BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002B03

Length=613
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004228627.1|  PREDICTED: uncharacterized oxidoreductase C2...    118   3e-51   Solanum lycopersicum
ref|XP_009588958.1|  PREDICTED: uncharacterized protein YMR315W         117   4e-51   Nicotiana tomentosiformis
ref|XP_009773348.1|  PREDICTED: uncharacterized protein LOC104223588    115   2e-50   Nicotiana sylvestris
ref|XP_006348416.1|  PREDICTED: uncharacterized protein YMR315W-like    116   4e-50   Solanum tuberosum [potatoes]
emb|CBI16434.3|  unnamed protein product                                116   3e-46   Vitis vinifera
ref|XP_002285606.1|  PREDICTED: uncharacterized protein LOC100245...    115   5e-46   Vitis vinifera
ref|XP_010651284.1|  PREDICTED: uncharacterized protein LOC100245...    115   5e-46   
ref|XP_010651283.1|  PREDICTED: uncharacterized protein LOC100245...    115   6e-46   Vitis vinifera
ref|XP_008449757.1|  PREDICTED: uncharacterized protein YMR315W         114   2e-45   
ref|XP_002513445.1|  oxidoreductase, putative                           109   5e-45   Ricinus communis
ref|XP_010031848.1|  PREDICTED: uncharacterized protein YMR315W         114   2e-44   Eucalyptus grandis [rose gum]
gb|KCW51233.1|  hypothetical protein EUGRSUZ_J00813                     114   2e-44   Eucalyptus grandis [rose gum]
emb|CAN75498.1|  hypothetical protein VITISV_020272                     109   3e-44   Vitis vinifera
emb|CDP14087.1|  unnamed protein product                                103   3e-44   Coffea canephora [robusta coffee]
ref|XP_009364727.1|  PREDICTED: uncharacterized protein LOC103954617    103   6e-43   Pyrus x bretschneideri [bai li]
gb|KFK39395.1|  hypothetical protein AALP_AA3G239500                    107   1e-42   Arabis alpina [alpine rockcress]
ref|XP_007014900.1|  Oxidoreductase, putative isoform 2                 108   1e-42   
gb|KDP20201.1|  hypothetical protein JCGZ_07921                         108   1e-42   Jatropha curcas
emb|CDY06381.1|  BnaC05g31490D                                          103   1e-42   
gb|KJB66099.1|  hypothetical protein B456_010G128200                    104   1e-42   Gossypium raimondii
gb|KJB66097.1|  hypothetical protein B456_010G128200                    104   1e-42   Gossypium raimondii
gb|KJB66095.1|  hypothetical protein B456_010G128200                    104   1e-42   Gossypium raimondii
ref|XP_009145584.1|  PREDICTED: uncharacterized protein YMR315W         103   2e-42   Brassica rapa
ref|XP_007014899.1|  Oxidoreductase, putative isoform 1                 107   2e-42   
emb|CDY19604.1|  BnaA05g20120D                                          103   2e-42   Brassica napus [oilseed rape]
ref|XP_009364714.1|  PREDICTED: uncharacterized protein LOC103954601    102   2e-42   Pyrus x bretschneideri [bai li]
ref|XP_011025252.1|  PREDICTED: uncharacterized protein YMR315W i...    102   4e-42   Populus euphratica
ref|XP_011025251.1|  PREDICTED: uncharacterized protein YMR315W i...    102   4e-42   Populus euphratica
ref|XP_006386094.1|  hypothetical protein POPTR_0003s22050g             102   4e-42   Populus trichocarpa [western balsam poplar]
ref|XP_006386095.1|  hypothetical protein POPTR_0003s22050g             102   4e-42   Populus trichocarpa [western balsam poplar]
gb|ABK96297.1|  unknown                                                 102   5e-42   Populus trichocarpa x Populus deltoides
ref|XP_006298014.1|  hypothetical protein CARUB_v10014059mg             105   6e-42   
ref|XP_010488066.1|  PREDICTED: glucose-fructose oxidoreductase d...    102   1e-41   Camelina sativa [gold-of-pleasure]
ref|XP_006406349.1|  hypothetical protein EUTSA_v10021019mg             102   1e-41   Eutrema salsugineum [saltwater cress]
ref|XP_010091995.1|  Uncharacterized protein L484_007981                109   1e-41   
ref|XP_008358862.1|  PREDICTED: uncharacterized protein YMR315W-l...    101   1e-41   Malus domestica [apple tree]
ref|XP_008243595.1|  PREDICTED: uncharacterized protein YMR315W         102   1e-41   Prunus mume [ume]
ref|XP_010544235.1|  PREDICTED: uncharacterized protein YMR315W i...  99.4    2e-41   Tarenaya hassleriana [spider flower]
ref|XP_010544236.1|  PREDICTED: uncharacterized protein YMR315W i...  99.4    2e-41   Tarenaya hassleriana [spider flower]
ref|XP_002883268.1|  oxidoreductase family protein                      103   3e-41   
ref|XP_007205433.1|  hypothetical protein PRUPE_ppa007778mg             102   3e-41   
ref|XP_010509356.1|  PREDICTED: glucose-fructose oxidoreductase d...    101   3e-41   Camelina sativa [gold-of-pleasure]
gb|KJB66096.1|  hypothetical protein B456_010G128200                  99.8    5e-41   Gossypium raimondii
ref|NP_188715.2|  NAD(P)-binding Rossmann-fold superfamily protein      103   5e-41   Arabidopsis thaliana [mouse-ear cress]
gb|ACU17312.1|  unknown                                               97.4    5e-41   Glycine max [soybeans]
dbj|BAB02487.1|  unnamed protein product                                103   6e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003543553.1|  PREDICTED: uncharacterized protein YMR315W       97.4    6e-41   Glycine max [soybeans]
ref|XP_006494722.1|  PREDICTED: uncharacterized protein YMR315W-like    108   1e-40   Citrus sinensis [apfelsine]
gb|KJB66098.1|  hypothetical protein B456_010G128200                  98.2    1e-40   Gossypium raimondii
ref|XP_011080243.1|  PREDICTED: uncharacterized protein LOC105163544  98.6    2e-40   Sesamum indicum [beniseed]
ref|XP_011090402.1|  PREDICTED: uncharacterized protein YMR315W-like  97.8    3e-40   Sesamum indicum [beniseed]
ref|XP_008358864.1|  PREDICTED: uncharacterized protein YMR315W-l...  96.3    3e-40   Malus domestica [apple tree]
ref|XP_006445974.1|  hypothetical protein CICLE_v10015756mg             105   8e-40   Citrus clementina [clementine]
ref|XP_006445973.1|  hypothetical protein CICLE_v10015756mg             105   8e-40   
ref|XP_006445972.1|  hypothetical protein CICLE_v10015756mg             105   1e-39   
ref|XP_011461910.1|  PREDICTED: uncharacterized protein YMR315W       97.1    1e-39   Fragaria vesca subsp. vesca
ref|XP_010257400.1|  PREDICTED: uncharacterized protein LOC104597...    105   2e-39   Nelumbo nucifera [Indian lotus]
ref|XP_010257398.1|  PREDICTED: uncharacterized protein LOC104597...    105   2e-39   Nelumbo nucifera [Indian lotus]
gb|EYU18011.1|  hypothetical protein MIMGU_mgv1a008840mg              98.2    4e-39   Erythranthe guttata [common monkey flower]
ref|XP_007150403.1|  hypothetical protein PHAVU_005G150400g           97.4    6e-39   Phaseolus vulgaris [French bean]
ref|XP_010913920.1|  PREDICTED: uncharacterized protein LOC105039...    102   9e-39   Elaeis guineensis
ref|XP_003577920.1|  PREDICTED: uncharacterized protein LOC100827110    100   9e-39   Brachypodium distachyon [annual false brome]
ref|XP_004956459.1|  PREDICTED: uncharacterized protein YMR315W-like    101   1e-38   Setaria italica
ref|XP_010913917.1|  PREDICTED: uncharacterized protein LOC105039...    101   1e-38   Elaeis guineensis
gb|KHG07862.1|  Uncharacterized protein F383_13730                    95.5    1e-38   Gossypium arboreum [tree cotton]
ref|XP_002459955.1|  hypothetical protein SORBIDRAFT_02g018670          100   2e-38   Sorghum bicolor [broomcorn]
ref|XP_009385566.1|  PREDICTED: glucose-fructose oxidoreductase d...  99.0    5e-38   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFK46300.1|  unknown                                               97.4    5e-38   Lotus japonicus
ref|NP_001149836.1|  NAD-dependent dyhydrogenase, Gfo/Idh/MocA fa...  96.7    6e-38   Zea mays [maize]
ref|XP_010257399.1|  PREDICTED: uncharacterized protein LOC104597...    100   7e-38   Nelumbo nucifera [Indian lotus]
ref|XP_006850072.1|  hypothetical protein AMTR_s00022p00213490          100   1e-37   
ref|XP_008668038.1|  PREDICTED: NAD-dependent dyhydrogenase, Gfo/...  96.7    1e-37   Zea mays [maize]
ref|XP_008787293.1|  PREDICTED: uncharacterized protein LOC103705381  98.6    2e-37   Phoenix dactylifera
gb|EMT01460.1|  hypothetical protein F775_26364                       95.9    1e-36   
ref|XP_006660493.1|  PREDICTED: uncharacterized protein YMR315W-like  99.0    1e-36   Oryza brachyantha
gb|EEE69341.1|  hypothetical protein OsJ_28659                          100   8e-36   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001062764.1|  Os09g0280300                                       100   8e-36   
ref|XP_010673578.1|  PREDICTED: uncharacterized protein YMR315W i...  97.4    2e-34   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010673579.1|  PREDICTED: uncharacterized protein YMR315W i...  97.4    2e-34   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004486934.1|  PREDICTED: uncharacterized protein YMR315W-like  90.1    2e-34   Cicer arietinum [garbanzo]
gb|KGN54119.1|  hypothetical protein Csa_4G286920                     99.4    2e-34   Cucumis sativus [cucumbers]
gb|EPS68382.1|  hypothetical protein M569_06387                       89.7    5e-32   Genlisea aurea
ref|XP_003597479.1|  Oxidoreductase, putative                         92.8    2e-31   Medicago truncatula
gb|EYU46309.1|  hypothetical protein MIMGU_mgv1a0096471mg             94.7    2e-30   Erythranthe guttata [common monkey flower]
ref|XP_001762266.1|  predicted protein                                79.7    1e-26   
ref|XP_001754780.1|  predicted protein                                76.3    2e-26   
gb|KJB66094.1|  hypothetical protein B456_010G128200                    105   1e-23   Gossypium raimondii
ref|XP_004169964.1|  PREDICTED: uncharacterized protein LOC101228167  99.0    9e-23   
ref|XP_004142242.1|  PREDICTED: uncharacterized LOC101204258          99.4    3e-22   
ref|XP_002981277.1|  hypothetical protein SELMODRAFT_114540           72.8    6e-22   
ref|XP_002969664.1|  hypothetical protein SELMODRAFT_92921            71.2    2e-21   
ref|XP_004152962.1|  PREDICTED: uncharacterized protein LOC101204258  87.0    2e-18   
ref|XP_001776337.1|  predicted protein                                63.5    7e-18   
ref|XP_002973220.1|  hypothetical protein SELMODRAFT_413759           66.2    3e-17   
ref|XP_004162028.1|  PREDICTED: uncharacterized LOC101204258          86.7    4e-17   
ref|XP_002976631.1|  hypothetical protein SELMODRAFT_416506           64.7    2e-16   Selaginella moellendorffii
gb|KJB66101.1|  hypothetical protein B456_010G128200                  84.0    4e-16   Gossypium raimondii
ref|XP_010466287.1|  PREDICTED: uncharacterized protein LOC104746495  80.9    3e-15   Camelina sativa [gold-of-pleasure]
ref|XP_002973823.1|  hypothetical protein SELMODRAFT_414190           58.2    8e-15   



>ref|XP_004228627.1| PREDICTED: uncharacterized oxidoreductase C26H5.09c [Solanum 
lycopersicum]
Length=359

 Score =   118 bits (295),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = +2

Query  362  VEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLSTNMTQKPIWAVAENYRFEPAFT  541
            V+MSLRLLK GKHVLQEKPAA  + EAE AL HYNSLST +TQ+PIWAVAENYRFEPAF 
Sbjct  89   VDMSLRLLKAGKHVLQEKPAAPTVDEAEKALTHYNSLSTTLTQQPIWAVAENYRFEPAFI  148

Query  542  ECKKMIAEIGDMMNVXVIIEGSMN  613
            E K++I+EIG+MMN+ VI+EG+MN
Sbjct  149  EGKRLISEIGEMMNIQVIVEGAMN  172


 Score =   111 bits (277),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 63/75 (84%), Positives = 71/75 (95%), Gaps = 0/75 (0%)
 Frame = +1

Query  100  SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECK  279
            +QLPQIAILG+GIFVKTQYIPRLAEIS LF+L+AIWSR+EES RSAVE+A+ HFPNVECK
Sbjct  2    AQLPQIAILGAGIFVKTQYIPRLAEISNLFILRAIWSRTEESVRSAVEIAQKHFPNVECK  61

Query  280  WGGAGLEEIIKDTSI  324
            WG AGLEEIIKD+SI
Sbjct  62   WGDAGLEEIIKDSSI  76



>ref|XP_009588958.1| PREDICTED: uncharacterized protein YMR315W [Nicotiana tomentosiformis]
Length=361

 Score =   117 bits (293),  Expect(2) = 4e-51, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = +2

Query  362  VEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLSTNMTQKPIWAVAENYRFEPAFT  541
            V+MSL+LLK GKHVLQEKPAAA + EAE AL HYNSLST +T +PIWAVAENYRFEPAF 
Sbjct  91   VDMSLKLLKAGKHVLQEKPAAATVDEAETALTHYNSLSTTLTHQPIWAVAENYRFEPAFI  150

Query  542  ECKKMIAEIGDMMNVXVIIEGSMN  613
            E KK+I+EIG+MMN+ VI+EGSMN
Sbjct  151  EGKKLISEIGEMMNIQVIVEGSMN  174


 Score =   111 bits (278),  Expect(2) = 4e-51, Method: Compositional matrix adjust.
 Identities = 66/78 (85%), Positives = 74/78 (95%), Gaps = 0/78 (0%)
 Frame = +1

Query  91   MAESQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNV  270
            MA+SQ+PQIAILG+GIFVKTQYIPRLAEI  LFVL+AIWSRSEESARSAVE+AR HFP+V
Sbjct  1    MAQSQVPQIAILGAGIFVKTQYIPRLAEIPDLFVLRAIWSRSEESARSAVEIARKHFPDV  60

Query  271  ECKWGGAGLEEIIKDTSI  324
            ECKWG AGLE+IIKD+SI
Sbjct  61   ECKWGDAGLEDIIKDSSI  78



>ref|XP_009773348.1| PREDICTED: uncharacterized protein LOC104223588 [Nicotiana sylvestris]
Length=361

 Score =   115 bits (287),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +2

Query  362  VEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLSTNMTQKPIWAVAENYRFEPAFT  541
            V+MSLRLLK GKHVLQEKPAAA + EAE AL HYNSLS  +T +P+WAVAENYRFEPAF 
Sbjct  91   VDMSLRLLKAGKHVLQEKPAAATVDEAETALTHYNSLSATLTHQPLWAVAENYRFEPAFI  150

Query  542  ECKKMIAEIGDMMNVXVIIEGSMN  613
            E +K+I+EIG+MMN+ VI+EGSMN
Sbjct  151  EGRKLISEIGEMMNIQVIVEGSMN  174


 Score =   112 bits (279),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 66/78 (85%), Positives = 74/78 (95%), Gaps = 0/78 (0%)
 Frame = +1

Query  91   MAESQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNV  270
            MA+SQ+PQIAILG+GIFVKTQYIPRLAEI  LFVL+AIWSRSEESARSAVE+AR HFP+V
Sbjct  1    MAQSQVPQIAILGAGIFVKTQYIPRLAEIPHLFVLRAIWSRSEESARSAVEIARKHFPDV  60

Query  271  ECKWGGAGLEEIIKDTSI  324
            ECKWG AGLE+IIKD+SI
Sbjct  61   ECKWGDAGLEDIIKDSSI  78



>ref|XP_006348416.1| PREDICTED: uncharacterized protein YMR315W-like [Solanum tuberosum]
Length=359

 Score =   116 bits (290),  Expect(2) = 4e-50, Method: Compositional matrix adjust.
 Identities = 61/84 (73%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = +2

Query  362  VEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLSTNMTQKPIWAVAENYRFEPAFT  541
            V+MSLRLLK GKHVLQEKPA+A + EAE AL HYNSLS  +TQ+PIWAVAENYRFEPAF 
Sbjct  89   VDMSLRLLKAGKHVLQEKPASATVDEAEKALTHYNSLSATLTQQPIWAVAENYRFEPAFI  148

Query  542  ECKKMIAEIGDMMNVXVIIEGSMN  613
            E K++I+EIG+MMN+ +I+EG+MN
Sbjct  149  EGKRLISEIGEMMNIQIIVEGAMN  172


 Score =   108 bits (271),  Expect(2) = 4e-50, Method: Compositional matrix adjust.
 Identities = 63/75 (84%), Positives = 71/75 (95%), Gaps = 0/75 (0%)
 Frame = +1

Query  100  SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECK  279
            +Q PQIAILG+GIFVKTQYIPRLAEIS LF+L+AIWSR+EESARSAVE+A+ HFPNVECK
Sbjct  2    AQHPQIAILGAGIFVKTQYIPRLAEISNLFILRAIWSRTEESARSAVEIAQKHFPNVECK  61

Query  280  WGGAGLEEIIKDTSI  324
            WG AGLEEIIKD+SI
Sbjct  62   WGDAGLEEIIKDSSI  76



>emb|CBI16434.3| unnamed protein product [Vitis vinifera]
Length=359

 Score =   116 bits (290),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 63/88 (72%), Positives = 76/88 (86%), Gaps = 0/88 (0%)
 Frame = +2

Query  350  AKLRVEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLSTNMTQKPIWAVAENYRFE  529
             +++VEMSLRLLK GKHVLQEKPAAA I+EAE AL HYNS+  ++  +PIWAVAENYRFE
Sbjct  85   GQMKVEMSLRLLKAGKHVLQEKPAAASISEAETALSHYNSICASIPGQPIWAVAENYRFE  144

Query  530  PAFTECKKMIAEIGDMMNVXVIIEGSMN  613
            PAF ECKK++ EIGDMM++ VI+EGSMN
Sbjct  145  PAFVECKKLMEEIGDMMSIQVIVEGSMN  172


 Score = 96.3 bits (238),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 56/72 (78%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = +1

Query  109  PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGG  288
            PQIA+LG GIFV+TQYIPRLAEIS LFVLKAIWSRS+ESA   VELAR +FP+VECKWG 
Sbjct  5    PQIAVLGGGIFVRTQYIPRLAEISHLFVLKAIWSRSQESANITVELARKNFPDVECKWGE  64

Query  289  AGLEEIIKDTSI  324
             GL+EII D+SI
Sbjct  65   DGLDEIINDSSI  76



>ref|XP_002285606.1| PREDICTED: uncharacterized protein LOC100245027 isoform X1 [Vitis 
vinifera]
Length=359

 Score =   115 bits (289),  Expect(2) = 5e-46, Method: Compositional matrix adjust.
 Identities = 63/88 (72%), Positives = 75/88 (85%), Gaps = 0/88 (0%)
 Frame = +2

Query  350  AKLRVEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLSTNMTQKPIWAVAENYRFE  529
             + +VEMSLRLLK GKHVLQEKPAAA I+EAE AL HYNS+  ++  +PIWAVAENYRFE
Sbjct  85   GQFQVEMSLRLLKAGKHVLQEKPAAASISEAETALSHYNSICASIPGQPIWAVAENYRFE  144

Query  530  PAFTECKKMIAEIGDMMNVXVIIEGSMN  613
            PAF ECKK++ EIGDMM++ VI+EGSMN
Sbjct  145  PAFVECKKLMEEIGDMMSIQVIVEGSMN  172


 Score = 95.9 bits (237),  Expect(2) = 5e-46, Method: Compositional matrix adjust.
 Identities = 56/72 (78%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = +1

Query  109  PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGG  288
            PQIA+LG GIFV+TQYIPRLAEIS LFVLKAIWSRS+ESA   VELAR +FP+VECKWG 
Sbjct  5    PQIAVLGGGIFVRTQYIPRLAEISHLFVLKAIWSRSQESANITVELARKNFPDVECKWGE  64

Query  289  AGLEEIIKDTSI  324
             GL+EII D+SI
Sbjct  65   DGLDEIINDSSI  76



>ref|XP_010651284.1| PREDICTED: uncharacterized protein LOC100245027 isoform X3 [Vitis 
vinifera]
Length=309

 Score =   115 bits (288),  Expect(2) = 5e-46, Method: Compositional matrix adjust.
 Identities = 63/88 (72%), Positives = 75/88 (85%), Gaps = 0/88 (0%)
 Frame = +2

Query  350  AKLRVEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLSTNMTQKPIWAVAENYRFE  529
             + +VEMSLRLLK GKHVLQEKPAAA I+EAE AL HYNS+  ++  +PIWAVAENYRFE
Sbjct  85   GQFQVEMSLRLLKAGKHVLQEKPAAASISEAETALSHYNSICASIPGQPIWAVAENYRFE  144

Query  530  PAFTECKKMIAEIGDMMNVXVIIEGSMN  613
            PAF ECKK++ EIGDMM++ VI+EGSMN
Sbjct  145  PAFVECKKLMEEIGDMMSIQVIVEGSMN  172


 Score = 95.9 bits (237),  Expect(2) = 5e-46, Method: Compositional matrix adjust.
 Identities = 56/72 (78%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = +1

Query  109  PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGG  288
            PQIA+LG GIFV+TQYIPRLAEIS LFVLKAIWSRS+ESA   VELAR +FP+VECKWG 
Sbjct  5    PQIAVLGGGIFVRTQYIPRLAEISHLFVLKAIWSRSQESANITVELARKNFPDVECKWGE  64

Query  289  AGLEEIIKDTSI  324
             GL+EII D+SI
Sbjct  65   DGLDEIINDSSI  76



>ref|XP_010651283.1| PREDICTED: uncharacterized protein LOC100245027 isoform X2 [Vitis 
vinifera]
Length=322

 Score =   115 bits (288),  Expect(2) = 6e-46, Method: Compositional matrix adjust.
 Identities = 63/88 (72%), Positives = 75/88 (85%), Gaps = 0/88 (0%)
 Frame = +2

Query  350  AKLRVEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLSTNMTQKPIWAVAENYRFE  529
             + +VEMSLRLLK GKHVLQEKPAAA I+EAE AL HYNS+  ++  +PIWAVAENYRFE
Sbjct  85   GQFQVEMSLRLLKAGKHVLQEKPAAASISEAETALSHYNSICASIPGQPIWAVAENYRFE  144

Query  530  PAFTECKKMIAEIGDMMNVXVIIEGSMN  613
            PAF ECKK++ EIGDMM++ VI+EGSMN
Sbjct  145  PAFVECKKLMEEIGDMMSIQVIVEGSMN  172


 Score = 96.3 bits (238),  Expect(2) = 6e-46, Method: Compositional matrix adjust.
 Identities = 56/72 (78%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = +1

Query  109  PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGG  288
            PQIA+LG GIFV+TQYIPRLAEIS LFVLKAIWSRS+ESA   VELAR +FP+VECKWG 
Sbjct  5    PQIAVLGGGIFVRTQYIPRLAEISHLFVLKAIWSRSQESANITVELARKNFPDVECKWGE  64

Query  289  AGLEEIIKDTSI  324
             GL+EII D+SI
Sbjct  65   DGLDEIINDSSI  76



>ref|XP_008449757.1| PREDICTED: uncharacterized protein YMR315W [Cucumis melo]
Length=355

 Score =   114 bits (284),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 73/88 (83%), Gaps = 0/88 (0%)
 Frame = +2

Query  350  AKLRVEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLSTNMTQKPIWAVAENYRFE  529
             + +VEMSLRLLK GKHVLQEKPAAA  +E E AL +YNSLS N  ++P+WAVAENYRFE
Sbjct  85   GQAQVEMSLRLLKAGKHVLQEKPAAASTSELEYALSNYNSLSANFLRQPLWAVAENYRFE  144

Query  530  PAFTECKKMIAEIGDMMNVXVIIEGSMN  613
            PA  ECK +IA++GDMM+V VI+EGSMN
Sbjct  145  PALVECKNLIADVGDMMSVQVIVEGSMN  172


 Score = 95.9 bits (237),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = +1

Query  100  SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECK  279
            ++LPQIAILG+G FVKTQY+PRLAEIS L ++KAIWSR+E SA+ AV++AR +FP VECK
Sbjct  2    AKLPQIAILGAGTFVKTQYLPRLAEISDLLIVKAIWSRTEASAKGAVDIARKYFPTVECK  61

Query  280  WGGAGLEEIIKDTSII  327
            WG AGL++II+D SI+
Sbjct  62   WGDAGLDDIIQDNSIL  77



>ref|XP_002513445.1| oxidoreductase, putative [Ricinus communis]
 gb|EEF48848.1| oxidoreductase, putative [Ricinus communis]
Length=359

 Score =   109 bits (273),  Expect(2) = 5e-45, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 71/88 (81%), Gaps = 0/88 (0%)
 Frame = +2

Query  350  AKLRVEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLSTNMTQKPIWAVAENYRFE  529
             + +V+MSL+LLK GKHVLQEKPAAA I+E E AL  Y SL  N   +PIWAVAENYRFE
Sbjct  85   GQTQVDMSLKLLKAGKHVLQEKPAAASISELEIALSSYKSLCANSPGQPIWAVAENYRFE  144

Query  530  PAFTECKKMIAEIGDMMNVXVIIEGSMN  613
            PAF EC+K++AEIGDMM V VI+EGSMN
Sbjct  145  PAFVECRKLLAEIGDMMTVQVIVEGSMN  172


 Score = 99.0 bits (245),  Expect(2) = 5e-45, Method: Compositional matrix adjust.
 Identities = 61/79 (77%), Positives = 68/79 (86%), Gaps = 2/79 (3%)
 Frame = +1

Query  91   MAESQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNV  270
            MA S  PQIAILG+GIFV+TQYIPRLAEIS LFVLKA+WSRSEESA+ AVE+AR HFP V
Sbjct  1    MANS--PQIAILGAGIFVRTQYIPRLAEISNLFVLKAVWSRSEESAQGAVEIARKHFPGV  58

Query  271  ECKWGGAGLEEIIKDTSII  327
            ECKWG  GL+EII D SI+
Sbjct  59   ECKWGDEGLDEIIHDHSIL  77



>ref|XP_010031848.1| PREDICTED: uncharacterized protein YMR315W [Eucalyptus grandis]
 gb|KCW51232.1| hypothetical protein EUGRSUZ_J00813 [Eucalyptus grandis]
Length=359

 Score =   114 bits (284),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 70/88 (80%), Gaps = 0/88 (0%)
 Frame = +2

Query  350  AKLRVEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLSTNMTQKPIWAVAENYRFE  529
             + +VEMSLRLLK GKHVLQEKPAAA   + E AL  Y +L  +   KPIWAVAENYRFE
Sbjct  85   GQAQVEMSLRLLKAGKHVLQEKPAAASTTDIEMALSRYRALCASSPSKPIWAVAENYRFE  144

Query  530  PAFTECKKMIAEIGDMMNVXVIIEGSMN  613
            PAF ECKK++A+IGDMMNV VI+EGSMN
Sbjct  145  PAFVECKKLLADIGDMMNVQVIVEGSMN  172


 Score = 92.8 bits (229),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 53/71 (75%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = +1

Query  112  QIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGGA  291
            QIAILG+GIFV+TQYIPRLAEISQL ++K+IWSR++ESA  AVE+AR HFP VECKWG  
Sbjct  6    QIAILGAGIFVRTQYIPRLAEISQLVLVKSIWSRTQESATGAVEIARKHFPEVECKWGDE  65

Query  292  GLEEIIKDTSI  324
            GL+EII+D SI
Sbjct  66   GLDEIIRDDSI  76



>gb|KCW51233.1| hypothetical protein EUGRSUZ_J00813 [Eucalyptus grandis]
Length=270

 Score =   114 bits (284),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 70/88 (80%), Gaps = 0/88 (0%)
 Frame = +2

Query  350  AKLRVEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLSTNMTQKPIWAVAENYRFE  529
             + +VEMSLRLLK GKHVLQEKPAAA   + E AL  Y +L  +   KPIWAVAENYRFE
Sbjct  85   GQAQVEMSLRLLKAGKHVLQEKPAAASTTDIEMALSRYRALCASSPSKPIWAVAENYRFE  144

Query  530  PAFTECKKMIAEIGDMMNVXVIIEGSMN  613
            PAF ECKK++A+IGDMMNV VI+EGSMN
Sbjct  145  PAFVECKKLLADIGDMMNVQVIVEGSMN  172


 Score = 92.4 bits (228),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 53/71 (75%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = +1

Query  112  QIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGGA  291
            QIAILG+GIFV+TQYIPRLAEISQL ++K+IWSR++ESA  AVE+AR HFP VECKWG  
Sbjct  6    QIAILGAGIFVRTQYIPRLAEISQLVLVKSIWSRTQESATGAVEIARKHFPEVECKWGDE  65

Query  292  GLEEIIKDTSI  324
            GL+EII+D SI
Sbjct  66   GLDEIIRDDSI  76



>emb|CAN75498.1| hypothetical protein VITISV_020272 [Vitis vinifera]
Length=364

 Score =   109 bits (272),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 62/84 (74%), Gaps = 6/84 (7%)
 Frame = +2

Query  362  VEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLSTNMTQKPIWAVAENYRFEPAFT  541
            VEMSLRLLK GKHVLQ    A         L HYNS+  ++  +PIWAVAENYRFEPAF 
Sbjct  82   VEMSLRLLKAGKHVLQAISEAETA------LSHYNSICASIPGQPIWAVAENYRFEPAFV  135

Query  542  ECKKMIAEIGDMMNVXVIIEGSMN  613
            ECKK++ EIGDMM++ VI+EGSMN
Sbjct  136  ECKKLMEEIGDMMSIQVIVEGSMN  159


 Score = 96.7 bits (239),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 56/72 (78%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = +1

Query  109  PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGG  288
            PQIA+LG GIFV+TQYIPRLAEIS LFVLKAIWSRS+ESA   VELAR +FP+VECKWG 
Sbjct  5    PQIAVLGGGIFVRTQYIPRLAEISHLFVLKAIWSRSQESANITVELARKNFPDVECKWGE  64

Query  289  AGLEEIIKDTSI  324
             GL+EII D+SI
Sbjct  65   DGLDEIINDSSI  76



>emb|CDP14087.1| unnamed protein product [Coffea canephora]
Length=359

 Score =   103 bits (258),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 73/88 (83%), Gaps = 0/88 (0%)
 Frame = +2

Query  350  AKLRVEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLSTNMTQKPIWAVAENYRFE  529
             +++V+MSLRLLK GKHVLQEKPA A I EAE AL  Y+SL T++  +P+WAVAENYRFE
Sbjct  85   GQIQVDMSLRLLKEGKHVLQEKPATASIDEAEAALSSYHSLRTHLPFQPVWAVAENYRFE  144

Query  530  PAFTECKKMIAEIGDMMNVXVIIEGSMN  613
            PAF E KK++AE+GD+M++ VIIEGSM 
Sbjct  145  PAFEESKKLMAEVGDVMSIQVIIEGSMT  172


 Score =   102 bits (253),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 62/76 (82%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = +1

Query  100  SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECK  279
            +QLP IAI+G+GIFVKTQYIPRLAEIS LFVLKAIWSRSEESAR AVE+AR  FP VECK
Sbjct  2    AQLPNIAIIGAGIFVKTQYIPRLAEISNLFVLKAIWSRSEESARGAVEVARKFFPEVECK  61

Query  280  WGGAGLEEIIKDTSII  327
            WG  GL+EIIKD+SII
Sbjct  62   WGDGGLDEIIKDSSII  77



>ref|XP_009364727.1| PREDICTED: uncharacterized protein LOC103954617 [Pyrus x bretschneideri]
Length=357

 Score =   103 bits (257),  Expect(2) = 6e-43, Method: Compositional matrix adjust.
 Identities = 55/88 (63%), Positives = 69/88 (78%), Gaps = 0/88 (0%)
 Frame = +2

Query  350  AKLRVEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLSTNMTQKPIWAVAENYRFE  529
             + +V+ SLR+LKGGKHVLQEKPAAA  +E E AL  Y S+  N   KPIWAVAENYRFE
Sbjct  83   GQAQVDFSLRMLKGGKHVLQEKPAAASTSELETALSSYKSIVDNAPDKPIWAVAENYRFE  142

Query  530  PAFTECKKMIAEIGDMMNVXVIIEGSMN  613
            PAF E +K++ E+GD+M++ VI+EGSMN
Sbjct  143  PAFVEGRKLMTEVGDVMSIQVIVEGSMN  170


 Score = 97.8 bits (242),  Expect(2) = 6e-43, Method: Compositional matrix adjust.
 Identities = 59/73 (81%), Positives = 65/73 (89%), Gaps = 0/73 (0%)
 Frame = +1

Query  109  PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGG  288
            PQIAILG+G FVKTQYIPRL+EIS L VLKAIWSR+EESARSAVE+AR HFP VECKWG 
Sbjct  3    PQIAILGAGTFVKTQYIPRLSEISNLLVLKAIWSRTEESARSAVEIARKHFPGVECKWGD  62

Query  289  AGLEEIIKDTSII  327
             GLEEII D+SI+
Sbjct  63   KGLEEIIADSSIL  75



>gb|KFK39395.1| hypothetical protein AALP_AA3G239500 [Arabis alpina]
Length=356

 Score =   107 bits (267),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = +2

Query  359  RVEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLSTNMTQKPIWAVAENYRFEPAF  538
            +VEMSLR+LK GKHVLQEKPAAA I+E E A+  Y ++S + T+ PIWAVAENYRFEPAF
Sbjct  91   QVEMSLRMLKAGKHVLQEKPAAASISEIETAMSSYKNISADSTRCPIWAVAENYRFEPAF  150

Query  539  TECKKMIAEIGDMMNVXVIIEGSMN  613
             E KK+I EIGDMMNV +IIEGSMN
Sbjct  151  VELKKLIGEIGDMMNVQLIIEGSMN  175


 Score = 93.6 bits (231),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 58/75 (77%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +1

Query  100  SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECK  279
            S  P IAILG+GIFVKTQYIPRLAEIS L VLKAIWSR+EESAR AVE+AR HFP V+CK
Sbjct  5    SSPPGIAILGAGIFVKTQYIPRLAEISDLVVLKAIWSRTEESARGAVEIARKHFPEVKCK  64

Query  280  WGGAGLEEIIKDTSI  324
            WG  GL EII+D+SI
Sbjct  65   WGDEGLNEIIQDSSI  79



>ref|XP_007014900.1| Oxidoreductase, putative isoform 2 [Theobroma cacao]
 gb|EOY32519.1| Oxidoreductase, putative isoform 2 [Theobroma cacao]
Length=344

 Score =   108 bits (269),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 71/88 (81%), Gaps = 1/88 (1%)
 Frame = +2

Query  350  AKLRVEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLSTNMTQKPIWAVAENYRFE  529
             + +V+MSL+LLKGGKHV+QEKPAAA   E E AL  Y S+ +N  Q PIWAVAENYRFE
Sbjct  85   GQAQVDMSLKLLKGGKHVIQEKPAAASTTETETALSSYKSICSNPGQ-PIWAVAENYRFE  143

Query  530  PAFTECKKMIAEIGDMMNVXVIIEGSMN  613
            PAF E KK+IA+IGDMMNV +IIEGSMN
Sbjct  144  PAFVESKKLIADIGDMMNVQIIIEGSMN  171


 Score = 92.4 bits (228),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = +1

Query  109  PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGG  288
            PQIA+LG+GIFVKTQYIPRLAEIS L  LK IWSR++ESAR AVELA+ HFP VECKWG 
Sbjct  5    PQIAVLGAGIFVKTQYIPRLAEISHLLCLKYIWSRTQESARGAVELAKQHFPGVECKWGD  64

Query  289  AGLEEIIKDTSII  327
             GL +II+D SI+
Sbjct  65   QGLNDIIQDASIL  77



>gb|KDP20201.1| hypothetical protein JCGZ_07921 [Jatropha curcas]
Length=359

 Score =   108 bits (270),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 70/88 (80%), Gaps = 0/88 (0%)
 Frame = +2

Query  350  AKLRVEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLSTNMTQKPIWAVAENYRFE  529
             + +V++SL+LLK GKHVLQEKPAAA  +E E AL  Y S+  N   +PIWAVAENYRFE
Sbjct  85   GQAQVDISLKLLKAGKHVLQEKPAAASASEIETALSSYKSIYANSPGQPIWAVAENYRFE  144

Query  530  PAFTECKKMIAEIGDMMNVXVIIEGSMN  613
            PAF ECKK++AEIGDMM V VI+EGSMN
Sbjct  145  PAFVECKKLLAEIGDMMTVEVIVEGSMN  172


 Score = 92.0 bits (227),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 55/73 (75%), Positives = 64/73 (88%), Gaps = 0/73 (0%)
 Frame = +1

Query  109  PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGG  288
            P +AILG+GIFV+TQY+PRLAEIS LFVLKAIWSR+EESAR AVE+AR HFP VE KWG 
Sbjct  5    PHLAILGAGIFVRTQYLPRLAEISDLFVLKAIWSRTEESAREAVEIARKHFPGVEYKWGD  64

Query  289  AGLEEIIKDTSII  327
             GL+EII+D SI+
Sbjct  65   KGLDEIIQDESIL  77



>emb|CDY06381.1| BnaC05g31490D [Brassica napus]
Length=348

 Score =   103 bits (257),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 71/88 (81%), Gaps = 0/88 (0%)
 Frame = +2

Query  350  AKLRVEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLSTNMTQKPIWAVAENYRFE  529
             + +VEMSL++LK GKHVLQEKPAAA I E E A+  Y ++ST+   +PIWAVAENYRFE
Sbjct  87   GQTQVEMSLKMLKAGKHVLQEKPAAASIGEIETAMTSYKNISTDSPCRPIWAVAENYRFE  146

Query  530  PAFTECKKMIAEIGDMMNVXVIIEGSMN  613
            PAF E KK++ EIGD+MNV +IIEGSMN
Sbjct  147  PAFVELKKLVEEIGDIMNVQLIIEGSMN  174


 Score = 96.7 bits (239),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 60/79 (76%), Positives = 65/79 (82%), Gaps = 0/79 (0%)
 Frame = +1

Query  91   MAESQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNV  270
            MA    P IAILG+GIFVKTQYIPRLAEIS L  LKAIWSRSEESA+ AVE+AR HFP V
Sbjct  1    MANPSPPGIAILGAGIFVKTQYIPRLAEISDLVNLKAIWSRSEESAKGAVEVARKHFPGV  60

Query  271  ECKWGGAGLEEIIKDTSII  327
            ECKWG  GL EII+DTSI+
Sbjct  61   ECKWGDEGLNEIIQDTSIL  79



>gb|KJB66099.1| hypothetical protein B456_010G128200 [Gossypium raimondii]
Length=358

 Score =   104 bits (260),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 71/88 (81%), Gaps = 1/88 (1%)
 Frame = +2

Query  350  AKLRVEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLSTNMTQKPIWAVAENYRFE  529
             +++V++SL+LLK GKHV+QEKPAA  I E E AL  Y S+STN  Q PIWAVAENYRFE
Sbjct  85   GQVQVDISLKLLKAGKHVIQEKPAATSIPEIETALASYKSVSTNPGQ-PIWAVAENYRFE  143

Query  530  PAFTECKKMIAEIGDMMNVXVIIEGSMN  613
            PAF E KK++A +GDMMNV VIIEGSMN
Sbjct  144  PAFVESKKLVAGVGDMMNVQVIIEGSMN  171


 Score = 95.5 bits (236),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = +1

Query  100  SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECK  279
            + LPQIA+LG+GIFVKTQYIPRLAEIS LF LK IWSRSEES+R AVE+A+ HFP VECK
Sbjct  2    ATLPQIAVLGAGIFVKTQYIPRLAEISHLFCLKYIWSRSEESSRRAVEIAKQHFPGVECK  61

Query  280  WGGAGLEEIIKDTSII  327
            WG  GL +I++D+S+I
Sbjct  62   WGDQGLNDIMQDSSLI  77



>gb|KJB66097.1| hypothetical protein B456_010G128200 [Gossypium raimondii]
Length=357

 Score =   104 bits (260),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 71/88 (81%), Gaps = 1/88 (1%)
 Frame = +2

Query  350  AKLRVEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLSTNMTQKPIWAVAENYRFE  529
             +++V++SL+LLK GKHV+QEKPAA  I E E AL  Y S+STN  Q PIWAVAENYRFE
Sbjct  85   GQVQVDISLKLLKAGKHVIQEKPAATSIPEIETALASYKSVSTNPGQ-PIWAVAENYRFE  143

Query  530  PAFTECKKMIAEIGDMMNVXVIIEGSMN  613
            PAF E KK++A +GDMMNV VIIEGSMN
Sbjct  144  PAFVESKKLVAGVGDMMNVQVIIEGSMN  171


 Score = 95.5 bits (236),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = +1

Query  100  SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECK  279
            + LPQIA+LG+GIFVKTQYIPRLAEIS LF LK IWSRSEES+R AVE+A+ HFP VECK
Sbjct  2    ATLPQIAVLGAGIFVKTQYIPRLAEISHLFCLKYIWSRSEESSRRAVEIAKQHFPGVECK  61

Query  280  WGGAGLEEIIKDTSII  327
            WG  GL +I++D+S+I
Sbjct  62   WGDQGLNDIMQDSSLI  77



>gb|KJB66095.1| hypothetical protein B456_010G128200 [Gossypium raimondii]
Length=358

 Score =   104 bits (260),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 71/88 (81%), Gaps = 1/88 (1%)
 Frame = +2

Query  350  AKLRVEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLSTNMTQKPIWAVAENYRFE  529
             +++V++SL+LLK GKHV+QEKPAA  I E E AL  Y S+STN  Q PIWAVAENYRFE
Sbjct  85   GQVQVDISLKLLKAGKHVIQEKPAATSIPEIETALASYKSVSTNPGQ-PIWAVAENYRFE  143

Query  530  PAFTECKKMIAEIGDMMNVXVIIEGSMN  613
            PAF E KK++A +GDMMNV VIIEGSMN
Sbjct  144  PAFVESKKLVAGVGDMMNVQVIIEGSMN  171


 Score = 95.5 bits (236),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = +1

Query  100  SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECK  279
            + LPQIA+LG+GIFVKTQYIPRLAEIS LF LK IWSRSEES+R AVE+A+ HFP VECK
Sbjct  2    ATLPQIAVLGAGIFVKTQYIPRLAEISHLFCLKYIWSRSEESSRRAVEIAKQHFPGVECK  61

Query  280  WGGAGLEEIIKDTSII  327
            WG  GL +I++D+S+I
Sbjct  62   WGDQGLNDIMQDSSLI  77



>ref|XP_009145584.1| PREDICTED: uncharacterized protein YMR315W [Brassica rapa]
Length=355

 Score =   103 bits (258),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 71/88 (81%), Gaps = 0/88 (0%)
 Frame = +2

Query  350  AKLRVEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLSTNMTQKPIWAVAENYRFE  529
             + +VEMSL++LK GKHVLQEKPAAA I E E A+  Y ++ST+   +PIWAVAENYRFE
Sbjct  87   GQTQVEMSLKMLKVGKHVLQEKPAAASIGEIETAMTSYKNISTDSPCRPIWAVAENYRFE  146

Query  530  PAFTECKKMIAEIGDMMNVXVIIEGSMN  613
            PAF E KK++ EIGDMMNV +IIEGSMN
Sbjct  147  PAFVELKKLVEEIGDMMNVQLIIEGSMN  174


 Score = 96.3 bits (238),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 59/79 (75%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = +1

Query  91   MAESQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNV  270
            MA +  P IAILG+GIFVKTQYIPRLAEIS L  LKAIWSRSEESA+ AVE+AR HFP V
Sbjct  1    MANASPPGIAILGAGIFVKTQYIPRLAEISDLVNLKAIWSRSEESAKGAVEVARKHFPGV  60

Query  271  ECKWGGAGLEEIIKDTSII  327
            ECKWG  GL EII+D+SI+
Sbjct  61   ECKWGDEGLNEIIQDSSIL  79



>ref|XP_007014899.1| Oxidoreductase, putative isoform 1 [Theobroma cacao]
 gb|EOY32518.1| Oxidoreductase, putative isoform 1 [Theobroma cacao]
Length=358

 Score =   107 bits (268),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 71/88 (81%), Gaps = 1/88 (1%)
 Frame = +2

Query  350  AKLRVEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLSTNMTQKPIWAVAENYRFE  529
             + +V+MSL+LLKGGKHV+QEKPAAA   E E AL  Y S+ +N  Q PIWAVAENYRFE
Sbjct  85   GQAQVDMSLKLLKGGKHVIQEKPAAASTTETETALSSYKSICSNPGQ-PIWAVAENYRFE  143

Query  530  PAFTECKKMIAEIGDMMNVXVIIEGSMN  613
            PAF E KK+IA+IGDMMNV +IIEGSMN
Sbjct  144  PAFVESKKLIADIGDMMNVQIIIEGSMN  171


 Score = 92.0 bits (227),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = +1

Query  109  PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGG  288
            PQIA+LG+GIFVKTQYIPRLAEIS L  LK IWSR++ESAR AVELA+ HFP VECKWG 
Sbjct  5    PQIAVLGAGIFVKTQYIPRLAEISHLLCLKYIWSRTQESARGAVELAKQHFPGVECKWGD  64

Query  289  AGLEEIIKDTSII  327
             GL +II+D SI+
Sbjct  65   QGLNDIIQDASIL  77



>emb|CDY19604.1| BnaA05g20120D [Brassica napus]
Length=347

 Score =   103 bits (258),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 71/88 (81%), Gaps = 0/88 (0%)
 Frame = +2

Query  350  AKLRVEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLSTNMTQKPIWAVAENYRFE  529
             + +VEMSL++LK GKHVLQEKPAAA I E E A+  Y ++S++   +PIWAVAENYRFE
Sbjct  87   GQTQVEMSLKMLKAGKHVLQEKPAAASIGEIETAMTSYKNISSDSPCRPIWAVAENYRFE  146

Query  530  PAFTECKKMIAEIGDMMNVXVIIEGSMN  613
            PAF E KK++ EIGDMMNV +IIEGSMN
Sbjct  147  PAFVELKKLVEEIGDMMNVQLIIEGSMN  174


 Score = 96.3 bits (238),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 59/79 (75%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = +1

Query  91   MAESQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNV  270
            MA +  P IAILG+GIFVKTQYIPRLAEIS L  LKAIWSRSEESA+ AVE+AR HFP V
Sbjct  1    MANASPPGIAILGAGIFVKTQYIPRLAEISDLVNLKAIWSRSEESAKGAVEVARKHFPGV  60

Query  271  ECKWGGAGLEEIIKDTSII  327
            ECKWG  GL EII+D+SI+
Sbjct  61   ECKWGDEGLNEIIQDSSIL  79



>ref|XP_009364714.1| PREDICTED: uncharacterized protein LOC103954601 [Pyrus x bretschneideri]
 ref|XP_009364715.1| PREDICTED: uncharacterized protein LOC103954601 [Pyrus x bretschneideri]
Length=357

 Score =   102 bits (253),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 54/88 (61%), Positives = 68/88 (77%), Gaps = 0/88 (0%)
 Frame = +2

Query  350  AKLRVEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLSTNMTQKPIWAVAENYRFE  529
             + +V+ SLR+LKGGKHVLQEKPAAA  +E E AL  Y S+  N   KPIWAVAENYRFE
Sbjct  83   GQAQVDFSLRMLKGGKHVLQEKPAAASTSELETALSSYKSIVDNAPDKPIWAVAENYRFE  142

Query  530  PAFTECKKMIAEIGDMMNVXVIIEGSMN  613
            P F E +K++ E+GD+M++ VI+EGSMN
Sbjct  143  PTFVEGRKLMTEVGDVMSIQVIVEGSMN  170


 Score = 97.8 bits (242),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 59/73 (81%), Positives = 65/73 (89%), Gaps = 0/73 (0%)
 Frame = +1

Query  109  PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGG  288
            PQIAILG+G FVKTQYIPRL+EIS L VLKAIWSR+EESARSAVE+AR HFP VECKWG 
Sbjct  3    PQIAILGAGTFVKTQYIPRLSEISNLLVLKAIWSRTEESARSAVEIARKHFPGVECKWGD  62

Query  289  AGLEEIIKDTSII  327
             GLEEII D+SI+
Sbjct  63   KGLEEIIADSSIL  75



>ref|XP_011025252.1| PREDICTED: uncharacterized protein YMR315W isoform X2 [Populus 
euphratica]
Length=359

 Score =   102 bits (253),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 59/76 (78%), Positives = 69/76 (91%), Gaps = 0/76 (0%)
 Frame = +1

Query  100  SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECK  279
            +QLPQI++LG+GIFVKTQYIPRLAEIS LFVLK+IWSRSEESAR AVE+A+ HFP VECK
Sbjct  3    NQLPQISVLGAGIFVKTQYIPRLAEISHLFVLKSIWSRSEESAREAVEVAKEHFPGVECK  62

Query  280  WGGAGLEEIIKDTSII  327
            WG  GL+EII+D SI+
Sbjct  63   WGDKGLDEIIQDESIL  78


 Score = 96.7 bits (239),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 55/88 (63%), Positives = 68/88 (77%), Gaps = 0/88 (0%)
 Frame = +2

Query  350  AKLRVEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLSTNMTQKPIWAVAENYRFE  529
            A+ +V+MSL+LLK GKHVLQEKPAA+ I+E E +L  Y S+  N    PIWAVAENYRFE
Sbjct  86   AQYQVDMSLKLLKAGKHVLQEKPAASSISEIETSLSSYKSICANSPGYPIWAVAENYRFE  145

Query  530  PAFTECKKMIAEIGDMMNVXVIIEGSMN  613
            PA  E KK++A+IG MM+V +IIE SMN
Sbjct  146  PALVESKKLLADIGKMMSVQLIIEASMN  173



>ref|XP_011025251.1| PREDICTED: uncharacterized protein YMR315W isoform X1 [Populus 
euphratica]
Length=360

 Score =   102 bits (253),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 59/76 (78%), Positives = 69/76 (91%), Gaps = 0/76 (0%)
 Frame = +1

Query  100  SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECK  279
            +QLPQI++LG+GIFVKTQYIPRLAEIS LFVLK+IWSRSEESAR AVE+A+ HFP VECK
Sbjct  3    NQLPQISVLGAGIFVKTQYIPRLAEISHLFVLKSIWSRSEESAREAVEVAKEHFPGVECK  62

Query  280  WGGAGLEEIIKDTSII  327
            WG  GL+EII+D SI+
Sbjct  63   WGDKGLDEIIQDESIL  78


 Score = 96.7 bits (239),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 55/88 (63%), Positives = 68/88 (77%), Gaps = 0/88 (0%)
 Frame = +2

Query  350  AKLRVEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLSTNMTQKPIWAVAENYRFE  529
            A+ +V+MSL+LLK GKHVLQEKPAA+ I+E E +L  Y S+  N    PIWAVAENYRFE
Sbjct  86   AQYQVDMSLKLLKAGKHVLQEKPAASSISEIETSLSSYKSICANSPGYPIWAVAENYRFE  145

Query  530  PAFTECKKMIAEIGDMMNVXVIIEGSMN  613
            PA  E KK++A+IG MM+V +IIE SMN
Sbjct  146  PALVESKKLLADIGKMMSVQLIIEASMN  173



>ref|XP_006386094.1| hypothetical protein POPTR_0003s22050g [Populus trichocarpa]
 gb|ERP63891.1| hypothetical protein POPTR_0003s22050g [Populus trichocarpa]
Length=359

 Score =   102 bits (253),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 59/76 (78%), Positives = 69/76 (91%), Gaps = 0/76 (0%)
 Frame = +1

Query  100  SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECK  279
            +QLPQI++LG+GIFVKTQYIPRLAEIS LFVLK+IWSRSEESAR AVE+A+ HFP VECK
Sbjct  3    NQLPQISVLGAGIFVKTQYIPRLAEISHLFVLKSIWSRSEESAREAVEVAKEHFPGVECK  62

Query  280  WGGAGLEEIIKDTSII  327
            WG  GL+EII+D SI+
Sbjct  63   WGDKGLDEIIQDESIL  78


 Score = 96.7 bits (239),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 55/88 (63%), Positives = 68/88 (77%), Gaps = 0/88 (0%)
 Frame = +2

Query  350  AKLRVEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLSTNMTQKPIWAVAENYRFE  529
            A+ +V+MSL+LLK GKHVLQEKPAA+ I+E E +L  Y S+  N    PIWAVAENYRFE
Sbjct  86   AQYQVDMSLKLLKAGKHVLQEKPAASSISEIETSLSSYKSICANSPGYPIWAVAENYRFE  145

Query  530  PAFTECKKMIAEIGDMMNVXVIIEGSMN  613
            PA  E KK++A+IG MM+V +IIE SMN
Sbjct  146  PALVESKKLLADIGKMMSVQLIIEASMN  173



>ref|XP_006386095.1| hypothetical protein POPTR_0003s22050g [Populus trichocarpa]
 gb|ERP63892.1| hypothetical protein POPTR_0003s22050g [Populus trichocarpa]
Length=360

 Score =   102 bits (253),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 59/76 (78%), Positives = 69/76 (91%), Gaps = 0/76 (0%)
 Frame = +1

Query  100  SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECK  279
            +QLPQI++LG+GIFVKTQYIPRLAEIS LFVLK+IWSRSEESAR AVE+A+ HFP VECK
Sbjct  3    NQLPQISVLGAGIFVKTQYIPRLAEISHLFVLKSIWSRSEESAREAVEVAKEHFPGVECK  62

Query  280  WGGAGLEEIIKDTSII  327
            WG  GL+EII+D SI+
Sbjct  63   WGDKGLDEIIQDESIL  78


 Score = 96.7 bits (239),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 55/88 (63%), Positives = 68/88 (77%), Gaps = 0/88 (0%)
 Frame = +2

Query  350  AKLRVEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLSTNMTQKPIWAVAENYRFE  529
            A+ +V+MSL+LLK GKHVLQEKPAA+ I+E E +L  Y S+  N    PIWAVAENYRFE
Sbjct  86   AQYQVDMSLKLLKAGKHVLQEKPAASSISEIETSLSSYKSICANSPGYPIWAVAENYRFE  145

Query  530  PAFTECKKMIAEIGDMMNVXVIIEGSMN  613
            PA  E KK++A+IG MM+V +IIE SMN
Sbjct  146  PALVESKKLLADIGKMMSVQLIIEASMN  173



>gb|ABK96297.1| unknown [Populus trichocarpa x Populus deltoides]
Length=363

 Score =   102 bits (253),  Expect(2) = 5e-42, Method: Compositional matrix adjust.
 Identities = 59/76 (78%), Positives = 69/76 (91%), Gaps = 0/76 (0%)
 Frame = +1

Query  100  SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECK  279
            +QLPQI++LG+GIFVKTQYIPRLAEIS LFVLK+IWSRSEESAR AVE+A+ HFP VECK
Sbjct  3    NQLPQISVLGAGIFVKTQYIPRLAEISHLFVLKSIWSRSEESAREAVEVAKEHFPGVECK  62

Query  280  WGGAGLEEIIKDTSII  327
            WG  GL+EII+D SI+
Sbjct  63   WGDKGLDEIIQDESIL  78


 Score = 96.7 bits (239),  Expect(2) = 5e-42, Method: Compositional matrix adjust.
 Identities = 55/88 (63%), Positives = 68/88 (77%), Gaps = 0/88 (0%)
 Frame = +2

Query  350  AKLRVEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLSTNMTQKPIWAVAENYRFE  529
            A+ +V+MSL+LLK GKHVLQEKPAA+ I+E E +L  Y S+  N    PIWAVAENYRFE
Sbjct  86   AQYQVDMSLKLLKAGKHVLQEKPAASSISEIETSLSSYKSICANSPGYPIWAVAENYRFE  145

Query  530  PAFTECKKMIAEIGDMMNVXVIIEGSMN  613
            PA  E KK++A+IG MM+V +IIE SMN
Sbjct  146  PALVESKKLLADIGKMMSVQLIIEASMN  173



>ref|XP_006298014.1| hypothetical protein CARUB_v10014059mg [Capsella rubella]
 gb|EOA30912.1| hypothetical protein CARUB_v10014059mg [Capsella rubella]
Length=355

 Score =   105 bits (262),  Expect(2) = 6e-42, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = +2

Query  362  VEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLSTNMTQKPIWAVAENYRFEPAFT  541
            VEMSL++LK GKHVLQEKPAAA I+E E A++ Y  +S +   +PIWAVAENYRFEPAF 
Sbjct  90   VEMSLKMLKAGKHVLQEKPAAASISEIEAAMLSYRIISADTPCRPIWAVAENYRFEPAFV  149

Query  542  ECKKMIAEIGDMMNVXVIIEGSMN  613
            E KK+IAEIGDMMNV +IIEGSMN
Sbjct  150  ELKKLIAEIGDMMNVQLIIEGSMN  173


 Score = 92.4 bits (228),  Expect(2) = 6e-42, Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 64/72 (89%), Gaps = 0/72 (0%)
 Frame = +1

Query  109  PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGG  288
            P IAILG+GIFVKTQYIPRLAEIS L VLKAIWSR+EESA+ AVE+AR HFP+V+CKWG 
Sbjct  6    PGIAILGAGIFVKTQYIPRLAEISDLVVLKAIWSRTEESAKGAVEIARKHFPDVKCKWGD  65

Query  289  AGLEEIIKDTSI  324
             GL EI++D+SI
Sbjct  66   EGLNEIMEDSSI  77



>ref|XP_010488066.1| PREDICTED: glucose-fructose oxidoreductase domain-containing 
protein 1-like [Camelina sativa]
Length=355

 Score =   102 bits (255),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = +2

Query  362  VEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLSTNMTQKPIWAVAENYRFEPAFT  541
            VEMSL++LK GKHVLQEKPAAA I+E E A+  Y ++S +   +PIWAVAENYRFEPAF 
Sbjct  91   VEMSLKMLKAGKHVLQEKPAAASISEIETAMSSYRNISADSPCRPIWAVAENYRFEPAFV  150

Query  542  ECKKMIAEIGDMMNVXVIIEGSMN  613
            E KK++ EIGDMMNV +IIEGSMN
Sbjct  151  ELKKLVVEIGDMMNVQLIIEGSMN  174


 Score = 94.7 bits (234),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 57/78 (73%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = +1

Query  91   MAESQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNV  270
            M     P IAILG+GIFVKTQYIPRLAEIS L VLKAIWSR+EESA+ AVE+AR HFP+V
Sbjct  1    MVNPSSPGIAILGAGIFVKTQYIPRLAEISDLLVLKAIWSRTEESAKGAVEIARKHFPDV  60

Query  271  ECKWGGAGLEEIIKDTSI  324
            +CKWG  GL EII D+SI
Sbjct  61   KCKWGDEGLNEIIADSSI  78



>ref|XP_006406349.1| hypothetical protein EUTSA_v10021019mg [Eutrema salsugineum]
 gb|ESQ47802.1| hypothetical protein EUTSA_v10021019mg [Eutrema salsugineum]
Length=356

 Score =   102 bits (255),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = +2

Query  359  RVEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLSTNMTQKPIWAVAENYRFEPAF  538
            +VEMSL++LK GKHVLQEKPAAA I+E E A+  Y ++  +   +PIWAVAENYRFEPAF
Sbjct  90   QVEMSLKMLKAGKHVLQEKPAAASISEIETAISSYRNIPADSPSRPIWAVAENYRFEPAF  149

Query  539  TECKKMIAEIGDMMNVXVIIEGSMN  613
             E KK++AE GDMMNV +IIEGSMN
Sbjct  150  VELKKLVAETGDMMNVQLIIEGSMN  174


 Score = 94.4 bits (233),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 57/78 (73%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = +1

Query  91   MAESQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNV  270
            M     P IAILG+GIFVKTQYIPRLAEIS L VLKAIWSR+EESA+ AVE+AR HFP V
Sbjct  1    MTNPSPPAIAILGAGIFVKTQYIPRLAEISDLVVLKAIWSRTEESAKGAVEVARKHFPEV  60

Query  271  ECKWGGAGLEEIIKDTSI  324
            +CKWG  GL EII+D+SI
Sbjct  61   KCKWGDEGLNEIIQDSSI  78



>ref|XP_010091995.1| Uncharacterized protein L484_007981 [Morus notabilis]
 gb|EXB48401.1| Uncharacterized protein L484_007981 [Morus notabilis]
Length=352

 Score =   109 bits (273),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 62/88 (70%), Gaps = 6/88 (7%)
 Frame = +2

Query  350  AKLRVEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLSTNMTQKPIWAVAENYRFE  529
             + +V+ SLRLLK GKHVLQ              L  YNS+S N+  KPIWAVAENYRFE
Sbjct  85   GQAQVDFSLRLLKAGKHVLQATSELEAA------LAGYNSISVNVPSKPIWAVAENYRFE  138

Query  530  PAFTECKKMIAEIGDMMNVXVIIEGSMN  613
            PAF E KK++AE+GDMM+V VIIEGSMN
Sbjct  139  PAFVESKKLVAEVGDMMSVQVIIEGSMN  166


 Score = 87.4 bits (215),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = +1

Query  100  SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECK  279
            ++ PQIAI+G+GIFV+TQYIPRL+EIS L  LKAIWSRSEESAR AVE+A+  FP VECK
Sbjct  2    AKAPQIAIVGAGIFVRTQYIPRLSEISDLVSLKAIWSRSEESARGAVEIAQKFFPGVECK  61

Query  280  WGGAGLEEIIKDTSII  327
            WG  G +EI++D SI+
Sbjct  62   WGDKGFDEIVQDNSIL  77



>ref|XP_008358862.1| PREDICTED: uncharacterized protein YMR315W-like isoform X1 [Malus 
domestica]
 ref|XP_008358863.1| PREDICTED: uncharacterized protein YMR315W-like isoform X1 [Malus 
domestica]
Length=357

 Score =   101 bits (251),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 54/88 (61%), Positives = 68/88 (77%), Gaps = 0/88 (0%)
 Frame = +2

Query  350  AKLRVEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLSTNMTQKPIWAVAENYRFE  529
             + +V+ SLR+LK GKHVLQEKPAAA  +E E AL  Y S+  N   KPIWAVAENYRFE
Sbjct  83   GQAQVDFSLRMLKAGKHVLQEKPAAASTSELETALSSYKSIVDNAPDKPIWAVAENYRFE  142

Query  530  PAFTECKKMIAEIGDMMNVXVIIEGSMN  613
            PAF E +K++ E+GD+M++ VI+EGSMN
Sbjct  143  PAFVEGRKLMTEVGDVMSIQVIVEGSMN  170


 Score = 95.9 bits (237),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 58/73 (79%), Positives = 64/73 (88%), Gaps = 0/73 (0%)
 Frame = +1

Query  109  PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGG  288
            P IAILG+G FVKTQYIPRL+EIS L VLKAIWSR+EESARSAVE+AR HFP VECKWG 
Sbjct  3    PHIAILGAGTFVKTQYIPRLSEISNLLVLKAIWSRTEESARSAVEIARKHFPGVECKWGD  62

Query  289  AGLEEIIKDTSII  327
             GLEEII D+SI+
Sbjct  63   KGLEEIIADSSIL  75



>ref|XP_008243595.1| PREDICTED: uncharacterized protein YMR315W [Prunus mume]
Length=360

 Score =   102 bits (255),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 56/88 (64%), Positives = 69/88 (78%), Gaps = 0/88 (0%)
 Frame = +2

Query  350  AKLRVEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLSTNMTQKPIWAVAENYRFE  529
             + +V+ SLRLLK GKHVLQEKPAAA  +E E AL  Y S+  N+  KPIWAVAENYRFE
Sbjct  85   GQAQVDFSLRLLKAGKHVLQEKPAAASTSELETALSSYRSIFANIPDKPIWAVAENYRFE  144

Query  530  PAFTECKKMIAEIGDMMNVXVIIEGSMN  613
            PAF E KK++ +IGD+M++ VI+EGSMN
Sbjct  145  PAFVEGKKLVNDIGDVMSIQVIVEGSMN  172


 Score = 94.4 bits (233),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 53/75 (71%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = +1

Query  103  QLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKW  282
            ++PQIAILG+G F++TQYIPRLAEIS+L +LK+IWSR+EESAR AVE+A+ HFP VECKW
Sbjct  3    EVPQIAILGAGTFMRTQYIPRLAEISKLLLLKSIWSRTEESARGAVEIAQEHFPGVECKW  62

Query  283  GGAGLEEIIKDTSII  327
            G  GL+EII+D+SI+
Sbjct  63   GDKGLQEIIEDSSIL  77



>ref|XP_010544235.1| PREDICTED: uncharacterized protein YMR315W isoform X1 [Tarenaya 
hassleriana]
Length=356

 Score = 99.4 bits (246),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 56/88 (64%), Positives = 69/88 (78%), Gaps = 0/88 (0%)
 Frame = +2

Query  350  AKLRVEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLSTNMTQKPIWAVAENYRFE  529
             +++VEMSL++LK GKHVLQEKPAAA I+E E A+  Y ++ST      IWAVAENYRFE
Sbjct  86   GQIQVEMSLKMLKAGKHVLQEKPAAASISEIETAISSYKNISTGSPSPSIWAVAENYRFE  145

Query  530  PAFTECKKMIAEIGDMMNVXVIIEGSMN  613
            PAF E KK++ EIG MMNV +I+EGSMN
Sbjct  146  PAFVELKKLVGEIGTMMNVQLIVEGSMN  173


 Score = 97.1 bits (240),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 55/73 (75%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = +1

Query  109  PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGG  288
            P +AILG+GIFV+TQYIPRLAEIS LFVL+AIWSR+EESA+ AVE+AR HFP+VECKWG 
Sbjct  6    PGLAILGAGIFVRTQYIPRLAEISDLFVLRAIWSRTEESAKGAVEIARKHFPDVECKWGE  65

Query  289  AGLEEIIKDTSII  327
             GL+EII+D SI+
Sbjct  66   EGLDEIIRDNSIV  78



>ref|XP_010544236.1| PREDICTED: uncharacterized protein YMR315W isoform X2 [Tarenaya 
hassleriana]
Length=355

 Score = 99.4 bits (246),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 56/88 (64%), Positives = 69/88 (78%), Gaps = 0/88 (0%)
 Frame = +2

Query  350  AKLRVEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLSTNMTQKPIWAVAENYRFE  529
             +++VEMSL++LK GKHVLQEKPAAA I+E E A+  Y ++ST      IWAVAENYRFE
Sbjct  86   GQIQVEMSLKMLKAGKHVLQEKPAAASISEIETAISSYKNISTGSPSPSIWAVAENYRFE  145

Query  530  PAFTECKKMIAEIGDMMNVXVIIEGSMN  613
            PAF E KK++ EIG MMNV +I+EGSMN
Sbjct  146  PAFVELKKLVGEIGTMMNVQLIVEGSMN  173


 Score = 97.1 bits (240),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 55/73 (75%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = +1

Query  109  PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGG  288
            P +AILG+GIFV+TQYIPRLAEIS LFVL+AIWSR+EESA+ AVE+AR HFP+VECKWG 
Sbjct  6    PGLAILGAGIFVRTQYIPRLAEISDLFVLRAIWSRTEESAKGAVEIARKHFPDVECKWGE  65

Query  289  AGLEEIIKDTSII  327
             GL+EII+D SI+
Sbjct  66   EGLDEIIRDNSIV  78



>ref|XP_002883268.1| oxidoreductase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59527.1| oxidoreductase family protein [Arabidopsis lyrata subsp. lyrata]
Length=360

 Score =   103 bits (256),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = +2

Query  362  VEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLSTNMTQKPIWAVAENYRFEPAFT  541
            VEMSL++LK GKHVLQEKPAAA I+E E A+  Y ++S +   +PIWAVAENYRFEPAF 
Sbjct  90   VEMSLKMLKAGKHVLQEKPAAASISEIETAMSSYRNISADSPCRPIWAVAENYRFEPAFV  149

Query  542  ECKKMIAEIGDMMNVXVIIEGSMN  613
            E KK+IAE GDMMNV +IIEGSMN
Sbjct  150  ELKKLIAETGDMMNVQLIIEGSMN  173


 Score = 92.8 bits (229),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 56/72 (78%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = +1

Query  109  PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGG  288
            P IAILG+GIFVKTQYIPRLAEIS L VLKAIWSR+EESA+ AVE+AR HFP V+CKWG 
Sbjct  6    PGIAILGAGIFVKTQYIPRLAEISDLVVLKAIWSRTEESAKGAVEIARKHFPEVKCKWGD  65

Query  289  AGLEEIIKDTSI  324
             GL EII+D+SI
Sbjct  66   DGLNEIIQDSSI  77



>ref|XP_007205433.1| hypothetical protein PRUPE_ppa007778mg [Prunus persica]
 gb|EMJ06632.1| hypothetical protein PRUPE_ppa007778mg [Prunus persica]
Length=356

 Score =   102 bits (253),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 55/88 (63%), Positives = 69/88 (78%), Gaps = 0/88 (0%)
 Frame = +2

Query  350  AKLRVEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLSTNMTQKPIWAVAENYRFE  529
             + +V+ SLRLLK GKHVLQEKPAAA  +E E AL  Y S+  N+  KPIWAVAENYRFE
Sbjct  85   GQAQVDFSLRLLKAGKHVLQEKPAAASTSELETALSSYRSIFANIPDKPIWAVAENYRFE  144

Query  530  PAFTECKKMIAEIGDMMNVXVIIEGSMN  613
            PAF E KK++ +IGD+M++ V++EGSMN
Sbjct  145  PAFVEGKKLVNDIGDVMSIQVLVEGSMN  172


 Score = 93.6 bits (231),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 53/75 (71%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = +1

Query  103  QLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKW  282
            + PQIAILG+G F++TQYIPRLAEIS+L +LK+IWSR+EESAR AVE+A+ HFP VECKW
Sbjct  3    EAPQIAILGAGTFMRTQYIPRLAEISKLLLLKSIWSRTEESARGAVEIAQKHFPGVECKW  62

Query  283  GGAGLEEIIKDTSII  327
            G  GL+EII+D+SI+
Sbjct  63   GDKGLQEIIEDSSIL  77



>ref|XP_010509356.1| PREDICTED: glucose-fructose oxidoreductase domain-containing 
protein 1-like [Camelina sativa]
Length=354

 Score =   101 bits (252),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = +2

Query  362  VEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLSTNMTQKPIWAVAENYRFEPAFT  541
            VEMSL++LK GKHVLQEKPAAA I+E E A+  Y  +S +   +PIWAVAENYRFEPAF 
Sbjct  90   VEMSLKMLKAGKHVLQEKPAAASISEIETAMSSYREISADSPCRPIWAVAENYRFEPAFV  149

Query  542  ECKKMIAEIGDMMNVXVIIEGSMN  613
            E KK++ EIGDMMNV +IIEGSMN
Sbjct  150  ELKKLMVEIGDMMNVQLIIEGSMN  173


 Score = 94.4 bits (233),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 56/72 (78%), Positives = 64/72 (89%), Gaps = 0/72 (0%)
 Frame = +1

Query  109  PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGG  288
            P IAILG+GIFVKTQYIPRLAEIS L VLKAIWSR+EESA+ AVE+AR HFP+V+CKWG 
Sbjct  6    PGIAILGAGIFVKTQYIPRLAEISDLLVLKAIWSRTEESAKGAVEIARKHFPDVKCKWGD  65

Query  289  AGLEEIIKDTSI  324
             GL EII+D+SI
Sbjct  66   EGLNEIIEDSSI  77



>gb|KJB66096.1| hypothetical protein B456_010G128200 [Gossypium raimondii]
Length=352

 Score = 99.8 bits (247),  Expect(2) = 5e-41, Method: Compositional matrix adjust.
 Identities = 52/88 (59%), Positives = 63/88 (72%), Gaps = 7/88 (8%)
 Frame = +2

Query  350  AKLRVEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLSTNMTQKPIWAVAENYRFE  529
             +++V++SL+LLK GKHV+Q  P           L  Y S+STN  Q PIWAVAENYRFE
Sbjct  85   GQVQVDISLKLLKAGKHVIQGIPEIETA------LASYKSVSTNPGQ-PIWAVAENYRFE  137

Query  530  PAFTECKKMIAEIGDMMNVXVIIEGSMN  613
            PAF E KK++A +GDMMNV VIIEGSMN
Sbjct  138  PAFVESKKLVAGVGDMMNVQVIIEGSMN  165


 Score = 95.5 bits (236),  Expect(2) = 5e-41, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = +1

Query  100  SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECK  279
            + LPQIA+LG+GIFVKTQYIPRLAEIS LF LK IWSRSEES+R AVE+A+ HFP VECK
Sbjct  2    ATLPQIAVLGAGIFVKTQYIPRLAEISHLFCLKYIWSRSEESSRRAVEIAKQHFPGVECK  61

Query  280  WGGAGLEEIIKDTSII  327
            WG  GL +I++D+S+I
Sbjct  62   WGDQGLNDIMQDSSLI  77



>ref|NP_188715.2| NAD(P)-binding Rossmann-fold superfamily protein [Arabidopsis 
thaliana]
 gb|AAM12966.1| unknown protein [Arabidopsis thaliana]
 gb|AAN15398.1| unknown protein [Arabidopsis thaliana]
 gb|AEE76423.1| NAD(P)-binding Rossmann-fold superfamily protein [Arabidopsis 
thaliana]
Length=355

 Score =   103 bits (258),  Expect(2) = 5e-41, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = +2

Query  362  VEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLSTNMTQKPIWAVAENYRFEPAFT  541
            VE+SL++LK GKHVLQEKPAAA I+E E A+  Y ++S +   +PIWAVAENYRFEPAF 
Sbjct  91   VELSLKMLKAGKHVLQEKPAAASISEIETAMSSYRNISADSPCRPIWAVAENYRFEPAFV  150

Query  542  ECKKMIAEIGDMMNVXVIIEGSMN  613
            E KK+IAEIGDMMNV +IIEGSMN
Sbjct  151  ELKKLIAEIGDMMNVQLIIEGSMN  174


 Score = 91.3 bits (225),  Expect(2) = 5e-41, Method: Compositional matrix adjust.
 Identities = 56/78 (72%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = +1

Query  91   MAESQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNV  270
            M     P IAILG+GIFVKTQYIPRLAEIS L  LKAIWSR+EESA+ AVE+AR HFP V
Sbjct  1    MVNPSSPGIAILGAGIFVKTQYIPRLAEISDLVDLKAIWSRTEESAKGAVEIARKHFPEV  60

Query  271  ECKWGGAGLEEIIKDTSI  324
            +CKWG  GL EII+D+SI
Sbjct  61   KCKWGDEGLNEIIQDSSI  78



>gb|ACU17312.1| unknown [Glycine max]
Length=225

 Score = 97.4 bits (241),  Expect(2) = 5e-41, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = +1

Query  91   MAESQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNV  270
            MA  QLPQIAILG+GIFVKTQY+PRL+EIS LF+LK+IWSR++ESA +AV++AR HFP V
Sbjct  1    MATKQLPQIAILGAGIFVKTQYLPRLSEISHLFILKSIWSRTQESATAAVDIARKHFPQV  60

Query  271  ECKWGGAGLEEIIKDTSI  324
            E KWG  G ++II D SI
Sbjct  61   ETKWGDNGFDDIIHDGSI  78


 Score = 97.4 bits (241),  Expect(2) = 5e-41, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 68/85 (80%), Gaps = 0/85 (0%)
 Frame = +2

Query  359  RVEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLSTNMTQKPIWAVAENYRFEPAF  538
            +V++SLRLLK GKHVLQEKPAA+C +E E AL  Y S+S++   + IW+VAENYRFEP  
Sbjct  90   QVDISLRLLKAGKHVLQEKPAASCTSELEAALSSYKSISSDAPGQLIWSVAENYRFEPGL  149

Query  539  TECKKMIAEIGDMMNVXVIIEGSMN  613
             ECKK+IA IG MM+V VIIEGSMN
Sbjct  150  VECKKLIAGIGKMMSVQVIIEGSMN  174



>dbj|BAB02487.1| unnamed protein product [Arabidopsis thaliana]
Length=316

 Score =   103 bits (258),  Expect(2) = 6e-41, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = +2

Query  362  VEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLSTNMTQKPIWAVAENYRFEPAFT  541
            VE+SL++LK GKHVLQEKPAAA I+E E A+  Y ++S +   +PIWAVAENYRFEPAF 
Sbjct  91   VELSLKMLKAGKHVLQEKPAAASISEIETAMSSYRNISADSPCRPIWAVAENYRFEPAFV  150

Query  542  ECKKMIAEIGDMMNVXVIIEGSMN  613
            E KK+IAEIGDMMNV +IIEGSMN
Sbjct  151  ELKKLIAEIGDMMNVQLIIEGSMN  174


 Score = 90.9 bits (224),  Expect(2) = 6e-41, Method: Compositional matrix adjust.
 Identities = 56/78 (72%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = +1

Query  91   MAESQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNV  270
            M     P IAILG+GIFVKTQYIPRLAEIS L  LKAIWSR+EESA+ AVE+AR HFP V
Sbjct  1    MVNPSSPGIAILGAGIFVKTQYIPRLAEISDLVDLKAIWSRTEESAKGAVEIARKHFPEV  60

Query  271  ECKWGGAGLEEIIKDTSI  324
            +CKWG  GL EII+D+SI
Sbjct  61   KCKWGDEGLNEIIQDSSI  78



>ref|XP_003543553.1| PREDICTED: uncharacterized protein YMR315W [Glycine max]
 gb|KHN30111.1| Hypothetical protein glysoja_010489 [Glycine soja]
Length=360

 Score = 97.4 bits (241),  Expect(2) = 6e-41, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = +1

Query  91   MAESQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNV  270
            MA  QLPQIAILG+GIFVKTQY+PRL+EIS LF+LK+IWSR++ESA +AV++AR HFP V
Sbjct  1    MATKQLPQIAILGAGIFVKTQYLPRLSEISHLFILKSIWSRTQESATAAVDIARKHFPQV  60

Query  271  ECKWGGAGLEEIIKDTSI  324
            E KWG  G ++II D SI
Sbjct  61   ETKWGDNGFDDIIHDGSI  78


 Score = 97.4 bits (241),  Expect(2) = 6e-41, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 68/85 (80%), Gaps = 0/85 (0%)
 Frame = +2

Query  359  RVEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLSTNMTQKPIWAVAENYRFEPAF  538
            +V++SLRLLK GKHVLQEKPAA+C +E E AL  Y S+S++   + IW+VAENYRFEP  
Sbjct  90   QVDISLRLLKAGKHVLQEKPAASCTSELEAALSSYKSISSDAPGQLIWSVAENYRFEPGL  149

Query  539  TECKKMIAEIGDMMNVXVIIEGSMN  613
             ECKK+IA IG MM+V VIIEGSMN
Sbjct  150  VECKKLIAGIGKMMSVQVIIEGSMN  174



>ref|XP_006494722.1| PREDICTED: uncharacterized protein YMR315W-like [Citrus sinensis]
 gb|KDO64912.1| hypothetical protein CISIN_1g018445mg [Citrus sinensis]
Length=355

 Score =   108 bits (269),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 73/88 (83%), Gaps = 0/88 (0%)
 Frame = +2

Query  350  AKLRVEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLSTNMTQKPIWAVAENYRFE  529
             + +V+ SL+LLK GKHV+QEKPAAA I+E ENAL  YNS+  +   +PIWAVAENYRFE
Sbjct  83   GQAQVDTSLKLLKAGKHVIQEKPAAANISEIENALSRYNSICPDPPGQPIWAVAENYRFE  142

Query  530  PAFTECKKMIAEIGDMMNVXVIIEGSMN  613
            PAF ECKK+IAEIGDMM+V VI+EGSMN
Sbjct  143  PAFVECKKLIAEIGDMMSVQVIVEGSMN  170


 Score = 85.5 bits (210),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = +1

Query  109  PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGG  288
            P+IAILG+GIFVKTQYIPRLAEIS L  LK IWSRSEESA+SA E+AR HF +VEC WG 
Sbjct  3    PRIAILGAGIFVKTQYIPRLAEISDLVSLKFIWSRSEESAKSAAEVARKHFADVECVWGD  62

Query  289  AGLEEIIKDTSII  327
             GLE+IIK+ SI+
Sbjct  63   NGLEQIIKEDSIL  75



>gb|KJB66098.1| hypothetical protein B456_010G128200 [Gossypium raimondii]
Length=356

 Score = 98.2 bits (243),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 70/88 (80%), Gaps = 3/88 (3%)
 Frame = +2

Query  350  AKLRVEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLSTNMTQKPIWAVAENYRFE  529
             +++V++SL+LLK GKHV+QEKPAA  I E E AL  Y S+STN  Q PIWAVAENYRFE
Sbjct  85   GQVQVDISLKLLKAGKHVIQEKPAATSIPEIETALASYKSVSTNPGQ-PIWAVAENYRFE  143

Query  530  PAFTECKKMIAEIGDMMNVXVIIEGSMN  613
            PAF E  K++A +GDMMNV VIIEGSMN
Sbjct  144  PAFVE--KLVAGVGDMMNVQVIIEGSMN  169


 Score = 95.5 bits (236),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = +1

Query  100  SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECK  279
            + LPQIA+LG+GIFVKTQYIPRLAEIS LF LK IWSRSEES+R AVE+A+ HFP VECK
Sbjct  2    ATLPQIAVLGAGIFVKTQYIPRLAEISHLFCLKYIWSRSEESSRRAVEIAKQHFPGVECK  61

Query  280  WGGAGLEEIIKDTSII  327
            WG  GL +I++D+S+I
Sbjct  62   WGDQGLNDIMQDSSLI  77



>ref|XP_011080243.1| PREDICTED: uncharacterized protein LOC105163544 [Sesamum indicum]
 ref|XP_011080244.1| PREDICTED: uncharacterized protein LOC105163544 [Sesamum indicum]
 ref|XP_011080245.1| PREDICTED: uncharacterized protein LOC105163544 [Sesamum indicum]
Length=356

 Score = 98.6 bits (244),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 67/88 (76%), Gaps = 4/88 (5%)
 Frame = +2

Query  350  AKLRVEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLSTNMTQKPIWAVAENYRFE  529
             + +V+MSLRLLK GKHVLQEKPAAA   E   A+  Y+SL       PIWAVAENYRFE
Sbjct  86   GQAQVDMSLRLLKSGKHVLQEKPAAASGTELNAAISSYSSLQP----APIWAVAENYRFE  141

Query  530  PAFTECKKMIAEIGDMMNVXVIIEGSMN  613
            PAF E KK++AEIGD++N+ VIIEGSMN
Sbjct  142  PAFVEGKKLMAEIGDVINIHVIIEGSMN  169


 Score = 94.7 bits (234),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 58/77 (75%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = +1

Query  97   ESQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVEC  276
            E   PQIAI+G+GIFV+  YIPRLAEIS L VL+AIWSRSEESAR AVE A+  FPNVEC
Sbjct  2    EQTPPQIAIIGAGIFVRNTYIPRLAEISNLLVLRAIWSRSEESARGAVETAKKFFPNVEC  61

Query  277  KWGGAGLEEIIKDTSII  327
            KWG AGLEEII+D SII
Sbjct  62   KWGEAGLEEIIQDASII  78



>ref|XP_011090402.1| PREDICTED: uncharacterized protein YMR315W-like [Sesamum indicum]
Length=358

 Score = 97.8 bits (242),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 50/88 (57%), Positives = 71/88 (81%), Gaps = 0/88 (0%)
 Frame = +2

Query  350  AKLRVEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLSTNMTQKPIWAVAENYRFE  529
            A+ +V++SL+LL+ GKHVLQEKPAA+ I E + AL  YNSLST++ ++PIWA+AENYRFE
Sbjct  84   AQFQVDLSLKLLRSGKHVLQEKPAASSINEVKTALSSYNSLSTSLPRQPIWAIAENYRFE  143

Query  530  PAFTECKKMIAEIGDMMNVXVIIEGSMN  613
            PA  E KK++ +IGD++N  +++E  MN
Sbjct  144  PAILEGKKLMPDIGDLVNFQILVEAPMN  171


 Score = 94.7 bits (234),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 55/73 (75%), Positives = 64/73 (88%), Gaps = 0/73 (0%)
 Frame = +1

Query  109  PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGG  288
            PQIAILG+GIFVKT+YIPRL+EI  LFVLKAIWSR+EESAR AV++A+  FP VECKWG 
Sbjct  4    PQIAILGAGIFVKTEYIPRLSEIPDLFVLKAIWSRTEESARGAVDIAKKFFPRVECKWGD  63

Query  289  AGLEEIIKDTSII  327
            AGL EII+D SI+
Sbjct  64   AGLNEIIQDASIV  76



>ref|XP_008358864.1| PREDICTED: uncharacterized protein YMR315W-like isoform X2 [Malus 
domestica]
Length=351

 Score = 96.3 bits (238),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 45/88 (51%), Positives = 58/88 (66%), Gaps = 6/88 (7%)
 Frame = +2

Query  350  AKLRVEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLSTNMTQKPIWAVAENYRFE  529
             + +V+ SLR+LK GKHVLQ              L  Y S+  N   KPIWAVAENYRFE
Sbjct  83   GQAQVDFSLRMLKAGKHVLQATSELETA------LSSYKSIVDNAPDKPIWAVAENYRFE  136

Query  530  PAFTECKKMIAEIGDMMNVXVIIEGSMN  613
            PAF E +K++ E+GD+M++ VI+EGSMN
Sbjct  137  PAFVEGRKLMTEVGDVMSIQVIVEGSMN  164


 Score = 95.9 bits (237),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 58/73 (79%), Positives = 64/73 (88%), Gaps = 0/73 (0%)
 Frame = +1

Query  109  PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGG  288
            P IAILG+G FVKTQYIPRL+EIS L VLKAIWSR+EESARSAVE+AR HFP VECKWG 
Sbjct  3    PHIAILGAGTFVKTQYIPRLSEISNLLVLKAIWSRTEESARSAVEIARKHFPGVECKWGD  62

Query  289  AGLEEIIKDTSII  327
             GLEEII D+SI+
Sbjct  63   KGLEEIIADSSIL  75



>ref|XP_006445974.1| hypothetical protein CICLE_v10015756mg [Citrus clementina]
 gb|ESR59214.1| hypothetical protein CICLE_v10015756mg [Citrus clementina]
Length=355

 Score =   105 bits (262),  Expect(2) = 8e-40, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 72/88 (82%), Gaps = 0/88 (0%)
 Frame = +2

Query  350  AKLRVEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLSTNMTQKPIWAVAENYRFE  529
             + +V+ SL+LLK GK V+QEKPAAA I+E ENAL  YNS+  +   +PIWAVAENYRFE
Sbjct  83   GQAQVDTSLKLLKAGKQVIQEKPAAANISEIENALSRYNSICPDPPGQPIWAVAENYRFE  142

Query  530  PAFTECKKMIAEIGDMMNVXVIIEGSMN  613
            PAF ECKK+IAEIGDMM+V VI+EGSMN
Sbjct  143  PAFVECKKLIAEIGDMMSVQVIVEGSMN  170


 Score = 85.5 bits (210),  Expect(2) = 8e-40, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = +1

Query  109  PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGG  288
            P+IAILG+GIFVKTQYIPRLAEIS L  LK IWSRSEESA+SA E+AR HF +VEC WG 
Sbjct  3    PRIAILGAGIFVKTQYIPRLAEISDLVSLKFIWSRSEESAKSAAEVARKHFADVECVWGD  62

Query  289  AGLEEIIKDTSII  327
             GLE+IIK+ SI+
Sbjct  63   NGLEQIIKEDSIL  75



>ref|XP_006445973.1| hypothetical protein CICLE_v10015756mg [Citrus clementina]
 gb|ESR59213.1| hypothetical protein CICLE_v10015756mg [Citrus clementina]
Length=268

 Score =   105 bits (263),  Expect(2) = 8e-40, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 72/88 (82%), Gaps = 0/88 (0%)
 Frame = +2

Query  350  AKLRVEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLSTNMTQKPIWAVAENYRFE  529
             + +V+ SL+LLK GK V+QEKPAAA I+E ENAL  YNS+  +   +PIWAVAENYRFE
Sbjct  83   GQAQVDTSLKLLKAGKQVIQEKPAAANISEIENALSRYNSICPDPPGQPIWAVAENYRFE  142

Query  530  PAFTECKKMIAEIGDMMNVXVIIEGSMN  613
            PAF ECKK+IAEIGDMM+V VI+EGSMN
Sbjct  143  PAFVECKKLIAEIGDMMSVQVIVEGSMN  170


 Score = 85.5 bits (210),  Expect(2) = 8e-40, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = +1

Query  109  PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGG  288
            P+IAILG+GIFVKTQYIPRLAEIS L  LK IWSRSEESA+SA E+AR HF +VEC WG 
Sbjct  3    PRIAILGAGIFVKTQYIPRLAEISDLVSLKFIWSRSEESAKSAAEVARKHFADVECVWGD  62

Query  289  AGLEEIIKDTSII  327
             GLE+IIK+ SI+
Sbjct  63   NGLEQIIKEDSIL  75



>ref|XP_006445972.1| hypothetical protein CICLE_v10015756mg [Citrus clementina]
 gb|ESR59212.1| hypothetical protein CICLE_v10015756mg [Citrus clementina]
Length=219

 Score =   105 bits (261),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 72/88 (82%), Gaps = 0/88 (0%)
 Frame = +2

Query  350  AKLRVEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLSTNMTQKPIWAVAENYRFE  529
             + +V+ SL+LLK GK V+QEKPAAA I+E ENAL  YNS+  +   +PIWAVAENYRFE
Sbjct  83   GQAQVDTSLKLLKAGKQVIQEKPAAANISEIENALSRYNSICPDPPGQPIWAVAENYRFE  142

Query  530  PAFTECKKMIAEIGDMMNVXVIIEGSMN  613
            PAF ECKK+IAEIGDMM+V VI+EGSMN
Sbjct  143  PAFVECKKLIAEIGDMMSVQVIVEGSMN  170


 Score = 85.1 bits (209),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = +1

Query  109  PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGG  288
            P+IAILG+GIFVKTQYIPRLAEIS L  LK IWSRSEESA+SA E+AR HF +VEC WG 
Sbjct  3    PRIAILGAGIFVKTQYIPRLAEISDLVSLKFIWSRSEESAKSAAEVARKHFADVECVWGD  62

Query  289  AGLEEIIKDTSII  327
             GLE+IIK+ SI+
Sbjct  63   NGLEQIIKEDSIL  75



>ref|XP_011461910.1| PREDICTED: uncharacterized protein YMR315W [Fragaria vesca subsp. 
vesca]
Length=359

 Score = 97.1 bits (240),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 68/88 (77%), Gaps = 0/88 (0%)
 Frame = +2

Query  350  AKLRVEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLSTNMTQKPIWAVAENYRFE  529
             + +V+ SL+LL+ GK+VLQEKPAAA  +E E AL  Y S+  N   KPIWA+AENYRFE
Sbjct  85   GQAQVDFSLKLLRAGKNVLQEKPAAATTSELEIALSSYKSIVANTPNKPIWAIAENYRFE  144

Query  530  PAFTECKKMIAEIGDMMNVXVIIEGSMN  613
            PAF E KK++ EIGD+M++ VI+EGSMN
Sbjct  145  PAFVEGKKLMTEIGDVMSIQVIVEGSMN  172


 Score = 93.6 bits (231),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 61/79 (77%), Positives = 66/79 (84%), Gaps = 2/79 (3%)
 Frame = +1

Query  91   MAESQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNV  270
            MAE+  PQIAI G+G FVKTQYIPRLAEIS L  LKAIWSRSEESAR AVE+AR HFP V
Sbjct  1    MAEA--PQIAICGAGTFVKTQYIPRLAEISNLVNLKAIWSRSEESARGAVEIARKHFPGV  58

Query  271  ECKWGGAGLEEIIKDTSII  327
            ECKWG  GLEEII D+SI+
Sbjct  59   ECKWGDQGLEEIIADSSIL  77



>ref|XP_010257400.1| PREDICTED: uncharacterized protein LOC104597515 isoform X3 [Nelumbo 
nucifera]
 ref|XP_010257401.1| PREDICTED: uncharacterized protein LOC104597515 isoform X3 [Nelumbo 
nucifera]
Length=359

 Score =   105 bits (262),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = +2

Query  350  AKLRVEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLSTNMTQKPIWAVAENYRFE  529
             + +V++SLRLL+ GKHVLQEKPAAA ++EA++AL  YNSL  N  ++P+WAVAENYRFE
Sbjct  85   GQTQVDISLRLLRAGKHVLQEKPAAASVSEAKSALSCYNSLCANYPRQPLWAVAENYRFE  144

Query  530  PAFTECKKMIAEIGDMMNVXVIIEGSMN  613
            PAF ECKK++ +IG+MM V VI+EGSMN
Sbjct  145  PAFVECKKLMNDIGEMMCVQVIVEGSMN  172


 Score = 84.0 bits (206),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 49/75 (65%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +1

Query  100  SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECK  279
            +Q P IA+LG+GIFV+TQYIPRL EI+   V+K+IWSR+E+SAR+AVELAR  FPN+ECK
Sbjct  2    TQQPHIAVLGAGIFVRTQYIPRLREIADTVVVKSIWSRTEKSARAAVELAREFFPNIECK  61

Query  280  WGGAGLEEIIKDTSI  324
            WG  GL+ II+D+S+
Sbjct  62   WGDEGLDAIIQDSSL  76



>ref|XP_010257398.1| PREDICTED: uncharacterized protein LOC104597515 isoform X1 [Nelumbo 
nucifera]
Length=382

 Score =   105 bits (262),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = +2

Query  350  AKLRVEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLSTNMTQKPIWAVAENYRFE  529
             + +V++SLRLL+ GKHVLQEKPAAA ++EA++AL  YNSL  N  ++P+WAVAENYRFE
Sbjct  108  GQTQVDISLRLLRAGKHVLQEKPAAASVSEAKSALSCYNSLCANYPRQPLWAVAENYRFE  167

Query  530  PAFTECKKMIAEIGDMMNVXVIIEGSMN  613
            PAF ECKK++ +IG+MM V VI+EGSMN
Sbjct  168  PAFVECKKLMNDIGEMMCVQVIVEGSMN  195


 Score = 84.3 bits (207),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 49/75 (65%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +1

Query  100  SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECK  279
            +Q P IA+LG+GIFV+TQYIPRL EI+   V+K+IWSR+E+SAR+AVELAR  FPN+ECK
Sbjct  25   TQQPHIAVLGAGIFVRTQYIPRLREIADTVVVKSIWSRTEKSARAAVELAREFFPNIECK  84

Query  280  WGGAGLEEIIKDTSI  324
            WG  GL+ II+D+S+
Sbjct  85   WGDEGLDAIIQDSSL  99



>gb|EYU18011.1| hypothetical protein MIMGU_mgv1a008840mg [Erythranthe guttata]
Length=360

 Score = 98.2 bits (243),  Expect(2) = 4e-39, Method: Compositional matrix adjust.
 Identities = 56/89 (63%), Positives = 70/89 (79%), Gaps = 1/89 (1%)
 Frame = +2

Query  350  AKLRVEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSL-STNMTQKPIWAVAENYRF  526
            A+ +V++SLR+LK GKHVLQEKPAAA I + E AL  YNSL ST +  KPIWAVAENYRF
Sbjct  84   AQFQVDLSLRILKSGKHVLQEKPAAASITKVETALSSYNSLTSTGLPSKPIWAVAENYRF  143

Query  527  EPAFTECKKMIAEIGDMMNVXVIIEGSMN  613
            EPAF E KK++ +IG+M+N  +I+E  MN
Sbjct  144  EPAFLEGKKLMGDIGEMVNFQIIVEVPMN  172


 Score = 90.5 bits (223),  Expect(2) = 4e-39, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = +1

Query  109  PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGG  288
            P+IAILG+GIFV+T+YIPRL+EISQLF LKAIWSR+EESA+ AVE+A+  FP VECKWG 
Sbjct  4    PKIAILGAGIFVRTEYIPRLSEISQLFSLKAIWSRTEESAKGAVEIAKEFFPEVECKWGD  63

Query  289  AGLEEIIKDTSI  324
             GL+++I+D+SI
Sbjct  64   DGLDDVIEDSSI  75



>ref|XP_007150403.1| hypothetical protein PHAVU_005G150400g [Phaseolus vulgaris]
 gb|ESW22397.1| hypothetical protein PHAVU_005G150400g [Phaseolus vulgaris]
Length=383

 Score = 97.4 bits (241),  Expect(2) = 6e-39, Method: Compositional matrix adjust.
 Identities = 56/75 (75%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = +1

Query  100  SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECK  279
            +++PQIAILG+GIFVK+QYIPRL+EIS LF LKAIWSRS+ESA +AVE+AR HFP VECK
Sbjct  27   TKVPQIAILGAGIFVKSQYIPRLSEISHLFHLKAIWSRSQESATAAVEVARKHFPGVECK  86

Query  280  WGGAGLEEIIKDTSI  324
            WG  GLE+II+D SI
Sbjct  87   WGDCGLEDIIQDGSI  101


 Score = 90.5 bits (223),  Expect(2) = 6e-39, Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 65/85 (76%), Gaps = 0/85 (0%)
 Frame = +2

Query  359  RVEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLSTNMTQKPIWAVAENYRFEPAF  538
            +V++SLR+LK GKHVLQEKPAA+C +E E AL  Y S+S +   + IW+VAENYRFE   
Sbjct  113  QVDISLRVLKAGKHVLQEKPAASCTSELETALSSYRSISADAPSQLIWSVAENYRFESGL  172

Query  539  TECKKMIAEIGDMMNVXVIIEGSMN  613
             ECKK+I  IG MM+V VIIEGSMN
Sbjct  173  LECKKLIGGIGKMMSVQVIIEGSMN  197



>ref|XP_010913920.1| PREDICTED: uncharacterized protein LOC105039462 isoform X2 [Elaeis 
guineensis]
Length=347

 Score =   102 bits (253),  Expect(2) = 9e-39, Method: Compositional matrix adjust.
 Identities = 54/88 (61%), Positives = 70/88 (80%), Gaps = 0/88 (0%)
 Frame = +2

Query  350  AKLRVEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLSTNMTQKPIWAVAENYRFE  529
             +++V++SL++LK GKHV+QEKPAA   +EA+ AL  Y SL  +   +PIWAVAENYRFE
Sbjct  89   GQVQVDISLKMLKMGKHVIQEKPAAESTSEADTALSRYKSLCDHFRSQPIWAVAENYRFE  148

Query  530  PAFTECKKMIAEIGDMMNVXVIIEGSMN  613
            PAF E +K+I EIGDMMN+ VI+EGSMN
Sbjct  149  PAFVEARKLINEIGDMMNIQVIVEGSMN  176


 Score = 85.5 bits (210),  Expect(2) = 9e-39, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 65/73 (89%), Gaps = 0/73 (0%)
 Frame = +1

Query  106  LPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWG  285
            LPQIAI+G+GIFV+TQYIPRL EI+   ++KAIWSRSEESA++AVELAR+  P VECKWG
Sbjct  8    LPQIAIIGAGIFVRTQYIPRLREIADHVIIKAIWSRSEESAKAAVELARDFAPQVECKWG  67

Query  286  GAGLEEIIKDTSI  324
             +GLE+II+D+SI
Sbjct  68   DSGLEDIIQDSSI  80



>ref|XP_003577920.1| PREDICTED: uncharacterized protein LOC100827110 [Brachypodium 
distachyon]
Length=360

 Score =   100 bits (250),  Expect(2) = 9e-39, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 68/88 (77%), Gaps = 0/88 (0%)
 Frame = +2

Query  350  AKLRVEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLSTNMTQKPIWAVAENYRFE  529
             +++VE+SL++LK GKHV+QEKPA+    EAE AL  YNS       KPIWA+AENYRFE
Sbjct  88   GQVQVELSLKMLKAGKHVIQEKPASGSTTEAEAALSIYNSFPKQFPYKPIWALAENYRFE  147

Query  530  PAFTECKKMIAEIGDMMNVXVIIEGSMN  613
            PAF E  K++++IGDMMN+ VI+EGSMN
Sbjct  148  PAFVESNKLMSDIGDMMNIQVIVEGSMN  175


 Score = 86.7 bits (213),  Expect(2) = 9e-39, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   AESQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVE  273
             E  LP+IA++G+GIF +TQYIPRL EI+ L VLKAIWSRS+ESA +AVELAR+  P++E
Sbjct  3    GEGDLPRIAVIGAGIFARTQYIPRLREIAHLVVLKAIWSRSQESAEAAVELARDFVPDIE  62

Query  274  CKWGGAGLEEIIKDTSII  327
            CKWG  GLEEI+ D SI+
Sbjct  63   CKWGDVGLEEIMGDRSIM  80



>ref|XP_004956459.1| PREDICTED: uncharacterized protein YMR315W-like [Setaria italica]
Length=365

 Score =   101 bits (251),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 54/88 (61%), Positives = 66/88 (75%), Gaps = 0/88 (0%)
 Frame = +2

Query  350  AKLRVEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLSTNMTQKPIWAVAENYRFE  529
             +++VE+SL++LK GKHV+QEKPA+    EAE AL  YNS       KPIWA+ ENYRFE
Sbjct  92   GQVQVELSLKMLKAGKHVIQEKPASGSTTEAETALSIYNSFPNQFPYKPIWALGENYRFE  151

Query  530  PAFTECKKMIAEIGDMMNVXVIIEGSMN  613
            PAF E  K+I +IGDMMN+ VIIEGSMN
Sbjct  152  PAFVESSKLIKDIGDMMNIQVIIEGSMN  179


 Score = 85.9 bits (211),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = +1

Query  106  LPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWG  285
            LP+IA++G+GIF +TQYIPRL EI+ L VLKAIWSR++ESA++A ELAR+  P +ECKWG
Sbjct  11   LPRIAVVGAGIFARTQYIPRLREIAHLVVLKAIWSRTQESAKAAAELARDFAPEIECKWG  70

Query  286  GAGLEEIIKDTSII  327
             AGLEEI+ D+SI+
Sbjct  71   DAGLEEIMGDSSIM  84



>ref|XP_010913917.1| PREDICTED: uncharacterized protein LOC105039462 isoform X1 [Elaeis 
guineensis]
 ref|XP_010913918.1| PREDICTED: uncharacterized protein LOC105039462 isoform X1 [Elaeis 
guineensis]
 ref|XP_010913919.1| PREDICTED: uncharacterized protein LOC105039462 isoform X1 [Elaeis 
guineensis]
Length=364

 Score =   101 bits (252),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 54/88 (61%), Positives = 70/88 (80%), Gaps = 0/88 (0%)
 Frame = +2

Query  350  AKLRVEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLSTNMTQKPIWAVAENYRFE  529
             +++V++SL++LK GKHV+QEKPAA   +EA+ AL  Y SL  +   +PIWAVAENYRFE
Sbjct  89   GQVQVDISLKMLKMGKHVIQEKPAAESTSEADTALSRYKSLCDHFRSQPIWAVAENYRFE  148

Query  530  PAFTECKKMIAEIGDMMNVXVIIEGSMN  613
            PAF E +K+I EIGDMMN+ VI+EGSMN
Sbjct  149  PAFVEARKLINEIGDMMNIQVIVEGSMN  176


 Score = 85.5 bits (210),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 65/73 (89%), Gaps = 0/73 (0%)
 Frame = +1

Query  106  LPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWG  285
            LPQIAI+G+GIFV+TQYIPRL EI+   ++KAIWSRSEESA++AVELAR+  P VECKWG
Sbjct  8    LPQIAIIGAGIFVRTQYIPRLREIADHVIIKAIWSRSEESAKAAVELARDFAPQVECKWG  67

Query  286  GAGLEEIIKDTSI  324
             +GLE+II+D+SI
Sbjct  68   DSGLEDIIQDSSI  80



>gb|KHG07862.1| Uncharacterized protein F383_13730 [Gossypium arboreum]
Length=353

 Score = 95.5 bits (236),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 50/88 (57%), Positives = 61/88 (69%), Gaps = 7/88 (8%)
 Frame = +2

Query  350  AKLRVEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLSTNMTQKPIWAVAENYRFE  529
             +++V++SL+LLK  KHV+Q  P           L  Y S+ TN  Q PIWAVAENYRFE
Sbjct  86   GQVQVDISLKLLKAAKHVIQGIPEIETA------LASYKSVCTNPGQ-PIWAVAENYRFE  138

Query  530  PAFTECKKMIAEIGDMMNVXVIIEGSMN  613
            PAF E KK++A +GDMMNV VIIEGSMN
Sbjct  139  PAFVESKKLVAGVGDMMNVQVIIEGSMN  166


 Score = 91.3 bits (225),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 49/77 (64%), Positives = 60/77 (78%), Gaps = 1/77 (1%)
 Frame = +1

Query  100  SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavel-arNHFPNVEC  276
            + LPQIA+LG+GIFVKTQYIPRLAEIS LF LK IWSRSE+ +       A+ HFP VEC
Sbjct  2    ATLPQIAVLGAGIFVKTQYIPRLAEISHLFCLKYIWSRSEKESSRGAVEIAKQHFPGVEC  61

Query  277  KWGGAGLEEIIKDTSII  327
            KWG  GL +I++D+S+I
Sbjct  62   KWGDQGLNDIVQDSSLI  78



>ref|XP_002459955.1| hypothetical protein SORBIDRAFT_02g018670 [Sorghum bicolor]
 gb|EER96476.1| hypothetical protein SORBIDRAFT_02g018670 [Sorghum bicolor]
Length=364

 Score =   100 bits (249),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 54/88 (61%), Positives = 66/88 (75%), Gaps = 0/88 (0%)
 Frame = +2

Query  350  AKLRVEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLSTNMTQKPIWAVAENYRFE  529
             +++VE+SL++LK GKHV+QEKPA+    EAE AL  YNS       KPIWAV ENYRFE
Sbjct  92   GQVQVELSLKMLKAGKHVIQEKPASGSTTEAETALSIYNSFPNQFPHKPIWAVGENYRFE  151

Query  530  PAFTECKKMIAEIGDMMNVXVIIEGSMN  613
            PAF E  K+I +IGDMM++ VIIEGSMN
Sbjct  152  PAFIESSKLINDIGDMMHIQVIIEGSMN  179


 Score = 86.3 bits (212),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   AESQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVE  273
              ++LP+IA++G+GIF +TQYIPRL EI+ L VLKAIWSR++ESA++A ELAR+  P++E
Sbjct  7    GRAELPRIAVIGAGIFARTQYIPRLREIAHLVVLKAIWSRTQESAKAAAELARDFAPDIE  66

Query  274  CKWGGAGLEEIIKDTSII  327
            CKWG  GLEEI+ D+SI+
Sbjct  67   CKWGDVGLEEIMGDSSIM  84



>ref|XP_009385566.1| PREDICTED: glucose-fructose oxidoreductase domain-containing 
protein 1 [Musa acuminata subsp. malaccensis]
Length=364

 Score = 99.0 bits (245),  Expect(2) = 5e-38, Method: Compositional matrix adjust.
 Identities = 53/83 (64%), Positives = 67/83 (81%), Gaps = 0/83 (0%)
 Frame = +2

Query  365  EMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLSTNMTQKPIWAVAENYRFEPAFTE  544
            E+SLR+LK GKHV+QEKPAA  ++EAE A+  YNS   N   +P+WA+AENYRFEPAF E
Sbjct  94   EISLRMLKAGKHVIQEKPAAGTVSEAETAISCYNSFCNNFPHQPVWALAENYRFEPAFVE  153

Query  545  CKKMIAEIGDMMNVXVIIEGSMN  613
             +K++ +IGDMM+V VIIEGSMN
Sbjct  154  SRKLLNDIGDMMHVQVIIEGSMN  176


 Score = 86.3 bits (212),  Expect(2) = 5e-38, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +1

Query  85   LPMAESQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFP  264
            +  +++  PQIAI+G+GIFV+TQYIPRL EI+   ++K+IWSR+EESA++A ELA++  P
Sbjct  1    MAASDAAPPQIAIIGAGIFVRTQYIPRLREIADHLIIKSIWSRTEESAKAAAELAQDFAP  60

Query  265  NVECKWGGAGLEEIIKDTSI  324
            N+ECKWG +GLEEII+D+SI
Sbjct  61   NIECKWGDSGLEEIIQDSSI  80



>gb|AFK46300.1| unknown [Lotus japonicus]
Length=359

 Score = 97.4 bits (241),  Expect(2) = 5e-38, Method: Compositional matrix adjust.
 Identities = 55/85 (65%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = +2

Query  359  RVEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLSTNMTQKPIWAVAENYRFEPAF  538
            +VE+SLR+LK GKH+LQEKPAA+CI+E E AL +Y S+  +  ++ +W+VAENYRFEPA 
Sbjct  89   QVEISLRMLKAGKHILQEKPAASCISELETALSNYKSICADAPRQLVWSVAENYRFEPAL  148

Query  539  TECKKMIAEIGDMMNVXVIIEGSMN  613
             ECKK+IA+IG MM+V VIIEGSMN
Sbjct  149  VECKKLIADIGKMMSVQVIIEGSMN  173


 Score = 87.4 bits (215),  Expect(2) = 5e-38, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = +1

Query  97   ESQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVEC  276
            E++ P+IAILG+G FVK+QY+PRL+EIS LF+LKAIWSR++ESARSAVE+A  +F  VEC
Sbjct  2    ETKRPEIAILGAGTFVKSQYLPRLSEISHLFILKAIWSRTQESARSAVEIAHRNFAGVEC  61

Query  277  KWGGAGLEEIIKDTSI  324
            KWG  GL++II D SI
Sbjct  62   KWGDDGLDDIIHDGSI  77



>ref|NP_001149836.1| NAD-dependent dyhydrogenase, Gfo/Idh/MocA family [Zea mays]
 gb|ACG36942.1| NAD-dependent dyhydrogenase, Gfo/Idh/MocA family [Zea mays]
Length=364

 Score = 96.7 bits (239),  Expect(2) = 6e-38, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 66/88 (75%), Gaps = 0/88 (0%)
 Frame = +2

Query  350  AKLRVEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLSTNMTQKPIWAVAENYRFE  529
             +++VE+SL++LK GKHV+QEKPA+    EAE AL  Y+S       KPIWAV ENYRFE
Sbjct  92   GQVQVELSLKMLKAGKHVIQEKPASGSTTEAETALSIYHSFQNLFPHKPIWAVGENYRFE  151

Query  530  PAFTECKKMIAEIGDMMNVXVIIEGSMN  613
            PAF E  K+I +IGDMM++ VIIEGSMN
Sbjct  152  PAFIESSKLINDIGDMMHIQVIIEGSMN  179


 Score = 88.2 bits (217),  Expect(2) = 6e-38, Method: Compositional matrix adjust.
 Identities = 49/78 (63%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   AESQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVE  273
              ++LP+IA++G+GIF +TQYIPRL EI+ L VLKAIWSR++ESA++A ELAR+  P++E
Sbjct  7    GRAELPRIAVIGAGIFARTQYIPRLREIAHLVVLKAIWSRTQESAKAAAELARDFAPDIE  66

Query  274  CKWGGAGLEEIIKDTSII  327
            CKWG AGLEEI+ D+SI+
Sbjct  67   CKWGDAGLEEIMGDSSIM  84



>ref|XP_010257399.1| PREDICTED: uncharacterized protein LOC104597515 isoform X2 [Nelumbo 
nucifera]
Length=376

 Score =   100 bits (249),  Expect(2) = 7e-38, Method: Compositional matrix adjust.
 Identities = 49/88 (56%), Positives = 62/88 (70%), Gaps = 6/88 (7%)
 Frame = +2

Query  350  AKLRVEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLSTNMTQKPIWAVAENYRFE  529
             + +V++SLRLL+ GKHVLQ    A         L  YNSL  N  ++P+WAVAENYRFE
Sbjct  108  GQTQVDISLRLLRAGKHVLQAVSEAKSA------LSCYNSLCANYPRQPLWAVAENYRFE  161

Query  530  PAFTECKKMIAEIGDMMNVXVIIEGSMN  613
            PAF ECKK++ +IG+MM V VI+EGSMN
Sbjct  162  PAFVECKKLMNDIGEMMCVQVIVEGSMN  189


 Score = 84.0 bits (206),  Expect(2) = 7e-38, Method: Compositional matrix adjust.
 Identities = 49/75 (65%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +1

Query  100  SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECK  279
            +Q P IA+LG+GIFV+TQYIPRL EI+   V+K+IWSR+E+SAR+AVELAR  FPN+ECK
Sbjct  25   TQQPHIAVLGAGIFVRTQYIPRLREIADTVVVKSIWSRTEKSARAAVELAREFFPNIECK  84

Query  280  WGGAGLEEIIKDTSI  324
            WG  GL+ II+D+S+
Sbjct  85   WGDEGLDAIIQDSSL  99



>ref|XP_006850072.1| hypothetical protein AMTR_s00022p00213490 [Amborella trichopoda]
 gb|ERN11653.1| hypothetical protein AMTR_s00022p00213490 [Amborella trichopoda]
Length=368

 Score =   100 bits (250),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 54/88 (61%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = +2

Query  350  AKLRVEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLSTNMTQKPIWAVAENYRFE  529
            A+++V++SLR+L+ GKHVLQEKPAA+ ++EAENA++ Y+SL  N   +PIWAVAENYRFE
Sbjct  94   AQVQVDISLRMLRAGKHVLQEKPAASSLSEAENAMLFYHSLHANFPHRPIWAVAENYRFE  153

Query  530  PAFTECKKMIAEIGDMMNVXVIIEGSMN  613
            PAF E +++  E+GDMM+V VI+E SMN
Sbjct  154  PAFVESQRLAKEVGDMMSVQVIVESSMN  181


 Score = 83.2 bits (204),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 60/76 (79%), Gaps = 0/76 (0%)
 Frame = +1

Query  97   ESQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVEC  276
            E  LP IA+LG GIFV++QYIPRL EISQ  VL+ IWSRSEESA++A ELA    PNVE 
Sbjct  10   EKMLPHIALLGGGIFVRSQYIPRLKEISQTVVLRVIWSRSEESAKAAAELAHEFSPNVEY  69

Query  277  KWGGAGLEEIIKDTSI  324
            KWG AGL +II+D+SI
Sbjct  70   KWGDAGLNDIIQDSSI  85



>ref|XP_008668038.1| PREDICTED: NAD-dependent dyhydrogenase, Gfo/Idh/MocA family isoform 
X1 [Zea mays]
 tpg|DAA39396.1| TPA: NAD-dependent dihydrogenase, Gfo/Idh/MocA family [Zea mays]
Length=364

 Score = 96.7 bits (239),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 66/88 (75%), Gaps = 0/88 (0%)
 Frame = +2

Query  350  AKLRVEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLSTNMTQKPIWAVAENYRFE  529
             +++VE+SL++LK GKHV+QEKPA+    EAE AL  Y+S       KPIWAV ENYRFE
Sbjct  92   GQVQVELSLKMLKAGKHVIQEKPASGSTTEAETALSIYHSFQNLFPHKPIWAVGENYRFE  151

Query  530  PAFTECKKMIAEIGDMMNVXVIIEGSMN  613
            PAF E  K+I +IGDMM++ VIIEGSMN
Sbjct  152  PAFIESSKLINDIGDMMHIQVIIEGSMN  179


 Score = 87.0 bits (214),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   AESQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVE  273
              ++LP+IA++G+GIF +TQYIPRL EI+ L VLK+IWSR++ESA++A ELAR+  P++E
Sbjct  7    GRAELPRIAVIGAGIFARTQYIPRLREIAHLVVLKSIWSRTQESAKAAAELARDFAPDIE  66

Query  274  CKWGGAGLEEIIKDTSII  327
            CKWG AGLEEI+ D+SI+
Sbjct  67   CKWGDAGLEEIMGDSSIM  84



>ref|XP_008787293.1| PREDICTED: uncharacterized protein LOC103705381 [Phoenix dactylifera]
 ref|XP_008787294.1| PREDICTED: uncharacterized protein LOC103705381 [Phoenix dactylifera]
 ref|XP_008787295.1| PREDICTED: uncharacterized protein LOC103705381 [Phoenix dactylifera]
 ref|XP_008787297.1| PREDICTED: uncharacterized protein LOC103705381 [Phoenix dactylifera]
 ref|XP_008787298.1| PREDICTED: uncharacterized protein LOC103705381 [Phoenix dactylifera]
 ref|XP_008787299.1| PREDICTED: uncharacterized protein LOC103705381 [Phoenix dactylifera]
 ref|XP_008787300.1| PREDICTED: uncharacterized protein LOC103705381 [Phoenix dactylifera]
Length=364

 Score = 98.6 bits (244),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 52/88 (59%), Positives = 69/88 (78%), Gaps = 0/88 (0%)
 Frame = +2

Query  350  AKLRVEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLSTNMTQKPIWAVAENYRFE  529
             +++V++SL+LL+ GKHV+QEKPAA    EA+ AL  Y SL  +   +PIWAVAENYRFE
Sbjct  89   GQVQVDISLKLLRMGKHVIQEKPAAESTIEADTALSCYKSLCDHFPSQPIWAVAENYRFE  148

Query  530  PAFTECKKMIAEIGDMMNVXVIIEGSMN  613
            PAF E +K++ EIGDM+N+ VI+EGSMN
Sbjct  149  PAFVEARKLVNEIGDMINIQVIVEGSMN  176


 Score = 84.7 bits (208),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 51/73 (70%), Positives = 65/73 (89%), Gaps = 0/73 (0%)
 Frame = +1

Query  106  LPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWG  285
            LPQIA++G+GIFV+TQYIPRL EI+   ++KAIWSRSEESA++AVELAR+  P VECKWG
Sbjct  8    LPQIAVIGAGIFVRTQYIPRLREIADHVIIKAIWSRSEESAKAAVELARDFAPKVECKWG  67

Query  286  GAGLEEIIKDTSI  324
             +GLE+II+D+SI
Sbjct  68   DSGLEDIIQDSSI  80



>gb|EMT01460.1| hypothetical protein F775_26364 [Aegilops tauschii]
Length=355

 Score = 95.9 bits (237),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 59/88 (67%), Gaps = 6/88 (7%)
 Frame = +2

Query  350  AKLRVEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLSTNMTQKPIWAVAENYRFE  529
             +++VE+SL++LK GKHV+Q    A         L  YNS    +  KPIWAV ENYRFE
Sbjct  89   GQVQVELSLKMLKAGKHVIQASTEAETA------LSVYNSFPNKLPCKPIWAVGENYRFE  142

Query  530  PAFTECKKMIAEIGDMMNVXVIIEGSMN  613
            PAF E  K++ +IGDMMN+ VI+EGSMN
Sbjct  143  PAFVESSKLMDDIGDMMNIQVIVEGSMN  170


 Score = 84.7 bits (208),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = +1

Query  106  LPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWG  285
            LP+IA++G+GIF +TQYIPRL EIS L VLKAIWSR++ESA +A ELAR+  P +ECKWG
Sbjct  8    LPRIAVVGAGIFARTQYIPRLREISHLVVLKAIWSRTQESAEAAAELARDFAPGIECKWG  67

Query  286  GAGLEEIIKDTSII  327
             AGLEEI+ D SI+
Sbjct  68   DAGLEEIMGDPSIL  81



>ref|XP_006660493.1| PREDICTED: uncharacterized protein YMR315W-like [Oryza brachyantha]
Length=359

 Score = 99.0 bits (245),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 52/88 (59%), Positives = 68/88 (77%), Gaps = 0/88 (0%)
 Frame = +2

Query  350  AKLRVEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLSTNMTQKPIWAVAENYRFE  529
             +++VE+SL++LK GKHV+QEKPA+    EAE AL  YNS       +PIWA+AENYRFE
Sbjct  87   GQVQVELSLKMLKAGKHVIQEKPASGSTMEAETALSVYNSFPNQPPYRPIWALAENYRFE  146

Query  530  PAFTECKKMIAEIGDMMNVXVIIEGSMN  613
            PAF E +K++ +IGDMMN+ VI+EGSMN
Sbjct  147  PAFVESRKLMNDIGDMMNIQVIVEGSMN  174


 Score = 81.3 bits (199),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = +1

Query  91   MAESQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNV  270
            MA   LP+IA+LG+G F +TQYIPRL EI+ L +L+AIWSR++ESA +A ELAR+  P +
Sbjct  1    MAADGLPRIAVLGAGTFARTQYIPRLREIAHLVLLRAIWSRTQESAEAAAELARDFAPEI  60

Query  271  ECKWGGAGLEEIIKDTSI  324
            EC+WG AGL EI++D SI
Sbjct  61   ECRWGDAGLAEIMEDASI  78



>gb|EEE69341.1| hypothetical protein OsJ_28659 [Oryza sativa Japonica Group]
Length=364

 Score =   100 bits (250),  Expect(2) = 8e-36, Method: Compositional matrix adjust.
 Identities = 52/88 (59%), Positives = 69/88 (78%), Gaps = 0/88 (0%)
 Frame = +2

Query  350  AKLRVEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLSTNMTQKPIWAVAENYRFE  529
             +++V++SL++LK GKHV+QEKPA+    EAE AL  YNS       KPIWA+AENYRFE
Sbjct  87   GQVQVDLSLKMLKAGKHVIQEKPASGSTMEAETALSVYNSFPNQFPYKPIWALAENYRFE  146

Query  530  PAFTECKKMIAEIGDMMNVXVIIEGSMN  613
            PAF E +K++++IGDMMN+ VI+EGSMN
Sbjct  147  PAFVESRKLMSDIGDMMNIQVIVEGSMN  174


 Score = 76.6 bits (187),  Expect(2) = 8e-36, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = +1

Query  91   MAESQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNV  270
            MA   LP+IA++G+GIF +TQYIPRL EI+ L +LK IWSR++ESA +A ELAR+  P +
Sbjct  1    MAGDGLPRIAVVGAGIFARTQYIPRLREIAHLVLLKTIWSRTKESAEAAAELARDFAPEI  60

Query  271  ECKWGGAGLEEIIKDTSI  324
            + +WG AGLEEI+ D SI
Sbjct  61   QPRWGDAGLEEIMGDASI  78



>ref|NP_001062764.1| Os09g0280300 [Oryza sativa Japonica Group]
 dbj|BAD26513.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF24678.1| Os09g0280300 [Oryza sativa Japonica Group]
 dbj|BAG93408.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC84244.1| hypothetical protein OsI_30682 [Oryza sativa Indica Group]
Length=359

 Score =   100 bits (250),  Expect(2) = 8e-36, Method: Compositional matrix adjust.
 Identities = 52/88 (59%), Positives = 69/88 (78%), Gaps = 0/88 (0%)
 Frame = +2

Query  350  AKLRVEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLSTNMTQKPIWAVAENYRFE  529
             +++V++SL++LK GKHV+QEKPA+    EAE AL  YNS       KPIWA+AENYRFE
Sbjct  87   GQVQVDLSLKMLKAGKHVIQEKPASGSTMEAETALSVYNSFPNQFPYKPIWALAENYRFE  146

Query  530  PAFTECKKMIAEIGDMMNVXVIIEGSMN  613
            PAF E +K++++IGDMMN+ VI+EGSMN
Sbjct  147  PAFVESRKLMSDIGDMMNIQVIVEGSMN  174


 Score = 76.6 bits (187),  Expect(2) = 8e-36, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = +1

Query  91   MAESQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNV  270
            MA   LP+IA++G+GIF +TQYIPRL EI+ L +LK IWSR++ESA +A ELAR+  P +
Sbjct  1    MAGDGLPRIAVVGAGIFARTQYIPRLREIAHLVLLKTIWSRTKESAEAAAELARDFAPEI  60

Query  271  ECKWGGAGLEEIIKDTSI  324
            + +WG AGLEEI+ D SI
Sbjct  61   QPRWGDAGLEEIMGDASI  78



>ref|XP_010673578.1| PREDICTED: uncharacterized protein YMR315W isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=360

 Score = 97.4 bits (241),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 54/87 (62%), Positives = 70/87 (80%), Gaps = 0/87 (0%)
 Frame = +2

Query  353  KLRVEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLSTNMTQKPIWAVAENYRFEP  532
            +++V+M+LRLLK GKHV+QEKPAAA   EAE AL  Y+ +  + + KPIWAVAENYRFEP
Sbjct  91   QIQVDMALRLLKAGKHVIQEKPAAASNEEAELALSSYDLVCPSNSSKPIWAVAENYRFEP  150

Query  533  AFTECKKMIAEIGDMMNVXVIIEGSMN  613
             F E +K++ EIGDMM+V VI+EGS+N
Sbjct  151  GFIEGRKLVEEIGDMMSVQVIVEGSVN  177


 Score = 75.9 bits (185),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 55/68 (81%), Gaps = 0/68 (0%)
 Frame = +1

Query  112  QIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGGA  291
            QI I+G+G FVK QYIPRL+EIS L  ++ IWSRSEESARSAVELA   FP VECKWG  
Sbjct  11   QITIIGAGTFVKNQYIPRLSEISHLVSIRYIWSRSEESARSAVELASKSFPEVECKWGDV  70

Query  292  GLEEIIKD  315
            G++EIIKD
Sbjct  71   GIDEIIKD  78



>ref|XP_010673579.1| PREDICTED: uncharacterized protein YMR315W isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=355

 Score = 97.4 bits (241),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 54/87 (62%), Positives = 70/87 (80%), Gaps = 0/87 (0%)
 Frame = +2

Query  353  KLRVEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLSTNMTQKPIWAVAENYRFEP  532
            +++V+M+LRLLK GKHV+QEKPAAA   EAE AL  Y+ +  + + KPIWAVAENYRFEP
Sbjct  86   QIQVDMALRLLKAGKHVIQEKPAAASNEEAELALSSYDLVCPSNSSKPIWAVAENYRFEP  145

Query  533  AFTECKKMIAEIGDMMNVXVIIEGSMN  613
             F E +K++ EIGDMM+V VI+EGS+N
Sbjct  146  GFIEGRKLVEEIGDMMSVQVIVEGSVN  172


 Score = 75.9 bits (185),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 55/68 (81%), Gaps = 0/68 (0%)
 Frame = +1

Query  112  QIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGGA  291
            QI I+G+G FVK QYIPRL+EIS L  ++ IWSRSEESARSAVELA   FP VECKWG  
Sbjct  6    QITIIGAGTFVKNQYIPRLSEISHLVSIRYIWSRSEESARSAVELASKSFPEVECKWGDV  65

Query  292  GLEEIIKD  315
            G++EIIKD
Sbjct  66   GIDEIIKD  73



>ref|XP_004486934.1| PREDICTED: uncharacterized protein YMR315W-like [Cicer arietinum]
Length=361

 Score = 90.1 bits (222),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 67/85 (79%), Gaps = 0/85 (0%)
 Frame = +2

Query  359  RVEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLSTNMTQKPIWAVAENYRFEPAF  538
            +V++SL+LLK GKHVLQEKPAA+C +E E AL +Y  +S +   + IW+VAENYRFEPA 
Sbjct  91   QVDISLKLLKAGKHVLQEKPAASCTSELETALSNYKLISADAPGQVIWSVAENYRFEPAL  150

Query  539  TECKKMIAEIGDMMNVXVIIEGSMN  613
             E KK+IA IG MM+V VIIEGSMN
Sbjct  151  VEGKKLIAGIGKMMSVQVIIEGSMN  175


 Score = 83.2 bits (204),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 61/79 (77%), Gaps = 1/79 (1%)
 Frame = +1

Query  91   MAESQ-LPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPN  267
            MA  Q  PQIAILG+G FVK+QY+PRL+EIS LF LKAIWSR+EESA +AVE+A  HF  
Sbjct  1    MATKQGTPQIAILGAGTFVKSQYLPRLSEISNLFHLKAIWSRTEESATAAVEIANKHFSG  60

Query  268  VECKWGGAGLEEIIKDTSI  324
            V  KWG  GL +II+D SI
Sbjct  61   VHSKWGDNGLHDIIQDPSI  79



>gb|KGN54119.1| hypothetical protein Csa_4G286920 [Cucumis sativus]
Length=175

 Score = 99.4 bits (246),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 53/76 (70%), Positives = 69/76 (91%), Gaps = 0/76 (0%)
 Frame = +1

Query  100  SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECK  279
            ++LPQIAILG+G FVKTQY+PRLAEIS L ++KAIWSR+E SA+ AV++ARN+FP VECK
Sbjct  2    AKLPQIAILGAGTFVKTQYLPRLAEISDLLIVKAIWSRTEASAKGAVDIARNYFPTVECK  61

Query  280  WGGAGLEEIIKDTSII  327
            WG AGL++II+D+SI+
Sbjct  62   WGDAGLDDIIQDSSIL  77


 Score = 73.6 bits (179),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 56/71 (79%), Gaps = 1/71 (1%)
 Frame = +2

Query  359  RVEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLSTNMTQKPIWAVAENYRFEPAF  538
            +V+MSLRLLK GKHVLQEKPAAA  +E E AL +Y SLS N +++ +WAVAENYRFEPAF
Sbjct  88   QVDMSLRLLKAGKHVLQEKPAAASTSELEYALSNYKSLSANFSRQRLWAVAENYRFEPAF  147

Query  539  TECKKMIAEIG  571
             E +  I ++G
Sbjct  148  VE-RGFILDMG  157



>gb|EPS68382.1| hypothetical protein M569_06387, partial [Genlisea aurea]
Length=340

 Score = 89.7 bits (221),  Expect(2) = 5e-32, Method: Compositional matrix adjust.
 Identities = 52/88 (59%), Positives = 66/88 (75%), Gaps = 4/88 (5%)
 Frame = +2

Query  350  AKLRVEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLSTNMTQKPIWAVAENYRFE  529
             + +V+MSLRLL  GKHVLQEKPAAA + E + A+  Y SL +     PIWAVAENYRFE
Sbjct  83   GQAQVDMSLRLLSAGKHVLQEKPAAASVNELQKAISGYQSLPS----APIWAVAENYRFE  138

Query  530  PAFTECKKMIAEIGDMMNVXVIIEGSMN  613
            PAF E +K++ EIG+++N  VI+EGSMN
Sbjct  139  PAFVEGRKLMTEIGNVVNFHVIVEGSMN  166


 Score = 75.1 bits (183),  Expect(2) = 5e-32, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 59/71 (83%), Gaps = 1/71 (1%)
 Frame = +1

Query  115  IAILGSGIFVKTQYIPRLAEI-SQLFVLKAIWsrseesarsavelarNHFPNVECKWGGA  291
            +AI+G+GIFV++ YIPRLAEI +  FVL+AIWSRSE+SA+SA  +A+  FP VECKWG A
Sbjct  4    VAIVGAGIFVRSTYIPRLAEIGNNSFVLRAIWSRSEDSAKSAHAIAKPFFPGVECKWGEA  63

Query  292  GLEEIIKDTSI  324
            GL++I+ D SI
Sbjct  64   GLDDIVGDASI  74



>ref|XP_003597479.1| Oxidoreductase, putative [Medicago truncatula]
 gb|AES67730.1| oxidoreductase family, NAD-binding rossmann fold protein [Medicago 
truncatula]
Length=356

 Score = 92.8 bits (229),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 54/88 (61%), Positives = 69/88 (78%), Gaps = 0/88 (0%)
 Frame = +2

Query  350  AKLRVEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLSTNMTQKPIWAVAENYRFE  529
             + +V++SL+LLK GKHVLQEKPAA+ I E E AL +Y S+S +   + IW+VAENYRFE
Sbjct  85   GQYQVDISLKLLKAGKHVLQEKPAASGINELETALSNYKSISADAPGQIIWSVAENYRFE  144

Query  530  PAFTECKKMIAEIGDMMNVXVIIEGSMN  613
            PA  E KK+IA++G MM+V VIIEGSMN
Sbjct  145  PALVEGKKLIADLGKMMSVQVIIEGSMN  172


 Score = 69.7 bits (169),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 58/72 (81%), Gaps = 1/72 (1%)
 Frame = +1

Query  112  QIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHF-PNVECKWGG  288
            QIAILG+G FVK QY+PRL+EIS LF LK+IWSR+++SA +AVE+A   F  NVE K+G 
Sbjct  5    QIAILGAGTFVKHQYLPRLSEISHLFNLKSIWSRTQDSANAAVEIANKLFGGNVESKFGD  64

Query  289  AGLEEIIKDTSI  324
             GL +II+D+SI
Sbjct  65   NGLNDIIQDSSI  76



>gb|EYU46309.1| hypothetical protein MIMGU_mgv1a0096471mg, partial [Erythranthe 
guttata]
Length=147

 Score = 94.7 bits (234),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/79 (70%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +1

Query  91   MAESQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNV  270
            MAE + PQIAILG+GIFV+  YIPRLAEIS L VL+AIWSR++ESAR AVE+A+ +FP+V
Sbjct  1    MAEQRPPQIAILGAGIFVRNTYIPRLAEISNLLVLRAIWSRTQESARGAVEIAKQYFPDV  60

Query  271  ECKWGGAGLEEIIKDTSII  327
            ECKWG AGL +II D SI+
Sbjct  61   ECKWGEAGLNDIILDASIV  79


 Score = 65.1 bits (157),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 47/64 (73%), Gaps = 4/64 (6%)
 Frame = +2

Query  353  KLRVEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLSTNMTQKPIWAVAENYRFEP  532
            + +V+MSLR LK GKHVLQEKPAAA + E E A+  YNS +      PIWAVAENYRFEP
Sbjct  88   QTQVDMSLRFLKAGKHVLQEKPAAASVNELETAISSYNSFNP----APIWAVAENYRFEP  143

Query  533  AFTE  544
            AF E
Sbjct  144  AFVE  147



>ref|XP_001762266.1| predicted protein [Physcomitrella patens]
 gb|EDQ73058.1| predicted protein [Physcomitrella patens]
Length=361

 Score = 79.7 bits (195),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 43/88 (49%), Positives = 60/88 (68%), Gaps = 0/88 (0%)
 Frame = +2

Query  350  AKLRVEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLSTNMTQKPIWAVAENYRFE  529
            A+ ++E+ LR L+ GKHV+QEKP    +A+  +A   Y +L+ N T+ PIWAVAENYRFE
Sbjct  86   AQHQLEIVLRALEAGKHVIQEKPVGPSVADVRSAWSAYQALAKNDTKLPIWAVAENYRFE  145

Query  530  PAFTECKKMIAEIGDMMNVXVIIEGSMN  613
            PA  +  K + E+G +M V V+IE  MN
Sbjct  146  PALIQAGKFVKELGQIMGVQVLIEAPMN  173


 Score = 67.0 bits (162),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 54/73 (74%), Gaps = 0/73 (0%)
 Frame = +1

Query  106  LPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWG  285
            +P +A+LGSGIF  +QYIP+L E+  +  L  IWSRSE+ A+ A++LA+++ PN E KWG
Sbjct  5    IPGLALLGSGIFASSQYIPKLGELGGIVSLNTIWSRSEDGAKKALQLAKSYAPNAEAKWG  64

Query  286  GAGLEEIIKDTSI  324
              GLE I++D SI
Sbjct  65   QEGLESILQDKSI  77



>ref|XP_001754780.1| predicted protein [Physcomitrella patens]
 gb|EDQ80234.1| predicted protein [Physcomitrella patens]
Length=362

 Score = 76.3 bits (186),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 43/88 (49%), Positives = 58/88 (66%), Gaps = 0/88 (0%)
 Frame = +2

Query  350  AKLRVEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLSTNMTQKPIWAVAENYRFE  529
            A+ ++E+ LR L+ GKHV+QEKP  A +A+   A   Y +L+ N  + PIWAVAENYRFE
Sbjct  86   AQHQLELVLRALEAGKHVIQEKPVGASVADVRKAWSTYQALAVNDKKLPIWAVAENYRFE  145

Query  530  PAFTECKKMIAEIGDMMNVXVIIEGSMN  613
            PA  +  K   EIG +M V V+IE  +N
Sbjct  146  PALIQTGKFAKEIGQIMGVQVLIEAPIN  173


 Score = 70.5 bits (171),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 55/72 (76%), Gaps = 0/72 (0%)
 Frame = +1

Query  109  PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGG  288
            P +A+LGSGIF  +QY+P+L E+S++  L+ IWSRSE+ A+ A+  AR++ PNVE KWG 
Sbjct  6    PGLALLGSGIFASSQYLPKLGELSEVISLRVIWSRSEDGAKKALLSARSYAPNVEAKWGQ  65

Query  289  AGLEEIIKDTSI  324
             GLE I++D SI
Sbjct  66   EGLEAILQDKSI  77



>gb|KJB66094.1| hypothetical protein B456_010G128200 [Gossypium raimondii]
Length=288

 Score =   105 bits (262),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 71/88 (81%), Gaps = 1/88 (1%)
 Frame = +2

Query  350  AKLRVEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLSTNMTQKPIWAVAENYRFE  529
             +++V++SL+LLK GKHV+QEKPAA  I E E AL  Y S+STN  Q PIWAVAENYRFE
Sbjct  15   GQVQVDISLKLLKAGKHVIQEKPAATSIPEIETALASYKSVSTNPGQ-PIWAVAENYRFE  73

Query  530  PAFTECKKMIAEIGDMMNVXVIIEGSMN  613
            PAF E KK++A +GDMMNV VIIEGSMN
Sbjct  74   PAFVESKKLVAGVGDMMNVQVIIEGSMN  101



>ref|XP_004169964.1| PREDICTED: uncharacterized protein LOC101228167 [Cucumis sativus]
Length=110

 Score = 99.0 bits (245),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 53/76 (70%), Positives = 69/76 (91%), Gaps = 0/76 (0%)
 Frame = +1

Query  100  SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECK  279
            ++LPQIAILG+G FVKTQY+PRLAEIS L ++KAIWSR+E SA+ AV++ARN+FP VECK
Sbjct  2    AKLPQIAILGAGTFVKTQYLPRLAEISDLLIVKAIWSRTEASAKGAVDIARNYFPTVECK  61

Query  280  WGGAGLEEIIKDTSII  327
            WG AGL++II+D+SI+
Sbjct  62   WGDAGLDDIIQDSSIL  77



>ref|XP_004142242.1| PREDICTED: uncharacterized LOC101204258 [Cucumis sativus]
Length=220

 Score = 99.4 bits (246),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 53/76 (70%), Positives = 69/76 (91%), Gaps = 0/76 (0%)
 Frame = +1

Query  100  SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECK  279
            ++LPQIAILG+G FVKTQY+PRLAEIS L ++KAIWSR+E SA+ AV++ARN+FP VECK
Sbjct  2    AKLPQIAILGAGTFVKTQYLPRLAEISDLLIVKAIWSRTEASAKGAVDIARNYFPTVECK  61

Query  280  WGGAGLEEIIKDTSII  327
            WG AGL++II+D+SI+
Sbjct  62   WGDAGLDDIIQDSSIL  77


 Score = 32.7 bits (73),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 14/20 (70%), Positives = 17/20 (85%), Gaps = 0/20 (0%)
 Frame = +2

Query  350  AKLRVEMSLRLLKGGKHVLQ  409
             + +V+MSLRLLK GKHVLQ
Sbjct  85   GQAQVDMSLRLLKAGKHVLQ  104



>ref|XP_002981277.1| hypothetical protein SELMODRAFT_114540 [Selaginella moellendorffii]
 gb|EFJ17465.1| hypothetical protein SELMODRAFT_114540 [Selaginella moellendorffii]
Length=338

 Score = 72.8 bits (177),  Expect(2) = 6e-22, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 49/85 (58%), Gaps = 9/85 (11%)
 Frame = +2

Query  359  RVEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLSTNMTQKPIWAVAENYRFEPAF  538
            R  +SLR LK GKHVLQ              ++ Y+S     +Q P+WAVAENYRFEP  
Sbjct  93   RYSISLRALKSGKHVLQALSDVRD-------VLSYHS--GMGSQAPVWAVAENYRFEPGL  143

Query  539  TECKKMIAEIGDMMNVXVIIEGSMN  613
             E  +++  IGDMM+  VI+E  MN
Sbjct  144  IEAARLVKSIGDMMSFEVIVELPMN  168


 Score = 58.2 bits (139),  Expect(2) = 6e-22, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 52/75 (69%), Gaps = 1/75 (1%)
 Frame = +1

Query  103  QLPQIAILGSGIFVKTQYIPRLA-EISQLFVLKAIWsrseesarsavelarNHFPNVECK  279
             +P +AILG+GIF  +QY+P L+ + S   +LKAIWSRS+++A +A       FP+V  K
Sbjct  3    SVPGVAILGAGIFTTSQYLPILSNQSSTAPILKAIWSRSKDAAENAASSVAKFFPDVVAK  62

Query  280  WGGAGLEEIIKDTSI  324
            WG  GL +I++D+SI
Sbjct  63   WGEDGLIQILEDSSI  77



>ref|XP_002969664.1| hypothetical protein SELMODRAFT_92921 [Selaginella moellendorffii]
 gb|EFJ28788.1| hypothetical protein SELMODRAFT_92921 [Selaginella moellendorffii]
Length=348

 Score = 71.2 bits (173),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 48/82 (59%), Gaps = 9/82 (11%)
 Frame = +2

Query  368  MSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLSTNMTQKPIWAVAENYRFEPAFTEC  547
            +SLR LK GKHVLQ              ++ Y+S     +Q P+WAVAENYRFEP   E 
Sbjct  96   ISLRALKSGKHVLQALSDVRD-------VLSYHS--GMGSQAPVWAVAENYRFEPGLIEA  146

Query  548  KKMIAEIGDMMNVXVIIEGSMN  613
             +++  IGDMM+  VI+E  MN
Sbjct  147  ARLVKSIGDMMSFEVIVELPMN  168


 Score = 58.2 bits (139),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  103  QLPQIAILGSGIFVKTQYIPRLAEISQLF-VLKAIWsrseesarsavelarNHFPNVECK  279
             +P +AILG+GIF  +QY+P L++ S    +LKAIWSRS+++A +A  L    FP+V  K
Sbjct  3    SVPGVAILGAGIFTTSQYLPILSKQSSTAPILKAIWSRSKDAAENAASLVAKFFPDVVAK  62

Query  280  WGGAGLEEIIKDTSI  324
            WG  GL +I++D+SI
Sbjct  63   WGEDGLIQILEDSSI  77



>ref|XP_004152962.1| PREDICTED: uncharacterized protein LOC101204258, partial [Cucumis 
sativus]
Length=81

 Score = 87.0 bits (214),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +2

Query  452  LMHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVXVIIEGSMN  613
            L +Y SLS N +++ +WAVAENYRFEPAF ECK +IA+IGDMM+V VI+EGSMN
Sbjct  8    LSNYKSLSANFSRQRLWAVAENYRFEPAFVECKNLIADIGDMMSVQVIVEGSMN  61



>ref|XP_001776337.1| predicted protein [Physcomitrella patens]
 gb|EDQ58836.1| predicted protein [Physcomitrella patens]
Length=366

 Score = 63.5 bits (153),  Expect(2) = 7e-18, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 48/79 (61%), Gaps = 3/79 (4%)
 Frame = +2

Query  377  RLLKGGKHVLQekpaaaciaeaenaLMHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKM  556
            R L+ GKHVLQEKP A  +     ++  Y+SL +     PIW VAENYRFEPAF +   M
Sbjct  100  RALRAGKHVLQEKPVAGSVEIGLKSMSFYHSLPS---PAPIWTVAENYRFEPAFHDAAAM  156

Query  557  IAEIGDMMNVXVIIEGSMN  613
            +  +G M++V V I+  M 
Sbjct  157  VKSLGTMVSVTVTIDVPMT  175


 Score = 53.9 bits (128),  Expect(2) = 7e-18, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 45/69 (65%), Gaps = 0/69 (0%)
 Frame = +1

Query  103  QLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKW  282
            +LP IA+LG G+F +  YIP L+ +S +  L+ +WSRSE  AR   E   +  P+VE +W
Sbjct  9    RLPAIALLGCGVFARDAYIPVLSSLSPIASLRYVWSRSEFKARQMQENVLHFAPDVEAEW  68

Query  283  GGAGLEEII  309
            G AGLE I+
Sbjct  69   GDAGLEIIL  77



>ref|XP_002973220.1| hypothetical protein SELMODRAFT_413759 [Selaginella moellendorffii]
 gb|EFJ25594.1| hypothetical protein SELMODRAFT_413759 [Selaginella moellendorffii]
Length=349

 Score = 66.2 bits (160),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 55/87 (63%), Gaps = 3/87 (3%)
 Frame = +2

Query  353  KLRVEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLSTNMTQKPIWAVAENYRFEP  532
            +++ E  ++ LK GKHV+QEKP A    +A++    Y SL T    +P+WA+AENYRFE 
Sbjct  85   QVQGEFVMQALKAGKHVIQEKPIAPSTQQAQSLTSFYESLGT---MRPVWAIAENYRFER  141

Query  533  AFTECKKMIAEIGDMMNVXVIIEGSMN  613
            A  E  K++ +IG M+ V V +E  MN
Sbjct  142  ALVEAHKLVKDIGHMVAVEVTVESPMN  168


 Score = 48.9 bits (115),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 50/74 (68%), Gaps = 1/74 (1%)
 Frame = +1

Query  109  PQIAILGSGIFVKTQYIPRLA-EISQLFVLKAIWsrseesarsavelarNHFPNVECKWG  285
            P +A++G G F + QY P  + +++ +  LKA+WSRS+ESA  +V L ++  P V+ KWG
Sbjct  3    PSLALIGVGNFAQKQYFPLFSTKLTDVVSLKALWSRSQESAERSVSLIKDCVPGVQAKWG  62

Query  286  GAGLEEIIKDTSII  327
              GL++I+ D +I+
Sbjct  63   QQGLDDILNDDTIL  76



>ref|XP_004162028.1| PREDICTED: uncharacterized LOC101204258, partial [Cucumis sativus]
Length=244

 Score = 86.7 bits (213),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +2

Query  452  LMHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVXVIIEGSMN  613
            L +Y SLS N +++ +WAVAENYRFEPAF ECK +IA+IGDMM+V VI+EGSMN
Sbjct  8    LSNYKSLSANFSRQRLWAVAENYRFEPAFVECKNLIADIGDMMSVQVIVEGSMN  61



>ref|XP_002976631.1| hypothetical protein SELMODRAFT_416506 [Selaginella moellendorffii]
 gb|EFJ22300.1| hypothetical protein SELMODRAFT_416506 [Selaginella moellendorffii]
Length=341

 Score = 64.7 bits (156),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 53/87 (61%), Gaps = 3/87 (3%)
 Frame = +2

Query  353  KLRVEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLSTNMTQKPIWAVAENYRFEP  532
            +++ E  ++ LK GKHV+QEKP A    +A+     Y SL T    +P+WA+AENYRFE 
Sbjct  85   QVQGEFVMQALKAGKHVIQEKPIAPSTQQAQGLTSFYESLGT---MRPVWAIAENYRFER  141

Query  533  AFTECKKMIAEIGDMMNVXVIIEGSMN  613
            A  E  K+  +IG M+ V V +E  MN
Sbjct  142  ALVEAHKLAKDIGHMVAVEVTVESPMN  168


 Score = 47.8 bits (112),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 50/74 (68%), Gaps = 1/74 (1%)
 Frame = +1

Query  109  PQIAILGSGIFVKTQYIPRLA-EISQLFVLKAIWsrseesarsavelarNHFPNVECKWG  285
            P +A++G G F + QY P  + +++ +  LKA+WSRS+ESA  +V L ++  P V+ KWG
Sbjct  3    PSLALIGVGNFAQKQYFPLFSTKLTDVVSLKALWSRSQESAERSVSLIKDCVPGVQPKWG  62

Query  286  GAGLEEIIKDTSII  327
              GL++I+ D +I+
Sbjct  63   QQGLDDILSDDTIL  76



>gb|KJB66101.1| hypothetical protein B456_010G128200 [Gossypium raimondii]
Length=259

 Score = 84.0 bits (206),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 44/54 (81%), Gaps = 1/54 (2%)
 Frame = +2

Query  452  LMHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVXVIIEGSMN  613
            L  Y S+STN  Q PIWAVAENYRFEPAF E KK++A +GDMMNV VIIEGSMN
Sbjct  20   LASYKSVSTNPGQ-PIWAVAENYRFEPAFVESKKLVAGVGDMMNVQVIIEGSMN  72



>ref|XP_010466287.1| PREDICTED: uncharacterized protein LOC104746495 [Camelina sativa]
Length=235

 Score = 80.9 bits (198),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = +2

Query  461  YNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVXVIIEGSMN  613
            Y  +S +   +PIWAVAENYRFEPAF E KK++ EIGDMMNV +IIEGSMN
Sbjct  4    YREISADSPSRPIWAVAENYRFEPAFVELKKLMVEIGDMMNVQLIIEGSMN  54



>ref|XP_002973823.1| hypothetical protein SELMODRAFT_414190 [Selaginella moellendorffii]
 ref|XP_002983567.1| hypothetical protein SELMODRAFT_422801 [Selaginella moellendorffii]
 gb|EFJ15468.1| hypothetical protein SELMODRAFT_422801 [Selaginella moellendorffii]
 gb|EFJ24778.1| hypothetical protein SELMODRAFT_414190 [Selaginella moellendorffii]
Length=341

 Score = 58.2 bits (139),  Expect(2) = 8e-15, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 50/81 (62%), Gaps = 3/81 (4%)
 Frame = +2

Query  371  SLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLSTNMTQKPIWAVAENYRFEPAFTECK  550
            +++ L  GKHVLQEKP A    +A++ +  Y  L  +   K +WA+ ENYRFE A  E  
Sbjct  91   AIQALTAGKHVLQEKPLAPSTQKAQSLVNLYKGLDND---KLVWAIGENYRFEQALAEAS  147

Query  551  KMIAEIGDMMNVXVIIEGSMN  613
            K++ +IG M+ V VI+E  MN
Sbjct  148  KLVKDIGHMVAVEVILESPMN  168


 Score = 48.9 bits (115),  Expect(2) = 8e-15, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 48/74 (65%), Gaps = 1/74 (1%)
 Frame = +1

Query  109  PQIAILGSGIFVKTQYIPRLA-EISQLFVLKAIWsrseesarsavelarNHFPNVECKWG  285
            P  A++G+G F K QY+P L+ ++      KAIWSRS+ESA SAV L ++  P V+ KWG
Sbjct  3    PGFALIGAGGFAKKQYLPLLSTKLMDRVSFKAIWSRSQESAESAVSLIKDRVPEVQPKWG  62

Query  286  GAGLEEIIKDTSII  327
              G  +I+ D SII
Sbjct  63   EEGFNDILMDNSII  76



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 842962938660