BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002B05

Length=490
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|NP_001275054.1|  probable mitochondrial-processing peptidase ...    212   1e-62   Solanum tuberosum [potatoes]
ref|XP_006338383.1|  PREDICTED: probable mitochondrial-processing...    204   2e-59   Solanum tuberosum [potatoes]
ref|XP_011085735.1|  PREDICTED: probable mitochondrial-processing...    198   2e-57   Sesamum indicum [beniseed]
gb|EPS67717.1|  mitochondrial processing peptidase                      198   3e-57   Genlisea aurea
ref|XP_010259364.1|  PREDICTED: probable mitochondrial-processing...    197   7e-57   Nelumbo nucifera [Indian lotus]
gb|AAK51086.1|AF363285_1  mitochondrial processing peptidase            196   3e-56   Avicennia marina
ref|XP_011098729.1|  PREDICTED: probable mitochondrial-processing...    194   7e-56   Sesamum indicum [beniseed]
ref|XP_010258107.1|  PREDICTED: probable mitochondrial-processing...    193   3e-55   Nelumbo nucifera [Indian lotus]
emb|CDP02290.1|  unnamed protein product                                192   4e-55   Coffea canephora [robusta coffee]
gb|EYU34612.1|  hypothetical protein MIMGU_mgv1a004447mg                187   5e-53   Erythranthe guttata [common monkey flower]
gb|KJB40891.1|  hypothetical protein B456_007G081900                    185   8e-53   Gossypium raimondii
ref|XP_009147385.1|  PREDICTED: probable mitochondrial-processing...    186   9e-53   Brassica rapa
emb|CDY43262.1|  BnaC05g48550D                                          186   1e-52   Brassica napus [oilseed rape]
gb|KHG26755.1|  hypothetical protein F383_04545                         186   2e-52   Gossypium arboreum [tree cotton]
gb|KJB40890.1|  hypothetical protein B456_007G081900                    185   3e-52   Gossypium raimondii
gb|KHG03167.1|  hypothetical protein F383_27059                         184   5e-52   Gossypium arboreum [tree cotton]
ref|XP_009360538.1|  PREDICTED: probable mitochondrial-processing...    184   6e-52   Pyrus x bretschneideri [bai li]
ref|XP_009360537.1|  PREDICTED: probable mitochondrial-processing...    184   6e-52   Pyrus x bretschneideri [bai li]
ref|XP_004156557.1|  PREDICTED: probable mitochondrial-processing...    182   6e-52   
ref|XP_006387548.1|  hypothetical protein POPTR_0863s00200g             181   6e-52   
gb|KHG03166.1|  hypothetical protein F383_27059                         184   7e-52   Gossypium arboreum [tree cotton]
ref|XP_008451674.1|  PREDICTED: probable mitochondrial-processing...    184   7e-52   
ref|NP_001284394.1|  probable mitochondrial-processing peptidase ...    184   8e-52   Cucumis melo [Oriental melon]
ref|XP_008379409.1|  PREDICTED: probable mitochondrial-processing...    184   9e-52   Malus domestica [apple tree]
ref|XP_006408449.1|  hypothetical protein EUTSA_v10020493mg             183   1e-51   Eutrema salsugineum [saltwater cress]
gb|KJB33442.1|  hypothetical protein B456_006G011200                    183   1e-51   Gossypium raimondii
ref|XP_008357912.1|  PREDICTED: probable mitochondrial-processing...    184   1e-51   
ref|NP_850500.1|  probable mitochondrial-processing peptidase sub...    183   1e-51   Arabidopsis thaliana [mouse-ear cress]
ref|NP_186858.1|  probable mitochondrial-processing peptidase sub...    183   1e-51   Arabidopsis thaliana [mouse-ear cress]
gb|KJB33443.1|  hypothetical protein B456_006G011200                    183   1e-51   Gossypium raimondii
ref|XP_002305398.2|  hypothetical protein POPTR_0004s117902g            181   2e-51   
ref|XP_010550013.1|  PREDICTED: probable mitochondrial-processing...    182   3e-51   Tarenaya hassleriana [spider flower]
ref|XP_004137198.1|  PREDICTED: probable mitochondrial-processing...    182   4e-51   Cucumis sativus [cucumbers]
ref|XP_010693397.1|  PREDICTED: probable mitochondrial-processing...    181   5e-51   Beta vulgaris subsp. vulgaris [field beet]
emb|CDY55794.1|  BnaCnng29060D                                          177   6e-51   Brassica napus [oilseed rape]
gb|EYU44179.1|  hypothetical protein MIMGU_mgv1a004428mg                181   7e-51   Erythranthe guttata [common monkey flower]
ref|XP_010550014.1|  PREDICTED: probable mitochondrial-processing...    182   7e-51   Tarenaya hassleriana [spider flower]
ref|XP_002323895.1|  mitochondrial processing peptidase beta subu...    181   1e-50   Populus trichocarpa [western balsam poplar]
ref|XP_011013432.1|  PREDICTED: probable mitochondrial-processing...    181   1e-50   Populus euphratica
ref|XP_011000102.1|  PREDICTED: probable mitochondrial-processing...    181   1e-50   Populus euphratica
ref|XP_010089616.1|  putative mitochondrial-processing peptidase ...    180   2e-50   Morus notabilis
ref|XP_009365858.1|  PREDICTED: probable mitochondrial-processing...    180   2e-50   Pyrus x bretschneideri [bai li]
ref|XP_009117791.1|  PREDICTED: probable mitochondrial-processing...    179   3e-50   
emb|CAN71501.1|  hypothetical protein VITISV_006460                     179   3e-50   Vitis vinifera
ref|XP_002284370.1|  PREDICTED: probable mitochondrial-processing...    179   3e-50   Vitis vinifera
emb|CDY34703.1|  BnaA01g33220D                                          179   3e-50   Brassica napus [oilseed rape]
ref|XP_009117783.1|  PREDICTED: probable mitochondrial-processing...    179   4e-50   Brassica rapa
ref|XP_007215683.1|  hypothetical protein PRUPE_ppa004059mg             179   7e-50   Prunus persica
ref|XP_008230864.1|  PREDICTED: probable mitochondrial-processing...    178   8e-50   Prunus mume [ume]
ref|XP_009775818.1|  PREDICTED: probable mitochondrial-processing...    178   9e-50   Nicotiana sylvestris
ref|XP_002526098.1|  mitochondrial processing peptidase beta subu...    177   9e-50   
ref|NP_001275163.1|  probable mitochondrial-processing peptidase ...    178   1e-49   Solanum tuberosum [potatoes]
ref|XP_007140694.1|  hypothetical protein PHAVU_008G133900g             178   1e-49   Phaseolus vulgaris [French bean]
gb|AAB28041.1|  cytochrome c reductase-processing peptidase subun...    178   1e-49   Solanum tuberosum [potatoes]
ref|XP_004492264.1|  PREDICTED: probable mitochondrial-processing...    178   1e-49   Cicer arietinum [garbanzo]
ref|XP_004239065.1|  PREDICTED: probable mitochondrial-processing...    177   2e-49   Solanum lycopersicum
ref|XP_006482732.1|  PREDICTED: probable mitochondrial-processing...    177   2e-49   Citrus sinensis [apfelsine]
ref|XP_009397752.1|  PREDICTED: probable mitochondrial-processing...    177   2e-49   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004304237.1|  PREDICTED: probable mitochondrial-processing...    177   2e-49   Fragaria vesca subsp. vesca
ref|XP_003532256.1|  PREDICTED: probable mitochondrial-processing...    177   3e-49   Glycine max [soybeans]
ref|XP_003552094.1|  PREDICTED: probable mitochondrial-processing...    176   4e-49   Glycine max [soybeans]
gb|KEH22544.1|  processing peptidase                                    176   6e-49   Medicago truncatula
ref|XP_006431275.1|  hypothetical protein CICLE_v10011465mg             176   8e-49   Citrus clementina [clementine]
ref|XP_007032695.1|  Insulinase (Peptidase family M16) protein is...    176   9e-49   
ref|XP_007032698.1|  Insulinase (Peptidase family M16) protein is...    176   9e-49   
ref|XP_009388910.1|  PREDICTED: probable mitochondrial-processing...    175   1e-48   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007032696.1|  Insulinase (Peptidase family M16) protein is...    176   1e-48   
ref|XP_009610110.1|  PREDICTED: probable mitochondrial-processing...    175   1e-48   Nicotiana tomentosiformis
gb|KHG02693.1|  hypothetical protein F383_26252                         174   3e-48   Gossypium arboreum [tree cotton]
gb|KCW57278.1|  hypothetical protein EUGRSUZ_H00078                     174   3e-48   Eucalyptus grandis [rose gum]
ref|XP_002871668.1|  hypothetical protein ARALYDRAFT_909526             174   3e-48   Arabidopsis lyrata subsp. lyrata
gb|KDP27225.1|  hypothetical protein JCGZ_19924                         174   3e-48   Jatropha curcas
ref|XP_010069059.1|  PREDICTED: probable mitochondrial-processing...    174   4e-48   Eucalyptus grandis [rose gum]
dbj|BAH57104.1|  AT3G02090                                              172   6e-48   Arabidopsis thaliana [mouse-ear cress]
gb|AIG20406.1|  mitochondrial processing peptidase beta subunit         173   6e-48   Brassica oleracea var. alboglabra [Chinese broccoli]
gb|KFK37669.1|  hypothetical protein AALP_AA3G013300                    173   7e-48   Arabis alpina [alpine rockcress]
ref|XP_006599164.1|  PREDICTED: probable mitochondrial-processing...    171   1e-47   
ref|XP_009408617.1|  PREDICTED: probable mitochondrial-processing...    172   2e-47   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006287485.1|  hypothetical protein CARUB_v10000696mg             172   2e-47   Capsella rubella
ref|XP_003547775.1|  PREDICTED: probable mitochondrial-processing...    171   6e-47   Glycine max [soybeans]
ref|XP_002882205.1|  predicted protein                                  171   7e-47   Arabidopsis lyrata subsp. lyrata
ref|XP_010525113.1|  PREDICTED: probable mitochondrial-processing...    170   1e-46   Tarenaya hassleriana [spider flower]
ref|XP_008792725.1|  PREDICTED: probable mitochondrial-processing...    168   4e-46   Phoenix dactylifera
ref|XP_010936330.1|  PREDICTED: probable mitochondrial-processing...    167   7e-46   Elaeis guineensis
ref|XP_010463599.1|  PREDICTED: probable mitochondrial-processing...    167   2e-45   Camelina sativa [gold-of-pleasure]
ref|XP_010463600.1|  PREDICTED: probable mitochondrial-processing...    167   2e-45   Camelina sativa [gold-of-pleasure]
ref|XP_010485442.1|  PREDICTED: probable mitochondrial-processing...    166   3e-45   Camelina sativa [gold-of-pleasure]
ref|XP_008805108.1|  PREDICTED: probable mitochondrial-processing...    164   4e-45   
ref|XP_010443247.1|  PREDICTED: probable mitochondrial-processing...    166   4e-45   Camelina sativa [gold-of-pleasure]
ref|XP_010485443.1|  PREDICTED: probable mitochondrial-processing...    166   4e-45   Camelina sativa [gold-of-pleasure]
gb|KFK25778.1|  hypothetical protein AALP_AA8G159200                    166   4e-45   Arabis alpina [alpine rockcress]
ref|XP_010443979.1|  PREDICTED: probable mitochondrial-processing...    166   4e-45   Camelina sativa [gold-of-pleasure]
ref|XP_006837053.1|  hypothetical protein AMTR_s00110p00066820          164   5e-45   
ref|XP_006297347.1|  hypothetical protein CARUB_v10013366mg             166   6e-45   
ref|XP_010649506.1|  PREDICTED: probable mitochondrial-processing...    164   8e-45   
ref|XP_010939148.1|  PREDICTED: LOW QUALITY PROTEIN: probable mit...    164   1e-44   Elaeis guineensis
ref|XP_008805107.1|  PREDICTED: probable mitochondrial-processing...    164   1e-44   Phoenix dactylifera
gb|KJB75639.1|  hypothetical protein B456_012G049500                    164   1e-44   Gossypium raimondii
ref|XP_010649504.1|  PREDICTED: probable mitochondrial-processing...    164   2e-44   Vitis vinifera
gb|EAY89022.1|  hypothetical protein OsI_10505                          164   2e-44   Oryza sativa Indica Group [Indian rice]
ref|NP_001049357.1|  Os03g0212700                                       164   3e-44   
gb|KJB75638.1|  hypothetical protein B456_012G049500                    162   6e-44   Gossypium raimondii
ref|XP_010492395.1|  PREDICTED: probable mitochondrial-processing...    162   7e-44   Camelina sativa [gold-of-pleasure]
gb|AFW89241.1|  peptidase beta subunit                                  160   3e-43   
ref|NP_001149620.1|  LOC100283246                                       160   4e-43   
ref|XP_010420217.1|  PREDICTED: probable mitochondrial-processing...    160   7e-43   Camelina sativa [gold-of-pleasure]
gb|EEE58574.1|  hypothetical protein OsJ_09894                          158   2e-42   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002468288.1|  hypothetical protein SORBIDRAFT_01g043060          157   4e-42   Sorghum bicolor [broomcorn]
ref|XP_010316226.1|  PREDICTED: LOW QUALITY PROTEIN: probable mit...    157   7e-42   
ref|XP_004985217.1|  PREDICTED: probable mitochondrial-processing...    155   3e-41   Setaria italica
ref|XP_004985216.1|  PREDICTED: probable mitochondrial-processing...    155   3e-41   
ref|NP_001130423.1|  uncharacterized protein LOC100191520               154   1e-40   Zea mays [maize]
ref|XP_007134165.1|  hypothetical protein PHAVU_010G024900g             153   1e-40   Phaseolus vulgaris [French bean]
emb|CAA56519.1|  mitochondrial processing peptidase                     152   3e-40   Solanum tuberosum [potatoes]
ref|XP_003558505.1|  PREDICTED: probable mitochondrial-processing...    152   4e-40   Brachypodium distachyon [annual false brome]
dbj|BAE98412.1|  putative mitochondrial processing peptidase            150   1e-39   Arabidopsis thaliana [mouse-ear cress]
gb|AAB28042.1|  cytochrome c reductase-processing peptidase subun...    149   5e-39   Solanum tuberosum [potatoes]
dbj|BAJ87789.1|  predicted protein                                      147   2e-38   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010680726.1|  PREDICTED: probable mitochondrial-processing...    140   5e-36   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006651164.1|  PREDICTED: probable mitochondrial-processing...    134   8e-34   Oryza brachyantha
ref|XP_002986789.1|  hypothetical protein SELMODRAFT_158279             132   4e-33   Selaginella moellendorffii
ref|XP_002969499.1|  hypothetical protein SELMODRAFT_146300             132   4e-33   Selaginella moellendorffii
ref|XP_001766086.1|  predicted protein                                  130   3e-32   
ref|XP_010943695.1|  PREDICTED: probable mitochondrial-processing...    107   2e-24   
ref|XP_010943628.1|  PREDICTED: probable mitochondrial-processing...    107   3e-24   Elaeis guineensis
ref|XP_003059696.1|  predicted protein                                  106   9e-24   Micromonas pusilla CCMP1545
emb|CBW52774.1|  ubiquinol:cytochrome c oxidoreductase 50 kDa cor...    105   3e-23   Polytomella sp. Pringsheim 198.80
ref|XP_008808512.1|  PREDICTED: probable mitochondrial-processing...    103   4e-23   
ref|XP_008808511.1|  PREDICTED: probable mitochondrial-processing...    103   9e-23   Phoenix dactylifera
gb|KIY91868.1|  hypothetical protein MNEG_16094                       99.0    1e-22   Monoraphidium neglectum
emb|CDM83807.1|  unnamed protein product                                103   2e-22   Triticum aestivum [Canadian hard winter wheat]
dbj|BAJ93474.1|  predicted protein                                      103   2e-22   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AFW83727.1|  hypothetical protein ZEAMMB73_211594                  99.0    4e-21   
ref|NP_001145782.1|  uncharacterized protein LOC100279289             99.0    5e-21   Zea mays [maize]
ref|XP_002948116.1|  hypothetical protein VOLCADRAFT_109656           99.0    5e-21   Volvox carteri f. nagariensis
ref|XP_009395786.1|  PREDICTED: probable mitochondrial-processing...  98.6    6e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_001697021.1|  ubiquinol:cytochrome c oxidoreductase 50 kDa...  98.6    7e-21   Chlamydomonas reinhardtii
gb|EMT32156.1|  Putative mitochondrial-processing peptidase subun...  99.8    8e-21   
ref|XP_003569667.1|  PREDICTED: probable mitochondrial-processing...  97.8    1e-20   Brachypodium distachyon [annual false brome]
ref|XP_004969725.1|  PREDICTED: probable mitochondrial-processing...  95.9    3e-20   
ref|XP_002456239.1|  hypothetical protein SORBIDRAFT_03g032670        96.3    4e-20   Sorghum bicolor [broomcorn]
ref|XP_004969724.1|  PREDICTED: probable mitochondrial-processing...  95.9    6e-20   Setaria italica
ref|XP_011396017.1|  putative mitochondrial-processing peptidase ...  95.9    6e-20   Auxenochlorella protothecoides
dbj|GAC94181.1|  hypothetical protein PHSY_001752                     93.2    8e-20   Pseudozyma hubeiensis SY62
gb|KIJ62690.1|  hypothetical protein HYDPIDRAFT_176479                95.1    8e-20   Hydnomerulius pinastri MD-312
ref|XP_002778427.1|  conserved hypothetical protein                   94.4    1e-19   Perkinsus marinus ATCC 50983
ref|XP_006858364.1|  hypothetical protein AMTR_s00064p00192980        93.6    2e-19   
ref|XP_002768300.1|  conserved hypothetical protein                   94.4    2e-19   Perkinsus marinus ATCC 50983
gb|KIO02691.1|  hypothetical protein M404DRAFT_1001905                94.0    2e-19   Pisolithus tinctorius Marx 270
ref|XP_007319485.1|  core subunit of the ubiquinol-cytochrome c r...  94.0    3e-19   Serpula lacrymans var. lacrymans S7.9
gb|EGN98147.1|  hypothetical protein SERLA73DRAFT_183038              94.0    3e-19   Serpula lacrymans var. lacrymans S7.3
gb|KDN44556.1|  putative MAS1-mitochondrial processing peptidase ...  94.0    3e-19   Tilletiaria anomala UBC 951
gb|EAY75568.1|  hypothetical protein OsI_03472                        94.0    3e-19   Oryza sativa Indica Group [Indian rice]
gb|KIK92447.1|  hypothetical protein PAXRUDRAFT_829946                93.6    4e-19   Paxillus rubicundulus Ve08.2h10
gb|KIJ19355.1|  hypothetical protein PAXINDRAFT_166565                93.2    4e-19   Paxillus involutus ATCC 200175
ref|XP_003739385.1|  PREDICTED: LOW QUALITY PROTEIN: mitochondria...  93.2    4e-19   Galendromus occidentalis
gb|EAZ13291.1|  hypothetical protein OsJ_03216                        93.6    4e-19   Oryza sativa Japonica Group [Japonica rice]
emb|CBQ71265.1|  probable MAS1-mitochondrial processing peptidase...  93.2    5e-19   Sporisorium reilianum SRZ2
dbj|BAD81527.1|  putative ubiquinol-cytochrome-c reductase            93.2    5e-19   Oryza sativa Japonica Group [Japonica rice]
emb|CCF49102.1|  probable MAS1-mitochondrial processing peptidase...  93.2    5e-19   Ustilago hordei
gb|KDQ11106.1|  hypothetical protein BOTBODRAFT_190057                93.2    5e-19   Botryobasidium botryosum FD-172 SS1
ref|XP_011392498.1|  putative metalloendopeptidase contributor        93.2    5e-19   Ustilago maydis 521
gb|EST07296.1|  G protein beta subunit-like protein                   93.2    6e-19   Kalmanozyma brasiliensis GHG001
emb|CDI56561.1|  probable MAS1-mitochondrial processing peptidase...  92.8    6e-19   Melanopsichium pennsylvanicum 4
ref|XP_009493536.1|  hypothetical protein H696_01367                  92.8    6e-19   Fonticula alba
dbj|GAK67360.1|  core subunit of the ubiquinol-cytochrome c reduc...  92.8    7e-19   Moesziomyces antarcticus
dbj|GAC76356.1|  G protein beta subunit-like protein                  92.8    7e-19   Moesziomyces antarcticus T-34
gb|ETS60436.1|  hypothetical protein PaG_05648                        92.8    7e-19   Moesziomyces aphidis DSM 70725
ref|XP_007881939.1|  hypothetical protein PFL1_06209                  92.0    1e-18   Anthracocystis flocculosa PF-1
ref|XP_002108929.1|  hypothetical protein TRIADDRAFT_63547            91.7    1e-18   Trichoplax adhaerens
dbj|BAK06609.1|  predicted protein                                    91.7    2e-18   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KIK48045.1|  hypothetical protein CY34DRAFT_798666                 91.7    2e-18   Suillus luteus UH-Slu-Lm8-n1
gb|KIJ49532.1|  hypothetical protein M422DRAFT_225340                 91.3    2e-18   Sphaerobolus stellatus SS14
ref|XP_009546668.1|  putative metallo peptidase M16                   91.3    2e-18   Heterobasidion irregulare TC 32-1
gb|EMD39674.1|  mitochondrial-processing peptidase subunit beta       91.3    2e-18   Gelatoporia subvermispora B
ref|XP_007333741.1|  QCR1 core subunit of the ubiquinol-cytochrom...  91.3    2e-18   Agaricus bisporus var. burnettii JB137-S8
ref|XP_006463920.1|  core subunit of the ubiquinol-cytochrome c r...  90.9    3e-18   Agaricus bisporus var. bisporus H97
ref|XP_007401794.1|  hypothetical protein PHACADRAFT_265392           91.3    3e-18   Phanerochaete carnosa HHB-10118-sp
gb|KFD57346.1|  hypothetical protein M513_01857                       90.9    4e-18   Trichuris suis
ref|XP_007341051.1|  mitochondrial processing peptidase beta subunit  90.5    4e-18   
ref|XP_007309517.1|  hypothetical protein STEHIDRAFT_161892           90.5    5e-18   Stereum hirsutum FP-91666 SS1
ref|XP_006679836.1|  hypothetical protein BATDEDRAFT_20015            90.1    5e-18   Batrachochytrium dendrobatidis JAM81
ref|XP_006808720.1|  PREDICTED: mitochondrial-processing peptidas...  89.7    6e-18   Neolamprologus brichardi [lyretail cichlid]
ref|XP_005755231.1|  PREDICTED: mitochondrial-processing peptidas...  90.1    6e-18   Pundamilia nyererei
gb|EJU03090.1|  hypothetical protein DACRYDRAFT_21414                 90.1    6e-18   Dacryopinax primogenitus
gb|KFD72731.1|  hypothetical protein M514_01857                       90.1    7e-18   Trichuris suis
gb|EPT00287.1|  hypothetical protein FOMPIDRAFT_1023870               89.7    7e-18   Fomitopsis pinicola FP-58527 SS1
ref|XP_007867025.1|  hypothetical protein GLOTRDRAFT_106396           89.7    8e-18   Gloeophyllum trabeum ATCC 11539
ref|XP_006140849.1|  PREDICTED: mitochondrial-processing peptidas...  89.7    8e-18   Tupaia chinensis
gb|ADD95721.1|  predicted protein                                     89.7    8e-18   uncultured organism MedDCM-OCT-S04-C161
ref|XP_005951901.1|  PREDICTED: mitochondrial-processing peptidas...  89.7    9e-18   Haplochromis burtoni
ref|XP_004576241.1|  PREDICTED: mitochondrial-processing peptidas...  89.7    9e-18   Maylandia zebra
ref|NP_501576.2|  Protein MPPB-1                                      89.4    1e-17   Caenorhabditis elegans [roundworm]
ref|XP_003385964.1|  PREDICTED: mitochondrial-processing peptidas...  89.4    1e-17   Amphimedon queenslandica
ref|XP_007509720.1|  predicted protein                                89.7    1e-17   Bathycoccus prasinos
gb|AAW78940.1|  GekBS094P                                             85.5    1e-17   Gekko japonicus
ref|XP_002632993.1|  C. briggsae CBR-MPPB-1 protein                   89.0    1e-17   Caenorhabditis briggsae
gb|EUC55192.1|  QCR1 core subunit of the ubiquinol-cytochrome C r...  89.0    1e-17   Rhizoctonia solani AG-3 Rhs1AP
gb|KIM20096.1|  hypothetical protein M408DRAFT_18639                  89.0    1e-17   Serendipita vermifera MAFF 305830
gb|KIM26404.1|  hypothetical protein M408DRAFT_330589                 89.0    1e-17   Serendipita vermifera MAFF 305830
ref|XP_008509794.1|  PREDICTED: mitochondrial-processing peptidas...  86.7    2e-17   Equus przewalskii [Przewalski horse]
ref|XP_007768537.1|  mitochondrial processing peptidase beta subunit  88.6    2e-17   Coniophora puteana RWD-64-598 SS2
ref|XP_001631568.1|  predicted protein                                89.0    2e-17   Nematostella vectensis
emb|CDR44724.1|  RHTO0S09e08020g1_1                                   88.6    2e-17   Rhodotorula toruloides
gb|EDL99415.1|  peptidase (mitochondrial processing) beta, isofor...  85.5    2e-17   Rattus norvegicus [brown rat]
gb|EMS19853.1|  mitochondrial processing peptidase beta subunit       88.6    2e-17   Rhodotorula toruloides NP11
ref|XP_010349997.1|  PREDICTED: mitochondrial-processing peptidas...  85.9    2e-17   Saimiri boliviensis boliviensis
ref|XP_006774967.1|  PREDICTED: mitochondrial-processing peptidas...  88.6    2e-17   
emb|CCL99463.1|  predicted protein                                    89.0    2e-17   Fibroporia radiculosa
emb|CEL58503.1|  mitochondrial processing peptidase                   88.6    2e-17   Rhizoctonia solani AG-1 IB
ref|XP_006085511.1|  PREDICTED: mitochondrial-processing peptidas...  88.6    2e-17   
ref|XP_006014114.1|  PREDICTED: mitochondrial-processing peptidas...  86.3    2e-17   
emb|CCI44798.1|  unnamed protein product                              88.2    2e-17   Albugo candida
ref|XP_004354528.1|  mitochondrial processing peptidase beta subunit  88.2    2e-17   Cavenderia fasciculata
gb|EDL99416.1|  peptidase (mitochondrial processing) beta, isofor...  86.7    2e-17   Rattus norvegicus [brown rat]
ref|XP_003171073.1|  hypothetical protein MGYG_07071                  84.0    2e-17   Nannizzia gypsea CBS 118893
ref|XP_005863048.1|  PREDICTED: mitochondrial-processing peptidas...  88.6    2e-17   
ref|XP_005650094.1|  putative mitochondrial processing peptidase      88.6    3e-17   Coccomyxa subellipsoidea C-169
ref|XP_011138830.1|  PREDICTED: mitochondrial-processing peptidas...  88.2    3e-17   Harpegnathos saltator
ref|XP_002291589.1|  probable mitochondrial processing peptidase      88.2    3e-17   Thalassiosira pseudonana CCMP1335
ref|XP_006987875.1|  PREDICTED: mitochondrial-processing peptidas...  88.2    3e-17   
ref|XP_004677214.1|  PREDICTED: mitochondrial-processing peptidas...  88.6    3e-17   
ref|XP_006090203.1|  PREDICTED: mitochondrial-processing peptidas...  88.2    3e-17   Myotis lucifugus
gb|KDN37296.1|  Mitochondrial-processing peptidase subunit beta       87.0    3e-17   Rhizoctonia solani AG-8 WAC10335
emb|CCA73308.1|  probable MAS1-mitochondrial processing peptidase...  88.2    3e-17   Serendipita indica DSM 11827
ref|XP_008323676.1|  PREDICTED: mitochondrial-processing peptidas...  88.2    3e-17   Cynoglossus semilaevis [half-smooth tongue sole]
gb|EFA82909.1|  mitochondrial processing peptidase beta subunit       88.2    3e-17   Heterostelium album PN500
ref|XP_002180975.1|  predicted protein                                88.2    3e-17   Phaeodactylum tricornutum CCAP 1055/1
ref|XP_008828982.1|  PREDICTED: mitochondrial-processing peptidas...  88.2    3e-17   Nannospalax galili
gb|KFG31663.1|  mitochondrial processing peptidase                    84.3    3e-17   Toxoplasma gondii GAB2-2007-GAL-DOM2
ref|XP_008037964.1|  mitochondrial processing peptidase beta subunit  87.8    3e-17   Trametes versicolor FP-101664 SS1
gb|EDL99418.1|  peptidase (mitochondrial processing) beta, isofor...  85.5    3e-17   Rattus norvegicus [brown rat]
ref|XP_007641060.1|  PREDICTED: mitochondrial-processing peptidas...  87.8    3e-17   
gb|EDL03196.1|  mCG6419, isoform CRA_c                                85.5    4e-17   Mus musculus [mouse]
ref|XP_006462420.1|  hypothetical protein AGABI2DRAFT_193572          87.8    4e-17   Agaricus bisporus var. bisporus H97
ref|XP_003771525.1|  PREDICTED: mitochondrial-processing peptidas...  87.8    4e-17   Sarcophilus harrisii
ref|XP_007329879.1|  hypothetical protein AGABI1DRAFT_113744          87.8    4e-17   Agaricus bisporus var. burnettii JB137-S8
sp|Q9Y8B5.1|MPPB_LENED  RecName: Full=Mitochondrial-processing pe...  87.8    4e-17   Lentinula edodes
ref|XP_005358415.1|  PREDICTED: mitochondrial-processing peptidas...  87.8    4e-17   Microtus ochrogaster [prairie voles]
sp|Q00302.1|MPPB_BLAEM  RecName: Full=Mitochondrial-processing pe...  87.8    4e-17   Blastocladiella emersonii
gb|KIM78462.1|  hypothetical protein PILCRDRAFT_824358                87.8    4e-17   Piloderma croceum F 1598
ref|XP_007380034.1|  hypothetical protein PUNSTDRAFT_141164           87.8    4e-17   Punctularia strigosozonata HHB-11173 SS5
gb|KIL64372.1|  hypothetical protein M378DRAFT_163408                 87.8    4e-17   Amanita muscaria Koide BX008
gb|AAB84398.1|  mitochondrial processing protease beta precursor      84.7    4e-17   Drosophila silvestris
gb|EDL99419.1|  peptidase (mitochondrial processing) beta, isofor...  85.5    4e-17   Rattus norvegicus [brown rat]
ref|XP_007504129.1|  PREDICTED: mitochondrial-processing peptidas...  88.2    4e-17   Monodelphis domestica
gb|KJA16954.1|  hypothetical protein HYPSUDRAFT_192662                87.8    4e-17   Hypholoma sublateritium FD-334 SS-4
ref|XP_007271781.1|  hypothetical protein FOMMEDRAFT_129851           87.4    4e-17   Fomitiporia mediterranea MF3/22
ref|XP_005679165.1|  PREDICTED: mitochondrial-processing peptidas...  87.8    4e-17   
ref|XP_004007875.1|  PREDICTED: mitochondrial-processing peptidas...  87.8    5e-17   
ref|XP_005961132.1|  PREDICTED: mitochondrial-processing peptidas...  87.8    5e-17   Pantholops hodgsonii [Tibetan antelope]
gb|KDE03116.1|  mitochondrial-processing peptidase subunit beta       87.4    5e-17   Microbotryum lychnidis-dioicae p1A1 Lamole
ref|XP_001875696.1|  predicted protein                                87.4    5e-17   Laccaria bicolor S238N-H82
emb|CCA16112.1|  mitochondrialprocessing peptidase subunit beta puta  87.4    5e-17   Albugo laibachii Nc14
gb|KIO29559.1|  hypothetical protein M407DRAFT_14489                  87.4    6e-17   Tulasnella calospora MUT 4182
emb|CBJ28316.1|  Mitochondrial Processing Peptidase beta subunit ...  87.4    6e-17   Ectocarpus siliculosus
emb|CDO73974.1|  hypothetical protein BN946_scf185043.g23             86.7    6e-17   Trametes cinnabarina
gb|KFH65272.1|  mitochondrial-processing peptidase subunit beta       87.0    6e-17   Mortierella verticillata NRRL 6337
ref|XP_004349090.1|  peptidase beta                                   87.0    6e-17   Capsaspora owczarzaki ATCC 30864
ref|XP_007641059.1|  PREDICTED: mitochondrial-processing peptidas...  87.4    6e-17   
gb|KDO27764.1|  hypothetical protein SPRG_07363                       87.0    7e-17   Saprolegnia parasitica CBS 223.65
ref|XP_002908827.1|  mitochondrial-processing peptidase subunit beta  87.0    7e-17   Phytophthora infestans T30-4
ref|XP_007641061.1|  PREDICTED: mitochondrial-processing peptidas...  87.4    7e-17   
ref|XP_005319524.1|  PREDICTED: mitochondrial-processing peptidas...  87.0    7e-17   Ictidomys tridecemlineatus
ref|XP_008904756.1|  hypothetical protein PPTG_10972                  87.0    7e-17   Phytophthora parasitica INRA-310
gb|KDQ25420.1|  core subunit of the ubiquinol-cytochrome c reduct...  87.0    7e-17   Pleurotus ostreatus PC15
emb|CAF93398.1|  unnamed protein product                              87.0    7e-17   Tetraodon nigroviridis
ref|XP_010983110.1|  PREDICTED: mitochondrial-processing peptidas...  87.0    8e-17   Camelus dromedarius [camel]
ref|XP_008608265.1|  mitochondrial processing peptidase               86.7    8e-17   Saprolegnia diclina VS20
ref|XP_009829539.1|  hypothetical protein H257_06124                  87.0    8e-17   Aphanomyces astaci
ref|XP_010944970.1|  PREDICTED: mitochondrial-processing peptidas...  87.0    8e-17   Camelus bactrianus [camel]
ref|XP_006198630.1|  PREDICTED: mitochondrial-processing peptidas...  87.0    8e-17   Vicugna pacos
gb|EGT34239.1|  CBN-MPPB-1 protein                                    86.7    8e-17   Caenorhabditis brenneri
gb|ETK87788.1|  hypothetical protein L915_07832                       87.0    8e-17   Phytophthora parasitica
ref|XP_007366221.1|  mitochondrial processing peptidase beta subunit  87.0    8e-17   Dichomitus squalens LYAD-421 SS1
ref|XP_009529851.1|  hypothetical protein PHYSODRAFT_545625           86.7    8e-17   Phytophthora sojae
gb|KGG50235.1|  hypothetical protein DI09_7p140                       86.7    9e-17   Mitosporidium daphniae
gb|KDR82408.1|  hypothetical protein GALMADRAFT_134032                86.7    9e-17   Galerina marginata CBS 339.88
ref|XP_004652947.1|  PREDICTED: mitochondrial-processing peptidas...  86.7    9e-17   Jaculus jaculus
gb|AEE61908.1|  unknown                                               86.7    9e-17   
ref|XP_010885582.1|  PREDICTED: mitochondrial-processing peptidas...  86.7    1e-16   
emb|CDQ89021.1|  unnamed protein product                              86.3    1e-16   
ref|XP_006633526.1|  PREDICTED: mitochondrial-processing peptidas...  86.7    1e-16   
ref|XP_008862015.1|  hypothetical protein H310_00858                  86.7    1e-16   
ref|XP_004439399.1|  PREDICTED: mitochondrial-processing peptidas...  86.7    1e-16   
ref|NP_001029785.1|  mitochondrial-processing peptidase subunit b...  86.7    1e-16   
ref|XP_008590511.1|  PREDICTED: mitochondrial-processing peptidas...  86.7    1e-16   
ref|XP_007532743.1|  PREDICTED: mitochondrial-processing peptidas...  86.7    1e-16   
ref|XP_007532744.1|  PREDICTED: mitochondrial-processing peptidas...  86.7    1e-16   
ref|XP_004479042.1|  PREDICTED: mitochondrial-processing peptidas...  86.7    1e-16   
ref|XP_010885583.1|  PREDICTED: mitochondrial-processing peptidas...  86.7    1e-16   
ref|XP_005895313.1|  PREDICTED: mitochondrial-processing peptidas...  86.7    1e-16   
ref|XP_007669158.1|  PREDICTED: mitochondrial-processing peptidas...  86.7    1e-16   
gb|KDQ62146.1|  hypothetical protein JAAARDRAFT_189512                86.7    1e-16   
ref|XP_002910711.1|  mitochondrial-processing peptidase subunit beta  87.4    1e-16   
ref|XP_005377286.1|  PREDICTED: mitochondrial-processing peptidas...  86.7    1e-16   
ref|XP_004591410.1|  PREDICTED: mitochondrial-processing peptidas...  86.7    1e-16   
ref|XP_009269439.1|  hypothetical protein J056_001536                 86.3    1e-16   
ref|XP_004390779.1|  PREDICTED: mitochondrial-processing peptidas...  86.7    1e-16   
gb|EJK75804.1|  hypothetical protein THAOC_02464                      86.3    1e-16   
ref|XP_007942807.1|  PREDICTED: mitochondrial-processing peptidas...  86.3    1e-16   
dbj|GAM19886.1|  hypothetical protein SAMD00019534_030610             86.3    1e-16   
gb|KIM42976.1|  hypothetical protein M413DRAFT_69963                  86.3    1e-16   
gb|KIK63838.1|  hypothetical protein GYMLUDRAFT_95394                 86.3    1e-16   
ref|XP_010635334.1|  PREDICTED: mitochondrial-processing peptidas...  86.3    1e-16   
ref|XP_011052600.1|  PREDICTED: mitochondrial-processing peptidas...  86.3    2e-16   
gb|EPZ35276.1|  Peptidase M16, zinc-binding site domain-containin...  85.9    2e-16   
ref|XP_011172112.1|  PREDICTED: mitochondrial-processing peptidas...  86.3    2e-16   
ref|XP_001948008.1|  PREDICTED: mitochondrial-processing peptidas...  86.3    2e-16   
ref|XP_011260098.1|  PREDICTED: mitochondrial-processing peptidas...  85.9    2e-16   
ref|XP_003370241.1|  peptidase, M16 family                            85.1    2e-16   
gb|ESS30954.1|  putative peptidase M16 family potein                  84.3    2e-16   
ref|XP_008060688.1|  PREDICTED: mitochondrial-processing peptidas...  86.7    2e-16   
emb|CDW53803.1|  Peptidase M16 C and Peptidase M16 domain contain...  85.5    2e-16   
ref|XP_006882745.1|  PREDICTED: mitochondrial-processing peptidas...  85.9    2e-16   
ref|XP_011204143.1|  PREDICTED: mitochondrial-processing peptidas...  85.9    2e-16   
sp|Q03346.3|MPPB_RAT  RecName: Full=Mitochondrial-processing pept...  85.9    2e-16   
dbj|BAA03007.1|  mitochondrial processing protease                    85.9    2e-16   
ref|NP_071790.1|  mitochondrial-processing peptidase subunit beta...  85.9    2e-16   
ref|XP_002928710.1|  PREDICTED: mitochondrial-processing peptidas...  85.9    2e-16   
ref|NP_001012514.1|  mitochondrial-processing peptidase subunit beta  85.9    2e-16   
ref|XP_004533197.1|  PREDICTED: mitochondrial-processing peptidas...  85.9    2e-16   
ref|XP_533104.3|  PREDICTED: mitochondrial-processing peptidase s...  85.9    2e-16   
ref|XP_003982736.1|  PREDICTED: mitochondrial-processing peptidas...  85.9    2e-16   
ref|XP_007129526.1|  PREDICTED: mitochondrial-processing peptidas...  85.9    2e-16   
ref|XP_008684373.1|  PREDICTED: mitochondrial-processing peptidas...  85.9    2e-16   
ref|XP_007083991.1|  PREDICTED: mitochondrial-processing peptidas...  85.9    2e-16   
dbj|BAE41163.1|  unnamed protein product                              85.9    2e-16   
emb|CEG02134.1|  Metalloenzyme, LuxS/M16 peptidase-like               85.5    2e-16   
ref|XP_006731962.1|  PREDICTED: mitochondrial-processing peptidas...  85.9    2e-16   
gb|KIJ96154.1|  hypothetical protein K443DRAFT_682488                 85.5    2e-16   
ref|NP_082707.1|  mitochondrial-processing peptidase subunit beta...  85.9    2e-16   
ref|XP_006925454.1|  PREDICTED: mitochondrial-processing peptidas...  85.9    2e-16   
gb|KIY69338.1|  hypothetical protein CYLTODRAFT_393971                85.5    2e-16   
ref|XP_007792577.1|  putative mitochondrial-processing peptidase ...  85.5    2e-16   
ref|XP_003782661.1|  PREDICTED: mitochondrial-processing peptidas...  85.5    2e-16   
ref|XP_005631033.1|  PREDICTED: mitochondrial-processing peptidas...  85.9    3e-16   
ref|XP_003407047.1|  PREDICTED: mitochondrial-processing peptidas...  85.5    3e-16   
ref|XP_007233744.1|  PREDICTED: mitochondrial-processing peptidas...  85.5    3e-16   
ref|XP_001422582.1|  predicted protein                                85.1    3e-16   
emb|CBK20240.2|  Mitochondrial-processing peptidase (subunit ?)       85.5    3e-16   
ref|XP_002712070.1|  PREDICTED: mitochondrial-processing peptidas...  85.5    3e-16   
ref|XP_002407106.1|  processing peptidase beta subunit, putative      85.5    3e-16   
ref|XP_006957779.1|  mitochondrial processing peptidase beta subunit  85.5    3e-16   
ref|XP_003130289.1|  PREDICTED: mitochondrial-processing peptidas...  85.5    3e-16   
ref|XP_008147991.1|  PREDICTED: mitochondrial-processing peptidas...  85.1    3e-16   
ref|XP_005080943.1|  PREDICTED: mitochondrial-processing peptidas...  85.5    3e-16   
ref|XP_003458723.1|  PREDICTED: mitochondrial-processing peptidas...  85.1    3e-16   
ref|XP_001507859.1|  PREDICTED: mitochondrial-processing peptidas...  85.1    4e-16   
ref|NP_001161452.1|  mitochondrial-processing peptidase subunit beta  85.1    4e-16   
ref|XP_002751725.1|  PREDICTED: mitochondrial-processing peptidas...  85.1    4e-16   
ref|XP_006137599.1|  PREDICTED: mitochondrial-processing peptidas...  85.1    4e-16   
tpg|DAA30658.1|  TPA: mitochondrial-processing peptidase subunit ...  85.1    4e-16   
ref|XP_004801290.1|  PREDICTED: mitochondrial-processing peptidas...  84.7    4e-16   
ref|XP_006621103.1|  PREDICTED: mitochondrial-processing peptidas...  85.1    4e-16   
ref|XP_007980659.1|  PREDICTED: mitochondrial-processing peptidas...  84.7    4e-16   
ref|XP_004602325.1|  PREDICTED: mitochondrial-processing peptidas...  84.7    4e-16   
gb|KFH07458.1|  mitochondrial processing peptidase                    84.3    5e-16   
ref|XP_006834428.1|  PREDICTED: mitochondrial-processing peptidas...  84.7    5e-16   
ref|XP_003825766.1|  PREDICTED: mitochondrial-processing peptidas...  84.7    5e-16   
ref|XP_002097818.1|  GE24263                                          84.7    5e-16   
ref|NP_004270.2|  mitochondrial-processing peptidase subunit beta...  84.7    5e-16   
ref|NP_001127198.1|  mitochondrial-processing peptidase subunit b...  84.7    5e-16   
ref|XP_008475257.1|  PREDICTED: mitochondrial-processing peptidas...  84.7    5e-16   
ref|XP_008949292.1|  PREDICTED: mitochondrial-processing peptidas...  84.7    5e-16   
emb|CEP12989.1|  hypothetical protein                                 84.7    5e-16   
dbj|BAF82553.1|  unnamed protein product                              84.7    5e-16   
ref|XP_001979978.1|  GG16882                                          84.7    5e-16   
ref|XP_005841328.1|  hypothetical protein GUITHDRAFT_83986            84.7    5e-16   
gb|AAC39915.1|  mitochondrial processing peptidase beta-subunit       84.7    5e-16   
ref|XP_009201840.1|  PREDICTED: mitochondrial-processing peptidas...  84.7    5e-16   
ref|NP_650401.1|  CG3731, isoform B                                   84.7    5e-16   
ref|XP_007980658.1|  PREDICTED: mitochondrial-processing peptidas...  84.7    5e-16   
ref|XP_004046041.1|  PREDICTED: mitochondrial-processing peptidas...  84.3    5e-16   
ref|XP_002129466.1|  PREDICTED: mitochondrial-processing peptidas...  84.7    5e-16   
gb|KIK26701.1|  hypothetical protein PISMIDRAFT_8741                  84.7    5e-16   
dbj|BAG50846.1|  unnamed protein product                              84.7    5e-16   
ref|XP_011497091.1|  PREDICTED: mitochondrial-processing peptidas...  84.3    5e-16   
ref|XP_001488876.1|  PREDICTED: mitochondrial-processing peptidas...  84.7    5e-16   
ref|XP_002072862.1|  GK13463                                          84.7    5e-16   
ref|XP_010375931.1|  PREDICTED: mitochondrial-processing peptidas...  84.7    6e-16   
ref|XP_009241366.1|  PREDICTED: mitochondrial-processing peptidas...  84.7    6e-16   
ref|XP_003101250.1|  CRE-MPPB-1 protein                               84.3    6e-16   
ref|XP_007177379.1|  PREDICTED: mitochondrial-processing peptidas...  84.7    6e-16   
ref|XP_001954133.1|  GF16898                                          84.3    6e-16   
ref|XP_004739642.1|  PREDICTED: mitochondrial-processing peptidas...  84.7    6e-16   
ref|XP_003489837.1|  PREDICTED: mitochondrial-processing peptidas...  84.3    6e-16   
ref|XP_002424317.1|  ubiquinol-cytochrome C reductase, core prote...  84.3    6e-16   
ref|XP_004325542.1|  PREDICTED: mitochondrial-processing peptidas...  84.3    6e-16   
ref|NP_001266818.1|  mitochondrial-processing peptidase subunit beta  84.7    6e-16   
ref|XP_001990254.1|  GH18338                                          84.3    6e-16   
ref|XP_010342844.1|  PREDICTED: mitochondrial-processing peptidas...  84.3    6e-16   
ref|NP_001088918.1|  uncharacterized protein LOC496289                84.3    6e-16   
ref|XP_009452126.1|  PREDICTED: mitochondrial-processing peptidas...  84.3    6e-16   
ref|XP_009058009.1|  hypothetical protein LOTGIDRAFT_105568           84.3    6e-16   
ref|XP_008170690.1|  PREDICTED: mitochondrial-processing peptidas...  84.3    7e-16   
ref|XP_010735238.1|  PREDICTED: mitochondrial-processing peptidas...  84.3    7e-16   
ref|XP_011497090.1|  PREDICTED: mitochondrial-processing peptidas...  84.3    7e-16   
emb|CDS14087.1|  hypothetical protein LRAMOSA06258                    84.3    7e-16   
ref|XP_010375930.1|  PREDICTED: mitochondrial-processing peptidas...  84.3    7e-16   
ref|NP_001270935.1|  peptidase (mitochondrial processing) beta        84.3    7e-16   
gb|ENN72490.1|  hypothetical protein YQE_10831                        84.3    7e-16   
gb|EIE79631.1|  hypothetical protein RO3G_04336                       84.0    7e-16   
gb|KFV00047.1|  Mitochondrial-processing peptidase subunit beta       82.8    7e-16   
ref|XP_003697978.1|  PREDICTED: mitochondrial-processing peptidas...  84.3    7e-16   
ref|XP_011333022.1|  PREDICTED: mitochondrial-processing peptidas...  84.3    7e-16   
ref|XP_003469905.1|  PREDICTED: mitochondrial-processing peptidas...  84.3    8e-16   
ref|XP_005377285.1|  PREDICTED: mitochondrial-processing peptidas...  84.3    8e-16   
gb|EPR60323.1|  putative peptidase M16 family potein                  84.3    8e-16   
ref|XP_001358232.1|  GA17647                                          84.0    8e-16   
ref|XP_002012924.1|  GL23853                                          84.0    8e-16   
ref|NP_001279114.1|  peptidase (mitochondrial processing) beta        84.0    8e-16   
ref|XP_010078191.1|  PREDICTED: mitochondrial-processing peptidas...  82.8    8e-16   
gb|EZF26496.1|  mitochondrial-processing peptidase subunit beta       82.8    8e-16   
ref|XP_008885491.1|  peptidase M16 family potein, putative            84.3    8e-16   
ref|XP_002369004.1|  mitochondrial-processing peptidase beta subu...  84.3    9e-16   
dbj|GAN10720.1|  mitochondrial processing peptidase beta subunit      84.0    9e-16   
gb|EPB84212.1|  mitochondrial processing peptidase                    84.0    9e-16   
ref|XP_003978567.1|  PREDICTED: mitochondrial-processing peptidas...  84.0    9e-16   
ref|XP_011192075.1|  PREDICTED: mitochondrial-processing peptidas...  84.0    9e-16   
ref|XP_004263433.1|  PREDICTED: mitochondrial-processing peptidas...  84.0    9e-16   
gb|EQL03943.1|  mitochondrial processing peptidase beta subunit       84.0    1e-15   
ref|XP_005550487.1|  PREDICTED: mitochondrial-processing peptidas...  84.0    1e-15   
gb|KFV20589.1|  Mitochondrial-processing peptidase subunit beta       83.6    1e-15   
ref|XP_006049911.1|  PREDICTED: mitochondrial-processing peptidas...  84.0    1e-15   
gb|EDL03194.1|  mCG6419, isoform CRA_a                                82.0    1e-15   
ref|XP_393509.2|  PREDICTED: mitochondrial-processing peptidase s...  83.6    1e-15   
ref|XP_008276772.1|  PREDICTED: mitochondrial-processing peptidas...  83.6    1e-15   
ref|XP_007856631.1|  mitochondrial processing peptidase beta subunit  83.6    1e-15   
ref|XP_002835070.1|  hypothetical protein                             83.6    1e-15   
ref|XP_004839772.1|  PREDICTED: mitochondrial-processing peptidas...  83.6    1e-15   
gb|KHJ93773.1|  peptidase, M16 family                                 82.8    1e-15   
ref|XP_002056260.1|  GJ10322                                          83.6    1e-15   
ref|XP_004402527.1|  PREDICTED: mitochondrial-processing peptidas...  83.6    1e-15   
ref|XP_010393952.1|  PREDICTED: mitochondrial-processing peptidas...  83.6    1e-15   
gb|KHJ92396.1|  peptidase, M16 family                                 82.4    1e-15   
emb|CDH55148.1|  mitochondrial processing peptidase beta subunit      83.2    1e-15   
gb|KFO65766.1|  Mitochondrial-processing peptidase subunit beta       83.2    2e-15   
ref|XP_010393953.1|  PREDICTED: mitochondrial-processing peptidas...  83.2    2e-15   
ref|XP_005715652.1|  mitochondrial processing peptidase beta subu...  83.6    2e-15   
ref|XP_010393954.1|  PREDICTED: mitochondrial-processing peptidas...  83.2    2e-15   
gb|KFP32339.1|  Mitochondrial-processing peptidase subunit beta       83.2    2e-15   
gb|KFP35805.1|  Mitochondrial-processing peptidase subunit beta       83.2    2e-15   
ref|XP_005101318.1|  PREDICTED: mitochondrial-processing peptidas...  83.2    2e-15   
ref|XP_001998997.1|  GI23318                                          83.2    2e-15   
ref|XP_008919690.1|  PREDICTED: mitochondrial-processing peptidas...  83.2    2e-15   
gb|KFV93779.1|  Mitochondrial-processing peptidase subunit beta       83.2    2e-15   
gb|KFQ95313.1|  Mitochondrial-processing peptidase subunit beta       83.2    2e-15   
gb|KFP00283.1|  Mitochondrial-processing peptidase subunit beta       83.2    2e-15   
gb|KFW74487.1|  Mitochondrial-processing peptidase subunit beta       83.2    2e-15   
gb|KFZ50709.1|  Mitochondrial-processing peptidase subunit beta       83.2    2e-15   
ref|XP_009579067.1|  PREDICTED: mitochondrial-processing peptidas...  83.2    2e-15   
emb|CDJ95551.1|  Peptidase M16 domain containing protein              83.2    2e-15   
ref|XP_010013100.1|  PREDICTED: mitochondrial-processing peptidas...  83.2    2e-15   
gb|KFP96283.1|  Mitochondrial-processing peptidase subunit beta       83.2    2e-15   
ref|XP_010181756.1|  PREDICTED: mitochondrial-processing peptidas...  83.2    2e-15   
gb|KFQ82541.1|  Mitochondrial-processing peptidase subunit beta       83.2    2e-15   
emb|CDJ90409.1|  Peptidase M16 domain containing protein              83.2    2e-15   
gb|KFZ45676.1|  Mitochondrial-processing peptidase subunit beta       82.8    2e-15   
gb|KFO90759.1|  Mitochondrial-processing peptidase subunit beta       82.8    2e-15   
ref|XP_010136123.1|  PREDICTED: mitochondrial-processing peptidas...  82.8    2e-15   
gb|KFV90311.1|  Mitochondrial-processing peptidase subunit beta       82.8    2e-15   
gb|KFP92695.1|  Mitochondrial-processing peptidase subunit beta       82.8    2e-15   
gb|KFR17775.1|  Mitochondrial-processing peptidase subunit beta       82.8    2e-15   
gb|KFO08448.1|  Mitochondrial-processing peptidase subunit beta       82.8    2e-15   
gb|KFM14074.1|  Mitochondrial-processing peptidase subunit beta       82.8    2e-15   
ref|XP_010294328.1|  PREDICTED: mitochondrial-processing peptidas...  83.2    2e-15   
ref|XP_010157604.1|  PREDICTED: mitochondrial-processing peptidas...  82.8    2e-15   
ref|XP_008935495.1|  PREDICTED: mitochondrial-processing peptidas...  82.8    2e-15   
gb|KFP63946.1|  Mitochondrial-processing peptidase subunit beta       82.8    2e-15   
ref|XP_003011841.1|  hypothetical protein ARB_01820                   83.2    2e-15   
ref|XP_009913519.1|  PREDICTED: mitochondrial-processing peptidas...  83.2    2e-15   
ref|XP_009287375.1|  PREDICTED: mitochondrial-processing peptidas...  83.2    2e-15   
ref|XP_005526069.1|  PREDICTED: mitochondrial-processing peptidas...  83.2    2e-15   
ref|XP_009875642.1|  PREDICTED: mitochondrial-processing peptidas...  82.8    2e-15   
gb|KFQ70073.1|  Mitochondrial-processing peptidase subunit beta       82.8    2e-15   
gb|EGE05913.1|  mitochondrial-processing peptidase                    83.2    2e-15   
ref|XP_003232164.1|  mitochondrial processing peptidase beta subunit  83.2    2e-15   
ref|XP_006261324.1|  PREDICTED: mitochondrial-processing peptidas...  83.2    2e-15   
ref|XP_009963542.1|  PREDICTED: mitochondrial-processing peptidas...  82.8    2e-15   
gb|KFW70148.1|  Mitochondrial-processing peptidase subunit beta       82.8    2e-15   
gb|KFQ42562.1|  Mitochondrial-processing peptidase subunit beta       82.8    2e-15   
ref|XP_009696269.1|  PREDICTED: mitochondrial-processing peptidas...  83.2    2e-15   
ref|XP_005801232.1|  PREDICTED: mitochondrial-processing peptidas...  83.2    2e-15   
ref|XP_006038463.1|  PREDICTED: mitochondrial-processing peptidas...  83.2    2e-15   
ref|XP_009461169.1|  PREDICTED: mitochondrial-processing peptidas...  82.8    2e-15   
ref|XP_003361114.1|  PREDICTED: mitochondrial-processing peptidas...  83.6    2e-15   
ref|NP_001039103.1|  mitochondrial-processing peptidase subunit beta  83.2    2e-15   
ref|XP_005423581.1|  PREDICTED: mitochondrial-processing peptidas...  83.2    2e-15   
ref|XP_009806972.1|  PREDICTED: mitochondrial-processing peptidas...  82.8    2e-15   
ref|XP_003083059.1|  mitochondrial processing peptidase beta subu...  82.8    2e-15   
ref|XP_010311964.1|  PREDICTED: mitochondrial-processing peptidas...  82.8    2e-15   
ref|XP_005850220.1|  hypothetical protein CHLNCDRAFT_20512            82.8    2e-15   
ref|XP_010175298.1|  PREDICTED: mitochondrial-processing peptidas...  82.8    2e-15   
gb|KIW08587.1|  mitochondrial-processing peptidase subunit beta       83.2    2e-15   
ref|XP_010201724.1|  PREDICTED: mitochondrial-processing peptidas...  83.2    2e-15   
ref|XP_009477134.1|  PREDICTED: mitochondrial-processing peptidas...  82.8    2e-15   
ref|XP_007577405.1|  PREDICTED: mitochondrial-processing peptidas...  83.2    2e-15   
gb|KFQ49766.1|  Mitochondrial-processing peptidase subunit beta       82.8    2e-15   
ref|XP_002543311.1|  mitochondrial processing peptidase beta subunit  82.8    2e-15   



>ref|NP_001275054.1| probable mitochondrial-processing peptidase subunit beta-like 
[Solanum tuberosum]
 gb|ABB86276.1| mitochondrial processing peptidase-like [Solanum tuberosum]
Length=522

 Score =   212 bits (540),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 128/151 (85%), Gaps = 0/151 (0%)
 Frame = +1

Query  37   MAIRQLLNLarrsrrtiasrrGKPFssssaavaaaaNGTLAPSPPPPTAMIYDRLAESVK  216
            M IRQLL LARRSR+   S   +   S+SA VA  ++ TLA  PPPP AMIYDRLAE VK
Sbjct  1    MTIRQLLTLARRSRKLTTSHSLRRLYSASAGVAGTSSSTLAIGPPPPDAMIYDRLAEDVK  60

Query  217  HKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVATESNLAAKTATVG  396
             K+KRLENPDSRFLQYNSPHP LADHT+IL+ P+TRVTTLP+GLRVATE+NLA KTATVG
Sbjct  61   QKIKRLENPDSRFLQYNSPHPTLADHTSILSFPSTRVTTLPSGLRVATETNLAVKTATVG  120

Query  397  VFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            VFIDAGSRFET+ETNGTAHFLEHMIFKGTE+
Sbjct  121  VFIDAGSRFETDETNGTAHFLEHMIFKGTEK  151



>ref|XP_006338383.1| PREDICTED: probable mitochondrial-processing peptidase subunit 
beta-like [Solanum tuberosum]
Length=529

 Score =   204 bits (519),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 128/151 (85%), Gaps = 0/151 (0%)
 Frame = +1

Query  37   MAIRQLLNLarrsrrtiasrrGKPFssssaavaaaaNGTLAPSPPPPTAMIYDRLAESVK  216
            M IRQLL LARRSR    S   +   S+SAAVAA ++ T A  PPPP AMIYDRLAE VK
Sbjct  1    MTIRQLLTLARRSRNLTTSHSLRRLYSASAAVAATSSSTPAIGPPPPDAMIYDRLAEDVK  60

Query  217  HKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVATESNLAAKTATVG  396
             K+KRLENPDSRFLQYNSPHP LADHT+IL+ P+TRVTTLP+GLRVATE+NLA KTATVG
Sbjct  61   QKIKRLENPDSRFLQYNSPHPTLADHTSILSFPSTRVTTLPSGLRVATETNLAVKTATVG  120

Query  397  VFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            VFIDAGSRFET+ETNGTAHFLEHMIFKGTE+
Sbjct  121  VFIDAGSRFETDETNGTAHFLEHMIFKGTEK  151



>ref|XP_011085735.1| PREDICTED: probable mitochondrial-processing peptidase subunit 
beta [Sesamum indicum]
Length=526

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 108/153 (71%), Positives = 124/153 (81%), Gaps = 7/153 (5%)
 Frame = +1

Query  37   MAIRQLLNLarrsrrtiasrrGKPFssssaavaaaaNGTLA--PSPPPPTAMIYDRLAES  210
            M IRQL+NL RR+R+ I     +PF+S      A A  + A  PSPPPPTAMIYDRLAES
Sbjct  1    MTIRQLINLGRRTRKPI-----RPFTSVQPLSTAVATASEASLPSPPPPTAMIYDRLAES  55

Query  211  VKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVATESNLAAKTAT  390
            VK KLK+LE+PD RFL+YNSPHP +  HT IL+AP TRVTTLPNGLR+ATES LA+ TAT
Sbjct  56   VKEKLKKLEDPDPRFLKYNSPHPAVHSHTEILSAPLTRVTTLPNGLRIATESTLASTTAT  115

Query  391  VGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            VGVFIDAGSRFE++E+NGTAHFLEHMIFKGTER
Sbjct  116  VGVFIDAGSRFESDESNGTAHFLEHMIFKGTER  148



>gb|EPS67717.1| mitochondrial processing peptidase [Genlisea aurea]
Length=526

 Score =   198 bits (503),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 124/151 (82%), Gaps = 3/151 (2%)
 Frame = +1

Query  37   MAIRQLLNLarrsrrtiasrrGKPFssssaavaaaaNGTLAPSPPPPTAMIYDRLAESVK  216
            M IRQLLNLARRSRR        P    S AV+A+A  +L PSPPPPTAMIYDRLAESVK
Sbjct  1    MTIRQLLNLARRSRRNPHVLV--PLQPLSTAVSASAEVSL-PSPPPPTAMIYDRLAESVK  57

Query  217  HKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVATESNLAAKTATVG  396
             KLKRLE PD RFL+YNSPHP +  HT IL AP TRVTTLPNGLR+ATESNLA KTATVG
Sbjct  58   EKLKRLEEPDPRFLRYNSPHPAVVSHTDILPAPLTRVTTLPNGLRIATESNLALKTATVG  117

Query  397  VFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            VFIDAGSRFE++E+NGTAHFLEHMIFKGT+R
Sbjct  118  VFIDAGSRFESDESNGTAHFLEHMIFKGTDR  148



>ref|XP_010259364.1| PREDICTED: probable mitochondrial-processing peptidase subunit 
beta [Nelumbo nucifera]
Length=528

 Score =   197 bits (501),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 108/151 (72%), Positives = 121/151 (80%), Gaps = 1/151 (1%)
 Frame = +1

Query  37   MAIRQLLNLarrsrrtiasrrGKPFssssaavaaaaNGTLAPSPPPPTAMIYDRLAESVK  216
            MAIRQLL LARRS +  +        SS +A  + A  T APSPP P  M+YDRLAE+VK
Sbjct  1    MAIRQLLTLARRSHKPSSLSPRALLQSSRSASTSPAVAT-APSPPAPNVMVYDRLAEAVK  59

Query  217  HKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVATESNLAAKTATVG  396
             +LKRL+NPD RFLQ+ SPHPVL DHT IL AP TRVTTLPNGLRVATESNLA +TATVG
Sbjct  60   QRLKRLDNPDPRFLQHASPHPVLVDHTKILAAPETRVTTLPNGLRVATESNLACRTATVG  119

Query  397  VFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            V+IDAGSRFET+ETNGTAHFLEHMIFKGTE+
Sbjct  120  VWIDAGSRFETDETNGTAHFLEHMIFKGTEK  150



>gb|AAK51086.1|AF363285_1 mitochondrial processing peptidase [Avicennia marina]
Length=527

 Score =   196 bits (497),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 106/152 (70%), Positives = 125/152 (82%), Gaps = 5/152 (3%)
 Frame = +1

Query  37   MAIRQLLNLarrsrrtiasrrG-KPFssssaavaaaaNGTLAPSPPPPTAMIYDRLAESV  213
            MAIRQL+ LARR+R+ + +    +PFS++ A      + +L PSPPPPT MIYDRL+ESV
Sbjct  1    MAIRQLITLARRTRKPVQACASLRPFSTAVATAP---DASL-PSPPPPTGMIYDRLSESV  56

Query  214  KHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVATESNLAAKTATV  393
            K KLK+LE PDSRFL+YNSPHP +  HT IL+AP TRVTTLPNGLR+ATES L + TATV
Sbjct  57   KQKLKKLEEPDSRFLRYNSPHPTVDSHTEILSAPLTRVTTLPNGLRIATESTLVSTTATV  116

Query  394  GVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            GVFIDAGSRFE+EE+NGTAHFLEHMIFKGTER
Sbjct  117  GVFIDAGSRFESEESNGTAHFLEHMIFKGTER  148



>ref|XP_011098729.1| PREDICTED: probable mitochondrial-processing peptidase subunit 
beta [Sesamum indicum]
Length=526

 Score =   194 bits (494),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 91/110 (83%), Positives = 102/110 (93%), Gaps = 0/110 (0%)
 Frame = +1

Query  160  PSPPPPTAMIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTLP  339
            PSPPPPTAMIYDRLAESVK KLK+LE+PD RFL++NSPHP +  HT IL+AP TRVTTLP
Sbjct  39   PSPPPPTAMIYDRLAESVKRKLKKLEDPDPRFLKHNSPHPTVDSHTEILSAPLTRVTTLP  98

Query  340  NGLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            NGLR+ATES LA++TATVGVFIDAGSRFE+EE+NGTAHFLEHMIFKGTER
Sbjct  99   NGLRIATESTLASQTATVGVFIDAGSRFESEESNGTAHFLEHMIFKGTER  148



>ref|XP_010258107.1| PREDICTED: probable mitochondrial-processing peptidase subunit 
beta [Nelumbo nucifera]
Length=528

 Score =   193 bits (490),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 105/151 (70%), Positives = 121/151 (80%), Gaps = 1/151 (1%)
 Frame = +1

Query  37   MAIRQLLNLarrsrrtiasrrGKPFssssaavaaaaNGTLAPSPPPPTAMIYDRLAESVK  216
            MAIRQLL LARRS ++          SS +A  + A   L PSPP P  M+YDRLAE+VK
Sbjct  1    MAIRQLLTLARRSHKSSCPSTRALLQSSRSASTSPAVADL-PSPPAPNVMVYDRLAEAVK  59

Query  217  HKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVATESNLAAKTATVG  396
             KLKRL+N D RF+Q+ SPHPVL DHT IL+AP TRVTTLPNGLR+ATESNLA++TATVG
Sbjct  60   AKLKRLDNSDPRFIQHASPHPVLVDHTKILSAPETRVTTLPNGLRIATESNLASRTATVG  119

Query  397  VFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            V+IDAGSRFET+ETNGTAHFLEHMIFKGTE+
Sbjct  120  VWIDAGSRFETDETNGTAHFLEHMIFKGTEK  150



>emb|CDP02290.1| unnamed protein product [Coffea canephora]
Length=530

 Score =   192 bits (489),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 90/109 (83%), Positives = 99/109 (91%), Gaps = 0/109 (0%)
 Frame = +1

Query  163  SPPPPTAMIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTLPN  342
            SPPPPTAMIYDRLAE+VK KLK+LE PDSRFL+Y+SPHP   DHT +L AP TRVTTLPN
Sbjct  44   SPPPPTAMIYDRLAENVKSKLKQLEQPDSRFLKYSSPHPARVDHTPVLAAPLTRVTTLPN  103

Query  343  GLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            GLR+ATESNLA  TATVGV+IDAGSRFE++ETNGTAHFLEHMIFKGTER
Sbjct  104  GLRIATESNLACPTATVGVWIDAGSRFESDETNGTAHFLEHMIFKGTER  152



>gb|EYU34612.1| hypothetical protein MIMGU_mgv1a004447mg [Erythranthe guttata]
Length=526

 Score =   187 bits (474),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 87/110 (79%), Positives = 98/110 (89%), Gaps = 0/110 (0%)
 Frame = +1

Query  160  PSPPPPTAMIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTLP  339
            PSPP P  MIYDRLAESVK KL +LE+PD RFL+YNSPHP +  HT IL+AP TRVTTLP
Sbjct  39   PSPPQPDVMIYDRLAESVKRKLTKLEDPDHRFLRYNSPHPTVDSHTEILSAPLTRVTTLP  98

Query  340  NGLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            NGLR+ATESNLA+ T+TVGVFIDAGSRFE++ETNGTAHFLEHMIFKGTE+
Sbjct  99   NGLRIATESNLASPTSTVGVFIDAGSRFESDETNGTAHFLEHMIFKGTEK  148



>gb|KJB40891.1| hypothetical protein B456_007G081900 [Gossypium raimondii]
Length=468

 Score =   185 bits (470),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 85/109 (78%), Positives = 99/109 (91%), Gaps = 0/109 (0%)
 Frame = +1

Query  163  SPPPPTAMIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTLPN  342
            SPPPPTAMIYDRL+ SVK KL++LENPD RFL+Y SPHP +  HT +L++P T++TTLPN
Sbjct  45   SPPPPTAMIYDRLSLSVKSKLQKLENPDPRFLKYGSPHPAVVSHTHMLSSPETKITTLPN  104

Query  343  GLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            GLRVATES L+++TATVGV+IDAGSRFETEETNGTAHFLEHMIFKGTER
Sbjct  105  GLRVATESTLSSRTATVGVWIDAGSRFETEETNGTAHFLEHMIFKGTER  153



>ref|XP_009147385.1| PREDICTED: probable mitochondrial-processing peptidase subunit 
beta [Brassica rapa]
 emb|CDY37550.1| BnaA05g34150D [Brassica napus]
Length=529

 Score =   186 bits (473),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 88/111 (79%), Positives = 97/111 (87%), Gaps = 0/111 (0%)
 Frame = +1

Query  157  APSPPPPTAMIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTL  336
            +PSP PP  M YD  AE VK KLKRLENPD RFL+Y SPHP+LA H  IL++P TRVTTL
Sbjct  41   SPSPTPPILMPYDHSAEIVKEKLKRLENPDQRFLKYASPHPILASHNHILSSPETRVTTL  100

Query  337  PNGLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            PNGLRVATESNL+AKTATVGV+IDAGSRFE++ETNGTAHFLEHMIFKGTER
Sbjct  101  PNGLRVATESNLSAKTATVGVWIDAGSRFESDETNGTAHFLEHMIFKGTER  151



>emb|CDY43262.1| BnaC05g48550D [Brassica napus]
Length=529

 Score =   186 bits (472),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/111 (79%), Positives = 96/111 (86%), Gaps = 0/111 (0%)
 Frame = +1

Query  157  APSPPPPTAMIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTL  336
            +PSPP P  M YD  AE  K KLKRLENPD RFL+Y SPHP+LA H  IL+AP TRVTTL
Sbjct  41   SPSPPTPILMPYDHAAEITKEKLKRLENPDQRFLKYASPHPILASHNHILSAPETRVTTL  100

Query  337  PNGLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            PNGLRVATESNL+AKTATVGV+IDAGSRFE++ETNGTAHFLEHMIFKGTER
Sbjct  101  PNGLRVATESNLSAKTATVGVWIDAGSRFESDETNGTAHFLEHMIFKGTER  151



>gb|KHG26755.1| hypothetical protein F383_04545 [Gossypium arboreum]
Length=528

 Score =   186 bits (471),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/109 (79%), Positives = 99/109 (91%), Gaps = 0/109 (0%)
 Frame = +1

Query  163  SPPPPTAMIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTLPN  342
            SPPPPTAMIYDRLA +VK KL++LENPD RFL+Y SPHP L  HT IL++P T++TTLPN
Sbjct  42   SPPPPTAMIYDRLALAVKSKLQKLENPDPRFLKYGSPHPTLTSHTHILSSPETKITTLPN  101

Query  343  GLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            GLRVATES L+++TATVGV+IDAGSRFETEETNGTAHFLEHMIFKGTE+
Sbjct  102  GLRVATESTLSSRTATVGVWIDAGSRFETEETNGTAHFLEHMIFKGTEK  150



>gb|KJB40890.1| hypothetical protein B456_007G081900 [Gossypium raimondii]
Length=531

 Score =   185 bits (469),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 85/109 (78%), Positives = 99/109 (91%), Gaps = 0/109 (0%)
 Frame = +1

Query  163  SPPPPTAMIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTLPN  342
            SPPPPTAMIYDRL+ SVK KL++LENPD RFL+Y SPHP +  HT +L++P T++TTLPN
Sbjct  45   SPPPPTAMIYDRLSLSVKSKLQKLENPDPRFLKYGSPHPAVVSHTHMLSSPETKITTLPN  104

Query  343  GLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            GLRVATES L+++TATVGV+IDAGSRFETEETNGTAHFLEHMIFKGTER
Sbjct  105  GLRVATESTLSSRTATVGVWIDAGSRFETEETNGTAHFLEHMIFKGTER  153



>gb|KHG03167.1| hypothetical protein F383_27059 [Gossypium arboreum]
Length=531

 Score =   184 bits (468),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 85/109 (78%), Positives = 98/109 (90%), Gaps = 0/109 (0%)
 Frame = +1

Query  163  SPPPPTAMIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTLPN  342
            SPPPPTAMIYDRL+ S K KL++LENPD RFL+Y SPHP +  HT IL++P T++TTLPN
Sbjct  45   SPPPPTAMIYDRLSLSFKSKLQKLENPDPRFLKYGSPHPAVVSHTHILSSPETKITTLPN  104

Query  343  GLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            GLRVATES L+++TATVGV+IDAGSRFETEETNGTAHFLEHMIFKGTER
Sbjct  105  GLRVATESTLSSRTATVGVWIDAGSRFETEETNGTAHFLEHMIFKGTER  153



>ref|XP_009360538.1| PREDICTED: probable mitochondrial-processing peptidase subunit 
beta isoform X2 [Pyrus x bretschneideri]
Length=534

 Score =   184 bits (467),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = +1

Query  178  TAMIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVA  357
            TAMIYDRLAE VK K+KRLENPD RFL+Y SPHP L DH+ ILTAP TRVTTLPNGLRVA
Sbjct  51   TAMIYDRLAEGVKSKIKRLENPDPRFLKYGSPHPSLTDHSHILTAPETRVTTLPNGLRVA  110

Query  358  TESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            TESNLA+KTATVGV+IDAGSRFE +ETNGTAHFLEHMIFKGTE+
Sbjct  111  TESNLASKTATVGVWIDAGSRFEDDETNGTAHFLEHMIFKGTEQ  154



>ref|XP_009360537.1| PREDICTED: probable mitochondrial-processing peptidase subunit 
beta isoform X1 [Pyrus x bretschneideri]
Length=532

 Score =   184 bits (467),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = +1

Query  178  TAMIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVA  357
            TAMIYDRLAE VK K+KRLENPD RFL+Y SPHP L DH+ ILTAP TRVTTLPNGLRVA
Sbjct  51   TAMIYDRLAEGVKSKIKRLENPDPRFLKYGSPHPSLTDHSHILTAPETRVTTLPNGLRVA  110

Query  358  TESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            TESNLA+KTATVGV+IDAGSRFE +ETNGTAHFLEHMIFKGTE+
Sbjct  111  TESNLASKTATVGVWIDAGSRFEDDETNGTAHFLEHMIFKGTEQ  154



>ref|XP_004156557.1| PREDICTED: probable mitochondrial-processing peptidase subunit 
beta-like [Cucumis sativus]
Length=440

 Score =   182 bits (462),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 86/103 (83%), Positives = 94/103 (91%), Gaps = 0/103 (0%)
 Frame = +1

Query  181  AMIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVAT  360
            AMIYDRLAE+VK KLK+LENPD RFL+Y SPHP + DHT IL+AP TRVTTL NGLRVAT
Sbjct  48   AMIYDRLAEAVKSKLKQLENPDPRFLKYGSPHPTITDHTRILSAPETRVTTLSNGLRVAT  107

Query  361  ESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            ESNL A+TATVGV+IDAGSRFETEETNGTAHFLEHMIFKGTE+
Sbjct  108  ESNLTARTATVGVWIDAGSRFETEETNGTAHFLEHMIFKGTEK  150



>ref|XP_006387548.1| hypothetical protein POPTR_0863s00200g, partial [Populus trichocarpa]
 gb|ERP46462.1| hypothetical protein POPTR_0863s00200g, partial [Populus trichocarpa]
Length=371

 Score =   181 bits (458),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 86/103 (83%), Positives = 94/103 (91%), Gaps = 0/103 (0%)
 Frame = +1

Query  181  AMIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVAT  360
            AMIYDRLAESVK KLK LENPD RFL+Y SPHP L  HT IL++P TR+TTLPNGLRVAT
Sbjct  47   AMIYDRLAESVKSKLKLLENPDPRFLKYGSPHPTLKTHTHILSSPETRITTLPNGLRVAT  106

Query  361  ESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            ESNLAAKTATVGV+IDAGSRFE++ETNGTAHFLEHMIFKGTE+
Sbjct  107  ESNLAAKTATVGVWIDAGSRFESDETNGTAHFLEHMIFKGTEK  149



>gb|KHG03166.1| hypothetical protein F383_27059 [Gossypium arboreum]
Length=543

 Score =   184 bits (467),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 85/109 (78%), Positives = 98/109 (90%), Gaps = 0/109 (0%)
 Frame = +1

Query  163  SPPPPTAMIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTLPN  342
            SPPPPTAMIYDRL+ S K KL++LENPD RFL+Y SPHP +  HT IL++P T++TTLPN
Sbjct  45   SPPPPTAMIYDRLSLSFKSKLQKLENPDPRFLKYGSPHPAVVSHTHILSSPETKITTLPN  104

Query  343  GLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            GLRVATES L+++TATVGV+IDAGSRFETEETNGTAHFLEHMIFKGTER
Sbjct  105  GLRVATESTLSSRTATVGVWIDAGSRFETEETNGTAHFLEHMIFKGTER  153



>ref|XP_008451674.1| PREDICTED: probable mitochondrial-processing peptidase subunit 
beta isoform X2 [Cucumis melo]
Length=522

 Score =   184 bits (466),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 87/103 (84%), Positives = 95/103 (92%), Gaps = 0/103 (0%)
 Frame = +1

Query  181  AMIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVAT  360
            AMIYDRLAE+VK KLK+LENPD RFL+Y SPHP + DHT IL+AP TRVTTL NGLRVAT
Sbjct  48   AMIYDRLAEAVKSKLKQLENPDPRFLKYGSPHPTITDHTRILSAPETRVTTLSNGLRVAT  107

Query  361  ESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            ESNLAA+TATVGV+IDAGSRFETEETNGTAHFLEHMIFKGTE+
Sbjct  108  ESNLAARTATVGVWIDAGSRFETEETNGTAHFLEHMIFKGTEK  150



>ref|NP_001284394.1| probable mitochondrial-processing peptidase subunit beta [Cucumis 
melo]
 gb|AAK07827.1|AF297643_1 mitochondrial processing peptidase beta subunit [Cucumis melo]
Length=528

 Score =   184 bits (466),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 87/103 (84%), Positives = 95/103 (92%), Gaps = 0/103 (0%)
 Frame = +1

Query  181  AMIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVAT  360
            AMIYDRLAE+VK KLK+LENPD RFL+Y SPHP + DHT IL+AP TRVTTL NGLRVAT
Sbjct  48   AMIYDRLAEAVKSKLKQLENPDPRFLKYGSPHPTITDHTRILSAPETRVTTLSNGLRVAT  107

Query  361  ESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            ESNLAA+TATVGV+IDAGSRFETEETNGTAHFLEHMIFKGTE+
Sbjct  108  ESNLAARTATVGVWIDAGSRFETEETNGTAHFLEHMIFKGTEK  150



>ref|XP_008379409.1| PREDICTED: probable mitochondrial-processing peptidase subunit 
beta [Malus domestica]
Length=532

 Score =   184 bits (466),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 87/104 (84%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = +1

Query  178  TAMIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVA  357
            TAM+YDRLAE VK K+KRLENPD RFL+Y SPHP L DH+ ILTAP TRVTTLPNGLRVA
Sbjct  51   TAMVYDRLAEEVKSKIKRLENPDPRFLKYGSPHPSLTDHSHILTAPETRVTTLPNGLRVA  110

Query  358  TESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            TESNLA+KTATVGV+IDAGSRFE +ETNGTAHFLEHMIFKGTE+
Sbjct  111  TESNLASKTATVGVWIDAGSRFENDETNGTAHFLEHMIFKGTEQ  154



>ref|XP_006408449.1| hypothetical protein EUTSA_v10020493mg [Eutrema salsugineum]
 gb|ESQ49902.1| hypothetical protein EUTSA_v10020493mg [Eutrema salsugineum]
Length=530

 Score =   183 bits (465),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/111 (77%), Positives = 97/111 (87%), Gaps = 0/111 (0%)
 Frame = +1

Query  157  APSPPPPTAMIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTL  336
            A SP PP  M YD+ AE +K+K+K+LENPD RFL+Y SPHP LA H  IL+AP TRVTTL
Sbjct  42   AQSPTPPILMPYDQAAEIIKNKIKKLENPDQRFLRYASPHPTLASHNHILSAPETRVTTL  101

Query  337  PNGLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            PNGLRVATESNL+AKTATVGV+IDAGSRFE++ETNGTAHFLEHMIFKGTER
Sbjct  102  PNGLRVATESNLSAKTATVGVWIDAGSRFESDETNGTAHFLEHMIFKGTER  152



>gb|KJB33442.1| hypothetical protein B456_006G011200 [Gossypium raimondii]
Length=509

 Score =   183 bits (464),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/109 (78%), Positives = 98/109 (90%), Gaps = 0/109 (0%)
 Frame = +1

Query  163  SPPPPTAMIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTLPN  342
            SPPPPTAMIYDRLA +VK KL++LENPD RFL+Y SPHP +  HT IL++P T++TTLPN
Sbjct  42   SPPPPTAMIYDRLALAVKSKLQKLENPDPRFLKYGSPHPTVTSHTHILSSPETKITTLPN  101

Query  343  GLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            GLRVATES L++ TATVGV+IDAGSRFETEETNGTAHFLEHMIFKGTE+
Sbjct  102  GLRVATESTLSSHTATVGVWIDAGSRFETEETNGTAHFLEHMIFKGTEK  150



>ref|XP_008357912.1| PREDICTED: probable mitochondrial-processing peptidase subunit 
beta [Malus domestica]
Length=579

 Score =   184 bits (467),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 87/104 (84%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = +1

Query  178  TAMIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVA  357
            TAM+YDRLAE VK K+KRLENPD RFL+Y SPHP L DH+ ILTAP TRVTTLPNGLRVA
Sbjct  98   TAMVYDRLAEEVKSKIKRLENPDPRFLKYGSPHPSLTDHSHILTAPETRVTTLPNGLRVA  157

Query  358  TESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            TESNLA+KTATVGV+IDAGSRFE +ETNGTAHFLEHMIFKGTE+
Sbjct  158  TESNLASKTATVGVWIDAGSRFENDETNGTAHFLEHMIFKGTEQ  201



>ref|NP_850500.1| probable mitochondrial-processing peptidase subunit beta [Arabidopsis 
thaliana]
 gb|AEE73762.1| probable mitochondrial-processing peptidase subunit beta [Arabidopsis 
thaliana]
Length=535

 Score =   183 bits (465),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/111 (77%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = +1

Query  157  APSPPPPTAMIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTL  336
            A SPPPP  M YD  AE +K+K+K+LENPD RFL+Y SPHP+LA H  IL+AP TRVTTL
Sbjct  43   ALSPPPPHLMPYDHAAEIIKNKIKKLENPDKRFLKYASPHPILASHNHILSAPETRVTTL  102

Query  337  PNGLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            PNGLRVATESNL+AKTATVGV+IDAGSRFE++ETNGTAHFLEHMIFKGT+R
Sbjct  103  PNGLRVATESNLSAKTATVGVWIDAGSRFESDETNGTAHFLEHMIFKGTDR  153



>ref|NP_186858.1| probable mitochondrial-processing peptidase subunit beta [Arabidopsis 
thaliana]
 sp|Q42290.2|MPPB_ARATH RecName: Full=Probable mitochondrial-processing peptidase subunit 
beta; AltName: Full=Beta-MPP; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAF14827.1|AC011664_9 putative mitochondrial processing peptidase [Arabidopsis thaliana]
 gb|AAM83217.1| AT3g02090/F1C9_12 [Arabidopsis thaliana]
 gb|AAN31809.1| putative mitochondrial processing peptidase [Arabidopsis thaliana]
 gb|AAN33205.1| At3g02090/F1C9_12 [Arabidopsis thaliana]
 gb|AAN71914.1| putative mitochondrial processing peptidase [Arabidopsis thaliana]
 gb|AEE73761.1| probable mitochondrial-processing peptidase subunit beta [Arabidopsis 
thaliana]
Length=531

 Score =   183 bits (465),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/111 (77%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = +1

Query  157  APSPPPPTAMIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTL  336
            A SPPPP  M YD  AE +K+K+K+LENPD RFL+Y SPHP+LA H  IL+AP TRVTTL
Sbjct  43   ALSPPPPHLMPYDHAAEIIKNKIKKLENPDKRFLKYASPHPILASHNHILSAPETRVTTL  102

Query  337  PNGLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            PNGLRVATESNL+AKTATVGV+IDAGSRFE++ETNGTAHFLEHMIFKGT+R
Sbjct  103  PNGLRVATESNLSAKTATVGVWIDAGSRFESDETNGTAHFLEHMIFKGTDR  153



>gb|KJB33443.1| hypothetical protein B456_006G011200 [Gossypium raimondii]
Length=528

 Score =   183 bits (464),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/109 (78%), Positives = 98/109 (90%), Gaps = 0/109 (0%)
 Frame = +1

Query  163  SPPPPTAMIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTLPN  342
            SPPPPTAMIYDRLA +VK KL++LENPD RFL+Y SPHP +  HT IL++P T++TTLPN
Sbjct  42   SPPPPTAMIYDRLALAVKSKLQKLENPDPRFLKYGSPHPTVTSHTHILSSPETKITTLPN  101

Query  343  GLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            GLRVATES L++ TATVGV+IDAGSRFETEETNGTAHFLEHMIFKGTE+
Sbjct  102  GLRVATESTLSSHTATVGVWIDAGSRFETEETNGTAHFLEHMIFKGTEK  150



>ref|XP_002305398.2| hypothetical protein POPTR_0004s117902g, partial [Populus trichocarpa]
 gb|EEE85909.2| hypothetical protein POPTR_0004s117902g, partial [Populus trichocarpa]
Length=440

 Score =   181 bits (459),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/103 (83%), Positives = 94/103 (91%), Gaps = 0/103 (0%)
 Frame = +1

Query  181  AMIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVAT  360
            AMIYDRLAESVK KLK LENPD RFL+Y SPHP L  HT IL+AP TR+TTLPNGLRVAT
Sbjct  46   AMIYDRLAESVKSKLKILENPDPRFLKYGSPHPTLKTHTHILSAPETRITTLPNGLRVAT  105

Query  361  ESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            ESNLA+KTATVGV+IDAGSRFE++ETNGTAHFLEHMIFKGTE+
Sbjct  106  ESNLASKTATVGVWIDAGSRFESDETNGTAHFLEHMIFKGTEK  148



>ref|XP_010550013.1| PREDICTED: probable mitochondrial-processing peptidase subunit 
beta isoform X1 [Tarenaya hassleriana]
Length=531

 Score =   182 bits (463),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 88/109 (81%), Positives = 95/109 (87%), Gaps = 0/109 (0%)
 Frame = +1

Query  163  SPPPPTAMIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTLPN  342
            +PPPP  M YDR AE VK KLK+LENPD RFL+Y SPHP L  H  IL+AP TRVTTLPN
Sbjct  45   TPPPPHVMPYDRAAEIVKSKLKKLENPDPRFLKYASPHPTLTTHNHILSAPETRVTTLPN  104

Query  343  GLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            GLRVATESNLAAKTATVGV+IDAGSRFE++ETNGTAHFLEHMIFKGTER
Sbjct  105  GLRVATESNLAAKTATVGVWIDAGSRFESDETNGTAHFLEHMIFKGTER  153



>ref|XP_004137198.1| PREDICTED: probable mitochondrial-processing peptidase subunit 
beta-like [Cucumis sativus]
 gb|KGN53636.1| hypothetical protein Csa_4G093000 [Cucumis sativus]
Length=528

 Score =   182 bits (461),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 86/103 (83%), Positives = 94/103 (91%), Gaps = 0/103 (0%)
 Frame = +1

Query  181  AMIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVAT  360
            AMIYDRLAE+VK KLK+LENPD RFL+Y SPHP + DHT IL+AP TRVTTL NGLRVAT
Sbjct  48   AMIYDRLAEAVKSKLKQLENPDPRFLKYGSPHPTITDHTRILSAPETRVTTLSNGLRVAT  107

Query  361  ESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            ESNL A+TATVGV+IDAGSRFETEETNGTAHFLEHMIFKGTE+
Sbjct  108  ESNLTARTATVGVWIDAGSRFETEETNGTAHFLEHMIFKGTEK  150



>ref|XP_010693397.1| PREDICTED: probable mitochondrial-processing peptidase subunit 
beta [Beta vulgaris subsp. vulgaris]
Length=522

 Score =   181 bits (460),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 85/104 (82%), Positives = 97/104 (93%), Gaps = 0/104 (0%)
 Frame = +1

Query  178  TAMIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVA  357
            TAM+YDRLAESVK KL RL NPD +FL++NSPHP LADHTAILT+PAT++TTLPNGLRVA
Sbjct  41   TAMLYDRLAESVKQKLNRLSNPDPKFLKHNSPHPTLADHTAILTSPATKITTLPNGLRVA  100

Query  358  TESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            TES+LAA+TATVGV+IDAGSRFE+ +TNGTAHFLEHMIFKGT R
Sbjct  101  TESHLAARTATVGVWIDAGSRFESADTNGTAHFLEHMIFKGTHR  144



>emb|CDY55794.1| BnaCnng29060D, partial [Brassica napus]
Length=318

 Score =   177 bits (448),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 84/105 (80%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = +1

Query  175  PTAMIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRV  354
            P  M YD  AE  K KLKRLENPD RFL+Y SPHP+LA H  IL+AP TRVTTLPNGLRV
Sbjct  50   PILMPYDHAAEITKEKLKRLENPDQRFLKYASPHPILASHNHILSAPETRVTTLPNGLRV  109

Query  355  ATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            ATESNL+AKTATVGV+IDAGSRFE++ETNGTAHFLEHMIFKGTER
Sbjct  110  ATESNLSAKTATVGVWIDAGSRFESDETNGTAHFLEHMIFKGTER  154



>gb|EYU44179.1| hypothetical protein MIMGU_mgv1a004428mg [Erythranthe guttata]
Length=527

 Score =   181 bits (460),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 87/110 (79%), Positives = 96/110 (87%), Gaps = 0/110 (0%)
 Frame = +1

Query  160  PSPPPPTAMIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTLP  339
            PS    T MIYD+LAESVK KLK+LE PD RFLQ+NSPH  +  HT IL+AP TRVTTLP
Sbjct  40   PSTTRQTPMIYDQLAESVKRKLKKLEEPDHRFLQHNSPHATVDSHTEILSAPLTRVTTLP  99

Query  340  NGLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            NGLR+ATESNLA+KTATVGVFIDAGSRFE+EE+NGTAHFLEHMIFKGTER
Sbjct  100  NGLRIATESNLASKTATVGVFIDAGSRFESEESNGTAHFLEHMIFKGTER  149



>ref|XP_010550014.1| PREDICTED: probable mitochondrial-processing peptidase subunit 
beta isoform X2 [Tarenaya hassleriana]
Length=584

 Score =   182 bits (462),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 88/109 (81%), Positives = 95/109 (87%), Gaps = 0/109 (0%)
 Frame = +1

Query  163  SPPPPTAMIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTLPN  342
            +PPPP  M YDR AE VK KLK+LENPD RFL+Y SPHP L  H  IL+AP TRVTTLPN
Sbjct  45   TPPPPHVMPYDRAAEIVKSKLKKLENPDPRFLKYASPHPTLTTHNHILSAPETRVTTLPN  104

Query  343  GLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            GLRVATESNLAAKTATVGV+IDAGSRFE++ETNGTAHFLEHMIFKGTER
Sbjct  105  GLRVATESNLAAKTATVGVWIDAGSRFESDETNGTAHFLEHMIFKGTER  153



>ref|XP_002323895.1| mitochondrial processing peptidase beta subunit family protein 
[Populus trichocarpa]
 gb|EEF04028.1| mitochondrial processing peptidase beta subunit family protein 
[Populus trichocarpa]
Length=527

 Score =   181 bits (458),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 86/103 (83%), Positives = 94/103 (91%), Gaps = 0/103 (0%)
 Frame = +1

Query  181  AMIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVAT  360
            AMIYDRLAESVK KLK LENPD RFL+Y SPHP L  HT IL++P TR+TTLPNGLRVAT
Sbjct  47   AMIYDRLAESVKSKLKLLENPDPRFLKYGSPHPTLKTHTHILSSPETRITTLPNGLRVAT  106

Query  361  ESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            ESNLAAKTATVGV+IDAGSRFE++ETNGTAHFLEHMIFKGTE+
Sbjct  107  ESNLAAKTATVGVWIDAGSRFESDETNGTAHFLEHMIFKGTEK  149



>ref|XP_011013432.1| PREDICTED: probable mitochondrial-processing peptidase subunit 
beta [Populus euphratica]
Length=526

 Score =   181 bits (458),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/104 (84%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = +1

Query  178  TAMIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVA  357
            TAMIYDRLAESVK KLK LENPD RFL+Y SPHP L  HT IL+AP TR+TTLPNGLRVA
Sbjct  45   TAMIYDRLAESVKSKLKTLENPDPRFLKYGSPHPTLKTHTHILSAPETRITTLPNGLRVA  104

Query  358  TESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            TESNLA+KTATVGV+IDAGSRFE++ETNGTAHFLEHMIFKGTE+
Sbjct  105  TESNLASKTATVGVWIDAGSRFESDETNGTAHFLEHMIFKGTEK  148



>ref|XP_011000102.1| PREDICTED: probable mitochondrial-processing peptidase subunit 
beta [Populus euphratica]
Length=527

 Score =   181 bits (458),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 86/103 (83%), Positives = 94/103 (91%), Gaps = 0/103 (0%)
 Frame = +1

Query  181  AMIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVAT  360
            AMIYDRLAESVK KLK LENPD RFL+Y SPHP L  HT IL++P TR+TTLPNGLRVAT
Sbjct  47   AMIYDRLAESVKSKLKLLENPDPRFLKYGSPHPTLKTHTHILSSPETRITTLPNGLRVAT  106

Query  361  ESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            ESNLAAKTATVGV+IDAGSRFE++ETNGTAHFLEHMIFKGTE+
Sbjct  107  ESNLAAKTATVGVWIDAGSRFESDETNGTAHFLEHMIFKGTEK  149



>ref|XP_010089616.1| putative mitochondrial-processing peptidase subunit beta [Morus 
notabilis]
 gb|EXB38087.1| putative mitochondrial-processing peptidase subunit beta [Morus 
notabilis]
Length=534

 Score =   180 bits (457),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/103 (83%), Positives = 94/103 (91%), Gaps = 0/103 (0%)
 Frame = +1

Query  181  AMIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVAT  360
            AMIYDRLAE+VK KL++LENPD RFL+Y SPHP + DHT IL+AP T+VTTL NGLRVAT
Sbjct  54   AMIYDRLAEAVKSKLQQLENPDPRFLKYGSPHPAVTDHTRILSAPETKVTTLENGLRVAT  113

Query  361  ESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            ESNLAA+TATVGV+IDAGSRFE EETNGTAHFLEHMIFKGTER
Sbjct  114  ESNLAAQTATVGVWIDAGSRFENEETNGTAHFLEHMIFKGTER  156



>ref|XP_009365858.1| PREDICTED: probable mitochondrial-processing peptidase subunit 
beta [Pyrus x bretschneideri]
Length=532

 Score =   180 bits (456),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/104 (83%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = +1

Query  178  TAMIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVA  357
            TAM+YDRLAE VK K+KRLENPD RFL+Y SPHP L  H+ ILTAP TRVTTLPNGLRVA
Sbjct  51   TAMVYDRLAEEVKSKIKRLENPDPRFLKYGSPHPSLTVHSHILTAPETRVTTLPNGLRVA  110

Query  358  TESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            TESNLA+KTATVGV+IDAGSRFE +ETNGTAHFLEHMIFKGTE+
Sbjct  111  TESNLASKTATVGVWIDAGSRFENDETNGTAHFLEHMIFKGTEQ  154



>ref|XP_009117791.1| PREDICTED: probable mitochondrial-processing peptidase subunit 
beta isoform X2 [Brassica rapa]
Length=525

 Score =   179 bits (455),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 87/112 (78%), Positives = 95/112 (85%), Gaps = 3/112 (3%)
 Frame = +1

Query  163  SPPPPTA---MIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTT  333
            SPPPP     M YD  AE  K KLKRLENPD RFL+Y SPHP+LA H  IL++P TRVTT
Sbjct  38   SPPPPATPILMPYDHAAEITKEKLKRLENPDQRFLKYASPHPILASHNHILSSPETRVTT  97

Query  334  LPNGLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            LPNGLRVATESNL+AKTATVGV+IDAGSRFE++ETNGTAHFLEHMIFKGTER
Sbjct  98   LPNGLRVATESNLSAKTATVGVWIDAGSRFESDETNGTAHFLEHMIFKGTER  149



>emb|CAN71501.1| hypothetical protein VITISV_006460 [Vitis vinifera]
Length=523

 Score =   179 bits (455),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 86/102 (84%), Positives = 96/102 (94%), Gaps = 0/102 (0%)
 Frame = +1

Query  178  TAMIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVA  357
            TAM+YDRLAE+VK KLK+LENPD RFL++ SPHP L+DHT IL+AP TRVTTLPNGLRVA
Sbjct  42   TAMVYDRLAEAVKSKLKQLENPDPRFLKHGSPHPTLSDHTKILSAPETRVTTLPNGLRVA  101

Query  358  TESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGT  483
            TESNLAA+TATVGV+IDAGSRFET+ETNGTAHFLEHMIFKGT
Sbjct  102  TESNLAARTATVGVWIDAGSRFETDETNGTAHFLEHMIFKGT  143



>ref|XP_002284370.1| PREDICTED: probable mitochondrial-processing peptidase subunit 
beta [Vitis vinifera]
Length=523

 Score =   179 bits (455),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 86/102 (84%), Positives = 96/102 (94%), Gaps = 0/102 (0%)
 Frame = +1

Query  178  TAMIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVA  357
            TAM+YDRLAE+VK KLK+LENPD RFL++ SPHP L+DHT IL+AP TRVTTLPNGLRVA
Sbjct  42   TAMVYDRLAEAVKSKLKQLENPDPRFLKHGSPHPTLSDHTKILSAPETRVTTLPNGLRVA  101

Query  358  TESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGT  483
            TESNLAA+TATVGV+IDAGSRFET+ETNGTAHFLEHMIFKGT
Sbjct  102  TESNLAARTATVGVWIDAGSRFETDETNGTAHFLEHMIFKGT  143



>emb|CDY34703.1| BnaA01g33220D [Brassica napus]
Length=528

 Score =   179 bits (455),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 87/112 (78%), Positives = 95/112 (85%), Gaps = 3/112 (3%)
 Frame = +1

Query  163  SPPPPTA---MIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTT  333
            SPPPP     M YD  AE  K KLKRLENPD RFL+Y SPHP+LA H  IL++P TRVTT
Sbjct  39   SPPPPATPILMPYDHAAEITKEKLKRLENPDQRFLKYASPHPILASHNHILSSPETRVTT  98

Query  334  LPNGLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            LPNGLRVATESNL+AKTATVGV+IDAGSRFE++ETNGTAHFLEHMIFKGTER
Sbjct  99   LPNGLRVATESNLSAKTATVGVWIDAGSRFESDETNGTAHFLEHMIFKGTER  150



>ref|XP_009117783.1| PREDICTED: probable mitochondrial-processing peptidase subunit 
beta isoform X1 [Brassica rapa]
Length=527

 Score =   179 bits (454),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 87/112 (78%), Positives = 95/112 (85%), Gaps = 3/112 (3%)
 Frame = +1

Query  163  SPPPPTA---MIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTT  333
            SPPPP     M YD  AE  K KLKRLENPD RFL+Y SPHP+LA H  IL++P TRVTT
Sbjct  38   SPPPPATPILMPYDHAAEITKEKLKRLENPDQRFLKYASPHPILASHNHILSSPETRVTT  97

Query  334  LPNGLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            LPNGLRVATESNL+AKTATVGV+IDAGSRFE++ETNGTAHFLEHMIFKGTER
Sbjct  98   LPNGLRVATESNLSAKTATVGVWIDAGSRFESDETNGTAHFLEHMIFKGTER  149



>ref|XP_007215683.1| hypothetical protein PRUPE_ppa004059mg [Prunus persica]
 gb|EMJ16882.1| hypothetical protein PRUPE_ppa004059mg [Prunus persica]
Length=532

 Score =   179 bits (453),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 84/102 (82%), Positives = 93/102 (91%), Gaps = 0/102 (0%)
 Frame = +1

Query  184  MIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVATE  363
            MIYDRLAE VK K++RLENPD RFL+Y SPHP +ADHT ILTAP TRVTTLPNGLRVATE
Sbjct  53   MIYDRLAEDVKSKIRRLENPDPRFLKYGSPHPSIADHTHILTAPETRVTTLPNGLRVATE  112

Query  364  SNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            SNLAA+TATVGV+IDAGSRFE + TNGTAHFLEHMIFKGT++
Sbjct  113  SNLAAQTATVGVWIDAGSRFENDATNGTAHFLEHMIFKGTDQ  154



>ref|XP_008230864.1| PREDICTED: probable mitochondrial-processing peptidase subunit 
beta [Prunus mume]
Length=532

 Score =   178 bits (452),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 84/102 (82%), Positives = 93/102 (91%), Gaps = 0/102 (0%)
 Frame = +1

Query  184  MIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVATE  363
            MIYDRLAE VK K++RLENPD RFL+Y SPHP +ADHT ILTAP TRVTTLPNGLRVATE
Sbjct  53   MIYDRLAEDVKSKIRRLENPDPRFLKYGSPHPSIADHTHILTAPETRVTTLPNGLRVATE  112

Query  364  SNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            SNLAA+TATVGV+IDAGSRFE + TNGTAHFLEHMIFKGT++
Sbjct  113  SNLAAQTATVGVWIDAGSRFENDATNGTAHFLEHMIFKGTDQ  154



>ref|XP_009775818.1| PREDICTED: probable mitochondrial-processing peptidase subunit 
beta [Nicotiana sylvestris]
Length=531

 Score =   178 bits (452),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 94/102 (92%), Gaps = 0/102 (0%)
 Frame = +1

Query  184  MIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVATE  363
            MIYDRLAE VK K+KRLE+P+ RFLQYNSPHP +ADHT+IL++P T++TTLPNGLRVATE
Sbjct  52   MIYDRLAEQVKSKIKRLEDPNPRFLQYNSPHPTVADHTSILSSPETKITTLPNGLRVATE  111

Query  364  SNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            SNL++ TATVGV+IDAGSRFETEE NG AHFLEHMIFKGTE+
Sbjct  112  SNLSSSTATVGVWIDAGSRFETEENNGVAHFLEHMIFKGTEK  153



>ref|XP_002526098.1| mitochondrial processing peptidase beta subunit, putative [Ricinus 
communis]
 gb|EEF36292.1| mitochondrial processing peptidase beta subunit, putative [Ricinus 
communis]
Length=475

 Score =   177 bits (449),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 85/104 (82%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = +1

Query  178  TAMIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVA  357
            TAMIYDRLAESVK KLK LENPD RFL+Y SPHPVL +HT IL+AP T++TTL NGLRVA
Sbjct  47   TAMIYDRLAESVKAKLKTLENPDPRFLKYGSPHPVLTNHTHILSAPETKITTLSNGLRVA  106

Query  358  TESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            TESNLA +TATVGV+IDAGSRFE++ETNGTAHFLEHMIFKGTE+
Sbjct  107  TESNLAVQTATVGVWIDAGSRFESDETNGTAHFLEHMIFKGTEK  150



>ref|NP_001275163.1| probable mitochondrial-processing peptidase subunit beta-like 
[Solanum tuberosum]
 emb|CAA56521.1| mitochondrial processing peptidase [Solanum tuberosum]
Length=534

 Score =   178 bits (452),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/103 (79%), Positives = 95/103 (92%), Gaps = 0/103 (0%)
 Frame = +1

Query  181  AMIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVAT  360
            AMIYDRLAE VK K+KRLE+P+ RFL+YNSP P +ADHT+IL+AP T+VTTLPNGLR+AT
Sbjct  53   AMIYDRLAEQVKSKIKRLEDPNQRFLRYNSPDPTVADHTSILSAPETKVTTLPNGLRIAT  112

Query  361  ESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            ESNL+++TATVGV+IDAGSRFETEE NG AHFLEHMIFKGTE+
Sbjct  113  ESNLSSQTATVGVWIDAGSRFETEENNGVAHFLEHMIFKGTEK  155



>ref|XP_007140694.1| hypothetical protein PHAVU_008G133900g [Phaseolus vulgaris]
 gb|ESW12688.1| hypothetical protein PHAVU_008G133900g [Phaseolus vulgaris]
Length=515

 Score =   178 bits (451),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 85/104 (82%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = +1

Query  178  TAMIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVA  357
            TAMIYDR AES+K+KL++LEN D RFL++ SP P L+DHT IL AP TRVTTLPNGLRVA
Sbjct  46   TAMIYDRAAESIKYKLRQLENQDPRFLKHGSPRPTLSDHTHILAAPETRVTTLPNGLRVA  105

Query  358  TESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            TES LAA+TATVGV+IDAGSRFETEETNGTAHFLEHMIFKGTER
Sbjct  106  TESTLAARTATVGVWIDAGSRFETEETNGTAHFLEHMIFKGTER  149



>gb|AAB28041.1| cytochrome c reductase-processing peptidase subunit I, MPP subunit 
I, P55 [potatoes, var. Marfona, tuber, Peptide Mitochondrial, 
534 aa]
Length=534

 Score =   178 bits (452),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/103 (79%), Positives = 95/103 (92%), Gaps = 0/103 (0%)
 Frame = +1

Query  181  AMIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVAT  360
            AMIYDRLAE VK K+KRLE+P+ RFL+YNSP P +ADHT+IL+AP T+VTTLPNGLR+AT
Sbjct  53   AMIYDRLAEQVKSKIKRLEDPNQRFLRYNSPDPTVADHTSILSAPETKVTTLPNGLRIAT  112

Query  361  ESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            ESNL+++TATVGV+IDAGSRFETEE NG AHFLEHMIFKGTE+
Sbjct  113  ESNLSSQTATVGVWIDAGSRFETEENNGVAHFLEHMIFKGTEK  155



>ref|XP_004492264.1| PREDICTED: probable mitochondrial-processing peptidase subunit 
beta-like [Cicer arietinum]
Length=530

 Score =   178 bits (451),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 85/103 (83%), Positives = 92/103 (89%), Gaps = 0/103 (0%)
 Frame = +1

Query  181  AMIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVAT  360
             MIYDRLAESVK KL++LENPD RFL+Y SP P L DHT IL+AP TRVTTLPNGLRVAT
Sbjct  50   VMIYDRLAESVKSKLQQLENPDPRFLKYGSPRPELRDHTRILSAPETRVTTLPNGLRVAT  109

Query  361  ESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            ES+L  +TATVGV+IDAGSRFETEETNGTAHFLEHMIFKGTER
Sbjct  110  ESSLGGRTATVGVWIDAGSRFETEETNGTAHFLEHMIFKGTER  152



>ref|XP_004239065.1| PREDICTED: probable mitochondrial-processing peptidase subunit 
beta [Solanum lycopersicum]
Length=533

 Score =   177 bits (450),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/103 (80%), Positives = 95/103 (92%), Gaps = 0/103 (0%)
 Frame = +1

Query  181  AMIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVAT  360
            AMIYDRLAE VK K+KRLE+P+ RFL+YNSP P +ADHT+IL+AP T+VTTLPNGLRVAT
Sbjct  53   AMIYDRLAEQVKSKIKRLEDPNPRFLKYNSPDPTVADHTSILSAPETKVTTLPNGLRVAT  112

Query  361  ESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            ESNL+++TATVGV+IDAGSRFETEE NG AHFLEHMIFKGTE+
Sbjct  113  ESNLSSQTATVGVWIDAGSRFETEENNGVAHFLEHMIFKGTEK  155



>ref|XP_006482732.1| PREDICTED: probable mitochondrial-processing peptidase subunit 
beta-like [Citrus sinensis]
Length=530

 Score =   177 bits (450),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/102 (82%), Positives = 92/102 (90%), Gaps = 0/102 (0%)
 Frame = +1

Query  184  MIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVATE  363
            MIYDRLAE+VK KLK LENPD +FL+Y SPHP L  HT IL AP T++TTLPNGLRVATE
Sbjct  51   MIYDRLAEAVKAKLKNLENPDPKFLKYGSPHPTLTSHTHILAAPETKITTLPNGLRVATE  110

Query  364  SNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            SNLAAKTATVGV+IDAGSRFET+ETNGTAHFLEHMIFKGTE+
Sbjct  111  SNLAAKTATVGVWIDAGSRFETDETNGTAHFLEHMIFKGTEK  152



>ref|XP_009397752.1| PREDICTED: probable mitochondrial-processing peptidase subunit 
beta [Musa acuminata subsp. malaccensis]
Length=524

 Score =   177 bits (449),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/110 (76%), Positives = 96/110 (87%), Gaps = 0/110 (0%)
 Frame = +1

Query  157  APSPPPPTAMIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTL  336
            APS   P  M YDRLAE+V+ K+KRL++PD RFL+Y SPHP LADHT IL AP TRVTTL
Sbjct  36   APSLAKPPVMHYDRLAEAVRSKIKRLDDPDPRFLRYASPHPTLADHTPILAAPETRVTTL  95

Query  337  PNGLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTE  486
            PNGLR++TES LA++TATVGV+IDAGSRFET+ETNGTAHFLEHMIFKGTE
Sbjct  96   PNGLRISTESTLASRTATVGVWIDAGSRFETDETNGTAHFLEHMIFKGTE  145



>ref|XP_004304237.1| PREDICTED: probable mitochondrial-processing peptidase subunit 
beta [Fragaria vesca subsp. vesca]
Length=526

 Score =   177 bits (449),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = +1

Query  178  TAMIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVA  357
            TAM+YDRLAE VK KL++LENPD RFL+Y SPHP + DH+ ILTAP TRVT LPNGLRVA
Sbjct  45   TAMVYDRLAEDVKSKLQKLENPDPRFLKYGSPHPAVTDHSHILTAPETRVTVLPNGLRVA  104

Query  358  TESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            TESNLAAKTATVGV+ID+GSRFE +E NGTAHFLEHMIFKGT++
Sbjct  105  TESNLAAKTATVGVWIDSGSRFENDENNGTAHFLEHMIFKGTKK  148



>ref|XP_003532256.1| PREDICTED: probable mitochondrial-processing peptidase subunit 
beta-like [Glycine max]
Length=528

 Score =   177 bits (448),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 83/104 (80%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = +1

Query  178  TAMIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVA  357
            TAMIYDR AE+VK KL++LENPD RFL++ SP P L+DHT IL++P TRVTTLPNGLR+A
Sbjct  47   TAMIYDRAAEAVKSKLRQLENPDPRFLKHGSPRPTLSDHTRILSSPETRVTTLPNGLRIA  106

Query  358  TESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            TES L+A+TATVGV+IDAGSRFETEETNGTAHFLEHMIFKGTER
Sbjct  107  TESTLSARTATVGVWIDAGSRFETEETNGTAHFLEHMIFKGTER  150



>ref|XP_003552094.1| PREDICTED: probable mitochondrial-processing peptidase subunit 
beta-like [Glycine max]
Length=527

 Score =   176 bits (447),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 84/104 (81%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = +1

Query  178  TAMIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVA  357
            TAMIYDR AE+VK KL+ LENPD RFL++ SP P L+DHT IL+AP TRVTTLPNGLR+A
Sbjct  46   TAMIYDRAAEAVKSKLRLLENPDPRFLKHGSPRPTLSDHTRILSAPETRVTTLPNGLRIA  105

Query  358  TESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            TES L+A+TATVGV+IDAGSRFETEETNGTAHFLEHMIFKGTER
Sbjct  106  TESTLSARTATVGVWIDAGSRFETEETNGTAHFLEHMIFKGTER  149



>gb|KEH22544.1| processing peptidase [Medicago truncatula]
Length=532

 Score =   176 bits (446),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 83/103 (81%), Positives = 92/103 (89%), Gaps = 0/103 (0%)
 Frame = +1

Query  181  AMIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVAT  360
             MIYDRLAESVK KL+RLENPD RFL++ SP P + DHT IL AP TR+TTLPNGLRVAT
Sbjct  52   VMIYDRLAESVKQKLQRLENPDPRFLKFGSPKPEIRDHTRILAAPETRITTLPNGLRVAT  111

Query  361  ESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            ES+L+A TATVGV+IDAGSRFETEE+NGTAHFLEHMIFKGTER
Sbjct  112  ESSLSAMTATVGVWIDAGSRFETEESNGTAHFLEHMIFKGTER  154



>ref|XP_006431275.1| hypothetical protein CICLE_v10011465mg [Citrus clementina]
 gb|ESR44515.1| hypothetical protein CICLE_v10011465mg [Citrus clementina]
Length=530

 Score =   176 bits (445),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 83/102 (81%), Positives = 91/102 (89%), Gaps = 0/102 (0%)
 Frame = +1

Query  184  MIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVATE  363
            MIYDRLAE+VK KLK LENPD +FL+Y SPHP L  HT IL AP T++ TLPNGLRVATE
Sbjct  51   MIYDRLAEAVKAKLKNLENPDPKFLKYGSPHPTLTSHTHILAAPETKIATLPNGLRVATE  110

Query  364  SNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            SNLAAKTATVGV+IDAGSRFET+ETNGTAHFLEHMIFKGTE+
Sbjct  111  SNLAAKTATVGVWIDAGSRFETDETNGTAHFLEHMIFKGTEK  152



>ref|XP_007032695.1| Insulinase (Peptidase family M16) protein isoform 1 [Theobroma 
cacao]
 ref|XP_007032697.1| Insulinase (Peptidase family M16) protein isoform 1 [Theobroma 
cacao]
 ref|XP_007032699.1| Insulinase (Peptidase family M16) protein isoform 1 [Theobroma 
cacao]
 gb|EOY03621.1| Insulinase (Peptidase family M16) protein isoform 1 [Theobroma 
cacao]
 gb|EOY03623.1| Insulinase (Peptidase family M16) protein isoform 1 [Theobroma 
cacao]
 gb|EOY03625.1| Insulinase (Peptidase family M16) protein isoform 1 [Theobroma 
cacao]
Length=531

 Score =   176 bits (445),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = +1

Query  178  TAMIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVA  357
            TAMIYDRLA SVK KL++LENPD RFL+Y SPHP +A HT IL++P T++TTLPNGLRVA
Sbjct  50   TAMIYDRLALSVKSKLQKLENPDPRFLKYGSPHPTVASHTHILSSPETKITTLPNGLRVA  109

Query  358  TESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            TES L+A+TATVGV+IDAGSRFET+ETNGTAHFLEHMIFKGTE+
Sbjct  110  TESTLSARTATVGVWIDAGSRFETDETNGTAHFLEHMIFKGTEK  153



>ref|XP_007032698.1| Insulinase (Peptidase family M16) protein isoform 4 [Theobroma 
cacao]
 gb|EOY03624.1| Insulinase (Peptidase family M16) protein isoform 4 [Theobroma 
cacao]
Length=532

 Score =   176 bits (445),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = +1

Query  178  TAMIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVA  357
            TAMIYDRLA SVK KL++LENPD RFL+Y SPHP +A HT IL++P T++TTLPNGLRVA
Sbjct  50   TAMIYDRLALSVKSKLQKLENPDPRFLKYGSPHPTVASHTHILSSPETKITTLPNGLRVA  109

Query  358  TESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            TES L+A+TATVGV+IDAGSRFET+ETNGTAHFLEHMIFKGTE+
Sbjct  110  TESTLSARTATVGVWIDAGSRFETDETNGTAHFLEHMIFKGTEK  153



>ref|XP_009388910.1| PREDICTED: probable mitochondrial-processing peptidase subunit 
beta [Musa acuminata subsp. malaccensis]
Length=523

 Score =   175 bits (444),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/110 (74%), Positives = 95/110 (86%), Gaps = 0/110 (0%)
 Frame = +1

Query  157  APSPPPPTAMIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTL  336
            A SP  P  M+YDRL+E+V+ K+KRL++PD RFL+Y SPH  L DHT IL AP TR+TTL
Sbjct  35   ASSPAKPPVMLYDRLSEAVRSKIKRLDDPDPRFLRYASPHAALVDHTPILAAPETRITTL  94

Query  337  PNGLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTE  486
            PNGLR+ATES LA++TATVGV+IDAGSRFET+ETNGTAHFLEHMIFKGTE
Sbjct  95   PNGLRIATESTLASRTATVGVWIDAGSRFETDETNGTAHFLEHMIFKGTE  144



>ref|XP_007032696.1| Insulinase (Peptidase family M16) protein isoform 2 [Theobroma 
cacao]
 gb|EOY03622.1| Insulinase (Peptidase family M16) protein isoform 2 [Theobroma 
cacao]
Length=538

 Score =   176 bits (445),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = +1

Query  178  TAMIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVA  357
            TAMIYDRLA SVK KL++LENPD RFL+Y SPHP +A HT IL++P T++TTLPNGLRVA
Sbjct  50   TAMIYDRLALSVKSKLQKLENPDPRFLKYGSPHPTVASHTHILSSPETKITTLPNGLRVA  109

Query  358  TESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            TES L+A+TATVGV+IDAGSRFET+ETNGTAHFLEHMIFKGTE+
Sbjct  110  TESTLSARTATVGVWIDAGSRFETDETNGTAHFLEHMIFKGTEK  153



>ref|XP_009610110.1| PREDICTED: probable mitochondrial-processing peptidase subunit 
beta [Nicotiana tomentosiformis]
Length=531

 Score =   175 bits (444),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 92/102 (90%), Gaps = 0/102 (0%)
 Frame = +1

Query  184  MIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVATE  363
            MIYDRLAE VK K+KRLE P+ +FLQYNSPHP  ADHT+IL++P T++TTLPNGLRVATE
Sbjct  52   MIYDRLAEQVKSKIKRLEEPNPKFLQYNSPHPTAADHTSILSSPETKITTLPNGLRVATE  111

Query  364  SNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            SNL++ TATVGV+IDAGSRFETEE NG AHFLEHMIFKGTE+
Sbjct  112  SNLSSSTATVGVWIDAGSRFETEENNGVAHFLEHMIFKGTEK  153



>gb|KHG02693.1| hypothetical protein F383_26252 [Gossypium arboreum]
Length=519

 Score =   174 bits (441),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 79/109 (72%), Positives = 94/109 (86%), Gaps = 0/109 (0%)
 Frame = +1

Query  163  SPPPPTAMIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTLPN  342
            +PPPPTAMIYDRL+  V  +L++LE+PDSRFL+Y SPHP    HT IL++P TR+TTL N
Sbjct  31   APPPPTAMIYDRLSHCVNSRLRKLEHPDSRFLKYGSPHPTQTSHTHILSSPETRITTLSN  90

Query  343  GLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            GLRVATES+L  +TATVGV+IDAGSRFE+EETNGTAHFLEHMI KGTE+
Sbjct  91   GLRVATESSLHCRTATVGVWIDAGSRFESEETNGTAHFLEHMILKGTEK  139



>gb|KCW57278.1| hypothetical protein EUGRSUZ_H00078 [Eucalyptus grandis]
Length=522

 Score =   174 bits (441),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 79/102 (77%), Positives = 94/102 (92%), Gaps = 0/102 (0%)
 Frame = +1

Query  184  MIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVATE  363
            M+YDRLAE+VK K+++LENPD RFL+Y SPHP +ADHT +L AP TRVTTL NGLR+ATE
Sbjct  58   MVYDRLAEAVKSKIRQLENPDPRFLRYASPHPAVADHTRVLAAPETRVTTLSNGLRIATE  117

Query  364  SNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            S+LAA+TATVGV+IDAGSRFET++TNGTAHFLEHMIFKGTE+
Sbjct  118  SSLAARTATVGVWIDAGSRFETDDTNGTAHFLEHMIFKGTEK  159



>ref|XP_002871668.1| hypothetical protein ARALYDRAFT_909526 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47927.1| hypothetical protein ARALYDRAFT_909526 [Arabidopsis lyrata subsp. 
lyrata]
Length=527

 Score =   174 bits (441),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 83/107 (78%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = +1

Query  163  SPPPPTAMIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTLPN  342
            SPPPP  + YD  AE+V  KLK+LENPDSRFL+Y SPHP LA H  IL+AP TRVTTLPN
Sbjct  41   SPPPPHILPYDNAAETVNSKLKKLENPDSRFLKYASPHPKLASHDHILSAPETRVTTLPN  100

Query  343  GLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGT  483
            GLRVATESNL+AKTATVGV+IDAGSRFE++ TNGTAHFLEHM+FKGT
Sbjct  101  GLRVATESNLSAKTATVGVWIDAGSRFESDSTNGTAHFLEHMLFKGT  147



>gb|KDP27225.1| hypothetical protein JCGZ_19924 [Jatropha curcas]
Length=530

 Score =   174 bits (441),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 83/103 (81%), Positives = 93/103 (90%), Gaps = 0/103 (0%)
 Frame = +1

Query  181  AMIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVAT  360
            AMIYDRLAESVK KL++LE+PD RFL+Y SPHP    HT IL+AP TR+TTL NGLRVAT
Sbjct  50   AMIYDRLAESVKSKLQQLESPDPRFLKYGSPHPTRRSHTHILSAPETRITTLSNGLRVAT  109

Query  361  ESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            ESNLA+KTATVGV+IDAGSRFETE+TNGTAHFLEHMIFKGTE+
Sbjct  110  ESNLASKTATVGVWIDAGSRFETEDTNGTAHFLEHMIFKGTEK  152



>ref|XP_010069059.1| PREDICTED: probable mitochondrial-processing peptidase subunit 
beta [Eucalyptus grandis]
 gb|KCW57277.1| hypothetical protein EUGRSUZ_H00078 [Eucalyptus grandis]
Length=537

 Score =   174 bits (441),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 79/102 (77%), Positives = 94/102 (92%), Gaps = 0/102 (0%)
 Frame = +1

Query  184  MIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVATE  363
            M+YDRLAE+VK K+++LENPD RFL+Y SPHP +ADHT +L AP TRVTTL NGLR+ATE
Sbjct  58   MVYDRLAEAVKSKIRQLENPDPRFLRYASPHPAVADHTRVLAAPETRVTTLSNGLRIATE  117

Query  364  SNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            S+LAA+TATVGV+IDAGSRFET++TNGTAHFLEHMIFKGTE+
Sbjct  118  SSLAARTATVGVWIDAGSRFETDDTNGTAHFLEHMIFKGTEK  159



>dbj|BAH57104.1| AT3G02090 [Arabidopsis thaliana]
Length=480

 Score =   172 bits (437),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 92/102 (90%), Gaps = 0/102 (0%)
 Frame = +1

Query  184  MIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVATE  363
            M YD  AE +K+K+K+LENPD RFL+Y SPHP+LA H  IL+AP TRVTTLPNGLRVATE
Sbjct  1    MPYDHAAEIIKNKIKKLENPDKRFLKYASPHPILASHNHILSAPETRVTTLPNGLRVATE  60

Query  364  SNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            SNL+AKTATVGV+IDAGSRFE++ETNGTAHFLEHMIFKGT+R
Sbjct  61   SNLSAKTATVGVWIDAGSRFESDETNGTAHFLEHMIFKGTDR  102



>gb|AIG20406.1| mitochondrial processing peptidase beta subunit [Brassica oleracea 
var. alboglabra]
Length=532

 Score =   173 bits (439),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 90/102 (88%), Gaps = 0/102 (0%)
 Frame = +1

Query  184  MIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVATE  363
            M YD  AE  K KLKRL+NPD RFL+Y SPHP+LA H  IL+AP TRVTTLPNGLRVATE
Sbjct  53   MPYDHAAEITKEKLKRLDNPDQRFLKYASPHPILASHNHILSAPETRVTTLPNGLRVATE  112

Query  364  SNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            SNL+AKTATVGV+IDAGSRFE++ETNGTAHFLEHMIFKGTER
Sbjct  113  SNLSAKTATVGVWIDAGSRFESDETNGTAHFLEHMIFKGTER  154



>gb|KFK37669.1| hypothetical protein AALP_AA3G013300 [Arabis alpina]
Length=530

 Score =   173 bits (439),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 91/102 (89%), Gaps = 0/102 (0%)
 Frame = +1

Query  184  MIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVATE  363
            M YD  AE +K+K+K+LENPD RFL+Y SPHP LA H  IL+AP TRVTTLPNGLRVATE
Sbjct  51   MPYDHAAEIIKNKIKKLENPDQRFLRYASPHPTLASHNHILSAPETRVTTLPNGLRVATE  110

Query  364  SNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            SNLAAKTATVGV+IDAGSRFE++ETNGTAHFLEHMIFKGTER
Sbjct  111  SNLAAKTATVGVWIDAGSRFESDETNGTAHFLEHMIFKGTER  152



>ref|XP_006599164.1| PREDICTED: probable mitochondrial-processing peptidase subunit 
beta-like isoform X2 [Glycine max]
Length=449

 Score =   171 bits (433),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 81/103 (79%), Positives = 93/103 (90%), Gaps = 0/103 (0%)
 Frame = +1

Query  181  AMIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVAT  360
            AM+YDRLAE+ K KL+RL+NPD RFL++ SP P LADHT +L AP TRVTTLPNGLRVAT
Sbjct  43   AMLYDRLAEATKAKLRRLDNPDPRFLKHGSPVPALADHTRVLGAPETRVTTLPNGLRVAT  102

Query  361  ESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            ES+LA++TATVGV+IDAGSRFETEETNGTAHFLEHMIFKGT +
Sbjct  103  ESSLASQTATVGVWIDAGSRFETEETNGTAHFLEHMIFKGTAK  145



>ref|XP_009408617.1| PREDICTED: probable mitochondrial-processing peptidase subunit 
beta [Musa acuminata subsp. malaccensis]
Length=522

 Score =   172 bits (435),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 78/101 (77%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +1

Query  184  MIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVATE  363
            M YDRLAE+V+ K+KRL++PD RFL+Y SPHP LADHT++L AP TRVTTLPNGLR+ATE
Sbjct  43   MHYDRLAEAVRSKIKRLDDPDPRFLRYASPHPALADHTSVLAAPQTRVTTLPNGLRIATE  102

Query  364  SNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTE  486
            S L+++TATVGV+IDAGSRFET+ETNGTAHFLEHMIFKGT+
Sbjct  103  STLSSRTATVGVWIDAGSRFETDETNGTAHFLEHMIFKGTQ  143



>ref|XP_006287485.1| hypothetical protein CARUB_v10000696mg [Capsella rubella]
 gb|EOA20383.1| hypothetical protein CARUB_v10000696mg [Capsella rubella]
Length=529

 Score =   172 bits (435),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 80/109 (73%), Positives = 94/109 (86%), Gaps = 0/109 (0%)
 Frame = +1

Query  163  SPPPPTAMIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTLPN  342
            S P P  M YD  AE+VK KLK+LENP+ RFL+Y SPHP+LA H  IL++P TR+TTLPN
Sbjct  43   SHPLPQVMPYDNAAETVKSKLKKLENPELRFLKYASPHPILASHDHILSSPETRITTLPN  102

Query  343  GLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            GLRVATESNL+AKTAT+GV+IDAGSRFE++ TNGTAHFLEHM+FKGTER
Sbjct  103  GLRVATESNLSAKTATIGVWIDAGSRFESDSTNGTAHFLEHMLFKGTER  151



>ref|XP_003547775.1| PREDICTED: probable mitochondrial-processing peptidase subunit 
beta-like isoform X1 [Glycine max]
Length=523

 Score =   171 bits (432),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 81/103 (79%), Positives = 93/103 (90%), Gaps = 0/103 (0%)
 Frame = +1

Query  181  AMIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVAT  360
            AM+YDRLAE+ K KL+RL+NPD RFL++ SP P LADHT +L AP TRVTTLPNGLRVAT
Sbjct  43   AMLYDRLAEATKAKLRRLDNPDPRFLKHGSPVPALADHTRVLGAPETRVTTLPNGLRVAT  102

Query  361  ESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            ES+LA++TATVGV+IDAGSRFETEETNGTAHFLEHMIFKGT +
Sbjct  103  ESSLASQTATVGVWIDAGSRFETEETNGTAHFLEHMIFKGTAK  145



>ref|XP_002882205.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58464.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=531

 Score =   171 bits (432),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 79/102 (77%), Positives = 92/102 (90%), Gaps = 0/102 (0%)
 Frame = +1

Query  184  MIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVATE  363
            M YD  AE +K+K+K+LENPD RFL+Y SPHP+LA H  IL+AP TRVTTLPNGLRVATE
Sbjct  52   MPYDHAAEIMKNKIKKLENPDKRFLKYASPHPILASHNHILSAPETRVTTLPNGLRVATE  111

Query  364  SNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            SNL+AKTATVGV+IDAGSRFE++ETNGTAHFLEHMIFKGT++
Sbjct  112  SNLSAKTATVGVWIDAGSRFESDETNGTAHFLEHMIFKGTDK  153



>ref|XP_010525113.1| PREDICTED: probable mitochondrial-processing peptidase subunit 
beta [Tarenaya hassleriana]
Length=531

 Score =   170 bits (430),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 88/102 (86%), Gaps = 0/102 (0%)
 Frame = +1

Query  184  MIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVATE  363
            M YDR AE VK K+K+LENPD RFL+Y SPHP L  H  IL+AP TRVTTLPNGLR+ATE
Sbjct  52   MPYDRAAEIVKSKIKKLENPDPRFLKYASPHPTLTSHNHILSAPETRVTTLPNGLRIATE  111

Query  364  SNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            SNLA KTATVGV+IDAGSRFE +ETNGTAHFLEHMIFKGTER
Sbjct  112  SNLAVKTATVGVWIDAGSRFEADETNGTAHFLEHMIFKGTER  153



>ref|XP_008792725.1| PREDICTED: probable mitochondrial-processing peptidase subunit 
beta [Phoenix dactylifera]
Length=525

 Score =   168 bits (426),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = +1

Query  154  LAPSPPPPTAMIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTT  333
            +APS   P  M YD L  +V  K++RL+NPDSRFL+Y+SP+P LADHT I+  P TRVTT
Sbjct  36   VAPSTSGPPVMHYDLLVRAVSAKIQRLDNPDSRFLRYSSPYPALADHTPIVAVPETRVTT  95

Query  334  LPNGLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGT  483
            LPNGLRVATES LA++TATVGV+IDAGSRFET+ETNGTAHFLEHMIFKGT
Sbjct  96   LPNGLRVATESTLASRTATVGVWIDAGSRFETDETNGTAHFLEHMIFKGT  145



>ref|XP_010936330.1| PREDICTED: probable mitochondrial-processing peptidase subunit 
beta [Elaeis guineensis]
Length=525

 Score =   167 bits (424),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 80/108 (74%), Positives = 91/108 (84%), Gaps = 0/108 (0%)
 Frame = +1

Query  160  PSPPPPTAMIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTLP  339
            PS   P  M YD L  +V  K++R++NPD RFL+Y+SPHP LADHT IL AP TRVTTLP
Sbjct  38   PSTSGPPVMHYDLLVRAVSAKIQRVDNPDPRFLRYSSPHPALADHTPILVAPETRVTTLP  97

Query  340  NGLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGT  483
            NGLRVATES LA++TATVGV+IDAGSRFET+ETNGTAHFLEHMIFKGT
Sbjct  98   NGLRVATESTLASRTATVGVWIDAGSRFETDETNGTAHFLEHMIFKGT  145



>ref|XP_010463599.1| PREDICTED: probable mitochondrial-processing peptidase subunit 
beta isoform X1 [Camelina sativa]
Length=531

 Score =   167 bits (422),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/102 (77%), Positives = 89/102 (87%), Gaps = 0/102 (0%)
 Frame = +1

Query  184  MIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVATE  363
            M YD  AE +K K+K+LENPD RFL+Y SP P+LA H  IL+AP TRVTTLPNGLRVATE
Sbjct  52   MPYDHAAELIKSKIKKLENPDKRFLKYASPIPILASHNHILSAPETRVTTLPNGLRVATE  111

Query  364  SNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            SNL+AKTATVGV+IDAGSRFE++ETNGTAHFLEHMIFKGT R
Sbjct  112  SNLSAKTATVGVWIDAGSRFESDETNGTAHFLEHMIFKGTSR  153



>ref|XP_010463600.1| PREDICTED: probable mitochondrial-processing peptidase subunit 
beta isoform X2 [Camelina sativa]
Length=535

 Score =   167 bits (422),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/102 (77%), Positives = 89/102 (87%), Gaps = 0/102 (0%)
 Frame = +1

Query  184  MIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVATE  363
            M YD  AE +K K+K+LENPD RFL+Y SP P+LA H  IL+AP TRVTTLPNGLRVATE
Sbjct  52   MPYDHAAELIKSKIKKLENPDKRFLKYASPIPILASHNHILSAPETRVTTLPNGLRVATE  111

Query  364  SNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            SNL+AKTATVGV+IDAGSRFE++ETNGTAHFLEHMIFKGT R
Sbjct  112  SNLSAKTATVGVWIDAGSRFESDETNGTAHFLEHMIFKGTSR  153



>ref|XP_010485442.1| PREDICTED: probable mitochondrial-processing peptidase subunit 
beta isoform X1 [Camelina sativa]
Length=531

 Score =   166 bits (420),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 78/102 (76%), Positives = 89/102 (87%), Gaps = 0/102 (0%)
 Frame = +1

Query  184  MIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVATE  363
            M YD  AE +K K+K+LENPD RFL+Y SP P+LA H  IL+AP TRVTTLPNGLRVATE
Sbjct  52   MPYDHAAEIIKSKIKKLENPDKRFLKYASPIPILASHNHILSAPETRVTTLPNGLRVATE  111

Query  364  SNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            SNL+AKTATVGV+IDAGSRFE+++TNGTAHFLEHMIFKGT R
Sbjct  112  SNLSAKTATVGVWIDAGSRFESDQTNGTAHFLEHMIFKGTSR  153



>ref|XP_008805108.1| PREDICTED: probable mitochondrial-processing peptidase subunit 
beta isoform X2 [Phoenix dactylifera]
Length=422

 Score =   164 bits (415),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 79/103 (77%), Positives = 89/103 (86%), Gaps = 0/103 (0%)
 Frame = +1

Query  175  PTAMIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRV  354
            P  M YD LA +V  K+KRL++PD RFL+Y SPHP  ADHT IL+AP TRVTTLPNGLRV
Sbjct  41   PPVMHYDVLARAVSAKIKRLDDPDPRFLRYASPHPARADHTPILSAPETRVTTLPNGLRV  100

Query  355  ATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGT  483
            ATES LA++TATVG++IDAGSRFETEETNGTAHFLEHMIFKGT
Sbjct  101  ATESALASRTATVGIWIDAGSRFETEETNGTAHFLEHMIFKGT  143



>ref|XP_010443247.1| PREDICTED: probable mitochondrial-processing peptidase subunit 
beta isoform X1 [Camelina sativa]
Length=531

 Score =   166 bits (420),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 78/102 (76%), Positives = 89/102 (87%), Gaps = 0/102 (0%)
 Frame = +1

Query  184  MIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVATE  363
            M YD  AE +K K+K+LENPD RFL+Y SP P+LA H  IL+AP TRVTTLPNGLRVATE
Sbjct  52   MPYDHAAELIKSKIKKLENPDKRFLKYASPIPILASHNHILSAPETRVTTLPNGLRVATE  111

Query  364  SNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            SNL+AKTATVGV+IDAGSRFE+++TNGTAHFLEHMIFKGT R
Sbjct  112  SNLSAKTATVGVWIDAGSRFESDQTNGTAHFLEHMIFKGTSR  153



>ref|XP_010485443.1| PREDICTED: probable mitochondrial-processing peptidase subunit 
beta isoform X2 [Camelina sativa]
Length=535

 Score =   166 bits (419),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 78/102 (76%), Positives = 89/102 (87%), Gaps = 0/102 (0%)
 Frame = +1

Query  184  MIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVATE  363
            M YD  AE +K K+K+LENPD RFL+Y SP P+LA H  IL+AP TRVTTLPNGLRVATE
Sbjct  52   MPYDHAAEIIKSKIKKLENPDKRFLKYASPIPILASHNHILSAPETRVTTLPNGLRVATE  111

Query  364  SNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            SNL+AKTATVGV+IDAGSRFE+++TNGTAHFLEHMIFKGT R
Sbjct  112  SNLSAKTATVGVWIDAGSRFESDQTNGTAHFLEHMIFKGTSR  153



>gb|KFK25778.1| hypothetical protein AALP_AA8G159200 [Arabis alpina]
Length=526

 Score =   166 bits (419),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 82/110 (75%), Positives = 94/110 (85%), Gaps = 1/110 (1%)
 Frame = +1

Query  163  SPPPPTAMI-YDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTLP  339
            SP  P+ +  YD   ES+K KLK+LENPD+RFL+Y SP+P LA H  IL+AP TRVTTLP
Sbjct  39   SPATPSFITPYDYAPESMKSKLKKLENPDTRFLKYASPNPTLASHDHILSAPETRVTTLP  98

Query  340  NGLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            NGLRVATESNL+AKTATVGV+IDAGSRFE+E TNGTAHFLEHMIFKGTE+
Sbjct  99   NGLRVATESNLSAKTATVGVWIDAGSRFESELTNGTAHFLEHMIFKGTEK  148



>ref|XP_010443979.1| PREDICTED: probable mitochondrial-processing peptidase subunit 
beta isoform X2 [Camelina sativa]
Length=535

 Score =   166 bits (419),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 78/102 (76%), Positives = 89/102 (87%), Gaps = 0/102 (0%)
 Frame = +1

Query  184  MIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVATE  363
            M YD  AE +K K+K+LENPD RFL+Y SP P+LA H  IL+AP TRVTTLPNGLRVATE
Sbjct  52   MPYDHAAELIKSKIKKLENPDKRFLKYASPIPILASHNHILSAPETRVTTLPNGLRVATE  111

Query  364  SNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            SNL+AKTATVGV+IDAGSRFE+++TNGTAHFLEHMIFKGT R
Sbjct  112  SNLSAKTATVGVWIDAGSRFESDQTNGTAHFLEHMIFKGTSR  153



>ref|XP_006837053.1| hypothetical protein AMTR_s00110p00066820 [Amborella trichopoda]
 gb|ERM99906.1| hypothetical protein AMTR_s00110p00066820 [Amborella trichopoda]
Length=477

 Score =   164 bits (416),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 76/100 (76%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = +1

Query  190  YDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVATESN  369
            YD+LAE VK KLK+L+NP+  FLQ+ SP P L DHTAIL+AP+T+VTTLP+G R+ATESN
Sbjct  48   YDQLAEQVKQKLKKLDNPNPLFLQHASPEPTLTDHTAILSAPSTKVTTLPSGFRIATESN  107

Query  370  LAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            LA++TATVGV+IDAGSRFET+ETNGTAHFLEHMIFKGT R
Sbjct  108  LASQTATVGVWIDAGSRFETDETNGTAHFLEHMIFKGTNR  147



>ref|XP_006297347.1| hypothetical protein CARUB_v10013366mg [Capsella rubella]
 gb|EOA30245.1| hypothetical protein CARUB_v10013366mg [Capsella rubella]
Length=561

 Score =   166 bits (419),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +1

Query  184  MIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVATE  363
            M YD  AE +K+K+K+LENPD RFL+Y SP P+LA H  IL+AP TRVTTLPNGLRVATE
Sbjct  52   MPYDHAAELIKNKIKKLENPDKRFLKYASPIPILASHNHILSAPETRVTTLPNGLRVATE  111

Query  364  SNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGT  483
            SNL+AKTATVGV+IDAGSRFE++ETNGTAHFLEHMIFKGT
Sbjct  112  SNLSAKTATVGVWIDAGSRFESDETNGTAHFLEHMIFKGT  151



>ref|XP_010649506.1| PREDICTED: probable mitochondrial-processing peptidase subunit 
beta isoform X2 [Vitis vinifera]
Length=485

 Score =   164 bits (415),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 75/104 (72%), Positives = 89/104 (86%), Gaps = 0/104 (0%)
 Frame = +1

Query  178  TAMIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVA  357
            T MIYDR A++VK KLKRLE PDSRFL+Y SPHP+LADH+A L++P TRVTTLPNGLRVA
Sbjct  40   TTMIYDRAADTVKSKLKRLETPDSRFLRYTSPHPILADHSATLSSPETRVTTLPNGLRVA  99

Query  358  TESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            TES L  + A VGV+ID+GSRFE++ TNG AHFLE M+FKGTE+
Sbjct  100  TESRLPGRAAAVGVWIDSGSRFESDATNGVAHFLERMVFKGTEK  143



>ref|XP_010939148.1| PREDICTED: LOW QUALITY PROTEIN: probable mitochondrial-processing 
peptidase subunit beta [Elaeis guineensis]
Length=523

 Score =   164 bits (416),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 79/103 (77%), Positives = 88/103 (85%), Gaps = 0/103 (0%)
 Frame = +1

Query  175  PTAMIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRV  354
            P  M YD LA +V  K+KRL++PD RFL+Y SPHP LADHT IL+ P TRVTTLPNGLRV
Sbjct  41   PPVMHYDVLARAVSAKIKRLDDPDPRFLRYASPHPALADHTPILSTPETRVTTLPNGLRV  100

Query  355  ATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGT  483
            ATES LA++TATVGV+IDAGSRFE EETNGTAHFLEHMIFKGT
Sbjct  101  ATESTLASRTATVGVWIDAGSRFENEETNGTAHFLEHMIFKGT  143



>ref|XP_008805107.1| PREDICTED: probable mitochondrial-processing peptidase subunit 
beta isoform X1 [Phoenix dactylifera]
Length=523

 Score =   164 bits (416),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 79/103 (77%), Positives = 89/103 (86%), Gaps = 0/103 (0%)
 Frame = +1

Query  175  PTAMIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRV  354
            P  M YD LA +V  K+KRL++PD RFL+Y SPHP  ADHT IL+AP TRVTTLPNGLRV
Sbjct  41   PPVMHYDVLARAVSAKIKRLDDPDPRFLRYASPHPARADHTPILSAPETRVTTLPNGLRV  100

Query  355  ATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGT  483
            ATES LA++TATVG++IDAGSRFETEETNGTAHFLEHMIFKGT
Sbjct  101  ATESALASRTATVGIWIDAGSRFETEETNGTAHFLEHMIFKGT  143



>gb|KJB75639.1| hypothetical protein B456_012G049500 [Gossypium raimondii]
Length=486

 Score =   164 bits (414),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 98/151 (65%), Positives = 120/151 (79%), Gaps = 12/151 (8%)
 Frame = +1

Query  37   MAIRQLLNLarrsrrtiasrrGKPFssssaavaaaaNGTLAPSPPPPTAMIYDRLAESVK  216
            MAI+QLL+LARRSR        KPFSS + A ++ +    A +PPPPTAMIYDRL+  V 
Sbjct  1    MAIKQLLSLARRSR--------KPFSSLTVARSSNS----AAAPPPPTAMIYDRLSHCVN  48

Query  217  HKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVATESNLAAKTATVG  396
             +L++LE+PDSRFL+Y SPHP    HT IL++P T++TTL NGLRVATES+L  +TATVG
Sbjct  49   SRLRKLEHPDSRFLKYGSPHPTQTSHTHILSSPETKITTLSNGLRVATESSLHCRTATVG  108

Query  397  VFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            V+IDAGSRFE+EETNGTAHFLEHMIFKGTE+
Sbjct  109  VWIDAGSRFESEETNGTAHFLEHMIFKGTEK  139



>ref|XP_010649504.1| PREDICTED: probable mitochondrial-processing peptidase subunit 
beta isoform X1 [Vitis vinifera]
Length=521

 Score =   164 bits (415),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/104 (72%), Positives = 89/104 (86%), Gaps = 0/104 (0%)
 Frame = +1

Query  178  TAMIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVA  357
            T MIYDR A++VK KLKRLE PDSRFL+Y SPHP+LADH+A L++P TRVTTLPNGLRVA
Sbjct  40   TTMIYDRAADTVKSKLKRLETPDSRFLRYTSPHPILADHSATLSSPETRVTTLPNGLRVA  99

Query  358  TESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            TES L  + A VGV+ID+GSRFE++ TNG AHFLE M+FKGTE+
Sbjct  100  TESRLPGRAAAVGVWIDSGSRFESDATNGVAHFLERMVFKGTEK  143



>gb|EAY89022.1| hypothetical protein OsI_10505 [Oryza sativa Indica Group]
Length=533

 Score =   164 bits (414),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 78/114 (68%), Positives = 95/114 (83%), Gaps = 2/114 (2%)
 Frame = +1

Query  148  GTLAPSPPP--PTAMIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPAT  321
            G +AP   P  P  M+YDR+AE+V  +L+RLE+PD RFL+Y SP P  ADHTAIL AP T
Sbjct  40   GVIAPDAAPVRPPMMVYDRIAEAVNARLRRLEHPDPRFLRYASPVPAHADHTAILAAPET  99

Query  322  RVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGT  483
            RVTTLPNGLRVATES+LA++TATVGV+IDAGSR+ETE++ G AHF+EHM+FKGT
Sbjct  100  RVTTLPNGLRVATESSLASRTATVGVWIDAGSRYETEDSAGVAHFVEHMLFKGT  153



>ref|NP_001049357.1| Os03g0212700 [Oryza sativa Japonica Group]
 gb|ABF94614.1| Mitochondrial processing peptidase beta subunit, mitochondrial 
precursor, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF11271.1| Os03g0212700 [Oryza sativa Japonica Group]
Length=533

 Score =   164 bits (414),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 78/114 (68%), Positives = 95/114 (83%), Gaps = 2/114 (2%)
 Frame = +1

Query  148  GTLAPSPPP--PTAMIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPAT  321
            G +AP   P  P  M+YDR+AE+V  +L+RLE+PD RFL+Y SP P  ADHTAIL AP T
Sbjct  40   GVIAPDAAPVRPPMMVYDRIAEAVNARLRRLEHPDPRFLRYASPVPAHADHTAILAAPET  99

Query  322  RVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGT  483
            RVTTLPNGLRVATES+LA++TATVGV+IDAGSR+ETE++ G AHF+EHM+FKGT
Sbjct  100  RVTTLPNGLRVATESSLASRTATVGVWIDAGSRYETEDSAGVAHFVEHMLFKGT  153



>gb|KJB75638.1| hypothetical protein B456_012G049500 [Gossypium raimondii]
Length=519

 Score =   162 bits (411),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 98/151 (65%), Positives = 118/151 (78%), Gaps = 12/151 (8%)
 Frame = +1

Query  37   MAIRQLLNLarrsrrtiasrrGKPFssssaavaaaaNGTLAPSPPPPTAMIYDRLAESVK  216
            MAI+QLL+LARRSR        KPFSS + A     +   A +PPPPTAMIYDRL+  V 
Sbjct  1    MAIKQLLSLARRSR--------KPFSSLTVAR----SSNSAAAPPPPTAMIYDRLSHCVN  48

Query  217  HKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVATESNLAAKTATVG  396
             +L++LE+PDSRFL+Y SPHP    HT IL++P T++TTL NGLRVATES+L  +TATVG
Sbjct  49   SRLRKLEHPDSRFLKYGSPHPTQTSHTHILSSPETKITTLSNGLRVATESSLHCRTATVG  108

Query  397  VFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            V+IDAGSRFE+EETNGTAHFLEHMIFKGTE+
Sbjct  109  VWIDAGSRFESEETNGTAHFLEHMIFKGTEK  139



>ref|XP_010492395.1| PREDICTED: probable mitochondrial-processing peptidase subunit 
beta [Camelina sativa]
Length=532

 Score =   162 bits (411),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 92/110 (84%), Gaps = 1/110 (1%)
 Frame = +1

Query  157  APSPPPPTAMIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTA-ILTAPATRVTT  333
            + S P P  M YD  AE+VK KLK+LENPD RFL+Y SPHP+LA H   IL++P TRVTT
Sbjct  43   SSSFPLPQVMPYDNAAEAVKSKLKKLENPDLRFLRYASPHPILASHDDHILSSPETRVTT  102

Query  334  LPNGLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGT  483
            L NGLRVATES+L+AKTAT+GV+IDAGSRFET+ TNGTAHFLEHM+FKGT
Sbjct  103  LANGLRVATESDLSAKTATIGVWIDAGSRFETDSTNGTAHFLEHMLFKGT  152



>gb|AFW89241.1| peptidase beta subunit [Zea mays]
Length=530

 Score =   160 bits (406),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 92/114 (81%), Gaps = 2/114 (2%)
 Frame = +1

Query  148  GTLAPSPPPPTA--MIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPAT  321
            G LAP   P  A  M YDR+AE+V  +L+RLE+PD RFL+Y SP P  ADHTAIL AP T
Sbjct  37   GVLAPDATPVRAPVMPYDRIAEAVNARLRRLEHPDPRFLRYASPVPSHADHTAILAAPET  96

Query  322  RVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGT  483
            RVTTLPNGLRVATES+LAA+TATVGV+IDAGSR+E EE  G AHF+EHM+FKGT
Sbjct  97   RVTTLPNGLRVATESSLAARTATVGVWIDAGSRYENEEAAGVAHFVEHMLFKGT  150



>ref|NP_001149620.1| LOC100283246 [Zea mays]
 gb|ACG36103.1| mitochondrial-processing peptidase beta subunit [Zea mays]
Length=530

 Score =   160 bits (405),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 92/114 (81%), Gaps = 2/114 (2%)
 Frame = +1

Query  148  GTLAPSPPPPTA--MIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPAT  321
            G LAP   P  A  M YDR+AE+V  +L+RLE+PD RFL+Y SP P  ADHTAIL AP T
Sbjct  37   GVLAPDATPVRAPVMPYDRIAEAVNARLRRLEHPDPRFLRYASPVPSHADHTAILAAPET  96

Query  322  RVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGT  483
            RVTTLPNGLRVATES+LAA+TATVGV+IDAGSR+E EE  G AHF+EHM+FKGT
Sbjct  97   RVTTLPNGLRVATESSLAARTATVGVWIDAGSRYENEEAAGVAHFVEHMLFKGT  150



>ref|XP_010420217.1| PREDICTED: probable mitochondrial-processing peptidase subunit 
beta [Camelina sativa]
Length=534

 Score =   160 bits (404),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 93/151 (62%), Positives = 114/151 (75%), Gaps = 2/151 (1%)
 Frame = +1

Query  37   MAIRQLLNLarrsrrtiasrrGKPFssssaavaaaaNGTLAPSP-PPPTAMIYDRLAESV  213
            MAI+QLL LARRS+ ++   +    +SS+ A  +     +  SP P P  M YD  AE+V
Sbjct  1    MAIKQLLTLARRSQISLCLNQAIRLASSAVAAVSPFTTPVTSSPFPLPQVMPYDNAAEAV  60

Query  214  KHKLKRLENPDSRFLQYNSPHPVLADHTA-ILTAPATRVTTLPNGLRVATESNLAAKTAT  390
            K KLK+LENPD RFL+Y SPHP+LA H   IL++P TRVTTL NGLR ATES+L+AKTAT
Sbjct  61   KSKLKKLENPDLRFLRYASPHPILASHDDHILSSPETRVTTLANGLRGATESDLSAKTAT  120

Query  391  VGVFIDAGSRFETEETNGTAHFLEHMIFKGT  483
            VGV+IDAGSRFE++ TNGTAHFLEHM+FKGT
Sbjct  121  VGVWIDAGSRFESDSTNGTAHFLEHMLFKGT  151



>gb|EEE58574.1| hypothetical protein OsJ_09894 [Oryza sativa Japonica Group]
Length=480

 Score =   158 bits (399),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 73/100 (73%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +1

Query  184  MIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVATE  363
            M+YDR+AE+V  +L+RLE+PD RFL+Y SP P  ADHTAIL AP TRVTTLPNGLRVATE
Sbjct  1    MVYDRIAEAVNARLRRLEHPDPRFLRYASPVPAHADHTAILAAPETRVTTLPNGLRVATE  60

Query  364  SNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGT  483
            S+LA++TATVGV+IDAGSR+ETE++ G AHF+EHM+FKGT
Sbjct  61   SSLASRTATVGVWIDAGSRYETEDSAGVAHFVEHMLFKGT  100



>ref|XP_002468288.1| hypothetical protein SORBIDRAFT_01g043060 [Sorghum bicolor]
 gb|EER95286.1| hypothetical protein SORBIDRAFT_01g043060 [Sorghum bicolor]
Length=530

 Score =   157 bits (398),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 78/114 (68%), Positives = 92/114 (81%), Gaps = 2/114 (2%)
 Frame = +1

Query  148  GTLAPSPPPPTAMI--YDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPAT  321
            G LAP   P  A +  YDR+AE+V  +L+RLE+PD RFL+Y SP P  ADHTAIL AP T
Sbjct  37   GVLAPDSTPVRAPVLPYDRIAEAVNARLRRLEHPDPRFLRYASPVPSHADHTAILAAPET  96

Query  322  RVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGT  483
            RVTTLPNGLRVATES+LAA+TATVGV+IDAGSR+E E+  G AHF+EHM+FKGT
Sbjct  97   RVTTLPNGLRVATESSLAARTATVGVWIDAGSRYENEKAAGVAHFVEHMLFKGT  150



>ref|XP_010316226.1| PREDICTED: LOW QUALITY PROTEIN: probable mitochondrial-processing 
peptidase subunit beta [Solanum lycopersicum]
Length=531

 Score =   157 bits (396),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 80/109 (73%), Positives = 86/109 (79%), Gaps = 1/109 (1%)
 Frame = +1

Query  166  PPPPTAMIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLAD-HTAILTAPATRVTTLPN  342
            PPPP AMIYDRLAE VK K+KRLENPDSRFLQ     P  +  H          VTTLP+
Sbjct  44   PPPPDAMIYDRLAEDVKRKIKRLENPDSRFLQXQLATPNFSRPHINPQLPLYAXVTTLPS  103

Query  343  GLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            GLRVATE+NLA KTATVGVFIDAGSRFET+ETNGTAHFLEHMIFKGTE+
Sbjct  104  GLRVATETNLAVKTATVGVFIDAGSRFETDETNGTAHFLEHMIFKGTEK  152



>ref|XP_004985217.1| PREDICTED: probable mitochondrial-processing peptidase subunit 
beta-like isoform X2 [Setaria italica]
Length=530

 Score =   155 bits (392),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 91/114 (80%), Gaps = 2/114 (2%)
 Frame = +1

Query  148  GTLAPSPPPPTA--MIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPAT  321
            G LAP   P  A  M YDR+AE+V  +++RLE+PD RFL+Y +P P  ADHTAIL AP T
Sbjct  37   GVLAPDATPVRAPVMPYDRIAEAVNARVRRLEHPDPRFLRYANPVPSHADHTAILAAPQT  96

Query  322  RVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGT  483
            RVTTL NGLRVATES+LAA+TATVGV+IDAGSR+E EE  G AHF+EHM+FKGT
Sbjct  97   RVTTLSNGLRVATESSLAARTATVGVWIDAGSRYENEEAAGVAHFVEHMLFKGT  150



>ref|XP_004985216.1| PREDICTED: probable mitochondrial-processing peptidase subunit 
beta-like isoform X1 [Setaria italica]
Length=537

 Score =   155 bits (391),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 91/114 (80%), Gaps = 2/114 (2%)
 Frame = +1

Query  148  GTLAPSPPPPTA--MIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPAT  321
            G LAP   P  A  M YDR+AE+V  +++RLE+PD RFL+Y +P P  ADHTAIL AP T
Sbjct  37   GVLAPDATPVRAPVMPYDRIAEAVNARVRRLEHPDPRFLRYANPVPSHADHTAILAAPQT  96

Query  322  RVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGT  483
            RVTTL NGLRVATES+LAA+TATVGV+IDAGSR+E EE  G AHF+EHM+FKGT
Sbjct  97   RVTTLSNGLRVATESSLAARTATVGVWIDAGSRYENEEAAGVAHFVEHMLFKGT  150



>ref|NP_001130423.1| uncharacterized protein LOC100191520 [Zea mays]
 gb|ACF78625.1| unknown [Zea mays]
 gb|ACF84621.1| unknown [Zea mays]
 gb|ACN25742.1| unknown [Zea mays]
 tpg|DAA44044.1| TPA: hypothetical protein ZEAMMB73_778007 [Zea mays]
Length=530

 Score =   154 bits (388),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 90/114 (79%), Gaps = 2/114 (2%)
 Frame = +1

Query  148  GTLAPSPPPPTA--MIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPAT  321
            G LAP      A  M YDR+A++V  +L+RLE+PD RFL+Y SP P  ADH AIL AP T
Sbjct  37   GVLAPDATAVRAPVMPYDRIADAVNARLRRLEHPDPRFLRYASPVPSHADHMAILAAPET  96

Query  322  RVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGT  483
            RVTTLPNGLR+ATES+LAA+TATVGV+IDAGSR+E EE  G AHF+EHM+FKGT
Sbjct  97   RVTTLPNGLRIATESSLAARTATVGVWIDAGSRYENEEAVGVAHFVEHMLFKGT  150



>ref|XP_007134165.1| hypothetical protein PHAVU_010G024900g [Phaseolus vulgaris]
 gb|ESW06159.1| hypothetical protein PHAVU_010G024900g [Phaseolus vulgaris]
Length=521

 Score =   153 bits (386),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 73/102 (72%), Positives = 87/102 (85%), Gaps = 0/102 (0%)
 Frame = +1

Query  184  MIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVATE  363
            M+YDRLA +   K++RL++PD RFL++ SP P   DHT  L AP TRVTTLP+GLRVATE
Sbjct  42   MLYDRLASATSAKIRRLDHPDPRFLKHGSPVPSDTDHTRFLGAPQTRVTTLPSGLRVATE  101

Query  364  SNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            S+LAA+TATVGV+IDAGSRFETEE+NGTAHFLEHMIFKGT +
Sbjct  102  SSLAARTATVGVWIDAGSRFETEESNGTAHFLEHMIFKGTAK  143



>emb|CAA56519.1| mitochondrial processing peptidase [Solanum tuberosum]
Length=530

 Score =   152 bits (384),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 79/116 (68%), Positives = 87/116 (75%), Gaps = 9/116 (8%)
 Frame = +1

Query  157  APSPPPPTAMIYDRLAESVKHKLKRLENPDSRFLQY-----NSPHPVLADHTAILTAPAT  321
            A  PPPP AMIYDRLAE VK K+KRLENPDSRFLQ+     N   P +    ++L     
Sbjct  41   AIGPPPPDAMIYDRLAEDVKQKIKRLENPDSRFLQHQLTTPNFSRPHINPQLSLLRG---  97

Query  322  RVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
             VTTLP+GLRV    NLA KTATVGVFIDAGSRFET+ETNGTAHFLEHMIFKGTE+
Sbjct  98   -VTTLPSGLRVGHGDNLAVKTATVGVFIDAGSRFETDETNGTAHFLEHMIFKGTEK  152



>ref|XP_003558505.1| PREDICTED: probable mitochondrial-processing peptidase subunit 
beta [Brachypodium distachyon]
Length=530

 Score =   152 bits (384),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 74/114 (65%), Positives = 89/114 (78%), Gaps = 2/114 (2%)
 Frame = +1

Query  148  GTLAPSPPPPTA--MIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPAT  321
            G + P  P   A  M YDR++E+V  +L+RLE+PD RFL+Y SP P   DHTAIL AP T
Sbjct  37   GVIGPDAPAVRAPLMPYDRISEAVNARLRRLEHPDPRFLRYASPVPAHVDHTAILAAPET  96

Query  322  RVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGT  483
            RVTTLPNGLRVATES+LAA+TATVGV+IDAGSR+E +   G AHF+EHM+FKGT
Sbjct  97   RVTTLPNGLRVATESSLAARTATVGVWIDAGSRYEKDSQAGVAHFVEHMLFKGT  150



>dbj|BAE98412.1| putative mitochondrial processing peptidase [Arabidopsis thaliana]
Length=462

 Score =   150 bits (378),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/84 (82%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = +1

Query  238  NPDSRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVATESNLAAKTATVGVFIDAGS  417
            NPD RFL+Y SPHP+LA H  IL+AP TRVTTLPNGLRVATESNL+AKTATVGV+IDAGS
Sbjct  1    NPDKRFLKYASPHPILASHNHILSAPETRVTTLPNGLRVATESNLSAKTATVGVWIDAGS  60

Query  418  RFETEETNGTAHFLEHMIFKGTER  489
            RF ++ETNGTAHFLEHMIFKGT+R
Sbjct  61   RFGSDETNGTAHFLEHMIFKGTDR  84



>gb|AAB28042.1| cytochrome c reductase-processing peptidase subunit II, MPP subunit 
II, P53 [potatoes, var. Marfona, tuber, Peptide Mitochondrial, 
530 aa]
Length=530

 Score =   149 bits (375),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 78/116 (67%), Positives = 85/116 (73%), Gaps = 9/116 (8%)
 Frame = +1

Query  157  APSPPPPTAMIYDRLAESVKHKLKRLENPDSRFLQY-----NSPHPVLADHTAILTAPAT  321
            A  PPPP AMIYDRLAE VK K+KRLENPDSRFLQ+     N   P +    ++L     
Sbjct  41   AIGPPPPDAMIYDRLAEDVKQKIKRLENPDSRFLQHQLTTPNFSRPHINPQLSLLRG---  97

Query  322  RVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
             VTTLP+GLRV    NLA KTATVGVFIDAGSRFE  ETNGTAHFLEHMIFKGTE+
Sbjct  98   -VTTLPSGLRVGHGDNLAVKTATVGVFIDAGSRFEDTETNGTAHFLEHMIFKGTEK  152



>dbj|BAJ87789.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=530

 Score =   147 bits (372),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 85/100 (85%), Gaps = 0/100 (0%)
 Frame = +1

Query  184  MIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVATE  363
            M YDR+AE+V  +++RLE+PD RFL+Y SP P   DHTAIL AP T+VTTL NGLRVATE
Sbjct  51   MPYDRIAEAVNARVRRLEHPDPRFLRYASPVPAHVDHTAILDAPETKVTTLDNGLRVATE  110

Query  364  SNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGT  483
            S+L+++TATVGV+IDAGSR+ETEE  G AHF+EHM+FKGT
Sbjct  111  SSLSSRTATVGVWIDAGSRYETEEAAGVAHFVEHMLFKGT  150



>ref|XP_010680726.1| PREDICTED: probable mitochondrial-processing peptidase subunit 
beta [Beta vulgaris subsp. vulgaris]
Length=517

 Score =   140 bits (353),  Expect = 5e-36, Method: Composition-based stats.
 Identities = 66/99 (67%), Positives = 81/99 (82%), Gaps = 0/99 (0%)
 Frame = +1

Query  178  TAMIYDRLAESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVA  357
            T MIYDRLAESVK K+K LENPD RFL+Y SPHP  ADH+ IL  P TRVT LPNGLRVA
Sbjct  44   THMIYDRLAESVKSKIKLLENPDPRFLRYASPHPTSADHSQILKFPDTRVTVLPNGLRVA  103

Query  358  TESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIF  474
            TES LAA +++VGV++D+GSRFE+EE +G +HFL+ ++ 
Sbjct  104  TESRLAAGSSSVGVWVDSGSRFESEEKSGVSHFLQRVVL  142



>ref|XP_006651164.1| PREDICTED: probable mitochondrial-processing peptidase subunit 
beta-like [Oryza brachyantha]
Length=468

 Score =   134 bits (337),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = +1

Query  238  NPDSRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVATESNLAAKTATVGVFIDAGS  417
            +PD RFL+Y SP P  ADHTAIL AP TRVTTLPNGLRVATES+LAA+TATVGV+IDAGS
Sbjct  7    HPDPRFLRYASPVPAHADHTAILAAPETRVTTLPNGLRVATESSLAARTATVGVWIDAGS  66

Query  418  RFETEETNGTAHFLEHMIFKGT  483
            R+ETEE  G AHF+EHM+FKGT
Sbjct  67   RYETEEAAGVAHFVEHMLFKGT  88



>ref|XP_002986789.1| hypothetical protein SELMODRAFT_158279 [Selaginella moellendorffii]
 gb|EFJ12119.1| hypothetical protein SELMODRAFT_158279 [Selaginella moellendorffii]
Length=492

 Score =   132 bits (332),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = +1

Query  241  PDSRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSR  420
            PD RF ++NSP P   DH++IL  P TR+TTL NGLRVATESN+AA+TATVGV+IDAGSR
Sbjct  32   PDERFTRFNSPVPSTVDHSSILATPPTRITTLSNGLRVATESNMAAETATVGVWIDAGSR  91

Query  421  FETEETNGTAHFLEHMIFKGTER  489
            FET+ TNGTAHFLEHMIFKGT++
Sbjct  92   FETDATNGTAHFLEHMIFKGTKK  114



>ref|XP_002969499.1| hypothetical protein SELMODRAFT_146300 [Selaginella moellendorffii]
 gb|EFJ29587.1| hypothetical protein SELMODRAFT_146300 [Selaginella moellendorffii]
Length=492

 Score =   132 bits (332),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = +1

Query  241  PDSRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSR  420
            PD RF ++NSP P   DH++IL  P TR+TTL NGLRVATESN+AA+TATVGV+IDAGSR
Sbjct  32   PDERFTRFNSPVPSTVDHSSILATPPTRITTLSNGLRVATESNMAAETATVGVWIDAGSR  91

Query  421  FETEETNGTAHFLEHMIFKGTER  489
            FET+ TNGTAHFLEHMIFKGT++
Sbjct  92   FETDATNGTAHFLEHMIFKGTKK  114



>ref|XP_001766086.1| predicted protein [Physcomitrella patens]
 gb|EDQ69145.1| predicted protein [Physcomitrella patens]
Length=496

 Score =   130 bits (326),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 75/94 (80%), Gaps = 1/94 (1%)
 Frame = +1

Query  205  ESVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVATESNLAAKT  384
            ++V+H    L  PD RF +YNSP P   DHT +L  P TRVTTL NG+RVA+E+N+AA+T
Sbjct  25   QAVRHS-HALALPDERFQRYNSPVPKDVDHTMVLGTPETRVTTLANGMRVASETNMAAET  83

Query  385  ATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTE  486
            ATVGV+IDAGSRFE+ ETNGTAHFLEHM FKGTE
Sbjct  84   ATVGVWIDAGSRFESAETNGTAHFLEHMFFKGTE  117



>ref|XP_010943695.1| PREDICTED: probable mitochondrial-processing peptidase subunit 
beta isoform X2 [Elaeis guineensis]
Length=461

 Score =   107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 65/85 (76%), Gaps = 2/85 (2%)
 Frame = +1

Query  241  PDSRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVATESN--LAAKTATVGVFIDAG  414
            PD RFL+++SP   L D++  L  P  RVTTLPNG+RVAT+S    A+ TA++GV+IDAG
Sbjct  37   PDPRFLRHSSPEARLLDNSPFLCFPQVRVTTLPNGIRVATQSAPLSASHTASIGVWIDAG  96

Query  415  SRFETEETNGTAHFLEHMIFKGTER  489
            SRFE   TNGTAHFLEHMIFKGT R
Sbjct  97   SRFEAPGTNGTAHFLEHMIFKGTRR  121



>ref|XP_010943628.1| PREDICTED: probable mitochondrial-processing peptidase subunit 
beta isoform X1 [Elaeis guineensis]
Length=497

 Score =   107 bits (268),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 65/85 (76%), Gaps = 2/85 (2%)
 Frame = +1

Query  241  PDSRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVATESN--LAAKTATVGVFIDAG  414
            PD RFL+++SP   L D++  L  P  RVTTLPNG+RVAT+S    A+ TA++GV+IDAG
Sbjct  37   PDPRFLRHSSPEARLLDNSPFLCFPQVRVTTLPNGIRVATQSAPLSASHTASIGVWIDAG  96

Query  415  SRFETEETNGTAHFLEHMIFKGTER  489
            SRFE   TNGTAHFLEHMIFKGT R
Sbjct  97   SRFEAPGTNGTAHFLEHMIFKGTRR  121



>ref|XP_003059696.1| predicted protein, partial [Micromonas pusilla CCMP1545]
 gb|EEH55648.1| predicted protein, partial [Micromonas pusilla CCMP1545]
Length=504

 Score =   106 bits (264),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = +1

Query  244  DSRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSRF  423
            D  FL++ +P P    H  IL +PAT+VTTL NG+RVATE    A+TATVGV+IDAGSR+
Sbjct  48   DDAFLKWTTPEPQAFTHAGILASPATKVTTLANGMRVATEETPFAETATVGVWIDAGSRY  107

Query  424  ETEETNGTAHFLEHMIFKGTER  489
            ET   NGTAHFLEHM FKGT +
Sbjct  108  ETAANNGTAHFLEHMAFKGTAK  129



>emb|CBW52774.1| ubiquinol:cytochrome c oxidoreductase 50 kDa core 1 subunit [Polytomella 
sp. Pringsheim 198.80]
Length=494

 Score =   105 bits (261),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 66/80 (83%), Gaps = 1/80 (1%)
 Frame = +1

Query  253  FLQYNSPHPVLADHTAIL-TAPATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFET  429
            FL+Y +P P   DH+A+L T P T+VTTLPNGLRVATE+   A+TATVGV+I++GSRFE 
Sbjct  35   FLRYANPFPAPVDHSALLATLPETKVTTLPNGLRVATENIPFAETATVGVWINSGSRFEN  94

Query  430  EETNGTAHFLEHMIFKGTER  489
            +  NGTAHFLEH++FKGT++
Sbjct  95   DANNGTAHFLEHLLFKGTQK  114



>ref|XP_008808512.1| PREDICTED: probable mitochondrial-processing peptidase subunit 
beta isoform X2 [Phoenix dactylifera]
Length=417

 Score =   103 bits (258),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 52/83 (63%), Positives = 62/83 (75%), Gaps = 2/83 (2%)
 Frame = +1

Query  241  PDSRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVATESN--LAAKTATVGVFIDAG  414
            PD RFL+++SP   L DH+  L     RVTTLPNG+RV T+S    A+ TA++GV+IDAG
Sbjct  37   PDPRFLRHSSPEARLLDHSPFLRFSQVRVTTLPNGIRVVTQSAPLSASHTASIGVWIDAG  96

Query  415  SRFETEETNGTAHFLEHMIFKGT  483
            SRFE   TNGTAHFLEHMIFKGT
Sbjct  97   SRFEVPGTNGTAHFLEHMIFKGT  119



>ref|XP_008808511.1| PREDICTED: probable mitochondrial-processing peptidase subunit 
beta isoform X1 [Phoenix dactylifera]
Length=497

 Score =   103 bits (257),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 52/83 (63%), Positives = 62/83 (75%), Gaps = 2/83 (2%)
 Frame = +1

Query  241  PDSRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVATESN--LAAKTATVGVFIDAG  414
            PD RFL+++SP   L DH+  L     RVTTLPNG+RV T+S    A+ TA++GV+IDAG
Sbjct  37   PDPRFLRHSSPEARLLDHSPFLRFSQVRVTTLPNGIRVVTQSAPLSASHTASIGVWIDAG  96

Query  415  SRFETEETNGTAHFLEHMIFKGT  483
            SRFE   TNGTAHFLEHMIFKGT
Sbjct  97   SRFEVPGTNGTAHFLEHMIFKGT  119



>gb|KIY91868.1| hypothetical protein MNEG_16094 [Monoraphidium neglectum]
Length=160

 Score = 99.0 bits (245),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 66/81 (81%), Gaps = 1/81 (1%)
 Frame = +1

Query  247  SRFLQYNSPHPVLADHTAIL-TAPATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSRF  423
            S FL++++P+P   D T +L T P T +TTL NGLRVATE+N  A+TATVG++I++GSRF
Sbjct  29   SPFLRFSNPYPTPVDTTPLLSTIPETNITTLDNGLRVATEANPHAETATVGIWINSGSRF  88

Query  424  ETEETNGTAHFLEHMIFKGTE  486
            ET+  NGTAHFLEH++FKGT+
Sbjct  89   ETDANNGTAHFLEHILFKGTK  109



>emb|CDM83807.1| unnamed protein product [Triticum aestivum]
Length=503

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 62/81 (77%), Gaps = 1/81 (1%)
 Frame = +1

Query  250  RFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVATESNLAA-KTATVGVFIDAGSRFE  426
            RFL++ SP P  ADH+  L  PA RV+TLP GLRV T+S  AA + A+VGV++DAGSRFE
Sbjct  31   RFLRHASPVPRAADHSPFLRLPAARVSTLPTGLRVVTQSYPAATRMASVGVWVDAGSRFE  90

Query  427  TEETNGTAHFLEHMIFKGTER  489
               TNGTAHFLEHM FKGTER
Sbjct  91   LPGTNGTAHFLEHMAFKGTER  111



>dbj|BAJ93474.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=512

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/82 (65%), Positives = 63/82 (77%), Gaps = 1/82 (1%)
 Frame = +1

Query  247  SRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVATESNLAA-KTATVGVFIDAGSRF  423
            +RFL++ SP P  ADH+  L  PA RVTTLP GLRV T++  AA + A+VGV++DAGSRF
Sbjct  31   NRFLRHASPLPRAADHSPFLGLPAARVTTLPTGLRVVTQAYPAATRMASVGVWVDAGSRF  90

Query  424  ETEETNGTAHFLEHMIFKGTER  489
            E   TNGTAHFLEHM FKGTER
Sbjct  91   ELPGTNGTAHFLEHMAFKGTER  112



>gb|AFW83727.1| hypothetical protein ZEAMMB73_211594 [Zea mays]
Length=503

 Score = 99.0 bits (245),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 62/82 (76%), Gaps = 1/82 (1%)
 Frame = +1

Query  247  SRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVATESN-LAAKTATVGVFIDAGSRF  423
            SRFL++ SP P   DH+  L  PA RV+TLP+GLRV T++  +A + A+VGV++DAGSRF
Sbjct  37   SRFLRHASPVPRTPDHSPYLRFPAARVSTLPSGLRVVTQAYPVATRIASVGVWVDAGSRF  96

Query  424  ETEETNGTAHFLEHMIFKGTER  489
            E   TNGTAHFLEHM FKGT R
Sbjct  97   ELPGTNGTAHFLEHMAFKGTRR  118



>ref|NP_001145782.1| uncharacterized protein LOC100279289 [Zea mays]
 gb|ACL52580.1| unknown [Zea mays]
 gb|AFW83726.1| hypothetical protein ZEAMMB73_211594 [Zea mays]
Length=508

 Score = 99.0 bits (245),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 62/82 (76%), Gaps = 1/82 (1%)
 Frame = +1

Query  247  SRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVATESN-LAAKTATVGVFIDAGSRF  423
            SRFL++ SP P   DH+  L  PA RV+TLP+GLRV T++  +A + A+VGV++DAGSRF
Sbjct  37   SRFLRHASPVPRTPDHSPYLRFPAARVSTLPSGLRVVTQAYPVATRIASVGVWVDAGSRF  96

Query  424  ETEETNGTAHFLEHMIFKGTER  489
            E   TNGTAHFLEHM FKGT R
Sbjct  97   ELPGTNGTAHFLEHMAFKGTRR  118



>ref|XP_002948116.1| hypothetical protein VOLCADRAFT_109656 [Volvox carteri f. nagariensis]
 gb|EFJ51104.1| hypothetical protein VOLCADRAFT_109656 [Volvox carteri f. nagariensis]
Length=496

 Score = 99.0 bits (245),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 64/80 (80%), Gaps = 1/80 (1%)
 Frame = +1

Query  253  FLQYNSPHPVLADHTAIL-TAPATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFET  429
            FL++++P P   DHT +L T P TR+TTLPNGLRVATES   A+T T+G++I++GSRFE 
Sbjct  37   FLRFSNPRPSPIDHTPLLSTLPETRITTLPNGLRVATESIPFAETTTLGIWINSGSRFEN  96

Query  430  EETNGTAHFLEHMIFKGTER  489
            +  NG AHFLEH++FKGT++
Sbjct  97   DANNGVAHFLEHILFKGTKK  116



>ref|XP_009395786.1| PREDICTED: probable mitochondrial-processing peptidase subunit 
beta [Musa acuminata subsp. malaccensis]
Length=500

 Score = 98.6 bits (244),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 54/87 (62%), Positives = 64/87 (74%), Gaps = 5/87 (6%)
 Frame = +1

Query  241  PDSRFLQYNSP--HPVLADHTAILTAPATRVTTLPNGLRVATESN--LAAKTATVGVFID  408
            PD RFL+Y+SP   P L DH+  L  P  R TTLP+G+RV T+S    A+ TA++GV+ID
Sbjct  39   PDPRFLRYSSPDARPPL-DHSPFLRFPQVRHTTLPSGIRVVTQSAPISASHTASIGVWID  97

Query  409  AGSRFETEETNGTAHFLEHMIFKGTER  489
            AGSRFE   TNGTAHFLEHMIFKGT R
Sbjct  98   AGSRFEAPGTNGTAHFLEHMIFKGTRR  124



>ref|XP_001697021.1| ubiquinol:cytochrome c oxidoreductase 50 kDa core 1 subunit [Chlamydomonas 
reinhardtii]
 gb|EDP00713.1| ubiquinol:cytochrome c oxidoreductase 50 kDa core 1 subunit [Chlamydomonas 
reinhardtii]
Length=495

 Score = 98.6 bits (244),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 47/79 (59%), Positives = 64/79 (81%), Gaps = 1/79 (1%)
 Frame = +1

Query  253  FLQYNSPHPVLADHTAIL-TAPATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFET  429
            FL++++P P   DHT +L T P TR+TTLPNGLRVATE+   A+T T+G++I++GSRFET
Sbjct  36   FLRFSNPRPSPIDHTPLLSTLPETRITTLPNGLRVATEAIPFAETTTLGIWINSGSRFET  95

Query  430  EETNGTAHFLEHMIFKGTE  486
            +  NG AHFLEH++FKGT+
Sbjct  96   DANNGVAHFLEHILFKGTK  114



>gb|EMT32156.1| Putative mitochondrial-processing peptidase subunit beta [Aegilops 
tauschii]
Length=917

 Score = 99.8 bits (247),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = +1

Query  280  VLADHTAILTAPATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFL  459
            ++  +   L AP T+VTTL NGLRVATES+L+++TATVGV+IDAGSR+ETEE  G AHF+
Sbjct  470  IVPQYKMFLQAPETKVTTLDNGLRVATESSLSSRTATVGVWIDAGSRYETEEAAGVAHFV  529

Query  460  EHMIFKGT  483
            EHM+FKGT
Sbjct  530  EHMLFKGT  537



>ref|XP_003569667.1| PREDICTED: probable mitochondrial-processing peptidase subunit 
beta [Brachypodium distachyon]
Length=499

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 61/82 (74%), Gaps = 1/82 (1%)
 Frame = +1

Query  247  SRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVATESNL-AAKTATVGVFIDAGSRF  423
            +RFL++ SP P  ADH+  L  PA RV+TLP GLRV T++   A + A+VGV++DAGSRF
Sbjct  30   NRFLRHASPVPRAADHSPFLRLPAARVSTLPTGLRVVTQACPPATRMASVGVWVDAGSRF  89

Query  424  ETEETNGTAHFLEHMIFKGTER  489
            E   TNGTAHFLEHM FKGT R
Sbjct  90   ELPGTNGTAHFLEHMAFKGTAR  111



>ref|XP_004969725.1| PREDICTED: probable mitochondrial-processing peptidase subunit 
beta-like isoform X2 [Setaria italica]
Length=455

 Score = 95.9 bits (237),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 62/82 (76%), Gaps = 1/82 (1%)
 Frame = +1

Query  247  SRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVATESNLAA-KTATVGVFIDAGSRF  423
            SRFL+++SP P   DH+  L  P  RV+TLP+GLRV T++  AA + A+VGV++DAGSRF
Sbjct  37   SRFLRHSSPVPRTPDHSPYLRFPDVRVSTLPSGLRVVTQAFPAATRMASVGVWVDAGSRF  96

Query  424  ETEETNGTAHFLEHMIFKGTER  489
            E   TNGTAHFLEHM FKGT R
Sbjct  97   ELPGTNGTAHFLEHMAFKGTGR  118



>ref|XP_002456239.1| hypothetical protein SORBIDRAFT_03g032670 [Sorghum bicolor]
 gb|EES01359.1| hypothetical protein SORBIDRAFT_03g032670 [Sorghum bicolor]
Length=508

 Score = 96.3 bits (238),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 62/82 (76%), Gaps = 1/82 (1%)
 Frame = +1

Query  247  SRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVATESNLAA-KTATVGVFIDAGSRF  423
            SRFL++ SP P   DH+  L  PA RV+TLP+GLRV T++  AA + A+VGV++DAGSRF
Sbjct  37   SRFLRHASPVPRTPDHSPHLRFPAARVSTLPSGLRVVTQAYPAATRMASVGVWVDAGSRF  96

Query  424  ETEETNGTAHFLEHMIFKGTER  489
            E   TNGTAHFLEHM FKG+ R
Sbjct  97   ELPGTNGTAHFLEHMAFKGSRR  118



>ref|XP_004969724.1| PREDICTED: probable mitochondrial-processing peptidase subunit 
beta-like isoform X1 [Setaria italica]
Length=510

 Score = 95.9 bits (237),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 62/82 (76%), Gaps = 1/82 (1%)
 Frame = +1

Query  247  SRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVATESNLAA-KTATVGVFIDAGSRF  423
            SRFL+++SP P   DH+  L  P  RV+TLP+GLRV T++  AA + A+VGV++DAGSRF
Sbjct  37   SRFLRHSSPVPRTPDHSPYLRFPDVRVSTLPSGLRVVTQAFPAATRMASVGVWVDAGSRF  96

Query  424  ETEETNGTAHFLEHMIFKGTER  489
            E   TNGTAHFLEHM FKGT R
Sbjct  97   ELPGTNGTAHFLEHMAFKGTGR  118



>ref|XP_011396017.1| putative mitochondrial-processing peptidase subunit beta [Auxenochlorella 
protothecoides]
 gb|KFM23147.1| putative mitochondrial-processing peptidase subunit beta [Auxenochlorella 
protothecoides]
Length=498

 Score = 95.9 bits (237),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 50/78 (64%), Positives = 59/78 (76%), Gaps = 1/78 (1%)
 Frame = +1

Query  253  FLQYNSPHPVLADHTAILTA-PATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFET  429
            F +Y SP P   + T+ L   P T+V+TL NGLRVA+ES   A+TATVGV+IDAGSRFET
Sbjct  32   FTRYASPFPAQLNLTSALAQLPETKVSTLANGLRVASESVPFAETATVGVYIDAGSRFET  91

Query  430  EETNGTAHFLEHMIFKGT  483
            + TNG AHFLEHM FKGT
Sbjct  92   DATNGAAHFLEHMAFKGT  109



>dbj|GAC94181.1| hypothetical protein PHSY_001752 [Pseudozyma hubeiensis SY62]
Length=268

 Score = 93.2 bits (230),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +1

Query  295  TAILTAPATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIF  474
            TA+   P T+ TTL NGL VATESN +A+TATVGV+IDAGSR ET+ TNGTAHFLEHM F
Sbjct  185  TAVSRQPITQTTTLSNGLTVATESNPSAQTATVGVWIDAGSRAETDRTNGTAHFLEHMAF  244

Query  475  KGT  483
            KGT
Sbjct  245  KGT  247



>gb|KIJ62690.1| hypothetical protein HYDPIDRAFT_176479 [Hydnomerulius pinastri 
MD-312]
Length=474

 Score = 95.1 bits (235),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 50/75 (67%), Positives = 60/75 (80%), Gaps = 1/75 (1%)
 Frame = +1

Query  268  SPHPVLADHTAI-LTAPATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFETEETNG  444
            +P P+ +  TA+ + AP T  TTLPNGL VATES+  A+TATVGV+IDAGSR ET++TNG
Sbjct  20   NPRPLRSFATAVNIPAPITETTTLPNGLTVATESHQHAQTATVGVWIDAGSRAETDKTNG  79

Query  445  TAHFLEHMIFKGTER  489
            TAHFLEHM FKGT R
Sbjct  80   TAHFLEHMAFKGTGR  94



>ref|XP_002778427.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983]
 gb|EER10222.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983]
Length=439

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 55/64 (86%), Gaps = 1/64 (2%)
 Frame = +1

Query  298  AILTAPATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFK  477
            A+  AP T+VTTLPNGLRVAT+     ++ATVGV+IDAGSR+ET+ETNGTAHFLEH+ FK
Sbjct  47   ALFNAPPTKVTTLPNGLRVATQHTFT-ESATVGVWIDAGSRYETKETNGTAHFLEHLAFK  105

Query  478  GTER  489
            GT+R
Sbjct  106  GTQR  109



>ref|XP_006858364.1| hypothetical protein AMTR_s00064p00192980 [Amborella trichopoda]
 gb|ERN19831.1| hypothetical protein AMTR_s00064p00192980 [Amborella trichopoda]
Length=401

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 65/83 (78%), Gaps = 4/83 (5%)
 Frame = +1

Query  250  RFLQY--NSPHPVLADHTAILTAPATRVTTLPN-GLRVATESNLAAKTATVGVFIDAGSR  420
            RFL++  ++P P  +DH   L  P TR++T+ N GLRV T+S+L+++TATVGV+IDAGSR
Sbjct  50   RFLRHCKDTP-PESSDHLPFLRFPQTRISTIRNSGLRVITQSSLSSRTATVGVWIDAGSR  108

Query  421  FETEETNGTAHFLEHMIFKGTER  489
            +E   TNGTAHFLEHM+FKGT R
Sbjct  109  YEAPGTNGTAHFLEHMLFKGTRR  131



>ref|XP_002768300.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983]
 gb|EER01018.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983]
Length=501

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 55/64 (86%), Gaps = 1/64 (2%)
 Frame = +1

Query  298  AILTAPATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFK  477
            A+  AP T+VTTLPNGLRVAT+     ++ATVGV+IDAGSR+ET+ETNGTAHFLEH+ FK
Sbjct  47   ALFNAPPTKVTTLPNGLRVATQHTFT-ESATVGVWIDAGSRYETKETNGTAHFLEHLAFK  105

Query  478  GTER  489
            GT+R
Sbjct  106  GTQR  109



>gb|KIO02691.1| hypothetical protein M404DRAFT_1001905 [Pisolithus tinctorius 
Marx 270]
Length=475

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +1

Query  310  APATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            AP T+ TTLPNGL VATES+  A+TATVGV+IDAGSR ET++TNGTAHFLEHM FKGT R
Sbjct  36   APITQTTTLPNGLTVATESHSHAQTATVGVWIDAGSRAETDKTNGTAHFLEHMAFKGTNR  95



>ref|XP_007319485.1| core subunit of the ubiquinol-cytochrome c reductase complex, 
QCR1 [Serpula lacrymans var. lacrymans S7.9]
 gb|EGO23723.1| core subunit of the ubiquinol-cytochrome c reductase complex, 
QCR1 [Serpula lacrymans var. lacrymans S7.9]
Length=465

 Score = 94.0 bits (232),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +1

Query  310  APATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            +P T VTTLPNGL VATE++  A+TATVGV+IDAGSR ET++TNGTAHFLEHM FKGT R
Sbjct  35   SPITEVTTLPNGLTVATEAHSHAQTATVGVWIDAGSRAETDKTNGTAHFLEHMAFKGTNR  94



>gb|EGN98147.1| hypothetical protein SERLA73DRAFT_183038 [Serpula lacrymans var. 
lacrymans S7.3]
Length=474

 Score = 94.0 bits (232),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +1

Query  310  APATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            +P T VTTLPNGL VATE++  A+TATVGV+IDAGSR ET++TNGTAHFLEHM FKGT R
Sbjct  35   SPITEVTTLPNGLTVATEAHSHAQTATVGVWIDAGSRAETDKTNGTAHFLEHMAFKGTNR  94



>gb|KDN44556.1| putative MAS1-mitochondrial processing peptidase beta chain precursor 
[Tilletiaria anomala UBC 951]
Length=479

 Score = 94.0 bits (232),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = +1

Query  295  TAILTAPATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIF  474
            TAI  +P T+VTTL NGL VATESN +A+TATVG +IDAGSR ET+ TNGTAHFLEHM F
Sbjct  35   TAINRSPITQVTTLSNGLTVATESNPSAQTATVGAWIDAGSRAETDATNGTAHFLEHMAF  94

Query  475  KGT  483
            KGT
Sbjct  95   KGT  97



>gb|EAY75568.1| hypothetical protein OsI_03472 [Oryza sativa Indica Group]
Length=505

 Score = 94.0 bits (232),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 49/82 (60%), Positives = 60/82 (73%), Gaps = 1/82 (1%)
 Frame = +1

Query  247  SRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVATESNLAA-KTATVGVFIDAGSRF  423
            +RFL++ SP P   DH+  L  P  RV+TLP GLRV T++  AA + A+VGV++DAGSRF
Sbjct  32   NRFLRHASPVPRDPDHSPFLRLPDARVSTLPTGLRVVTQAYPAATRMASVGVWVDAGSRF  91

Query  424  ETEETNGTAHFLEHMIFKGTER  489
            E   TNGTAHFLEHM FKGT R
Sbjct  92   ELPGTNGTAHFLEHMAFKGTTR  113



>gb|KIK92447.1| hypothetical protein PAXRUDRAFT_829946 [Paxillus rubicundulus 
Ve08.2h10]
Length=474

 Score = 93.6 bits (231),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 49/75 (65%), Positives = 60/75 (80%), Gaps = 1/75 (1%)
 Frame = +1

Query  268  SPHPVLADHTAI-LTAPATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFETEETNG  444
            +P P+ +  TA+ + AP T  TTLPNGL +ATES+  A+TATVGV+IDAGSR ET++TNG
Sbjct  20   NPRPLRSFATAVKIPAPITETTTLPNGLTIATESHPHAQTATVGVWIDAGSRAETDKTNG  79

Query  445  TAHFLEHMIFKGTER  489
            TAHFLEHM FKGT R
Sbjct  80   TAHFLEHMAFKGTGR  94



>gb|KIJ19355.1| hypothetical protein PAXINDRAFT_166565 [Paxillus involutus ATCC 
200175]
Length=474

 Score = 93.2 bits (230),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 50/75 (67%), Positives = 59/75 (79%), Gaps = 1/75 (1%)
 Frame = +1

Query  268  SPHPVLADHTAI-LTAPATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFETEETNG  444
            +P P+ +  TA+ + AP T  TTLPNGL VATES+  A+TATVGV+IDAGSR ET+ TNG
Sbjct  20   NPRPLRSFATAVNIPAPITETTTLPNGLTVATESHPHAQTATVGVWIDAGSRAETDRTNG  79

Query  445  TAHFLEHMIFKGTER  489
            TAHFLEHM FKGT R
Sbjct  80   TAHFLEHMAFKGTGR  94



>ref|XP_003739385.1| PREDICTED: LOW QUALITY PROTEIN: mitochondrial-processing peptidase 
subunit beta-like [Metaseiulus occidentalis]
Length=474

 Score = 93.2 bits (230),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 52/63 (83%), Gaps = 1/63 (2%)
 Frame = +1

Query  301  ILTAPATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKG  480
            +L  P TRVTTL NG+RVATE+N    TATVGV+IDAGSR+ETE+ NG AHFLEHM FKG
Sbjct  34   LLNIPETRVTTLSNGVRVATENN-GGPTATVGVWIDAGSRYETEKXNGVAHFLEHMAFKG  92

Query  481  TER  489
            TE+
Sbjct  93   TEK  95



>gb|EAZ13291.1| hypothetical protein OsJ_03216 [Oryza sativa Japonica Group]
Length=505

 Score = 93.6 bits (231),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 60/82 (73%), Gaps = 1/82 (1%)
 Frame = +1

Query  247  SRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVATESNLAA-KTATVGVFIDAGSRF  423
            +RFL++ SP P   DH+  L  P  RV+TLP GLR+ T++  AA + A+VGV++DAGSRF
Sbjct  32   NRFLRHASPVPRDPDHSPFLRLPDARVSTLPTGLRIVTQAYPAATRMASVGVWVDAGSRF  91

Query  424  ETEETNGTAHFLEHMIFKGTER  489
            E   TNGTAHFLEHM FKGT R
Sbjct  92   ELPGTNGTAHFLEHMAFKGTTR  113



>emb|CBQ71265.1| probable MAS1-mitochondrial processing peptidase beta chain precursor 
[Sporisorium reilianum SRZ2]
Length=477

 Score = 93.2 bits (230),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +1

Query  295  TAILTAPATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIF  474
            TA+   P T+ TTL NGL VATESN +A+TATVGV+IDAGSR ET+ TNGTAHFLEHM F
Sbjct  33   TAVSRQPITQTTTLSNGLTVATESNPSAQTATVGVWIDAGSRAETDRTNGTAHFLEHMAF  92

Query  475  KGT  483
            KGT
Sbjct  93   KGT  95



>dbj|BAD81527.1| putative ubiquinol-cytochrome-c reductase [Oryza sativa Japonica 
Group]
 dbj|BAD82262.1| putative ubiquinol-cytochrome-c reductase [Oryza sativa Japonica 
Group]
Length=495

 Score = 93.2 bits (230),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 60/82 (73%), Gaps = 1/82 (1%)
 Frame = +1

Query  247  SRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVATESNLAA-KTATVGVFIDAGSRF  423
            +RFL++ SP P   DH+  L  P  RV+TLP GLR+ T++  AA + A+VGV++DAGSRF
Sbjct  32   NRFLRHASPVPRDPDHSPFLRLPDARVSTLPTGLRIVTQAYPAATRMASVGVWVDAGSRF  91

Query  424  ETEETNGTAHFLEHMIFKGTER  489
            E   TNGTAHFLEHM FKGT R
Sbjct  92   ELPGTNGTAHFLEHMAFKGTTR  113



>emb|CCF49102.1| probable MAS1-mitochondrial processing peptidase beta chain precursor 
[Ustilago hordei]
Length=477

 Score = 93.2 bits (230),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +1

Query  295  TAILTAPATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIF  474
            TA+   P T+ TTL NGL VATESN +A+TATVGV+IDAGSR ET+ TNGTAHFLEHM F
Sbjct  33   TAVSRQPITQATTLSNGLTVATESNPSAQTATVGVWIDAGSRAETDRTNGTAHFLEHMAF  92

Query  475  KGT  483
            KGT
Sbjct  93   KGT  95



>gb|KDQ11106.1| hypothetical protein BOTBODRAFT_190057 [Botryobasidium botryosum 
FD-172 SS1]
Length=474

 Score = 93.2 bits (230),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 58/76 (76%), Gaps = 1/76 (1%)
 Frame = +1

Query  265  NSPHPVLADHTAI-LTAPATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFETEETN  441
            NS   V    TA+ L  P T+V+TLPNGL VATES+  A+TATVGV+IDAGSR ET+ TN
Sbjct  19   NSSRAVRPLATAVNLGTPTTQVSTLPNGLTVATESHPHAQTATVGVWIDAGSRAETDATN  78

Query  442  GTAHFLEHMIFKGTER  489
            GTAHFLEHM FKGT R
Sbjct  79   GTAHFLEHMAFKGTNR  94



>ref|XP_011392498.1| putative metalloendopeptidase contributor [Ustilago maydis 521]
 gb|KIS65904.1| putative metalloendopeptidase contributor [Ustilago maydis 521]
Length=477

 Score = 93.2 bits (230),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +1

Query  295  TAILTAPATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIF  474
            TA+   P T+ TTL NGL VATESN +A+TATVGV+IDAGSR ET+ TNGTAHFLEHM F
Sbjct  33   TAVSRQPITQTTTLSNGLTVATESNPSAQTATVGVWIDAGSRAETDRTNGTAHFLEHMAF  92

Query  475  KGT  483
            KGT
Sbjct  93   KGT  95



>gb|EST07296.1| G protein beta subunit-like protein, partial [Pseudozyma brasiliensis 
GHG001]
Length=481

 Score = 93.2 bits (230),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +1

Query  295  TAILTAPATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIF  474
            TA+   P T+ TTL NGL VATESN +A+TATVGV+IDAGSR ET+ TNGTAHFLEHM F
Sbjct  37   TAVSRQPITQTTTLSNGLTVATESNPSAQTATVGVWIDAGSRAETDRTNGTAHFLEHMAF  96

Query  475  KGT  483
            KGT
Sbjct  97   KGT  99



>emb|CDI56561.1| probable MAS1-mitochondrial processing peptidase beta chain precursor 
[Melanopsichium pennsylvanicum 4]
Length=477

 Score = 92.8 bits (229),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +1

Query  295  TAILTAPATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIF  474
            TA+   P T+ TTL NGL VATESN +A+TATVGV+IDAGSR ET+ TNGTAHFLEHM F
Sbjct  33   TAVSRQPITQTTTLSNGLTVATESNPSAQTATVGVWIDAGSRAETDRTNGTAHFLEHMAF  92

Query  475  KGT  483
            KGT
Sbjct  93   KGT  95



>ref|XP_009493536.1| hypothetical protein H696_01367 [Fonticula alba]
 gb|KCV71958.1| hypothetical protein H696_01367 [Fonticula alba]
Length=465

 Score = 92.8 bits (229),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 53/64 (83%), Gaps = 1/64 (2%)
 Frame = +1

Query  298  AILTAPATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFK  477
            A L  P TR+TTLPNGLRV TE+N  ++TA+VGV+ID GSR+ETEETNG AHFLEH+ FK
Sbjct  27   ASLAGPETRMTTLPNGLRVCTENN-GSETASVGVWIDTGSRYETEETNGVAHFLEHVSFK  85

Query  478  GTER  489
            GT +
Sbjct  86   GTHK  89



>dbj|GAK67360.1| core subunit of the ubiquinol-cytochrome c reductase complex 
[Pseudozyma antarctica]
Length=477

 Score = 92.8 bits (229),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +1

Query  295  TAILTAPATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIF  474
            TA+   P T+ TTL NGL VATESN +A+TATVGV+IDAGSR ET+ TNGTAHFLEHM F
Sbjct  33   TAVSRQPITQTTTLANGLTVATESNPSAQTATVGVWIDAGSRAETDRTNGTAHFLEHMAF  92

Query  475  KGT  483
            KGT
Sbjct  93   KGT  95



>dbj|GAC76356.1| G protein beta subunit-like protein [Pseudozyma antarctica T-34]
Length=475

 Score = 92.8 bits (229),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +1

Query  295  TAILTAPATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIF  474
            TA+   P T+ TTL NGL VATESN +A+TATVGV+IDAGSR ET+ TNGTAHFLEHM F
Sbjct  33   TAVSRQPITQTTTLANGLTVATESNPSAQTATVGVWIDAGSRAETDRTNGTAHFLEHMAF  92

Query  475  KGT  483
            KGT
Sbjct  93   KGT  95



>gb|ETS60436.1| hypothetical protein PaG_05648 [Pseudozyma aphidis DSM 70725]
Length=477

 Score = 92.8 bits (229),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +1

Query  295  TAILTAPATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIF  474
            TA+   P T+ TTL NGL VATESN +A+TATVGV+IDAGSR ET+ TNGTAHFLEHM F
Sbjct  33   TAVSRQPITQTTTLANGLTVATESNPSAQTATVGVWIDAGSRAETDRTNGTAHFLEHMAF  92

Query  475  KGT  483
            KGT
Sbjct  93   KGT  95



>ref|XP_007881939.1| hypothetical protein PFL1_06209 [Pseudozyma flocculosa PF-1]
 gb|EPQ26274.1| hypothetical protein PFL1_06209 [Pseudozyma flocculosa PF-1]
Length=476

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 52/65 (80%), Gaps = 0/65 (0%)
 Frame = +1

Query  295  TAILTAPATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIF  474
            TA+   P T+ T L NGL VATESN +A+TATVGV+IDAGSR ET+ TNGTAHFLEHM F
Sbjct  32   TAVSRQPITQTTVLSNGLTVATESNPSAQTATVGVWIDAGSRAETDRTNGTAHFLEHMAF  91

Query  475  KGTER  489
            KGT +
Sbjct  92   KGTNK  96



>ref|XP_002108929.1| hypothetical protein TRIADDRAFT_63547 [Trichoplax adhaerens]
 gb|EDV29727.1| hypothetical protein TRIADDRAFT_63547 [Trichoplax adhaerens]
Length=473

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 58/78 (74%), Gaps = 1/78 (1%)
 Frame = +1

Query  256  LQYNSPHPVLADHTAILTAPATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFETEE  435
            LQ +   PV +   ++   P T VTT+ NGLR+A+E +  + TAT+G++IDAGSRFE ++
Sbjct  22   LQSSIASPVFSYQQSLENVPETLVTTIDNGLRIASEDS-GSLTATIGLWIDAGSRFENDD  80

Query  436  TNGTAHFLEHMIFKGTER  489
            TNG AHFLEHMIFKGT+R
Sbjct  81   TNGVAHFLEHMIFKGTKR  98



>dbj|BAK06609.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=468

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +1

Query  304  LTAPATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGT  483
            + +PAT+++TLPNGL VATE++ A+ TATVGV+IDAGSR ET++T+GTAHFLEHM FKGT
Sbjct  26   VASPATQISTLPNGLTVATEASSASSTATVGVWIDAGSRAETDKTSGTAHFLEHMAFKGT  85



>gb|KIK48045.1| hypothetical protein CY34DRAFT_798666 [Suillus luteus UH-Slu-Lm8-n1]
Length=474

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 61/75 (81%), Gaps = 1/75 (1%)
 Frame = +1

Query  268  SPHPVLADHTAI-LTAPATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFETEETNG  444
            +P P+ +  TA+ + +P T+ TTL NGL VATES+  A+TAT+GV+IDAGSR ET++TNG
Sbjct  20   NPRPLRSFATAVNIPSPITQTTTLSNGLTVATESHPHAQTATIGVWIDAGSRAETDKTNG  79

Query  445  TAHFLEHMIFKGTER  489
            TAHFLEHM FKGT+R
Sbjct  80   TAHFLEHMAFKGTKR  94



>gb|KIJ49532.1| hypothetical protein M422DRAFT_225340 [Sphaerobolus stellatus 
SS14]
Length=472

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +1

Query  310  APATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            +P T VTTLPNGL VATES+  A TATVGV+IDAGSR ET+ TNGTAHFLEHM FKGT R
Sbjct  33   SPLTEVTTLPNGLTVATESHPHAPTATVGVWIDAGSRAETDSTNGTAHFLEHMAFKGTNR  92



>ref|XP_009546668.1| putative metallo peptidase M16 [Heterobasidion irregulare TC 
32-1]
 gb|ETW82106.1| putative metallo peptidase M16 [Heterobasidion irregulare TC 
32-1]
Length=474

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 58/74 (78%), Gaps = 1/74 (1%)
 Frame = +1

Query  271  PHPVLADHTAILT-APATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFETEETNGT  447
            P P+ +  TA+ + +P T VTTL NGL VATES+  A+TATVGV+IDAGSR ET+ TNGT
Sbjct  21   PAPIRSLATAVSSQSPFTEVTTLSNGLTVATESHPHAQTATVGVWIDAGSRAETDATNGT  80

Query  448  AHFLEHMIFKGTER  489
            AHFLEHM FKGT R
Sbjct  81   AHFLEHMAFKGTNR  94



>gb|EMD39674.1| mitochondrial-processing peptidase subunit beta [Ceriporiopsis 
subvermispora B]
Length=475

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  304  LTAPATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGT  483
            + AP T  TTLPNGL VATES+  A+TATVGV+IDAGSR ET+ TNGTAHFLEHM FKGT
Sbjct  34   IRAPKTETTTLPNGLTVATESHPHAQTATVGVWIDAGSRAETDATNGTAHFLEHMAFKGT  93

Query  484  ER  489
             R
Sbjct  94   GR  95



>ref|XP_007333741.1| QCR1 core subunit of the ubiquinol-cytochrome c reductase complex 
[Agaricus bisporus var. burnettii JB137-S8]
 gb|EKM75682.1| QCR1 core subunit of the ubiquinol-cytochrome c reductase complex 
[Agaricus bisporus var. burnettii JB137-S8]
Length=467

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +1

Query  310  APATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
             P T VTTL NGL VATES+  A+TATVGV+IDAGSR ET++TNGTAHFLEHM FKGT R
Sbjct  28   GPLTEVTTLSNGLTVATESHSHAQTATVGVWIDAGSRAETDKTNGTAHFLEHMAFKGTGR  87



>ref|XP_006463920.1| core subunit of the ubiquinol-cytochrome c reductase complex 
[Agaricus bisporus var. bisporus H97]
 gb|EKV44599.1| core subunit of the ubiquinol-cytochrome c reductase complex 
[Agaricus bisporus var. bisporus H97]
Length=467

 Score = 90.9 bits (224),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +1

Query  310  APATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
             P T VTTL NGL VATES+  A+TATVGV+IDAGSR ET++TNGTAHFLEHM FKGT R
Sbjct  28   GPLTEVTTLSNGLTVATESHSHAQTATVGVWIDAGSRAETDKTNGTAHFLEHMAFKGTGR  87



>ref|XP_007401794.1| hypothetical protein PHACADRAFT_265392 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EKM49740.1| hypothetical protein PHACADRAFT_265392 [Phanerochaete carnosa 
HHB-10118-sp]
Length=475

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +1

Query  304  LTAPATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGT  483
            + AP T++TTLPNGL VATE++  A+TATVGV+IDAGSR ET++T+GTAHFLEHM FKGT
Sbjct  34   VNAPVTQLTTLPNGLTVATEAHSHAQTATVGVWIDAGSRAETDKTSGTAHFLEHMAFKGT  93

Query  484  ER  489
             +
Sbjct  94   NK  95



>gb|KFD57346.1| hypothetical protein M513_01857 [Trichuris suis]
Length=514

 Score = 90.9 bits (224),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 48/94 (51%), Positives = 66/94 (70%), Gaps = 5/94 (5%)
 Frame = +1

Query  208  SVKHKLKRLENPDSRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVATESNLAAKTA  387
            +V H++K      S+  + +S    L+   AI+  P T+VTT+ NGLRVA+E +  + T+
Sbjct  29   NVSHQVKYRNALASQLSKLHS----LSYKDAIINMPETQVTTMRNGLRVASEDS-GSLTS  83

Query  388  TVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            T+GV+IDAGSR+ETE+TNG AHFLEHM FKGT R
Sbjct  84   TIGVWIDAGSRYETEKTNGVAHFLEHMAFKGTGR  117



>ref|XP_007341051.1| mitochondrial processing peptidase beta subunit [Auricularia 
delicata TFB-10046 SS5]
 gb|EJD50912.1| mitochondrial processing peptidase beta subunit [Auricularia 
delicata TFB-10046 SS5]
Length=475

 Score = 90.5 bits (223),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +1

Query  304  LTAPATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGT  483
            + AP T ++TL NGL VATE++ +A+TATVGV+IDAGSR ET+ TNGTAHFLEHM FKGT
Sbjct  34   IQAPVTELSTLGNGLTVATEAHPSAQTATVGVWIDAGSRAETDATNGTAHFLEHMAFKGT  93

Query  484  ER  489
            +R
Sbjct  94   QR  95



>ref|XP_007309517.1| hypothetical protein STEHIDRAFT_161892 [Stereum hirsutum FP-91666 
SS1]
 gb|EIM81725.1| hypothetical protein STEHIDRAFT_161892 [Stereum hirsutum FP-91666 
SS1]
Length=477

 Score = 90.5 bits (223),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +1

Query  313  PATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            P T++TTL NGL VATES+  A+TATVGV+IDAGSR ET+ TNGTAHFLEHM FKGT R
Sbjct  39   PETQITTLKNGLTVATESHSHAQTATVGVWIDAGSRAETDATNGTAHFLEHMAFKGTGR  97



>ref|XP_006679836.1| hypothetical protein BATDEDRAFT_20015 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF79523.1| hypothetical protein BATDEDRAFT_20015 [Batrachochytrium dendrobatidis 
JAM81]
Length=484

 Score = 90.1 bits (222),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 47/83 (57%), Positives = 58/83 (70%), Gaps = 7/83 (8%)
 Frame = +1

Query  238  NPDSRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVATESNLAAKTATVGVFIDAGS  417
            +P +  L+Y+ P        ++   P T+VT L NG  VATESN   +TATVGV+IDAGS
Sbjct  33   SPSADQLKYSYP-------ASLANVPETKVTRLSNGFTVATESNPNNQTATVGVWIDAGS  85

Query  418  RFETEETNGTAHFLEHMIFKGTE  486
            RFET +TNGTAHFLEHM FKGT+
Sbjct  86   RFETAKTNGTAHFLEHMAFKGTK  108



>ref|XP_006808720.1| PREDICTED: mitochondrial-processing peptidase subunit beta-like 
[Neolamprologus brichardi]
Length=422

 Score = 89.7 bits (221),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 61/95 (64%), Gaps = 8/95 (8%)
 Frame = +1

Query  214  KHKLKRLENPDSRFLQYNSPHPVLAD---HTAILTAPATRVTTLPNGLRVATESNLAAKT  384
            +H LK+  N  SRF     PH +LA    H   L  P T+VT L NGLRVA+E +    T
Sbjct  18   RHLLKK--NSISRFTA--GPHRLLATQAAHQVALNVPETKVTALENGLRVASEDS-GLPT  72

Query  385  ATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
             TVG++IDAGSR+E E  NGTAHFLEHM FKGT +
Sbjct  73   CTVGLWIDAGSRYENERNNGTAHFLEHMAFKGTRK  107



>ref|XP_005755231.1| PREDICTED: mitochondrial-processing peptidase subunit beta-like 
[Pundamilia nyererei]
Length=484

 Score = 90.1 bits (222),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 61/95 (64%), Gaps = 8/95 (8%)
 Frame = +1

Query  214  KHKLKRLENPDSRFLQYNSPHPVLAD---HTAILTAPATRVTTLPNGLRVATESNLAAKT  384
            +H LK+  N  SRF     PH +LA    H   L  P T+VT L NGLRVA+E +    T
Sbjct  18   RHLLKK--NSISRFTA--GPHRLLATQAAHQVALNVPETKVTALENGLRVASEDS-GLPT  72

Query  385  ATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
             TVG++IDAGSR+E E  NGTAHFLEHM FKGT +
Sbjct  73   CTVGLWIDAGSRYENERNNGTAHFLEHMAFKGTRK  107



>gb|EJU03090.1| hypothetical protein DACRYDRAFT_21414 [Dacryopinax sp. DJM-731 
SS1]
Length=473

 Score = 90.1 bits (222),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +1

Query  310  APATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            AP T VTTLPNGL +ATES+  A TATVGV+IDAGSR ET++TNG AHFLEHM FKGT +
Sbjct  34   APVTEVTTLPNGLTIATESHPNAMTATVGVWIDAGSRAETDKTNGAAHFLEHMAFKGTNK  93



>gb|KFD72731.1| hypothetical protein M514_01857 [Trichuris suis]
 gb|KHJ46344.1| peptidase, M16 family [Trichuris suis]
Length=478

 Score = 90.1 bits (222),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 55/69 (80%), Gaps = 1/69 (1%)
 Frame = +1

Query  283  LADHTAILTAPATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLE  462
            L+   AI+  P T+VTT+ NGLRVA+E +  + T+T+GV+IDAGSR+ETE+TNG AHFLE
Sbjct  35   LSYKDAIINMPETQVTTMRNGLRVASEDS-GSLTSTIGVWIDAGSRYETEKTNGVAHFLE  93

Query  463  HMIFKGTER  489
            HM FKGT R
Sbjct  94   HMAFKGTGR  102



>gb|EPT00287.1| hypothetical protein FOMPIDRAFT_1023870 [Fomitopsis pinicola 
FP-58527 SS1]
Length=474

 Score = 89.7 bits (221),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +1

Query  310  APATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            +P T  TTL NGL VATESN  A+TATVGV+IDAGSR ET++TNGTAHFLEHM FKGT R
Sbjct  35   SPLTESTTLSNGLTVATESNPHAQTATVGVWIDAGSRAETDKTNGTAHFLEHMAFKGTGR  94



>ref|XP_007867025.1| hypothetical protein GLOTRDRAFT_106396 [Gloeophyllum trabeum 
ATCC 11539]
 gb|EPQ54775.1| hypothetical protein GLOTRDRAFT_106396 [Gloeophyllum trabeum 
ATCC 11539]
Length=473

 Score = 89.7 bits (221),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 52/65 (80%), Gaps = 0/65 (0%)
 Frame = +1

Query  295  TAILTAPATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIF  474
            TA   +P T V+TL NGL VATES+  A+TATVGV+IDAGSR ET+ TNGTAHFLEHM F
Sbjct  29   TATSNSPFTEVSTLSNGLTVATESHPHAQTATVGVWIDAGSRAETDATNGTAHFLEHMAF  88

Query  475  KGTER  489
            KGT R
Sbjct  89   KGTNR  93



>ref|XP_006140849.1| PREDICTED: mitochondrial-processing peptidase subunit beta [Tupaia 
chinensis]
Length=489

 Score = 89.7 bits (221),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 55/81 (68%), Gaps = 1/81 (1%)
 Frame = +1

Query  247  SRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFE  426
            S +L  N P    A    +L  P T+VT L NGLRVA+E +    T TVG++IDAGSR+E
Sbjct  34   SFYLGENRPRSTQAAAQVVLNVPETKVTCLENGLRVASEDS-GLSTCTVGLWIDAGSRYE  92

Query  427  TEETNGTAHFLEHMIFKGTER  489
             E+ NGTAHFLEHM FKGT++
Sbjct  93   NEKNNGTAHFLEHMAFKGTKK  113



>gb|ADD95721.1| predicted protein [uncultured organism MedDCM-OCT-S04-C161]
Length=482

 Score = 89.7 bits (221),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 52/101 (51%), Positives = 69/101 (68%), Gaps = 12/101 (12%)
 Frame = +1

Query  220  KLKRLENP-DSRF-----LQYNSPHP-----VLADHTAILTAPATRVTTLPNGLRVATES  366
            KL R+ NP D  F     L  N  H      +L+ H  + +  + +VTTLP+GLRVATE+
Sbjct  3    KLDRIFNPIDQLFSLSFSLSANHFHASLTRAILSSH-FLFSTLSPQVTTLPSGLRVATEA  61

Query  367  NLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
               ++TAT+GV+IDAGSR+E++ETNGTAHFLEHM FKGT +
Sbjct  62   TPYSETATIGVWIDAGSRYESKETNGTAHFLEHMAFKGTAK  102



>ref|XP_005951901.1| PREDICTED: mitochondrial-processing peptidase subunit beta-like 
[Haplochromis burtoni]
Length=483

 Score = 89.7 bits (221),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 61/95 (64%), Gaps = 8/95 (8%)
 Frame = +1

Query  214  KHKLKRLENPDSRFLQYNSPHPVLAD---HTAILTAPATRVTTLPNGLRVATESNLAAKT  384
            +H LK+  N  SRF     PH +LA    H   L  P T+VT L NGLRVA+E +    T
Sbjct  18   RHLLKK--NSISRFTA--GPHRLLATQAAHQVALNVPETKVTALENGLRVASEDS-GLPT  72

Query  385  ATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
             TVG++IDAGSR+E E  NGTAHFLEHM FKGT +
Sbjct  73   CTVGLWIDAGSRYENERNNGTAHFLEHMAFKGTRK  107



>ref|XP_004576241.1| PREDICTED: mitochondrial-processing peptidase subunit beta-like 
[Maylandia zebra]
Length=483

 Score = 89.7 bits (221),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 61/95 (64%), Gaps = 8/95 (8%)
 Frame = +1

Query  214  KHKLKRLENPDSRFLQYNSPHPVL---ADHTAILTAPATRVTTLPNGLRVATESNLAAKT  384
            +H LK+  N  SRF     PH +L   A H   L  P T+VT L NGLRVA+E +    T
Sbjct  18   RHLLKK--NSISRFTA--GPHRLLVTQAAHQVALNVPETKVTALENGLRVASEDS-GLPT  72

Query  385  ATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
             TVG++IDAGSR+E E  NGTAHFLEHM FKGT +
Sbjct  73   CTVGLWIDAGSRYENERNNGTAHFLEHMAFKGTRK  107



>ref|NP_501576.2| Protein MPPB-1 [Caenorhabditis elegans]
 emb|CAA92566.2| MPPB-1 [Caenorhabditis elegans]
Length=458

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 47/60 (78%), Gaps = 1/60 (2%)
 Frame = +1

Query  310  APATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
             P T VTTLPNG RVATE N    TAT+GVFIDAGSR+E E+ NGTAHFLEHM FKGT R
Sbjct  27   VPETIVTTLPNGFRVATE-NTGGSTATIGVFIDAGSRYENEKNNGTAHFLEHMAFKGTPR  85



>ref|XP_003385964.1| PREDICTED: mitochondrial-processing peptidase subunit beta-like 
[Amphimedon queenslandica]
Length=472

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 56/85 (66%), Gaps = 1/85 (1%)
 Frame = +1

Query  232  LENPDSRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVATESNLAAKTATVGVFIDA  411
            L+ P   +   +S    L+   ++   P T VT LPNGLRVA+E N    T TVG++IDA
Sbjct  13   LQLPSKNYRYASSAAAQLSYQQSLYNVPKTNVTRLPNGLRVASE-NSGGSTCTVGLWIDA  71

Query  412  GSRFETEETNGTAHFLEHMIFKGTE  486
            GSRFET ETNG AHFLEHM FKGT+
Sbjct  72   GSRFETPETNGVAHFLEHMAFKGTK  96



>ref|XP_007509720.1| predicted protein [Bathycoccus prasinos]
 emb|CCO18835.1| predicted protein [Bathycoccus prasinos]
Length=557

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 52/101 (51%), Positives = 69/101 (68%), Gaps = 12/101 (12%)
 Frame = +1

Query  220  KLKRLENP-DSRF-----LQYNSPHP-----VLADHTAILTAPATRVTTLPNGLRVATES  366
            KL R+ NP D  F     L  N  H      +L+ H  + +  + +VTTLP+GLRVATE+
Sbjct  78   KLDRIFNPIDQLFSLSFSLSANHFHASLTRAILSSHF-LFSTLSPQVTTLPSGLRVATEA  136

Query  367  NLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
               ++TAT+GV+IDAGSR+E++ETNGTAHFLEHM FKGT +
Sbjct  137  TPYSETATIGVWIDAGSRYESKETNGTAHFLEHMAFKGTAK  177



>gb|AAW78940.1| GekBS094P [Gekko japonicus]
Length=158

 Score = 85.5 bits (210),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 52/82 (63%), Gaps = 1/82 (1%)
 Frame = +1

Query  244  DSRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSRF  423
             S +   N      A     L  P TRVT L NGLRVA+E +    T TVG++IDAGSR+
Sbjct  33   QSLYFGGNRLRSTQAATQVFLNVPETRVTCLENGLRVASEDS-GLSTCTVGLWIDAGSRY  91

Query  424  ETEETNGTAHFLEHMIFKGTER  489
            E E+ NGTAHFLEHM FKGT++
Sbjct  92   ENEKNNGTAHFLEHMAFKGTKK  113



>ref|XP_002632993.1| C. briggsae CBR-MPPB-1 protein [Caenorhabditis briggsae]
 emb|CAP38417.1| Protein CBR-MPPB-1 [Caenorhabditis briggsae]
Length=459

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 50/74 (68%), Gaps = 1/74 (1%)
 Frame = +1

Query  268  SPHPVLADHTAILTAPATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFETEETNGT  447
            S   +   H   +  P T VTTLPNG RVATE N    TAT+GVFIDAGSR+E  E NGT
Sbjct  13   SQRKIAQAHAKPVFVPETIVTTLPNGFRVATE-NTGGSTATIGVFIDAGSRYENAENNGT  71

Query  448  AHFLEHMIFKGTER  489
            AHFLEHM FKGT R
Sbjct  72   AHFLEHMAFKGTPR  85



>gb|EUC55192.1| QCR1 core subunit of the ubiquinol-cytochrome C reductase complex 
protein [Rhizoctonia solani AG-3 Rhs1AP]
 gb|KEP47823.1| QCR1 core subunit of the ubiquinol-cytochrome C reductase complex 
protein [Rhizoctonia solani 123E]
Length=471

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  TAPATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTE  486
            +AP T ++TL NGL +ATES+  A+TATVGV+IDAGSR ET+ TNGTAHFLEHM FKGT 
Sbjct  31   SAPLTEISTLSNGLTIATESHPHAQTATVGVWIDAGSRAETDATNGTAHFLEHMAFKGTG  90

Query  487  R  489
            R
Sbjct  91   R  91



>gb|KIM20096.1| hypothetical protein M408DRAFT_18639 [Serendipita vermifera MAFF 
305830]
Length=468

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +1

Query  310  APATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
             P T +TTLP+GL VATES+  A+TATVGV+IDAGSR ET+ TNGTAHFLEHM FKGT++
Sbjct  32   GPFTEITTLPSGLTVATESHPHAQTATVGVWIDAGSRAETDATNGTAHFLEHMAFKGTQK  91



>gb|KIM26404.1| hypothetical protein M408DRAFT_330589 [Serendipita vermifera 
MAFF 305830]
Length=468

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +1

Query  310  APATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
             P T +TTLP+GL VATES+  A+TATVGV+IDAGSR ET+ TNGTAHFLEHM FKGT++
Sbjct  29   GPFTEITTLPSGLTVATESHPHAQTATVGVWIDAGSRAETDATNGTAHFLEHMAFKGTQK  88



>ref|XP_008509794.1| PREDICTED: mitochondrial-processing peptidase subunit beta-like 
[Equus przewalskii]
Length=250

 Score = 86.7 bits (213),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 49/63 (78%), Gaps = 1/63 (2%)
 Frame = +1

Query  301  ILTAPATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKG  480
            +L  P TRVT L NGLRVA+E +    T TVG++IDAGSR+E E+ NGTAHFLEHM FKG
Sbjct  53   VLNVPETRVTCLENGLRVASEDS-GLSTCTVGLWIDAGSRYENEKNNGTAHFLEHMAFKG  111

Query  481  TER  489
            T++
Sbjct  112  TKK  114



>ref|XP_007768537.1| mitochondrial processing peptidase beta subunit [Coniophora puteana 
RWD-64-598 SS2]
 gb|EIW81120.1| mitochondrial processing peptidase beta subunit [Coniophora puteana 
RWD-64-598 SS2]
Length=475

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +1

Query  304  LTAPATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGT  483
            L +P T+V+TL NGL VATES+  A+TATVGV+IDAGSR ET++TNGTAHFLEHM FKGT
Sbjct  34   LPSPTTQVSTLSNGLTVATESHPHAQTATVGVWIDAGSRAETDKTNGTAHFLEHMAFKGT  93



>ref|XP_001631568.1| predicted protein [Nematostella vectensis]
 gb|EDO39505.1| predicted protein [Nematostella vectensis]
Length=485

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 55/76 (72%), Gaps = 2/76 (3%)
 Frame = +1

Query  259  QYNSPHPVLADHTAILTAPATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFETEET  438
            +Y S H +  + + +   P T+VTTL NGL+VATE +    TATVG++IDAGSRFETE  
Sbjct  36   RYQSSHALTYEQS-LYNVPDTKVTTLSNGLKVATEDS-GISTATVGLWIDAGSRFETEAN  93

Query  439  NGTAHFLEHMIFKGTE  486
            NG AHFLEHM FKGT+
Sbjct  94   NGVAHFLEHMAFKGTK  109



>emb|CDR44724.1| RHTO0S09e08020g1_1 [Rhodosporidium toruloides]
Length=467

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 53/59 (90%), Gaps = 0/59 (0%)
 Frame = +1

Query  307  TAPATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGT  483
            ++P T+++TLPNGL VATE++ +A TATVGV+IDAGSR ET++T+GTAHFLEHM FKGT
Sbjct  26   SSPLTQISTLPNGLTVATEASPSASTATVGVWIDAGSRAETDKTSGTAHFLEHMAFKGT  84



>gb|EDL99415.1| peptidase (mitochondrial processing) beta, isoform CRA_a [Rattus 
norvegicus]
Length=178

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 49/63 (78%), Gaps = 1/63 (2%)
 Frame = +1

Query  301  ILTAPATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKG  480
            +L  P T+VT L NGLRVA+E N    T TVG++IDAGSR+E E+ NGTAHFLEHM FKG
Sbjct  52   VLNVPETQVTCLENGLRVASE-NSGISTCTVGLWIDAGSRYENEKNNGTAHFLEHMAFKG  110

Query  481  TER  489
            T++
Sbjct  111  TKK  113



>gb|EMS19853.1| mitochondrial processing peptidase beta subunit [Rhodosporidium 
toruloides NP11]
Length=476

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 53/59 (90%), Gaps = 0/59 (0%)
 Frame = +1

Query  307  TAPATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGT  483
            ++P T+++TLPNGL VATE++ +A TATVGV+IDAGSR ET++T+GTAHFLEHM FKGT
Sbjct  26   SSPLTQISTLPNGLTVATEASPSASTATVGVWIDAGSRAETDKTSGTAHFLEHMAFKGT  84



>ref|XP_010349997.1| PREDICTED: mitochondrial-processing peptidase subunit beta-like, 
partial [Saimiri boliviensis boliviensis]
Length=215

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 54/82 (66%), Gaps = 1/82 (1%)
 Frame = +1

Query  244  DSRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSRF  423
             S +   N      A    +L  P TRVT+L +GLRVA+E +    T TVG++IDAGSR+
Sbjct  60   QSSYFGENRLRSTQAATQVVLNVPETRVTSLESGLRVASEDS-GLSTCTVGLWIDAGSRY  118

Query  424  ETEETNGTAHFLEHMIFKGTER  489
            E E+ NGTAHFLEHM FKGT++
Sbjct  119  ENEKNNGTAHFLEHMAFKGTKK  140



>ref|XP_006774967.1| PREDICTED: mitochondrial-processing peptidase subunit beta, partial 
[Myotis davidii]
Length=461

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 52/75 (69%), Gaps = 1/75 (1%)
 Frame = +1

Query  265  NSPHPVLADHTAILTAPATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFETEETNG  444
            N P    A    +L  P TRVT L NGLRVA+E +    T TVG++IDAGSR+E E+ NG
Sbjct  12   NRPRSTRAAAQVVLNVPETRVTRLQNGLRVASEDS-GLSTCTVGLWIDAGSRYENEKNNG  70

Query  445  TAHFLEHMIFKGTER  489
            TAHFLEHM FKGT++
Sbjct  71   TAHFLEHMAFKGTKK  85



>emb|CCL99463.1| predicted protein [Fibroporia radiculosa]
Length=530

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +1

Query  304  LTAPATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGT  483
            +  P T  TTL NGL VATES+  A+TATVGV+IDAGSR ET++TNGTAHFLEHM FKGT
Sbjct  89   VAGPLTETTTLSNGLTVATESHPHAQTATVGVWIDAGSRAETDKTNGTAHFLEHMAFKGT  148

Query  484  ER  489
             R
Sbjct  149  NR  150



>emb|CEL58503.1| mitochondrial processing peptidase [Rhizoctonia solani AG-1 IB]
Length=471

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 64/99 (65%), Gaps = 11/99 (11%)
 Frame = +1

Query  199  LAESVKHKLKR--LENPDSRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVATESNL  372
            L+ S+K  L+R  +  P  R L     H          ++P T ++TL NGL +ATES+ 
Sbjct  2    LSASLKQGLRRASVARPLRRTLATAVQHS---------SSPLTEISTLSNGLTIATESHP  52

Query  373  AAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
             A+TATVGV+IDAGSR ET+ TNGTAHFLEHM FKGT R
Sbjct  53   HAQTATVGVWIDAGSRAETDVTNGTAHFLEHMAFKGTNR  91



>ref|XP_006085511.1| PREDICTED: mitochondrial-processing peptidase subunit beta [Myotis 
lucifugus]
Length=477

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 52/75 (69%), Gaps = 1/75 (1%)
 Frame = +1

Query  265  NSPHPVLADHTAILTAPATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFETEETNG  444
            N P    A    +L  P TRVT L NGLRVA+E +    T TVG++IDAGSR+E E+ NG
Sbjct  28   NRPRSTRAAAQVVLNVPETRVTRLENGLRVASEDS-GLSTCTVGLWIDAGSRYENEKNNG  86

Query  445  TAHFLEHMIFKGTER  489
            TAHFLEHM FKGT++
Sbjct  87   TAHFLEHMAFKGTKK  101



>ref|XP_006014114.1| PREDICTED: mitochondrial-processing peptidase subunit beta-like, 
partial [Latimeria chalumnae]
Length=264

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 52/68 (76%), Gaps = 1/68 (1%)
 Frame = +1

Query  286  ADHTAILTAPATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEH  465
            A +  +L  P T+VTTL NGLRVA+E +    T TVG++IDAGSR+E E+ NGTAHFLEH
Sbjct  66   AANEILLNVPETKVTTLENGLRVASEDS-GLSTCTVGLWIDAGSRYENEKNNGTAHFLEH  124

Query  466  MIFKGTER  489
            M FKGT++
Sbjct  125  MAFKGTKK  132



>emb|CCI44798.1| unnamed protein product [Albugo candida]
Length=467

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 52/63 (83%), Gaps = 1/63 (2%)
 Frame = +1

Query  301  ILTAPATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKG  480
            ++ APAT VTTLP+GLRVA+E +   +TATVGV+I AGSR+ETE+ NG AHFLEHM FKG
Sbjct  30   VINAPATEVTTLPSGLRVASEGS-HGETATVGVWIGAGSRYETEKNNGAAHFLEHMAFKG  88

Query  481  TER  489
            T R
Sbjct  89   TCR  91



>ref|XP_004354528.1| mitochondrial processing peptidase beta subunit [Dictyostelium 
fasciculatum]
 gb|EGG15781.1| mitochondrial processing peptidase beta subunit [Dictyostelium 
fasciculatum]
Length=470

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 55/70 (79%), Gaps = 1/70 (1%)
 Frame = +1

Query  280  VLADHTAILTAPATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFL  459
            + A+   ++  P T++TTLPNG+RVATE +   +TA++GV++D+GS +E E+ NG AHFL
Sbjct  26   LFANRDFLVQNPETKITTLPNGIRVATEQSFG-ETASIGVWVDSGSVYENEKNNGVAHFL  84

Query  460  EHMIFKGTER  489
            EHMIFKGTE+
Sbjct  85   EHMIFKGTEK  94



>gb|EDL99416.1| peptidase (mitochondrial processing) beta, isoform CRA_b [Rattus 
norvegicus]
Length=291

 Score = 86.7 bits (213),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 49/63 (78%), Gaps = 1/63 (2%)
 Frame = +1

Query  301  ILTAPATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKG  480
            +L  P T+VT L NGLRVA+E N    T TVG++IDAGSR+E E+ NGTAHFLEHM FKG
Sbjct  52   VLNVPETQVTCLENGLRVASE-NSGISTCTVGLWIDAGSRYENEKNNGTAHFLEHMAFKG  110

Query  481  TER  489
            T++
Sbjct  111  TKK  113



>ref|XP_003171073.1| hypothetical protein MGYG_07071 [Microsporum gypseum CBS 118893]
 gb|EFR04065.1| hypothetical protein MGYG_07071 [Microsporum gypseum CBS 118893]
Length=119

 Score = 84.0 bits (206),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +1

Query  310  APATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            A +T+ TTL NGL +ATE +  A+T+TVGV+IDAGSR ET++TNGTAHFLEH+ FKGT R
Sbjct  35   AGSTQSTTLSNGLTIATEYSPWAQTSTVGVWIDAGSRAETDQTNGTAHFLEHLAFKGTNR  94



>ref|XP_005863048.1| PREDICTED: mitochondrial-processing peptidase subunit beta [Myotis 
brandtii]
Length=507

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 52/75 (69%), Gaps = 1/75 (1%)
 Frame = +1

Query  265  NSPHPVLADHTAILTAPATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFETEETNG  444
            N P    A    +L  P TRVT L NGLRVA+E +    T TVG++IDAGSR+E E+ NG
Sbjct  58   NRPRSTRAAAQVVLNVPETRVTRLENGLRVASEDS-GLSTCTVGLWIDAGSRYENEKNNG  116

Query  445  TAHFLEHMIFKGTER  489
            TAHFLEHM FKGT++
Sbjct  117  TAHFLEHMAFKGTKK  131



>ref|XP_005650094.1| putative mitochondrial processing peptidase [Coccomyxa subellipsoidea 
C-169]
 gb|EIE25550.1| putative mitochondrial processing peptidase [Coccomyxa subellipsoidea 
C-169]
Length=502

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/82 (57%), Positives = 61/82 (74%), Gaps = 1/82 (1%)
 Frame = +1

Query  244  DSRFLQYNSPHPVLADHTAILTA-PATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSR  420
            +S FL++ SP P    +  +L++ P T VTTL +GLRVA+E+   A+TATVGV+IDAGSR
Sbjct  40   ESPFLRFASPVPQPTTYAPLLSSIPDTSVTTLSSGLRVASETTPFAETATVGVWIDAGSR  99

Query  421  FETEETNGTAHFLEHMIFKGTE  486
            +E    NGTAHFLEHM FKGT+
Sbjct  100  YENAANNGTAHFLEHMAFKGTK  121



>ref|XP_011138830.1| PREDICTED: mitochondrial-processing peptidase subunit beta [Harpegnathos 
saltator]
 gb|EFN84900.1| Mitochondrial-processing peptidase subunit beta [Harpegnathos 
saltator]
Length=477

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 59/77 (77%), Gaps = 3/77 (4%)
 Frame = +1

Query  259  QYNSPHPVLADHTAILTAPATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFETEET  438
            Q+ S    L +  A++  PATR+TTL +G+RVA+E + AA TATVG++ID+GSR+ET+E 
Sbjct  27   QWRSTAASLKE--ALINQPATRITTLDSGMRVASEDSGAA-TATVGLWIDSGSRYETDEN  83

Query  439  NGTAHFLEHMIFKGTER  489
            NG AHF+EHM FKGT +
Sbjct  84   NGVAHFMEHMAFKGTTK  100



>ref|XP_002291589.1| probable mitochondrial processing peptidase [Thalassiosira pseudonana 
CCMP1335]
 gb|EED91696.1| probable mitochondrial processing peptidase [Thalassiosira pseudonana 
CCMP1335]
Length=481

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = +1

Query  301  ILTAPATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKG  480
            +L  P+T +T  P+GLRVA+E+ L A TATVGV+IDAGSR+ET   NG AHFLEHM FKG
Sbjct  44   LLATPSTEITQFPSGLRVASETMLGANTATVGVWIDAGSRYETIHNNGAAHFLEHMAFKG  103

Query  481  TER  489
            T +
Sbjct  104  TSK  106



>ref|XP_006987875.1| PREDICTED: mitochondrial-processing peptidase subunit beta [Peromyscus 
maniculatus bairdii]
Length=453

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 49/63 (78%), Gaps = 1/63 (2%)
 Frame = +1

Query  301  ILTAPATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKG  480
            +L  P TRVT L NGLRVA+E N    T TVG++IDAGSR+E E+ NGTAHFLEHM FKG
Sbjct  52   VLNVPETRVTCLENGLRVASE-NSGLSTCTVGLWIDAGSRYENEKNNGTAHFLEHMAFKG  110

Query  481  TER  489
            T++
Sbjct  111  TKK  113



>ref|XP_004677214.1| PREDICTED: mitochondrial-processing peptidase subunit beta [Condylura 
cristata]
Length=529

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 54/81 (67%), Gaps = 1/81 (1%)
 Frame = +1

Query  247  SRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFE  426
            S +L  N      A    +L  P TRVT L NGLRVA+E +    T TVG++IDAGSR+E
Sbjct  74   SLYLGCNRLRSTQAAAEVVLNVPETRVTCLENGLRVASEDS-GLSTCTVGLWIDAGSRYE  132

Query  427  TEETNGTAHFLEHMIFKGTER  489
             E+ NGTAHFLEHM FKGT++
Sbjct  133  NEKNNGTAHFLEHMAFKGTKK  153



>ref|XP_006090203.1| PREDICTED: mitochondrial-processing peptidase subunit beta-like 
[Myotis lucifugus]
Length=489

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 52/75 (69%), Gaps = 1/75 (1%)
 Frame = +1

Query  265  NSPHPVLADHTAILTAPATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFETEETNG  444
            N P    A    +L  P TRVT L NGLRVA+E +    T TVG++IDAGSR+E E+ NG
Sbjct  40   NRPRSTRAAAQVVLNVPETRVTRLENGLRVASEDS-GLSTCTVGLWIDAGSRYENEKNNG  98

Query  445  TAHFLEHMIFKGTER  489
            TAHFLEHM FKGT++
Sbjct  99   TAHFLEHMAFKGTKK  113



>gb|KDN37296.1| Mitochondrial-processing peptidase subunit beta, partial [Rhizoctonia 
solani AG-8 WAC10335]
Length=383

 Score = 87.0 bits (214),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +1

Query  310  APATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            AP T ++TL NGL +ATES+  A+TATVG++IDAGSR ET+ TNGTAHFLEHM FKGT R
Sbjct  32   APLTAISTLSNGLTIATESHPHAQTATVGIWIDAGSRAETDATNGTAHFLEHMAFKGTGR  91



>emb|CCA73308.1| probable MAS1-mitochondrial processing peptidase beta chain precursor 
[Piriformospora indica DSM 11827]
Length=469

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +1

Query  310  APATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
             P T ++ LPNGL VATES+  A+TATVGV+IDAGSR ET+ TNGTAHFLEHM FKGT++
Sbjct  30   GPFTEISVLPNGLTVATESHPHAQTATVGVWIDAGSRAETDATNGTAHFLEHMAFKGTQK  89



>ref|XP_008323676.1| PREDICTED: mitochondrial-processing peptidase subunit beta [Cynoglossus 
semilaevis]
Length=497

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 50/68 (74%), Gaps = 1/68 (1%)
 Frame = +1

Query  286  ADHTAILTAPATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEH  465
            A H  +L  P T+VTTL NGLRVA+E +    T TVG++IDAGSR+E E  NGTAHFLEH
Sbjct  58   AAHRVLLNVPETKVTTLENGLRVASEDS-GLSTCTVGLWIDAGSRYENERNNGTAHFLEH  116

Query  466  MIFKGTER  489
            M FKGT +
Sbjct  117  MAFKGTRK  124



>gb|EFA82909.1| mitochondrial processing peptidase beta subunit [Polysphondylium 
pallidum PN500]
Length=474

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 56/79 (71%), Gaps = 3/79 (4%)
 Frame = +1

Query  253  FLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFETE  432
            F     P P+  D   +   P TRVTTLPNG+RVATE +   +TA++GV++D+GS +E E
Sbjct  23   FASETGPQPLNTDF--LNKTPETRVTTLPNGIRVATEQSFG-ETASIGVWVDSGSVYENE  79

Query  433  ETNGTAHFLEHMIFKGTER  489
            + NG AHFLEHMIFKGTE+
Sbjct  80   KNNGVAHFLEHMIFKGTEK  98



>ref|XP_002180975.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC47627.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=473

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = +1

Query  301  ILTAPATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKG  480
            +L AP T VTTL +GLRVA+E+   ++TATVGV+IDAGSR+ET   NG AHFLEH+ FKG
Sbjct  34   VLRAPTTDVTTLDSGLRVASETVQGSETATVGVWIDAGSRYETARNNGVAHFLEHLAFKG  93

Query  481  TER  489
            TE+
Sbjct  94   TEQ  96



>ref|XP_008828982.1| PREDICTED: mitochondrial-processing peptidase subunit beta [Nannospalax 
galili]
Length=489

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 53/79 (67%), Gaps = 1/79 (1%)
 Frame = +1

Query  253  FLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFETE  432
            +L+ N      A    +L  P TRVT L NGLRVA+E N    T TVG++IDAGSR+E E
Sbjct  36   YLRGNRLRSTQAAPQVVLNVPETRVTCLENGLRVASE-NSGLSTCTVGLWIDAGSRYENE  94

Query  433  ETNGTAHFLEHMIFKGTER  489
              NGTAHFLEHM FKGT++
Sbjct  95   RNNGTAHFLEHMAFKGTKK  113



>gb|KFG31663.1| mitochondrial processing peptidase, partial [Toxoplasma gondii 
GAB2-2007-GAL-DOM2]
 gb|KFG43941.1| mitochondrial processing peptidase, partial [Toxoplasma gondii 
FOU]
 gb|KFH16236.1| mitochondrial processing peptidase, partial [Toxoplasma gondii 
MAS]
Length=152

 Score = 84.3 bits (207),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = +1

Query  313  PATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
            P T  TTLPNG+RVAT+     +TATVGV+ID+GSR++T+ETNG AHFLEHM FKGT+R
Sbjct  67   PPTLTTTLPNGIRVATQRLPFHQTATVGVWIDSGSRYDTKETNGAAHFLEHMTFKGTKR  125



>ref|XP_008037964.1| mitochondrial processing peptidase beta subunit [Trametes versicolor 
FP-101664 SS1]
 gb|EIW59736.1| mitochondrial processing peptidase beta subunit [Trametes versicolor 
FP-101664 SS1]
Length=475

 Score = 87.8 bits (216),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 53/75 (71%), Gaps = 12/75 (16%)
 Frame = +1

Query  265  NSPHPVLADHTAILTAPATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFETEETNG  444
            N PHP L            + TTLPNGL VATE++  A+TATVGV+IDAGSR ET+ TNG
Sbjct  33   NVPHPQL------------QTTTLPNGLTVATEAHPHAQTATVGVWIDAGSRAETDATNG  80

Query  445  TAHFLEHMIFKGTER  489
            TAHFLEHM FKGT R
Sbjct  81   TAHFLEHMAFKGTNR  95



>gb|EDL99418.1| peptidase (mitochondrial processing) beta, isoform CRA_d [Rattus 
norvegicus]
Length=222

 Score = 85.5 bits (210),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 49/63 (78%), Gaps = 1/63 (2%)
 Frame = +1

Query  301  ILTAPATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKG  480
            +L  P T+VT L NGLRVA+E N    T TVG++IDAGSR+E E+ NGTAHFLEHM FKG
Sbjct  52   VLNVPETQVTCLENGLRVASE-NSGISTCTVGLWIDAGSRYENEKNNGTAHFLEHMAFKG  110

Query  481  TER  489
            T++
Sbjct  111  TKK  113



>ref|XP_007641060.1| PREDICTED: mitochondrial-processing peptidase subunit beta isoform 
X2 [Cricetulus griseus]
 ref|XP_007631195.1| PREDICTED: mitochondrial-processing peptidase subunit beta isoform 
X6 [Cricetulus griseus]
Length=458

 Score = 87.8 bits (216),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 49/64 (77%), Gaps = 1/64 (2%)
 Frame = +1

Query  298  AILTAPATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFK  477
             +L  P TRVT L NGLRVA+E N    T TVG++IDAGSR+E E+ NGTAHFLEHM FK
Sbjct  20   VVLNVPETRVTCLENGLRVASE-NSGISTCTVGLWIDAGSRYENEKNNGTAHFLEHMAFK  78

Query  478  GTER  489
            GT++
Sbjct  79   GTKK  82



>gb|EDL03196.1| mCG6419, isoform CRA_c [Mus musculus]
Length=222

 Score = 85.5 bits (210),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 49/63 (78%), Gaps = 1/63 (2%)
 Frame = +1

Query  301  ILTAPATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKG  480
            +L  P T+VT L NGLRVA+E N    T TVG++IDAGSR+E E+ NGTAHFLEHM FKG
Sbjct  52   VLNVPETQVTCLENGLRVASE-NSGLSTCTVGLWIDAGSRYENEKNNGTAHFLEHMAFKG  110

Query  481  TER  489
            T++
Sbjct  111  TKK  113



>ref|XP_006462420.1| hypothetical protein AGABI2DRAFT_193572 [Agaricus bisporus var. 
bisporus H97]
 gb|EKV45600.1| hypothetical protein AGABI2DRAFT_193572 [Agaricus bisporus var. 
bisporus H97]
Length=464

 Score = 87.8 bits (216),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 53/74 (72%), Gaps = 0/74 (0%)
 Frame = +1

Query  268  SPHPVLADHTAILTAPATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFETEETNGT  447
            SP P  +  T     P T VTTL NGL VATE++  A+TATVGV+IDAGSR ETE+ NG 
Sbjct  17   SPRPTRSYATIRNAGPLTEVTTLANGLTVATEAHPHAQTATVGVWIDAGSRAETEKINGA  76

Query  448  AHFLEHMIFKGTER  489
            AHFLEHM FKGT R
Sbjct  77   AHFLEHMAFKGTGR  90



>ref|XP_003771525.1| PREDICTED: mitochondrial-processing peptidase subunit beta [Sarcophilus 
harrisii]
Length=485

 Score = 87.8 bits (216),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 50/64 (78%), Gaps = 1/64 (2%)
 Frame = +1

Query  298  AILTAPATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFK  477
             +L  P TRVTTL NGLRVA+E +    T TVG++IDAGSR+E E+ NGTAHFLEHM FK
Sbjct  47   VVLNVPETRVTTLENGLRVASEDS-GLSTCTVGLWIDAGSRYENEKNNGTAHFLEHMAFK  105

Query  478  GTER  489
            GT++
Sbjct  106  GTKK  109



>ref|XP_007329879.1| hypothetical protein AGABI1DRAFT_113744 [Agaricus bisporus var. 
burnettii JB137-S8]
 gb|EKM79125.1| hypothetical protein AGABI1DRAFT_113744 [Agaricus bisporus var. 
burnettii JB137-S8]
Length=464

 Score = 87.8 bits (216),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 53/74 (72%), Gaps = 0/74 (0%)
 Frame = +1

Query  268  SPHPVLADHTAILTAPATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFETEETNGT  447
            SP P  +  T     P T VTTL NGL VATE++  A+TATVGV+IDAGSR ETE+ NG 
Sbjct  17   SPRPTRSYATIRNAGPLTEVTTLANGLTVATEAHPHAQTATVGVWIDAGSRAETEKINGA  76

Query  448  AHFLEHMIFKGTER  489
            AHFLEHM FKGT R
Sbjct  77   AHFLEHMAFKGTGR  90



>sp|Q9Y8B5.1|MPPB_LENED RecName: Full=Mitochondrial-processing peptidase subunit beta; 
AltName: Full=Beta-MPP; Flags: Precursor [Lentinula edodes]
 gb|AAD37722.1|AF146393_1 mitochondrial processing peptidase beta subunit [Lentinula edodes]
Length=466

 Score = 87.8 bits (216),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = +1

Query  310  APATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
             P T ++TL NGL VATES   A+TATVGV+IDAGSR ET++TNGTAHFLEHM FKGT R
Sbjct  26   GPFTEISTLSNGLTVATESQPHAQTATVGVWIDAGSRAETDKTNGTAHFLEHMAFKGTGR  85



>ref|XP_005358415.1| PREDICTED: mitochondrial-processing peptidase subunit beta [Microtus 
ochrogaster]
Length=489

 Score = 87.8 bits (216),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 49/63 (78%), Gaps = 1/63 (2%)
 Frame = +1

Query  301  ILTAPATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKG  480
            +L  P TRVT L NGLRVA+E N    T TVG++IDAGSR+E E+ NGTAHFLEHM FKG
Sbjct  52   VLNVPETRVTCLENGLRVASE-NSGLSTCTVGLWIDAGSRYENEKNNGTAHFLEHMAFKG  110

Query  481  TER  489
            T++
Sbjct  111  TKK  113



>sp|Q00302.1|MPPB_BLAEM RecName: Full=Mitochondrial-processing peptidase subunit beta; 
AltName: Full=BeMPP1; AltName: Full=Beta-MPP; Flags: Precursor 
[Blastocladiella emersonii]
 gb|AAC63093.1| mitochondrial processing peptidase beta subunit 1 [Blastocladiella 
emersonii]
Length=465

 Score = 87.8 bits (216),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = +1

Query  298  AILTAPATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFK  477
            A+L  P T+VT LPNGL VATESN A  TATVGV+ID+GSR ET+  NG AHFLEH+ FK
Sbjct  28   ALLNVPKTQVTRLPNGLTVATESNPALATATVGVWIDSGSRAETKANNGVAHFLEHISFK  87

Query  478  GTER  489
            GT++
Sbjct  88   GTKQ  91



>gb|KIM78462.1| hypothetical protein PILCRDRAFT_824358 [Piloderma croceum F 1598]
Length=474

 Score = 87.8 bits (216),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +1

Query  310  APATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTE  486
            +P T V+TL NGL VATE++  A+TATVGV+IDAGSR ET++TNGTAHFLEHM FKGT+
Sbjct  35   SPLTEVSTLSNGLTVATEAHSHAQTATVGVWIDAGSRAETDKTNGTAHFLEHMAFKGTK  93



>ref|XP_007380034.1| hypothetical protein PUNSTDRAFT_141164 [Punctularia strigosozonata 
HHB-11173 SS5]
 gb|EIN12467.1| hypothetical protein PUNSTDRAFT_141164 [Punctularia strigosozonata 
HHB-11173 SS5]
Length=473

 Score = 87.8 bits (216),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +1

Query  310  APATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGTER  489
             P T V+TLPNGL VATE++ +A+TATVGV+IDAGSR ET+ T+GTAHFLEHM FKGT R
Sbjct  34   GPFTEVSTLPNGLTVATEAHPSAQTATVGVWIDAGSRAETDATSGTAHFLEHMAFKGTGR  93



>gb|KIL64372.1| hypothetical protein M378DRAFT_163408 [Amanita muscaria Koide 
BX008]
Length=471

 Score = 87.8 bits (216),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  304  LTAPATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKGT  483
            +T P T V+TL NGL VATE+   A+TATVGV+IDAGSR ET++T+GTAHFLEHM FKGT
Sbjct  30   VTGPFTEVSTLSNGLTVATEAQPHAQTATVGVWIDAGSRAETDKTSGTAHFLEHMAFKGT  89

Query  484  ER  489
             R
Sbjct  90   NR  91



>gb|AAB84398.1| mitochondrial processing protease beta precursor [Drosophila 
silvestris]
Length=178

 Score = 84.7 bits (208),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 49/63 (78%), Gaps = 1/63 (2%)
 Frame = +1

Query  301  ILTAPATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKG  480
            +L  PAT+VT L NGLRVA+E +  A TATVG++IDAGSR E +  NG AHFLEHM FKG
Sbjct  35   LLNIPATQVTQLDNGLRVASEDS-GASTATVGLWIDAGSRSENDRNNGVAHFLEHMAFKG  93

Query  481  TER  489
            T++
Sbjct  94   TDK  96



>gb|EDL99419.1| peptidase (mitochondrial processing) beta, isoform CRA_e [Rattus 
norvegicus]
Length=246

 Score = 85.5 bits (210),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 49/63 (78%), Gaps = 1/63 (2%)
 Frame = +1

Query  301  ILTAPATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFKG  480
            +L  P T+VT L NGLRVA+E N    T TVG++IDAGSR+E E+ NGTAHFLEHM FKG
Sbjct  52   VLNVPETQVTCLENGLRVASE-NSGISTCTVGLWIDAGSRYENEKNNGTAHFLEHMAFKG  110

Query  481  TER  489
            T++
Sbjct  111  TKK  113



>ref|XP_007504129.1| PREDICTED: mitochondrial-processing peptidase subunit beta [Monodelphis 
domestica]
Length=539

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 50/64 (78%), Gaps = 1/64 (2%)
 Frame = +1

Query  298  AILTAPATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFETEETNGTAHFLEHMIFK  477
             +L  P TRVTTL NGLRVA+E +    T TVG++IDAGSR+E E+ NGTAHFLEHM FK
Sbjct  101  VVLNVPETRVTTLENGLRVASEDS-GLSTCTVGLWIDAGSRYENEKNNGTAHFLEHMAFK  159

Query  478  GTER  489
            GT++
Sbjct  160  GTKK  163



>gb|KJA16954.1| hypothetical protein HYPSUDRAFT_192662 [Hypholoma sublateritium 
FD-334 SS-4]
Length=470

 Score = 87.8 bits (216),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 61/83 (73%), Gaps = 2/83 (2%)
 Frame = +1

Query  247  SRFLQYNSPHP--VLADHTAILTAPATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSR  420
            SR L+  + HP  +    TA   +P T V+TL NGL VATE+   A+TATVGV+IDAGSR
Sbjct  8    SRVLKNAARHPRALRGFATAHPASPFTEVSTLSNGLTVATEAQPHAQTATVGVWIDAGSR  67

Query  421  FETEETNGTAHFLEHMIFKGTER  489
             ET++T+GTAHFLEHM FKGT+R
Sbjct  68   AETDKTSGTAHFLEHMAFKGTQR  90



>ref|XP_007271781.1| hypothetical protein FOMMEDRAFT_129851 [Fomitiporia mediterranea 
MF3/22]
 gb|EJC97946.1| hypothetical protein FOMMEDRAFT_129851 [Fomitiporia mediterranea 
MF3/22]
Length=469

 Score = 87.4 bits (215),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 54/74 (73%), Gaps = 0/74 (0%)
 Frame = +1

Query  268  SPHPVLADHTAILTAPATRVTTLPNGLRVATESNLAAKTATVGVFIDAGSRFETEETNGT  447
            +P P+ +  T +   P T +TTL NGL VATES+  A+TATVGV+IDAGSR E +  NGT
Sbjct  16   NPRPLRSFATVVNPTPTTEITTLANGLTVATESHPHAETATVGVWIDAGSRAENDANNGT  75

Query  448  AHFLEHMIFKGTER  489
            AHFLEHM FKGT R
Sbjct  76   AHFLEHMAFKGTNR  89



>ref|XP_005679165.1| PREDICTED: mitochondrial-processing peptidase subunit beta [Capra 
hircus]
Length=492

 Score = 87.8 bits (216),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 47/82 (57%), Positives = 56/82 (68%), Gaps = 3/82 (4%)
 Frame = +1

Query  247  SRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVATE-SNLAAKTATVGVFIDAGSRF  423
            S +L  N      A    +L  P TRVT L NGLRVA+E S LA  T TVG++IDAGSR+
Sbjct  37   SLYLGGNRLRSTQAATQVVLNVPETRVTCLENGLRVASEDSGLA--TCTVGLWIDAGSRY  94

Query  424  ETEETNGTAHFLEHMIFKGTER  489
            E E+ NGTAHFLEHM FKGT++
Sbjct  95   ENEKNNGTAHFLEHMAFKGTKK  116



>ref|XP_004007875.1| PREDICTED: mitochondrial-processing peptidase subunit beta [Ovis 
aries]
Length=491

 Score = 87.8 bits (216),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 47/82 (57%), Positives = 56/82 (68%), Gaps = 3/82 (4%)
 Frame = +1

Query  247  SRFLQYNSPHPVLADHTAILTAPATRVTTLPNGLRVATE-SNLAAKTATVGVFIDAGSRF  423
            S +L  N      A    +L  P TRVT L NGLRVA+E S LA  T TVG++IDAGSR+
Sbjct  36   SLYLGGNRLRSTQAATQVVLNVPETRVTCLENGLRVASEDSGLA--TCTVGLWIDAGSRY  93

Query  424  ETEETNGTAHFLEHMIFKGTER  489
            E E+ NGTAHFLEHM FKGT++
Sbjct  94   ENEKNNGTAHFLEHMAFKGTKK  115



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 557548962370