVKMGYQHIDCASRYGNEIEIGK  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLKKLF DGVVKRE LFITSK+W TD  P DV  ALN+TL+DLQLDY+DLYL+HWPV +K
Sbjct  61   VLKKLFEDGVVKREKLFITSKIWLTDLDPPDVQEALNRTLQDLQLDYVDLYLMHWPVRLK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K +V F PEN++P +IP+TWKAMEALYDSGKARAIGVSNFS
Sbjct  121  KGTVDFKPENIMPIDIPSTWKAMEALYDSGKARAIGVSNFS  161



>ref|NP_001145887.1| uncharacterized protein LOC100279403 [Zea mays]
 gb|ACL52791.1| unknown [Zea mays]
 gb|ADU32867.1| aldose reductase [Zea mays]
Length=311

 Score =   207 bits (527),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 112/154 (73%), Positives = 130/154 (84%), Gaps = 1/154 (1%)
 Frame = +2

Query  98   FVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGEVLKKLFA  277
            FVLNTGAKIPSVGLGTWQA+ G+VG AV AA+K GYRHIDCA+ Y NEKE+G  L+++  
Sbjct  5    FVLNTGAKIPSVGLGTWQADNGLVGDAVYAAVKAGYRHIDCAQAYNNEKEVGFGLRRVLD  64

Query  278  DGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMKKDSVGFA  457
            +G+VKREDLFITSKLW  +HA EDVPVALN TLKDLQ DY+DLYL+HWPV MKK   GF 
Sbjct  65   EGIVKREDLFITSKLWDINHAAEDVPVALNGTLKDLQTDYVDLYLMHWPVRMKK-GAGFG  123

Query  458  PENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            P  ++P++IPATW AME LYD+GKARAIGVSNFS
Sbjct  124  PHAVVPSDIPATWAAMEELYDAGKARAIGVSNFS  157



>ref|XP_008369943.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Malus 
domestica]
 ref|XP_008369945.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Malus 
domestica]
Length=317

 Score =   207 bits (527),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 132/154 (86%), Gaps = 0/154 (0%)
 Frame = +2

Query  98   FVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGEVLKKLFA  277
            F LNTGAKIPSVGLGTW+AEPGVVGQAV AA+K GYRHIDCA  YGNEKE+G  LK+LF+
Sbjct  11   FDLNTGAKIPSVGLGTWKAEPGVVGQAVIAAVKNGYRHIDCASVYGNEKEVGVALKELFS  70

Query  278  DGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMKKDSVGFA  457
             GVV+R +LFITSKLWC+DHAPEDV  AL++TL+DLQLDYIDLYLIH+P+  K  SVGFA
Sbjct  71   TGVVQRSELFITSKLWCSDHAPEDVSKALSKTLEDLQLDYIDLYLIHYPLRTKPGSVGFA  130

Query  458  PENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            PE ++P  +P TW AME LY SG+ARAIGVSN+S
Sbjct  131  PEVMVPLCLPETWNAMEGLYASGQARAIGVSNYS  164



>ref|XP_006493579.1| PREDICTED: aldo-keto reductase family 4 member C9-like isoform 
X1 [Citrus sinensis]
Length=321

 Score =   207 bits (527),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 112/158 (71%), Positives = 132/158 (84%), Gaps = 1/158 (1%)
 Frame = +2

Query  89   VKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIK-VGYRHIDCARRYGNEKEIGEVLK  265
            V+ F LN GAK+P +GLGTWQA+ GVV +A+  AIK  GYRHIDCA  YGNEKEIG  LK
Sbjct  9    VQYFELNNGAKMPPIGLGTWQAQHGVVAEAIAIAIKQAGYRHIDCAYFYGNEKEIGTELK  68

Query  266  KLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMKKDS  445
            KLF DGV+KREDL+ITSKLWC DHAPEDVP A+++TL+DLQ+DY+DLYL+HWPV  KK  
Sbjct  69   KLFEDGVIKREDLWITSKLWCCDHAPEDVPKAMDRTLQDLQIDYVDLYLVHWPVRTKKGF  128

Query  446  VGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            +   PE+L+  +IP+TWKAMEALYDSGKARAIGVSNFS
Sbjct  129  ISLNPEDLLQPDIPSTWKAMEALYDSGKARAIGVSNFS  166



>ref|XP_006294644.1| hypothetical protein CARUB_v10023681mg [Capsella rubella]
 gb|EOA27542.1| hypothetical protein CARUB_v10023681mg [Capsella rubella]
Length=311

 Score =   206 bits (525),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 113/161 (70%), Positives = 131/161 (81%), Gaps = 4/161 (2%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA  ++ F LNTGAK+PSVGLGT+     +VG  +E AIK+GYRHIDCA  YGNEKEIG 
Sbjct  1    MAAPIRFFELNTGAKLPSVGLGTY----AMVGTTIEQAIKIGYRHIDCASIYGNEKEIGV  56

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            V KKL  DGVVKRE+LFITSKLWC DH PEDVP AL++TL+DL++DY+DLYLIHWPV +K
Sbjct  57   VFKKLIDDGVVKREELFITSKLWCNDHLPEDVPKALDKTLQDLEIDYVDLYLIHWPVSLK  116

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K+S    PE L   +IP+TWKAMEALYDSGKARAIGVSNFS
Sbjct  117  KESPKPTPEMLTKPDIPSTWKAMEALYDSGKARAIGVSNFS  157



>gb|AFK33934.1| unknown [Medicago truncatula]
Length=172

 Score =   202 bits (513),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 130/157 (83%), Gaps = 7/157 (4%)
 Frame = +2

Query  89   VKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGEVLKK  268
            ++ F LNTGAKIPSVGLGTW A PGVV  A+  A+ VGYRHIDCA+ YGNEKEIG+ LKK
Sbjct  6    LRLFELNTGAKIPSVGLGTWLAAPGVVYDAISTAVNVGYRHIDCAQIYGNEKEIGDALKK  65

Query  269  LFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMKKDSV  448
            LFA+GVVKRE+++ITSKLWCTDH PEDVP A ++TL+DLQLDY+DLYLIHWPV +K    
Sbjct  66   LFANGVVKREEMWITSKLWCTDHLPEDVPKAFDRTLRDLQLDYLDLYLIHWPVSIKNG--  123

Query  449  GFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
                 +L   +IP+TWKAMEALYDSGKARAIGVSNFS
Sbjct  124  -----HLTKPDIPSTWKAMEALYDSGKARAIGVSNFS  155



>ref|XP_010427047.1| PREDICTED: aldo-keto reductase family 4 member C11-like [Camelina 
sativa]
Length=315

 Score =   206 bits (525),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 121/161 (75%), Positives = 138/161 (86%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA  +  F LNTGAKIPSVGLGTWQA PGVVG AV AA+K+GY+HIDCA RYGNE EIG+
Sbjct  1    MADELGFFQLNTGAKIPSVGLGTWQAAPGVVGDAVAAAVKIGYQHIDCASRYGNEVEIGK  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLKKLF DGVVKRE LFITSK+W T+  P DV  ALN+TL+DLQLDY+DLYL+HWPV +K
Sbjct  61   VLKKLFEDGVVKREKLFITSKIWLTELDPPDVQEALNKTLQDLQLDYVDLYLMHWPVRLK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K +V F PEN++P +IP+TWKAMEALYDSGKARAIGVSNFS
Sbjct  121  KGTVEFKPENIMPIDIPSTWKAMEALYDSGKARAIGVSNFS  161



>gb|KJB36675.1| hypothetical protein B456_006G170400 [Gossypium raimondii]
Length=311

 Score =   206 bits (523),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 115/161 (71%), Positives = 129/161 (80%), Gaps = 4/161 (2%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA  ++ F LNTGAKIPSVGLGT+     V    V  A+KVGYRH+DCA  YGNEKEIG 
Sbjct  1    MADEIRFFELNTGAKIPSVGLGTY----AVTRNTVATAVKVGYRHLDCASIYGNEKEIGF  56

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
             LK+LF DGVVKREDLFITSKLWCT H PEDVP ALN+TL+DLQLDY+DLYLIHWP+ +K
Sbjct  57   ALKELFDDGVVKREDLFITSKLWCTHHLPEDVPEALNKTLEDLQLDYVDLYLIHWPISLK  116

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K SVG  PENL   +I  TW+AMEALYDSGKARA+GVSNFS
Sbjct  117  KVSVGVLPENLTQPDISGTWRAMEALYDSGKARAVGVSNFS  157



>gb|KJB36676.1| hypothetical protein B456_006G170400 [Gossypium raimondii]
Length=343

 Score =   206 bits (525),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 115/161 (71%), Positives = 129/161 (80%), Gaps = 4/161 (2%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA  ++ F LNTGAKIPSVGLGT+     V    V  A+KVGYRH+DCA  YGNEKEIG 
Sbjct  1    MADEIRFFELNTGAKIPSVGLGTY----AVTRNTVATAVKVGYRHLDCASIYGNEKEIGF  56

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
             LK+LF DGVVKREDLFITSKLWCT H PEDVP ALN+TL+DLQLDY+DLYLIHWP+ +K
Sbjct  57   ALKELFDDGVVKREDLFITSKLWCTHHLPEDVPEALNKTLEDLQLDYVDLYLIHWPISLK  116

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K SVG  PENL   +I  TW+AMEALYDSGKARA+GVSNFS
Sbjct  117  KVSVGVLPENLTQPDISGTWRAMEALYDSGKARAVGVSNFS  157



>gb|AFW78250.1| putative oxidoreductase, aldo/keto reductase family protein [Zea 
mays]
Length=380

 Score =   207 bits (526),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 112/154 (73%), Positives = 131/154 (85%), Gaps = 1/154 (1%)
 Frame = +2

Query  98   FVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGEVLKKLFA  277
            FVLNTGAKIPSVGLGTWQA+ G+VG AV AA+K GYRHIDCA+ Y NEKE+G  L+++  
Sbjct  74   FVLNTGAKIPSVGLGTWQADNGLVGDAVYAAVKAGYRHIDCAQAYNNEKEVGFGLRRVLD  133

Query  278  DGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMKKDSVGFA  457
            +G+VKREDLFITSKLW  +HA EDVPVALN TLKDLQ DY+DLYL+HWPV MKK + GF 
Sbjct  134  EGIVKREDLFITSKLWDINHAAEDVPVALNGTLKDLQTDYVDLYLMHWPVRMKKGA-GFG  192

Query  458  PENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            P  ++P++IPATW AME LYD+GKARAIGVSNFS
Sbjct  193  PHAVVPSDIPATWAAMEELYDAGKARAIGVSNFS  226



>ref|XP_002529867.1| aldo-keto reductase, putative [Ricinus communis]
 gb|EEF32517.1| aldo-keto reductase, putative [Ricinus communis]
Length=315

 Score =   205 bits (521),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 113/154 (73%), Positives = 128/154 (83%), Gaps = 0/154 (0%)
 Frame = +2

Query  98   FVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGEVLKKLFA  277
            F LNTGAKIPSVGLGTW+AEPGVVG AV+AAIK GYRHIDCA+ Y NE+EIGE  K+LF+
Sbjct  9    FDLNTGAKIPSVGLGTWKAEPGVVGDAVKAAIKAGYRHIDCAKVYNNEREIGEAFKELFS  68

Query  278  DGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMKKDSVGFA  457
             GVVKR +LFITSKLWC+DHAPEDV  AL ++LKDLQLDYIDLYLIHWP   K  S G+ 
Sbjct  69   SGVVKRSELFITSKLWCSDHAPEDVSKALAKSLKDLQLDYIDLYLIHWPFRTKAGSTGWD  128

Query  458  PENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            PEN++   +P TW AME LY SG+ARAIGVSNFS
Sbjct  129  PENMVSLCLPETWSAMEGLYASGQARAIGVSNFS  162



>ref|NP_190956.1| aldo-keto reductase family 4 member C11 [Arabidopsis thaliana]
 sp|Q9M338.1|AKRCB_ARATH RecName: Full=Aldo-keto reductase family 4 member C11 [Arabidopsis 
thaliana]
 emb|CAB88350.1| reductase-like protein [Arabidopsis thaliana]
 gb|AAM61428.1| reductase-like protein [Arabidopsis thaliana]
 gb|ABH07517.1| aldo-keto reductase [Arabidopsis thaliana]
 gb|AEE79153.1| aldo-keto reductase family 4 member C11 [Arabidopsis thaliana]
Length=315

 Score =   204 bits (520),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 121/161 (75%), Positives = 137/161 (85%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA  +  F LNTGAKIPSVGLGTWQA PGVVG AV AA+K+GY+HIDCA RYGNE EIG+
Sbjct  1    MADEIGFFQLNTGAKIPSVGLGTWQAAPGVVGDAVAAAVKIGYQHIDCASRYGNEIEIGK  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLKKLF DGVVKRE LFITSK+W TD  P DV  ALN+TL+DLQLDY+DLYL+HWPV +K
Sbjct  61   VLKKLFDDGVVKREKLFITSKIWLTDLDPPDVQDALNRTLQDLQLDYVDLYLMHWPVRLK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K +V F PEN++P +IP+TWKAMEAL DSGKARAIGVSNFS
Sbjct  121  KGTVDFKPENIMPIDIPSTWKAMEALVDSGKARAIGVSNFS  161



>gb|KJB36677.1| hypothetical protein B456_006G170400 [Gossypium raimondii]
Length=376

 Score =   206 bits (525),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 115/161 (71%), Positives = 129/161 (80%), Gaps = 4/161 (2%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA  ++ F LNTGAKIPSVGLGT+     V    V  A+KVGYRH+DCA  YGNEKEIG 
Sbjct  1    MADEIRFFELNTGAKIPSVGLGTY----AVTRNTVATAVKVGYRHLDCASIYGNEKEIGF  56

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
             LK+LF DGVVKREDLFITSKLWCT H PEDVP ALN+TL+DLQLDY+DLYLIHWP+ +K
Sbjct  57   ALKELFDDGVVKREDLFITSKLWCTHHLPEDVPEALNKTLEDLQLDYVDLYLIHWPISLK  116

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K SVG  PENL   +I  TW+AMEALYDSGKARA+GVSNFS
Sbjct  117  KVSVGVLPENLTQPDISGTWRAMEALYDSGKARAVGVSNFS  157



>ref|XP_007205574.1| hypothetical protein PRUPE_ppa008802mg [Prunus persica]
 gb|EMJ06773.1| hypothetical protein PRUPE_ppa008802mg [Prunus persica]
Length=318

 Score =   204 bits (520),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 129/154 (84%), Gaps = 0/154 (0%)
 Frame = +2

Query  98   FVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGEVLKKLFA  277
            F LNTGAKIPSVGLGTW+AEPGVVGQAV AA+K GYRHIDCA  YGNEKE+G  LK+LF+
Sbjct  12   FDLNTGAKIPSVGLGTWKAEPGVVGQAVIAAVKNGYRHIDCASIYGNEKEVGVALKELFS  71

Query  278  DGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMKKDSVGFA  457
             GVV+R +LFITSKLWC+DHAP DV  AL++TL+DLQLDYIDLYLIHWP+  K  SVG A
Sbjct  72   TGVVQRSELFITSKLWCSDHAPADVSKALSKTLEDLQLDYIDLYLIHWPLRTKPGSVGLA  131

Query  458  PENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            PEN+ P  +  TW AME LY SG+ARAIGVSNFS
Sbjct  132  PENMAPLCLSETWNAMEGLYASGQARAIGVSNFS  165



>gb|EMT22693.1| Alcohol dehydrogenase (NADP+) A [Aegilops tauschii]
Length=311

 Score =   204 bits (519),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 112/154 (73%), Positives = 128/154 (83%), Gaps = 0/154 (0%)
 Frame = +2

Query  98   FVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGEVLKKLFA  277
            FVLNTGAKIPSVGLGTWQ+ PG+VG+AV AA+K GYRHIDCAR Y NEKE+G  LKKLF 
Sbjct  5    FVLNTGAKIPSVGLGTWQSAPGIVGEAVYAAVKAGYRHIDCARAYNNEKEVGLALKKLFE  64

Query  278  DGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMKKDSVGFA  457
            + VVKREDLFITSKLWC  HAPEDVP AL  +L DLQLDY+DLYLIHWP  ++K +    
Sbjct  65   ESVVKREDLFITSKLWCGHHAPEDVPEALGDSLDDLQLDYLDLYLIHWPFRVRKGTSIGN  124

Query  458  PENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            PEN +P +IPATW AME L+D+GKARAIGVSNF+
Sbjct  125  PENFLPPDIPATWGAMEKLHDAGKARAIGVSNFA  158



>gb|ACG28331.1| aldose reductase [Zea mays]
Length=278

 Score =   203 bits (516),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 111/155 (72%), Positives = 125/155 (81%), Gaps = 1/155 (1%)
 Frame = +2

Query  92   KCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGEVLKKL  271
            + FVLNTGAKIPSVGLGTWQ++PGVVG AV AA+K GYRHIDCAR YGNEKEIG  LKKL
Sbjct  3    RHFVLNTGAKIPSVGLGTWQSDPGVVGNAVYAAVKAGYRHIDCARVYGNEKEIGLALKKL  62

Query  272  FADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMKKDSVG  451
            F +GVVKREDLFITSKLW   HAPEDVP ALN +L DLQL+Y+DLYLIHWP  +KK    
Sbjct  63   FEEGVVKREDLFITSKLWNDHHAPEDVPEALNDSLNDLQLEYLDLYLIHWPFRVKK-GTN  121

Query  452  FAPENLIPANIPATWKAMEALYDSGKARAIGVSNF  556
             +PEN +  + PATW AME LYD+GKARAIG +  
Sbjct  122  TSPENFVTPDFPATWGAMEKLYDAGKARAIGQTKL  156



>gb|EEC71798.1| hypothetical protein OsI_04426 [Oryza sativa Indica Group]
Length=263

 Score =   202 bits (514),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 126/152 (83%), Gaps = 0/152 (0%)
 Frame = +2

Query  92   KCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGEVLKKL  271
            K FVLNTGAKIPSVGLGTWQ++PGVVG AV AA+K GYRHIDCAR Y NE E+G  LKKL
Sbjct  3    KHFVLNTGAKIPSVGLGTWQSDPGVVGDAVYAAVKAGYRHIDCARMYKNENEVGIALKKL  62

Query  272  FADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMKKDSVG  451
            F +GVVKREDLFITSKLWC  HAPEDVP +L++TL DLQL+Y+DLYLIHWP  +KK S  
Sbjct  63   FEEGVVKREDLFITSKLWCDCHAPEDVPESLDKTLSDLQLEYLDLYLIHWPFRVKKGSGI  122

Query  452  FAPENLIPANIPATWKAMEALYDSGKARAIGV  547
               E+ IP +IP+TW AME LYDSGK+RAIGV
Sbjct  123  SNTEDYIPPDIPSTWGAMEKLYDSGKSRAIGV  154



>ref|XP_011006382.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Populus 
euphratica]
Length=315

 Score =   204 bits (518),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 117/161 (73%), Positives = 136/161 (84%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA  ++ F LNTGAK+PSVGLGTWQ++PGVVG AV AA+K+GYRHIDCA+ Y NE+E+G 
Sbjct  1    MANEIRFFELNTGAKMPSVGLGTWQSDPGVVGAAVTAAVKIGYRHIDCAQAYENEEEVGL  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
             LKKLF +GVVKREDLFITSKLWC++HAPEDV  A   TL+DLQLDY+DLYLIHWPV MK
Sbjct  61   ALKKLFQEGVVKREDLFITSKLWCSNHAPEDVSEAFAGTLRDLQLDYVDLYLIHWPVRMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K S+G  PEN +  + P TW+AMEALYDSGKARAIGVSNFS
Sbjct  121  KGSIGIKPENFVQPDFPLTWQAMEALYDSGKARAIGVSNFS  161



>ref|XP_002308181.2| aldo/keto reductase family protein [Populus trichocarpa]
 gb|EEE91704.2| aldo/keto reductase family protein [Populus trichocarpa]
Length=317

 Score =   204 bits (518),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 118/161 (73%), Positives = 136/161 (84%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA  ++ F LNTGAK+PSVGLGTWQ++PGVVG AV AA+K+GYRHIDCA+ Y NE+E+G 
Sbjct  1    MANEIRFFELNTGAKMPSVGLGTWQSDPGVVGAAVTAAVKIGYRHIDCAQAYKNEEEVGL  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
             LKKLF DGVVKREDLFITSKLWC++HAPEDV  A   TLKDLQLDY+DLYLIHWPV MK
Sbjct  61   ALKKLFQDGVVKREDLFITSKLWCSNHAPEDVSEAFAGTLKDLQLDYVDLYLIHWPVRMK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K S+G  PEN    ++P TW+AMEA+YDSGKARAIGVSNFS
Sbjct  121  KGSIGIKPENFAQPDLPLTWQAMEAVYDSGKARAIGVSNFS  161



>emb|CDY57149.1| BnaC04g53550D [Brassica napus]
 emb|CDY57153.1| BnaC04g53580D [Brassica napus]
Length=311

 Score =   203 bits (516),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 109/161 (68%), Positives = 130/161 (81%), Gaps = 4/161 (2%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA  ++ F LNTGAK+PSVGLGT+     +V   +E AIK+GYRHIDCA  YGNEKEIG 
Sbjct  1    MATPIRSFELNTGAKLPSVGLGTY----ALVSSTIEQAIKIGYRHIDCASMYGNEKEIGS  56

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLKK+  DG VKRE+LFITSKLWC DH PEDVP AL++TL+DLQ+DY+DLYL+HWPV +K
Sbjct  57   VLKKVIDDGFVKREELFITSKLWCNDHLPEDVPKALDKTLQDLQIDYVDLYLVHWPVSLK  116

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K+S+   PE L   ++P+TWKAMEALY SGKARAIGVSNFS
Sbjct  117  KESLIPTPETLTKPDLPSTWKAMEALYHSGKARAIGVSNFS  157



>ref|XP_010515893.1| PREDICTED: aldo-keto reductase family 4 member C11 [Camelina 
sativa]
Length=315

 Score =   203 bits (517),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 119/161 (74%), Positives = 136/161 (84%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA  +  F LNTG+KIPSVGLGTWQA PGVVG AV AA+K+GY+HIDCA RYGNE EIG+
Sbjct  1    MADELGFFQLNTGSKIPSVGLGTWQAAPGVVGDAVAAAVKIGYQHIDCASRYGNEIEIGK  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLK LF DGVVKRE LFITSK+W TD  P DV  ALN+TL+DLQLDY+DLYL+HWPV +K
Sbjct  61   VLKNLFEDGVVKREKLFITSKIWLTDLDPPDVQDALNRTLQDLQLDYVDLYLMHWPVRLK  120

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K +V F PEN++P +IP+TWKAMEALYDSGKAR IGVSNFS
Sbjct  121  KGTVEFKPENIMPIDIPSTWKAMEALYDSGKARVIGVSNFS  161



>gb|ABL61257.1| aldo-keto reductase [Aloe arborescens]
Length=307

 Score =   202 bits (514),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 129/156 (83%), Gaps = 1/156 (1%)
 Frame = +2

Query  92   KCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGEVLKKL  271
            K F LNTGAKIPS+GLGTW+AEPGVV  AV AAIK GYRHIDCA  YGNEKEIG  LKKL
Sbjct  3    KFFTLNTGAKIPSIGLGTWRAEPGVVENAVTAAIKAGYRHIDCAAMYGNEKEIGFSLKKL  62

Query  272  FADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMKKDSVG  451
              D VVKREDLFITSKLW T+ A EDVP+AL +TL++LQLDYIDLYLIHWP  +KK +  
Sbjct  63   LEDAVVKREDLFITSKLWLTEQAREDVPLALAKTLEELQLDYIDLYLIHWPFRLKKGTT-  121

Query  452  FAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
             + +NLIP++IP+TW AME L+ SGK+RAIGVSNFS
Sbjct  122  LSADNLIPSDIPSTWSAMEKLFYSGKSRAIGVSNFS  157



>gb|EMS64418.1| Aldo-keto reductase family 4 member C9 [Triticum urartu]
Length=305

 Score =   202 bits (514),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 115/161 (71%), Positives = 132/161 (82%), Gaps = 4/161 (2%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MAG+   FVLNTGA IPSVGLGTWQ +P VVG  + AA+K GYRHIDCA  Y NEKE+G 
Sbjct  1    MAGS---FVLNTGAGIPSVGLGTWQIKPEVVGDTIYAAVKAGYRHIDCAPAYSNEKEVGL  57

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
             LKKLF DGVVKRE+LFITSKLW  +HAPEDVP A++ TLKDLQLDY+DL+LIH P+ +K
Sbjct  58   ALKKLFEDGVVKREELFITSKLWSGNHAPEDVPEAIDTTLKDLQLDYLDLFLIHGPIRIK  117

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K +   +PENLIP +IPATW AME LYDSGKARAIGVSNF+
Sbjct  118  KGTT-HSPENLIPTDIPATWGAMEKLYDSGKARAIGVSNFT  157



>ref|XP_009621149.1| PREDICTED: aldo-keto reductase family 4 member C9-like isoform 
X2 [Nicotiana tomentosiformis]
Length=292

 Score =   201 bits (512),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 113/161 (70%), Positives = 127/161 (79%), Gaps = 17/161 (11%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA A++ F LNTGAKIPSVGLGTWQ++PG+VGQA+E AIK                 IG+
Sbjct  1    MAEAIQYFELNTGAKIPSVGLGTWQSDPGIVGQAIETAIK-----------------IGQ  43

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLK+LF DGVVKREDLFITSKLWCTDHAPEDVP A  +TL DLQLDYIDLYL+HWPV MK
Sbjct  44   VLKRLFKDGVVKREDLFITSKLWCTDHAPEDVPAAFRKTLDDLQLDYIDLYLMHWPVRMK  103

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
              + GF PENLIP +IP+TW+AME LYDS KARAIGVSNFS
Sbjct  104  NAADGFKPENLIPGDIPSTWQAMEKLYDSTKARAIGVSNFS  144



>ref|XP_002456632.1| hypothetical protein SORBIDRAFT_03g039760 [Sorghum bicolor]
 gb|EES01752.1| hypothetical protein SORBIDRAFT_03g039760 [Sorghum bicolor]
Length=311

 Score =   202 bits (514),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 107/156 (69%), Positives = 130/156 (83%), Gaps = 0/156 (0%)
 Frame = +2

Query  92   KCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGEVLKKL  271
            + FVLNTGA+IPSVG GTWQ++P VVG +V AA+K GYRHIDCAR Y NEKEIG  L++L
Sbjct  3    RRFVLNTGAEIPSVGYGTWQSKPDVVGDSVYAAVKAGYRHIDCARAYRNEKEIGLALQRL  62

Query  272  FADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMKKDSVG  451
            F +GVVKRE+LFITSKLW   HAPEDVP +L+++L DLQL+Y+DLYLIHWP  +KK +  
Sbjct  63   FEEGVVKREELFITSKLWHDHHAPEDVPESLDKSLNDLQLEYLDLYLIHWPFRLKKGTDW  122

Query  452  FAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
             +P+N +P +IPATW AME LYD+GKARAIGVSNFS
Sbjct  123  SSPDNFLPPDIPATWGAMEKLYDTGKARAIGVSNFS  158



>ref|XP_003604919.1| Aldose reductase [Medicago truncatula]
 gb|ACJ84246.1| unknown [Medicago truncatula]
 gb|AES87116.1| aldo/keto reductase family oxidoreductase [Medicago truncatula]
 gb|AFK40685.1| unknown [Medicago truncatula]
Length=304

 Score =   202 bits (513),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 130/157 (83%), Gaps = 7/157 (4%)
 Frame = +2

Query  89   VKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGEVLKK  268
            ++ F LNTGAKIPSVGLGTW A PGVV  A+  A+ VGYRHIDCA+ YGNEKEIG+ LKK
Sbjct  6    LRLFELNTGAKIPSVGLGTWLAAPGVVYDAISTAVNVGYRHIDCAQIYGNEKEIGDALKK  65

Query  269  LFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMKKDSV  448
            LFA+GVVKRE+++ITSKLWCTDH PEDVP A ++TL+DLQLDY+DLYLIHWPV +K    
Sbjct  66   LFANGVVKREEMWITSKLWCTDHLPEDVPKAFDRTLRDLQLDYLDLYLIHWPVSIKNG--  123

Query  449  GFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
                 +L   +IP+TWKAMEALYDSGKARAIGVSNFS
Sbjct  124  -----HLTKPDIPSTWKAMEALYDSGKARAIGVSNFS  155



>gb|AFK39472.1| unknown [Lotus japonicus]
Length=212

 Score =   199 bits (505),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 128/157 (82%), Gaps = 7/157 (4%)
 Frame = +2

Query  89   VKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGEVLKK  268
            ++ F L+TGAKIPSVGLGTW A PGVV  A+  A+ VGYRH+DCA+ Y NEKEIG+ LKK
Sbjct  7    LRFFELSTGAKIPSVGLGTWLAAPGVVANAIATAVDVGYRHLDCAQIYRNEKEIGDGLKK  66

Query  269  LFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMKKDSV  448
            LFADGVVKRED+FITSKLWCTDH PEDVP A ++TL+DLQLDY+DLYLIHWPV MK    
Sbjct  67   LFADGVVKREDMFITSKLWCTDHLPEDVPKAFDRTLRDLQLDYLDLYLIHWPVSMKNG--  124

Query  449  GFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
                  L   +IP+TW+AMEALY+SGKARAIGVSNFS
Sbjct  125  -----QLTKPDIPSTWRAMEALYNSGKARAIGVSNFS  156



>ref|XP_006429179.1| hypothetical protein CICLE_v10012214mg [Citrus clementina]
 gb|ESR42419.1| hypothetical protein CICLE_v10012214mg [Citrus clementina]
Length=320

 Score =   202 bits (514),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 132/157 (84%), Gaps = 0/157 (0%)
 Frame = +2

Query  89   VKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGEVLKK  268
            V+ F LN GAK+P +GLGTWQA+P VV +A+  AIK GYRHIDCA  YGNEKEIG  LKK
Sbjct  9    VQYFELNNGAKMPPIGLGTWQAKPSVVAEAIAIAIKAGYRHIDCAYFYGNEKEIGTELKK  68

Query  269  LFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMKKDSV  448
            LF DGV+KREDL+ITSKLWC DHAPEDVP A+++TL+DLQ+DY+DLYL+HWPV  KK  +
Sbjct  69   LFEDGVIKREDLWITSKLWCCDHAPEDVPKAMDRTLQDLQIDYVDLYLVHWPVRTKKGFI  128

Query  449  GFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
               PE+L+  +IP+TWKAMEALYDSGKARAIGVSNFS
Sbjct  129  SLNPEDLLQPDIPSTWKAMEALYDSGKARAIGVSNFS  165



>ref|XP_010505373.1| PREDICTED: aldo-keto reductase family 4 member C8 [Camelina sativa]
Length=311

 Score =   202 bits (513),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 110/161 (68%), Positives = 130/161 (81%), Gaps = 4/161 (2%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA  ++ F LNTGAK+PSVGLGT+   P    +++E AI +GYRHIDCA  YGNEKEIG 
Sbjct  1    MAAPIRFFELNTGAKLPSVGLGTYAMAP----ESIEHAINIGYRHIDCASIYGNEKEIGG  56

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLKK+  DG VKRE+LFITSKLWC DH PEDVP AL++TL+DLQ+DY+DLYLIHWPV +K
Sbjct  57   VLKKMIDDGFVKREELFITSKLWCNDHLPEDVPKALDKTLQDLQIDYVDLYLIHWPVSLK  116

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K+S    PE L   +IP+TWKAMEALYDSGKA+AIGVSNFS
Sbjct  117  KESTKPTPEMLTKPDIPSTWKAMEALYDSGKAKAIGVSNFS  157



>ref|XP_010231310.1| PREDICTED: aldo-keto reductase family 4 member C10-like [Brachypodium 
distachyon]
Length=311

 Score =   201 bits (512),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 110/156 (71%), Positives = 129/156 (83%), Gaps = 1/156 (1%)
 Frame = +2

Query  92   KCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGEVLKKL  271
            + FVLNTGA+IPS+G GTWQ EP VVG  + AA+K GYRHIDCA  Y NEKE+G  LKKL
Sbjct  3    ESFVLNTGARIPSIGFGTWQIEPAVVGHTIYAAVKAGYRHIDCAPIYRNEKEVGLALKKL  62

Query  272  FADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMKKDSVG  451
            F DGVVKRED+FITSKLW  DHAPEDVP A++ TLKDLQLDY+DL+LIH P+ +KK ++ 
Sbjct  63   FEDGVVKREDMFITSKLWAGDHAPEDVPEAIDTTLKDLQLDYLDLFLIHGPIRIKKGTMP  122

Query  452  FAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
             +P+N +P +IPATW AME LYDSGKARAIGVSNFS
Sbjct  123  -SPDNFLPPDIPATWGAMEKLYDSGKARAIGVSNFS  157



>ref|XP_004305184.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Fragaria 
vesca subsp. vesca]
Length=318

 Score =   202 bits (513),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 112/154 (73%), Positives = 126/154 (82%), Gaps = 0/154 (0%)
 Frame = +2

Query  98   FVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGEVLKKLFA  277
            F LNTGAKIPSVGLGTW AEPGVVGQAV AA+K GYRHIDCA  YGNEKEIG  LK+LF+
Sbjct  12   FDLNTGAKIPSVGLGTWHAEPGVVGQAVIAAVKNGYRHIDCASVYGNEKEIGVALKELFS  71

Query  278  DGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMKKDSVGFA  457
             GVV R ++FITSKLWC+DHAPEDV  AL+++L+DLQLDYIDLYLIHWP+  K  S G  
Sbjct  72   TGVVHRSEIFITSKLWCSDHAPEDVSTALSKSLEDLQLDYIDLYLIHWPIRTKPGSKGLT  131

Query  458  PENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            PE + P  +P TW AME LY SG+ARAIGVSNFS
Sbjct  132  PEVMAPLCLPETWNAMEGLYASGQARAIGVSNFS  165



>gb|AFK37060.1| unknown [Lotus japonicus]
Length=305

 Score =   201 bits (512),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 128/157 (82%), Gaps = 7/157 (4%)
 Frame = +2

Query  89   VKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGEVLKK  268
            ++ F LNTGAKIPSVGLGTW A PGVV  A+  A+ VGYRH+DCA+ Y NEKEIG+ LKK
Sbjct  7    LRFFELNTGAKIPSVGLGTWLAAPGVVANAIATAVDVGYRHLDCAQIYRNEKEIGDGLKK  66

Query  269  LFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMKKDSV  448
            LFADGVVKRED+FITSKLWCTDH PEDVP A ++TL+DLQLDY+DLYLIHWPV MK    
Sbjct  67   LFADGVVKREDMFITSKLWCTDHLPEDVPKAFDRTLRDLQLDYLDLYLIHWPVSMKNG--  124

Query  449  GFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
                  L   +IP+TW+AMEALY+SGKARAIGVSNFS
Sbjct  125  -----QLTKPDIPSTWRAMEALYNSGKARAIGVSNFS  156



>ref|XP_006410967.1| hypothetical protein EUTSA_v10016976mg [Eutrema salsugineum]
 gb|ESQ52420.1| hypothetical protein EUTSA_v10016976mg [Eutrema salsugineum]
Length=311

 Score =   201 bits (512),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 111/161 (69%), Positives = 127/161 (79%), Gaps = 4/161 (2%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA  ++ F LNTGAK+PSVGLGT+   P      +E AIK+GYRHIDCA  YGNEKEIG 
Sbjct  1    MAAPIRSFELNTGAKLPSVGLGTYALVPA----TIEQAIKIGYRHIDCASIYGNEKEIGS  56

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
            VLKKL  DG VKRE+LFITSKLWC DH PEDVP AL++TL DLQ+DY+DLYLIHWPV +K
Sbjct  57   VLKKLIDDGFVKREELFITSKLWCNDHLPEDVPKALDKTLHDLQIDYVDLYLIHWPVSLK  116

Query  437  KDSVGFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K+S    PE L   ++P+TWKAMEALY SGKARAIGVSNFS
Sbjct  117  KESRVPTPETLTKPDLPSTWKAMEALYHSGKARAIGVSNFS  157



>ref|XP_010529798.1| PREDICTED: aldo-keto reductase family 4 member C11-like isoform 
X2 [Tarenaya hassleriana]
Length=303

 Score =   201 bits (511),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 113/162 (70%), Positives = 129/162 (80%), Gaps = 1/162 (1%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA A+  F LNTGA IPSVGLGTWQA PGVVG +V  A+K+GYRHIDCA+ YGNEKE+G 
Sbjct  1    MANALVSFRLNTGAMIPSVGLGTWQAPPGVVGDSVVTAVKIGYRHIDCAQLYGNEKEVGN  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
             LKKLF +GVVKR++L+ITSKLW T HAPEDV  A+N +L DLQLDY+DLYL+HWPV MK
Sbjct  61   ALKKLFDEGVVKRDELWITSKLWNTHHAPEDVHEAMNGSLSDLQLDYVDLYLMHWPVSMK  120

Query  437  KDSVGFAP-ENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K SV     E+    +IP TWKAME LYDSGKARAIGV NFS
Sbjct  121  KGSVDVTKRESYTKPDIPKTWKAMEELYDSGKARAIGVCNFS  162



>ref|XP_006576246.1| PREDICTED: uncharacterized protein LOC100809492 isoform X1 [Glycine 
max]
Length=304

 Score =   201 bits (511),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 128/157 (82%), Gaps = 7/157 (4%)
 Frame = +2

Query  89   VKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGEVLKK  268
            ++ F LNTGAKIPSVGLGTW AEPGVV +A+  AI VGYRHIDCA+ YGNEKEIG  LKK
Sbjct  6    LRFFELNTGAKIPSVGLGTWLAEPGVVARALATAINVGYRHIDCAQIYGNEKEIGAALKK  65

Query  269  LFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMKKDSV  448
            LFADGVVKRED+FITSKLWC DH PE+VP A ++TL+DLQLDY+DLYLIHWPV  K    
Sbjct  66   LFADGVVKREDMFITSKLWCNDHLPENVPEAFDKTLQDLQLDYLDLYLIHWPVSAKNGK-  124

Query  449  GFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
                  L   +IP+TW+AMEALY+SGKA+AIGVSNFS
Sbjct  125  ------LTKPDIPSTWRAMEALYNSGKAQAIGVSNFS  155



>ref|XP_006493580.1| PREDICTED: aldo-keto reductase family 4 member C9-like isoform 
X2 [Citrus sinensis]
Length=320

 Score =   201 bits (512),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 132/157 (84%), Gaps = 0/157 (0%)
 Frame = +2

Query  89   VKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGEVLKK  268
            V+ F LN GAK+P +GLGTWQA+ GVV +A+  AIK GYRHIDCA  YGNEKEIG  LKK
Sbjct  9    VQYFELNNGAKMPPIGLGTWQAQHGVVAEAIAIAIKAGYRHIDCAYFYGNEKEIGTELKK  68

Query  269  LFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMKKDSV  448
            LF DGV+KREDL+ITSKLWC DHAPEDVP A+++TL+DLQ+DY+DLYL+HWPV  KK  +
Sbjct  69   LFEDGVIKREDLWITSKLWCCDHAPEDVPKAMDRTLQDLQIDYVDLYLVHWPVRTKKGFI  128

Query  449  GFAPENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
               PE+L+  +IP+TWKAMEALYDSGKARAIGVSNFS
Sbjct  129  SLNPEDLLQPDIPSTWKAMEALYDSGKARAIGVSNFS  165



>ref|XP_010529797.1| PREDICTED: aldo-keto reductase family 4 member C10-like isoform 
X1 [Tarenaya hassleriana]
Length=315

 Score =   201 bits (511),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 113/162 (70%), Positives = 129/162 (80%), Gaps = 1/162 (1%)
 Frame = +2

Query  77   MAGAVKCFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGE  256
            MA A+  F LNTGA IPSVGLGTWQA PGVVG +V  A+K+GYRHIDCA+ YGNEKE+G 
Sbjct  1    MANALVSFRLNTGAMIPSVGLGTWQAPPGVVGDSVVTAVKIGYRHIDCAQLYGNEKEVGN  60

Query  257  VLKKLFADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMK  436
             LKKLF +GVVKR++L+ITSKLW T HAPEDV  A+N +L DLQLDY+DLYL+HWPV MK
Sbjct  61   ALKKLFDEGVVKRDELWITSKLWNTHHAPEDVHEAMNGSLSDLQLDYVDLYLMHWPVSMK  120

Query  437  KDSVGFAP-ENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            K SV     E+    +IP TWKAME LYDSGKARAIGV NFS
Sbjct  121  KGSVDVTKRESYTKPDIPKTWKAMEELYDSGKARAIGVCNFS  162



>ref|XP_010037792.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Eucalyptus 
grandis]
 gb|KCW49536.1| hypothetical protein EUGRSUZ_K03059 [Eucalyptus grandis]
Length=324

 Score =   201 bits (512),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 109/155 (70%), Positives = 127/155 (82%), Gaps = 0/155 (0%)
 Frame = +2

Query  95   CFVLNTGAKIPSVGLGTWQAEPGVVGQAVEAAIKVGYRHIDCARRYGNEKEIGEVLKKLF  274
            CF LNTG KIPSVGLGTW+A PGVVGQAV  A++ GYRHIDCAR Y NEKEIG  LK+LF
Sbjct  17   CFDLNTGGKIPSVGLGTWKAPPGVVGQAVIEAVQAGYRHIDCARVYDNEKEIGVALKELF  76

Query  275  ADGVVKREDLFITSKLWCTDHAPEDVPVALNQTlkdlqldyidlyliHWPVPMKKDSVGF  454
            + GVV R ++FITSKLWC+DHA EDV  AL ++L+DLQLDY+DLYLIHWPV  K  + GF
Sbjct  77   STGVVDRNEMFITSKLWCSDHAAEDVSKALTRSLQDLQLDYVDLYLIHWPVRTKSGTRGF  136

Query  455  APENLIPANIPATWKAMEALYDSGKARAIGVSNFS  559
            APE+++P  +P TW AME LY SG+ARAIGVSNFS
Sbjct  137  APEDMVPLCLPETWTAMEGLYASGQARAIGVSNFS  171



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 631248065840