BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002A24

Length=547
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009614692.1|  PREDICTED: uncharacterized protein LOC104107561    163   1e-44   Nicotiana tomentosiformis
ref|XP_009780705.1|  PREDICTED: uncharacterized protein LOC104229716    158   1e-42   Nicotiana sylvestris
ref|XP_006363989.1|  PREDICTED: uncharacterized protein LOC102601007    157   4e-42   Solanum tuberosum [potatoes]
ref|XP_004235367.1|  PREDICTED: uncharacterized protein LOC101248757    150   1e-39   Solanum lycopersicum
ref|XP_011073153.1|  PREDICTED: uncharacterized protein LOC105158192    149   4e-39   Sesamum indicum [beniseed]
ref|XP_010069444.1|  PREDICTED: uncharacterized protein LOC104456368    141   2e-36   Eucalyptus grandis [rose gum]
ref|XP_009360040.1|  PREDICTED: uncharacterized protein LOC103950...    138   4e-35   Pyrus x bretschneideri [bai li]
ref|XP_009360039.1|  PREDICTED: uncharacterized protein LOC103950...    137   1e-34   Pyrus x bretschneideri [bai li]
emb|CDO98647.1|  unnamed protein product                                135   3e-34   Coffea canephora [robusta coffee]
ref|XP_006374243.1|  hypothetical protein POPTR_0015s05360g             132   4e-33   
ref|XP_006374246.1|  hypothetical protein POPTR_0015s05360g             132   4e-33   
ref|XP_008240405.1|  PREDICTED: uncharacterized protein LOC103338912    132   7e-33   Prunus mume [ume]
ref|XP_002533448.1|  conserved hypothetical protein                     129   5e-32   
ref|XP_007209930.1|  hypothetical protein PRUPE_ppa004570mg             129   7e-32   
ref|XP_010241168.1|  PREDICTED: uncharacterized protein LOC104585831    129   7e-32   Nelumbo nucifera [Indian lotus]
ref|XP_011047792.1|  PREDICTED: uncharacterized protein LOC105142042    126   8e-31   Populus euphratica
ref|XP_007036963.1|  Uncharacterized protein isoform 3                  124   1e-30   
ref|XP_008393457.1|  PREDICTED: uncharacterized protein LOC103455...    125   2e-30   
ref|XP_008393456.1|  PREDICTED: uncharacterized protein LOC103455...    124   2e-30   
ref|XP_007036962.1|  Uncharacterized protein isoform 2                  124   3e-30   
ref|XP_007036961.1|  Uncharacterized protein isoform 1                  124   3e-30   
ref|XP_002317709.1|  hypothetical protein POPTR_0012s03930g             124   4e-30   Populus trichocarpa [western balsam poplar]
ref|XP_006493269.1|  PREDICTED: uncharacterized protein LOC102611...    122   1e-29   Citrus sinensis [apfelsine]
gb|EYU21849.1|  hypothetical protein MIMGU_mgv1a007186mg                122   1e-29   Erythranthe guttata [common monkey flower]
ref|XP_009355996.1|  PREDICTED: uncharacterized protein LOC103946...    122   2e-29   Pyrus x bretschneideri [bai li]
ref|XP_009355995.1|  PREDICTED: uncharacterized protein LOC103946...    122   3e-29   Pyrus x bretschneideri [bai li]
ref|XP_008798412.1|  PREDICTED: uncharacterized protein LOC103713309    121   4e-29   Phoenix dactylifera
gb|KDO47166.1|  hypothetical protein CISIN_1g014467mg                   121   4e-29   Citrus sinensis [apfelsine]
ref|XP_006441318.1|  hypothetical protein CICLE_v10020337mg             121   4e-29   Citrus clementina [clementine]
ref|XP_011003767.1|  PREDICTED: uncharacterized protein LOC105110429    120   5e-29   Populus euphratica
ref|XP_010687245.1|  PREDICTED: uncharacterized protein LOC104901374    120   7e-29   Beta vulgaris subsp. vulgaris [field beet]
gb|EPS73872.1|  hypothetical protein M569_00881                         119   1e-28   Genlisea aurea
ref|XP_010271178.1|  PREDICTED: uncharacterized protein LOC104607271    119   2e-28   Nelumbo nucifera [Indian lotus]
emb|CBI35458.3|  unnamed protein product                                119   3e-28   Vitis vinifera
ref|XP_002267281.3|  PREDICTED: uncharacterized protein LOC100262899    119   3e-28   Vitis vinifera
ref|XP_008356700.1|  PREDICTED: uncharacterized protein LOC103420...    118   6e-28   
ref|XP_008356699.1|  PREDICTED: uncharacterized protein LOC103420...    117   8e-28   
ref|XP_010936872.1|  PREDICTED: uncharacterized protein LOC105056391    117   8e-28   Elaeis guineensis
ref|XP_010091765.1|  hypothetical protein L484_019353                   117   1e-27   Morus notabilis
gb|KDP30111.1|  hypothetical protein JCGZ_18399                         117   1e-27   Jatropha curcas
gb|EYU24493.1|  hypothetical protein MIMGU_mgv1a007418mg                115   4e-27   Erythranthe guttata [common monkey flower]
ref|XP_009414789.1|  PREDICTED: uncharacterized protein LOC103995...    115   7e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008466989.1|  PREDICTED: uncharacterized protein LOC103504355    114   1e-26   Cucumis melo [Oriental melon]
ref|XP_004137518.1|  PREDICTED: uncharacterized protein LOC101203627    114   2e-26   Cucumis sativus [cucumbers]
ref|XP_010939981.1|  PREDICTED: uncharacterized protein LOC105058679    113   2e-26   
ref|XP_002894114.1|  hypothetical protein ARALYDRAFT_473985             113   3e-26   
ref|XP_004513343.1|  PREDICTED: uncharacterized protein LOC101494...    112   4e-26   
ref|XP_009414790.1|  PREDICTED: uncharacterized protein LOC103995...    112   4e-26   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006374245.1|  hypothetical protein POPTR_0015s05360g             111   7e-26   
gb|KGN64195.1|  hypothetical protein Csa_1G042990                       113   9e-26   Cucumis sativus [cucumbers]
ref|XP_006393405.1|  hypothetical protein EUTSA_v10011507mg             111   1e-25   Eutrema salsugineum [saltwater cress]
gb|KFK36092.1|  hypothetical protein AALP_AA4G076400                    111   1e-25   Arabis alpina [alpine rockcress]
ref|XP_006306266.1|  hypothetical protein CARUB_v10012116mg             111   1e-25   Capsella rubella
ref|XP_006849427.1|  hypothetical protein AMTR_s00024p00021530          110   3e-25   
ref|XP_007160560.1|  hypothetical protein PHAVU_002G331900g             108   9e-25   Phaseolus vulgaris [French bean]
ref|XP_004500125.1|  PREDICTED: uncharacterized protein LOC101505...    104   1e-24   
gb|KHN43658.1|  hypothetical protein glysoja_027724                     108   1e-24   Glycine soja [wild soybean]
ref|XP_003534126.1|  PREDICTED: uncharacterized protein LOC100802...    108   1e-24   Glycine max [soybeans]
emb|CBI40011.3|  unnamed protein product                                107   1e-24   Vitis vinifera
ref|XP_010461662.1|  PREDICTED: uncharacterized protein LOC104742...    108   2e-24   Camelina sativa [gold-of-pleasure]
ref|XP_009408539.1|  PREDICTED: uncharacterized protein LOC103990...    108   2e-24   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB30250.1|  hypothetical protein B456_005G134400                    108   2e-24   Gossypium raimondii
ref|XP_003528983.1|  PREDICTED: uncharacterized protein LOC100777...    107   2e-24   Glycine max [soybeans]
gb|ACU24516.1|  unknown                                                 107   2e-24   Glycine max [soybeans]
ref|XP_002273280.1|  PREDICTED: uncharacterized protein LOC100245...    107   2e-24   Vitis vinifera
gb|AFK42768.1|  unknown                                                 107   3e-24   Lotus japonicus
ref|XP_009408547.1|  PREDICTED: uncharacterized protein LOC103990...    106   6e-24   
gb|KHG11329.1|  Alanine--tRNA ligase                                    106   9e-24   Gossypium arboreum [tree cotton]
dbj|BAJ34170.1|  unnamed protein product                                105   1e-23   Eutrema halophilum
ref|XP_006406690.1|  hypothetical protein EUTSA_v10020677mg             106   1e-23   
ref|XP_008375017.1|  PREDICTED: uncharacterized protein LOC103438...    105   2e-23   
ref|XP_008375019.1|  PREDICTED: uncharacterized protein LOC103438...    105   2e-23   
gb|AGV54799.1|  hypothetical protein                                    105   2e-23   Phaseolus vulgaris [French bean]
gb|KEH26747.1|  plant/T1N15-5 protein                                   105   2e-23   Medicago truncatula
emb|CDX95820.1|  BnaC05g35710D                                          104   3e-23   
ref|XP_010549034.1|  PREDICTED: uncharacterized protein LOC104820...    103   5e-23   Tarenaya hassleriana [spider flower]
ref|XP_010549033.1|  PREDICTED: uncharacterized protein LOC104820...    103   5e-23   Tarenaya hassleriana [spider flower]
gb|KFK39108.1|  hypothetical protein AALP_AA3G202000                    103   6e-23   Arabis alpina [alpine rockcress]
emb|CDX92162.1|  BnaA05g22450D                                          103   9e-23   
ref|XP_009145975.1|  PREDICTED: uncharacterized protein LOC103869650    103   9e-23   Brassica rapa
ref|XP_010465837.1|  PREDICTED: uncharacterized protein LOC104746127    102   1e-22   Camelina sativa [gold-of-pleasure]
ref|XP_006297794.1|  hypothetical protein CARUB_v10013829mg             102   1e-22   Capsella rubella
emb|CAN79123.1|  hypothetical protein VITISV_030635                     102   1e-22   Vitis vinifera
ref|XP_010487675.1|  PREDICTED: uncharacterized protein LOC104765624    102   2e-22   Camelina sativa [gold-of-pleasure]
ref|XP_010505920.1|  PREDICTED: uncharacterized protein LOC104782624    102   2e-22   Camelina sativa [gold-of-pleasure]
ref|XP_010661178.1|  PREDICTED: uncharacterized protein LOC100245...    102   2e-22   
dbj|BAH56904.1|  AT1G48450                                              101   3e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009135549.1|  PREDICTED: uncharacterized protein LOC103859727    101   3e-22   Brassica rapa
gb|AAL32564.1|  Unknown protein                                         101   3e-22   Arabidopsis thaliana [mouse-ear cress]
ref|NP_566588.1|  uncharacterized protein                               101   3e-22   Arabidopsis thaliana [mouse-ear cress]
dbj|BAF01343.1|  hypothetical protein                                   101   3e-22   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001031154.1|  uncharacterized protein                            101   4e-22   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001078173.1|  uncharacterized protein                            101   4e-22   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001185170.1|  uncharacterized protein                            100   4e-22   Arabidopsis thaliana [mouse-ear cress]
ref|NP_175278.1|  uncharacterized protein                               101   5e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002885230.1|  predicted protein                                  100   6e-22   
emb|CDX75937.1|  BnaC03g40200D                                          100   1e-21   
ref|XP_009145005.1|  PREDICTED: uncharacterized protein LOC103868678    100   1e-21   Brassica rapa
ref|XP_007152648.1|  hypothetical protein PHAVU_004G147200g           99.8    2e-21   Phaseolus vulgaris [French bean]
ref|XP_011464472.1|  PREDICTED: uncharacterized protein LOC101299...  99.8    2e-21   Fragaria vesca subsp. vesca
emb|CDX82345.1|  BnaA03g34760D                                        99.4    2e-21   
ref|XP_010479269.1|  PREDICTED: uncharacterized protein LOC104758146  98.2    6e-21   Camelina sativa [gold-of-pleasure]
ref|XP_010500371.1|  PREDICTED: uncharacterized protein LOC104777762  97.8    9e-21   Camelina sativa [gold-of-pleasure]
ref|XP_004299503.1|  PREDICTED: uncharacterized protein LOC101299...  97.4    1e-20   Fragaria vesca subsp. vesca
gb|KJB53076.1|  hypothetical protein B456_008G292100                  95.9    4e-20   Gossypium raimondii
ref|XP_003525180.1|  PREDICTED: uncharacterized protein LOC100817...  94.7    1e-19   Glycine max [soybeans]
ref|XP_006580389.1|  PREDICTED: uncharacterized protein LOC100817...  94.4    1e-19   Glycine max [soybeans]
ref|XP_004503251.1|  PREDICTED: uncharacterized protein LOC101489103  94.0    2e-19   Cicer arietinum [garbanzo]
emb|CDY58279.1|  BnaCnng32840D                                        93.6    3e-19   Brassica napus [oilseed rape]
gb|EAY91660.1|  hypothetical protein OsI_13299                        93.2    5e-19   Oryza sativa Indica Group [Indian rice]
ref|NP_001051084.1|  Os03g0717900                                     92.8    1e-18   
ref|XP_002276652.1|  PREDICTED: uncharacterized protein LOC100260823  90.9    2e-18   Vitis vinifera
ref|XP_010919980.1|  PREDICTED: uncharacterized protein LOC105043949  90.9    2e-18   
gb|AFK36208.1|  unknown                                               91.3    2e-18   Medicago truncatula
gb|ACJ84884.1|  unknown                                               91.3    3e-18   Medicago truncatula
emb|CBI33818.3|  unnamed protein product                              90.9    4e-18   Vitis vinifera
gb|ACF87802.1|  unknown                                               89.4    1e-17   Zea mays [maize]
gb|ADE77481.1|  unknown                                               89.4    1e-17   Picea sitchensis
gb|ABR17692.1|  unknown                                               89.0    2e-17   Picea sitchensis
ref|XP_006854071.1|  hypothetical protein AMTR_s00048p00111750        88.2    2e-17   Amborella trichopoda
ref|XP_006385682.1|  hypothetical protein POPTR_0003s09620g           84.3    3e-17   
ref|XP_009413223.1|  PREDICTED: uncharacterized protein LOC103994...  87.4    5e-17   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAN81624.1|  hypothetical protein VITISV_014254                   84.3    6e-17   Vitis vinifera
ref|NP_001143815.1|  uncharacterized protein LOC100276591             87.0    7e-17   Zea mays [maize]
ref|XP_008800077.1|  PREDICTED: uncharacterized protein LOC103714...  85.9    2e-16   Phoenix dactylifera
ref|XP_011028101.1|  PREDICTED: uncharacterized protein LOC105128231  85.5    2e-16   Populus euphratica
gb|ABF98565.1|  expressed protein                                     84.3    3e-16   Oryza sativa Japonica Group [Japonica rice]
emb|CDP11681.1|  unnamed protein product                              84.7    5e-16   Coffea canephora [robusta coffee]
ref|NP_001169730.1|  hypothetical protein                             84.7    5e-16   Zea mays [maize]
ref|XP_006650499.1|  PREDICTED: uncharacterized protein LOC102715191  83.6    5e-16   
dbj|BAJ85118.1|  predicted protein                                    84.3    6e-16   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011081424.1|  PREDICTED: uncharacterized protein LOC105164476  84.3    6e-16   Sesamum indicum [beniseed]
ref|XP_003530975.1|  PREDICTED: uncharacterized protein LOC100793300  83.6    1e-15   Glycine max [soybeans]
gb|EMT10781.1|  hypothetical protein F775_30852                       83.6    2e-15   
ref|XP_003560595.1|  PREDICTED: uncharacterized protein LOC100829350  82.4    4e-15   Brachypodium distachyon [annual false brome]
ref|XP_009413222.1|  PREDICTED: uncharacterized protein LOC103994...  81.6    5e-15   
ref|XP_006471483.1|  PREDICTED: uncharacterized protein LOC102623998  81.6    6e-15   Citrus sinensis [apfelsine]
gb|KDO57187.1|  hypothetical protein CISIN_1g035864mg                 78.2    6e-15   Citrus sinensis [apfelsine]
ref|XP_007209264.1|  hypothetical protein PRUPE_ppa007392mg           80.9    7e-15   
ref|XP_010261560.1|  PREDICTED: uncharacterized protein LOC104600354  79.7    2e-14   Nelumbo nucifera [Indian lotus]
ref|XP_010677383.1|  PREDICTED: uncharacterized protein LOC104893042  79.0    5e-14   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB21160.1|  hypothetical protein B456_003G185600                  79.0    5e-14   Gossypium raimondii
ref|XP_010088656.1|  hypothetical protein L484_007878                 77.0    6e-14   
gb|KHG08376.1|  Beta-casein                                           78.6    6e-14   Gossypium arboreum [tree cotton]
ref|XP_008238169.1|  PREDICTED: uncharacterized protein LOC103336834  78.6    7e-14   Prunus mume [ume]
gb|KDO36404.1|  hypothetical protein CISIN_1g034247mg                 74.3    7e-14   Citrus sinensis [apfelsine]
gb|KDP30713.1|  hypothetical protein JCGZ_15541                       77.8    1e-13   Jatropha curcas
ref|XP_004300191.1|  PREDICTED: uncharacterized protein LOC101292798  77.4    2e-13   Fragaria vesca subsp. vesca
ref|XP_004981973.1|  PREDICTED: uncharacterized protein LOC101781...  77.0    3e-13   Setaria italica
ref|XP_008373529.1|  PREDICTED: uncharacterized protein LOC103436859  75.5    8e-13   
ref|XP_007040722.1|  Uncharacterized protein TCM_016604               75.1    1e-12   
ref|XP_008466019.1|  PREDICTED: uncharacterized protein LOC103503...  74.7    1e-12   Cucumis melo [Oriental melon]
ref|XP_006352932.1|  PREDICTED: uncharacterized protein LOC102595128  74.7    1e-12   Solanum tuberosum [potatoes]
ref|XP_003612708.1|  hypothetical protein MTR_5g028020                74.7    2e-12   Medicago truncatula
ref|XP_010055250.1|  PREDICTED: uncharacterized protein LOC104443499  74.3    2e-12   
gb|KCW71713.1|  hypothetical protein EUGRSUZ_E00224                   74.7    2e-12   Eucalyptus grandis [rose gum]
ref|XP_004981974.1|  PREDICTED: uncharacterized protein LOC101781...  73.9    3e-12   Setaria italica
ref|XP_009804854.1|  PREDICTED: uncharacterized protein LOC104250017  73.9    3e-12   Nicotiana sylvestris
ref|XP_004136206.1|  PREDICTED: uncharacterized protein LOC101213975  73.6    4e-12   Cucumis sativus [cucumbers]
ref|XP_009373461.1|  PREDICTED: uncharacterized protein LOC103962488  73.6    4e-12   Pyrus x bretschneideri [bai li]
ref|XP_004512464.1|  PREDICTED: uncharacterized protein LOC101507671  72.8    7e-12   Cicer arietinum [garbanzo]
ref|XP_009607216.1|  PREDICTED: uncharacterized protein LOC104101473  72.8    8e-12   Nicotiana tomentosiformis
ref|XP_004245960.1|  PREDICTED: uncharacterized protein LOC101262445  72.4    8e-12   
gb|EPS63452.1|  hypothetical protein M569_11331                       71.2    2e-11   Genlisea aurea
gb|AAQ14307.1|  ABRH7                                                 69.3    2e-11   Marsilea quadrifolia
ref|XP_002518989.1|  conserved hypothetical protein                   71.6    2e-11   Ricinus communis
ref|XP_007158234.1|  hypothetical protein PHAVU_002G135300g           71.2    2e-11   Phaseolus vulgaris [French bean]
ref|XP_010240349.1|  PREDICTED: uncharacterized protein LOC104585415  69.7    8e-11   Brachypodium distachyon [annual false brome]
gb|AFK33975.1|  unknown                                               66.2    1e-10   Lotus japonicus
ref|XP_003534296.1|  PREDICTED: uncharacterized protein LOC100802337  68.2    3e-10   Glycine max [soybeans]
gb|AFW59314.1|  hypothetical protein ZEAMMB73_007794                  67.8    3e-10   
ref|XP_004976664.1|  PREDICTED: uncharacterized protein LOC101761297  67.8    3e-10   Setaria italica
gb|EEC77902.1|  hypothetical protein OsI_17223                        66.6    1e-09   Oryza sativa Indica Group [Indian rice]
ref|XP_008800078.1|  PREDICTED: uncharacterized protein LOC103714...  66.2    1e-09   
ref|XP_002448446.1|  hypothetical protein SORBIDRAFT_06g027240        66.2    1e-09   Sorghum bicolor [broomcorn]
gb|EYU43718.1|  hypothetical protein MIMGU_mgv1a007450mg              65.9    1e-09   Erythranthe guttata [common monkey flower]
gb|AFW59313.1|  hypothetical protein ZEAMMB73_007794                  63.2    1e-09   
ref|NP_001053731.1|  Os04g0595100                                     64.7    4e-09   
ref|NP_001145533.1|  uncharacterized protein LOC100278968             64.7    4e-09   Zea mays [maize]
ref|NP_001242537.1|  uncharacterized protein LOC100810147             63.5    9e-09   
gb|KHN40428.1|  hypothetical protein glysoja_000926                   63.5    9e-09   Glycine soja [wild soybean]
ref|XP_009145204.1|  PREDICTED: uncharacterized protein LOC103868901  62.8    1e-08   Brassica rapa
emb|CDY35549.1|  BnaA05g16370D                                        62.8    2e-08   Brassica napus [oilseed rape]
ref|XP_002977160.1|  hypothetical protein SELMODRAFT_106276           61.2    4e-08   
ref|XP_010540738.1|  PREDICTED: uncharacterized protein LOC104814412  61.2    5e-08   Tarenaya hassleriana [spider flower]
ref|XP_002890970.1|  hypothetical protein ARALYDRAFT_473397           61.2    5e-08   Arabidopsis lyrata subsp. lyrata
ref|XP_006415245.1|  hypothetical protein EUTSA_v10007794mg           60.8    8e-08   Eutrema salsugineum [saltwater cress]
ref|XP_006653725.1|  PREDICTED: uncharacterized protein LOC102702753  60.5    9e-08   Oryza brachyantha
ref|XP_006307539.1|  hypothetical protein CARUB_v10009166mg           60.1    2e-07   
gb|EMT04061.1|  hypothetical protein F775_32804                       59.7    2e-07   
emb|CDY29940.1|  BnaC05g28960D                                        59.3    2e-07   Brassica napus [oilseed rape]
ref|XP_002965311.1|  hypothetical protein SELMODRAFT_82738            58.9    3e-07   
dbj|BAJ87444.1|  predicted protein                                    58.9    3e-07   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS68345.1|  hypothetical protein TRIUR3_07699                     58.5    4e-07   Triticum urartu
ref|NP_564389.1|  uncharacterized protein                             58.5    4e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010478637.1|  PREDICTED: uncharacterized protein LOC104757587  55.8    3e-06   Camelina sativa [gold-of-pleasure]
ref|XP_010461033.1|  PREDICTED: uncharacterized protein LOC104741810  55.8    4e-06   Camelina sativa [gold-of-pleasure]
gb|KFK44959.1|  hypothetical protein AALP_AA1G325800                  55.1    7e-06   Arabis alpina [alpine rockcress]
ref|XP_010499760.1|  PREDICTED: uncharacterized protein LOC104777247  52.4    5e-05   Camelina sativa [gold-of-pleasure]
gb|ABR16101.1|  unknown                                               50.4    2e-04   Picea sitchensis



>ref|XP_009614692.1| PREDICTED: uncharacterized protein LOC104107561 [Nicotiana tomentosiformis]
Length=421

 Score =   163 bits (413),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 91/153 (59%), Positives = 107/153 (70%), Gaps = 15/153 (10%)
 Frame = +3

Query  108  MEMTTSLRSSITVGCGPVKSGRRFTTDAPGFVKFGSKALLSAPSIK-------VKLGNRR  266
            ME  T+  S+ ++   P K+    +     FV+FGS+  +S   IK       VKL NR+
Sbjct  1    METATAFGSAFSICYRPTKA----SLGGSDFVRFGSQFRISPSGIKLYPSVSHVKLSNRK  56

Query  267  VAFGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLE  446
             AFGS KC SIRASL  S SGGSA PIAPL+LESPIGQFL+QIL SHPHLV AAVDQQLE
Sbjct  57   AAFGSRKCTSIRASLSPSESGGSAAPIAPLQLESPIGQFLSQILTSHPHLVPAAVDQQLE  116

Query  447  QLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIA  545
            QLQT+R+ E+Q E    EPSA+GTDIVLYRRIA
Sbjct  117  QLQTERDSEQQKE----EPSATGTDIVLYRRIA  145



>ref|XP_009780705.1| PREDICTED: uncharacterized protein LOC104229716 [Nicotiana sylvestris]
 ref|XP_009780706.1| PREDICTED: uncharacterized protein LOC104229716 [Nicotiana sylvestris]
Length=421

 Score =   158 bits (399),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 90/153 (59%), Positives = 105/153 (69%), Gaps = 15/153 (10%)
 Frame = +3

Query  108  MEMTTSLRSSITVGCGPVKSGRRFTTDAPGFVKFGSKALLSAPSIK-------VKLGNRR  266
            ME  T+  SS ++   P K+    +     FV+FGS+   S   IK       VKL N++
Sbjct  1    METATAFGSSFSICYRPTKA----SLGGSDFVRFGSQFRNSPSGIKLYPSISHVKLSNKK  56

Query  267  VAFGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLE  446
             AFGS KC SIRASL  S SG SA PIAPL+LESPIGQFL+QIL SHPHLV AAVDQQLE
Sbjct  57   AAFGSRKCTSIRASLSPSESGRSAAPIAPLQLESPIGQFLSQILTSHPHLVPAAVDQQLE  116

Query  447  QLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIA  545
            QLQT+R+ E+Q E    EPSA+GTDIVLYRRIA
Sbjct  117  QLQTERDSEQQKE----EPSATGTDIVLYRRIA  145



>ref|XP_006363989.1| PREDICTED: uncharacterized protein LOC102601007 [Solanum tuberosum]
Length=421

 Score =   157 bits (396),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 87/153 (57%), Positives = 105/153 (69%), Gaps = 15/153 (10%)
 Frame = +3

Query  108  MEMTTSLRSSITVGCGPVKSGRRFTTDAPGFVKFGSKALLSAPSIK-------VKLGNRR  266
            ME  T+ RS  ++   P K+    + D   FV+ GS+  +S   IK       VKL NR+
Sbjct  1    METATAFRSGFSICYKPTKA----SLDGSDFVRVGSQLRMSPSGIKLYPSISHVKLSNRK  56

Query  267  VAFGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLE  446
            V+FGS K  +IRAS+  S SGGSA PIAPL+LESPIGQFL+QIL SHPHLV AAVDQQLE
Sbjct  57   VSFGSRKYTAIRASVSPSESGGSAAPIAPLQLESPIGQFLSQILTSHPHLVPAAVDQQLE  116

Query  447  QLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIA  545
             L+TDR+ E+Q E    EPS +GTDIVLYRRIA
Sbjct  117  LLKTDRDAEQQKE----EPSPAGTDIVLYRRIA  145



>ref|XP_004235367.1| PREDICTED: uncharacterized protein LOC101248757 [Solanum lycopersicum]
Length=421

 Score =   150 bits (378),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 90/156 (58%), Positives = 104/156 (67%), Gaps = 21/156 (13%)
 Frame = +3

Query  108  MEMTTSLRSSITVGCGPVKSGRRFTTDAPG---FVKFGSKALLSAPSIK-------VKLG  257
            ME  T+ RS  ++ C       R T  A G   FV+ GS+  +S   IK       VKL 
Sbjct  1    METATAFRSGFSI-CN------RATKAALGGSDFVRVGSQLRMSPSGIKLYPSISHVKLS  53

Query  258  NRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQ  437
            NR+VAFGS K  +IRAS+  S SGGSA PIAPL+LESPIGQFL QIL SHPHLVSAAVDQ
Sbjct  54   NRKVAFGSRKYTAIRASVSPSESGGSAAPIAPLQLESPIGQFLCQILTSHPHLVSAAVDQ  113

Query  438  QLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIA  545
            QLE L+ DR+ E+Q E    EPS +GTDIVLYRRIA
Sbjct  114  QLELLKIDRDAEQQKE----EPSIAGTDIVLYRRIA  145



>ref|XP_011073153.1| PREDICTED: uncharacterized protein LOC105158192 [Sesamum indicum]
Length=421

 Score =   149 bits (375),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 80/140 (57%), Positives = 101/140 (72%), Gaps = 21/140 (15%)
 Frame = +3

Query  177  FTTDAPGFV----------KFGSKALLSAPSIK-------VKLGNRRVAFGSTKCNSIRA  305
            F++ +P +V          + GS++LLS   I+       VKLGNR+V F + KC  IRA
Sbjct  11   FSSVSPNWVARSGPARPELRVGSRSLLSYSWIRQRPSISHVKLGNRKVDFVTRKCTGIRA  70

Query  306  SLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNE  485
            S+  S+SG +A PIAPL+LESPIGQFL+QILVSHPHLV AAV+QQLEQLQTDR+ EK+ E
Sbjct  71   SMQPSDSGSAAAPIAPLQLESPIGQFLSQILVSHPHLVPAAVEQQLEQLQTDRDAEKEKE  130

Query  486  KQNDEPSASGTDIVLYRRIA  545
                EP+ASGT++VLYRRIA
Sbjct  131  ----EPAASGTELVLYRRIA  146



>ref|XP_010069444.1| PREDICTED: uncharacterized protein LOC104456368 [Eucalyptus grandis]
 gb|KCW57801.1| hypothetical protein EUGRSUZ_H00558 [Eucalyptus grandis]
Length=423

 Score =   141 bits (356),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 84/151 (56%), Positives = 102/151 (68%), Gaps = 17/151 (11%)
 Frame = +3

Query  120  TSLRSSITVGCGPVKSGRR---FTTDAPGFVKFGSKALLSAPS------IKVKLGNRRVA  272
            T+ RSS      P     R      D PGFV+FG  A L APS      ++ + G+RRVA
Sbjct  7    TAFRSSTVGALRPSPCASRSAVLAADGPGFVRFG--AGLPAPSKHYTSSLRSRAGHRRVA  64

Query  273  FGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQL  452
             GS +C  +RAS    ++G SA PIAPLKLESPIGQFL++ILVSHPHLV AAV+QQLEQL
Sbjct  65   VGSRRC-MVRASASFESAGSSA-PIAPLKLESPIGQFLSEILVSHPHLVPAAVEQQLEQL  122

Query  453  QTDRNLEKQNEKQNDEPSASGTDIVLYRRIA  545
            QTDR+ E + E    EP+ASGT++VLYRRIA
Sbjct  123  QTDRDAETKKE----EPNASGTELVLYRRIA  149



>ref|XP_009360040.1| PREDICTED: uncharacterized protein LOC103950540 isoform X2 [Pyrus 
x bretschneideri]
Length=430

 Score =   138 bits (347),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 75/129 (58%), Positives = 96/129 (74%), Gaps = 7/129 (5%)
 Frame = +3

Query  177  FTTDAPGFVKFGSKA---LLSAPSI-KVKLGNRRVAFGSTKCNSIRASLPLS--NSGGSA  338
             T + PGF++ G K    +    SI + K+G+RR+ FGS +   +RA    S  +S GSA
Sbjct  29   LTANGPGFLRLGPKTHSPIKHQFSICQPKVGHRRMGFGSRRGFVVRAVAASSSPDSAGSA  88

Query  339  MPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGT  518
             PIAPL+LESPIGQFL+QI++SHPHLV +AVDQQLEQLQTDR+ E++ E Q +EPSASGT
Sbjct  89   SPIAPLQLESPIGQFLSQIMISHPHLVPSAVDQQLEQLQTDRDAEQKKE-QKEEPSASGT  147

Query  519  DIVLYRRIA  545
            D+VLYRRIA
Sbjct  148  DLVLYRRIA  156



>ref|XP_009360039.1| PREDICTED: uncharacterized protein LOC103950540 isoform X1 [Pyrus 
x bretschneideri]
Length=431

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 76/132 (58%), Positives = 97/132 (73%), Gaps = 12/132 (9%)
 Frame = +3

Query  177  FTTDAPGFVKFGSKALLSAP------SI-KVKLGNRRVAFGSTKCNSIRASLPLS--NSG  329
             T + PGF++ G K    +P      SI + K+G+RR+ FGS +   +RA    S  +S 
Sbjct  29   LTANGPGFLRLGPKT--HSPIKQHQFSICQPKVGHRRMGFGSRRGFVVRAVAASSSPDSA  86

Query  330  GSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSA  509
            GSA PIAPL+LESPIGQFL+QI++SHPHLV +AVDQQLEQLQTDR+ E++ E Q +EPSA
Sbjct  87   GSASPIAPLQLESPIGQFLSQIMISHPHLVPSAVDQQLEQLQTDRDAEQKKE-QKEEPSA  145

Query  510  SGTDIVLYRRIA  545
            SGTD+VLYRRIA
Sbjct  146  SGTDLVLYRRIA  157



>emb|CDO98647.1| unnamed protein product [Coffea canephora]
Length=424

 Score =   135 bits (341),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 82/154 (53%), Positives = 102/154 (66%), Gaps = 15/154 (10%)
 Frame = +3

Query  108  MEMTTSLRSSITVGCGPVKSGRRFTTDAPGFVKFGSKALLSAPSIK-------VKLGNRR  266
            ME   + RSS+ +   P     R     P FV+FGS + ++  S+K       VKLG  R
Sbjct  1    METAATFRSSLGI---PSYYDVRSVVKGPDFVQFGSISRVTPASVKQHPLISHVKLGQSR  57

Query  267  VAFGSTKCNSIRASLPLSNSGGSAM-PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQL  443
            V   S KC  IR+S+  S++ G +  PIAPL+LESPIGQFL++ILVSHPHLV AAV+QQL
Sbjct  58   VTLKSRKCTRIRSSMSSSSNSGGSTAPIAPLQLESPIGQFLSEILVSHPHLVPAAVEQQL  117

Query  444  EQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIA  545
            EQLQTDR+ E Q E    EP+ASGTD+VLYRRIA
Sbjct  118  EQLQTDRDAESQKE----EPAASGTDLVLYRRIA  147



>ref|XP_006374243.1| hypothetical protein POPTR_0015s05360g [Populus trichocarpa]
 ref|XP_006374244.1| hypothetical protein POPTR_0015s05360g [Populus trichocarpa]
 gb|ERP52040.1| hypothetical protein POPTR_0015s05360g [Populus trichocarpa]
 gb|ERP52041.1| hypothetical protein POPTR_0015s05360g [Populus trichocarpa]
Length=424

 Score =   132 bits (333),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 81/151 (54%), Positives = 102/151 (68%), Gaps = 11/151 (7%)
 Frame = +3

Query  108  MEMTTSLRSSITVGCG-PVKSGRRF---TTDAPGFVKFGSKALLSAPSIKVKLGNRRVAF  275
            ME  T+     ++G   P KS  R     T+   FV F  K   S      KLG+RRVA+
Sbjct  1    MEAATATVIGSSIGISTPAKSVARLGFLATNKQDFVHFPIKRHSSVSY--SKLGHRRVAY  58

Query  276  GSTKCNSIRASLPLSNSGGSAM-PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQL  452
            GS +C ++RAS   S+    ++ PIAPL+LESPIGQFL+QILVSHPHLV AAV+QQLEQL
Sbjct  59   GSRRCMAVRASSSSSSDSSGSIVPIAPLQLESPIGQFLSQILVSHPHLVPAAVEQQLEQL  118

Query  453  QTDRNLEKQNEKQNDEPSASGTDIVLYRRIA  545
            QTDR+    +EKQ ++PSA+GTD+VLYRRIA
Sbjct  119  QTDRD----SEKQKEDPSATGTDLVLYRRIA  145



>ref|XP_006374246.1| hypothetical protein POPTR_0015s05360g [Populus trichocarpa]
 ref|XP_006374247.1| hypothetical protein POPTR_0015s05360g [Populus trichocarpa]
 gb|ABK96147.1| unknown [Populus trichocarpa]
 gb|ERP52043.1| hypothetical protein POPTR_0015s05360g [Populus trichocarpa]
 gb|ERP52044.1| hypothetical protein POPTR_0015s05360g [Populus trichocarpa]
Length=417

 Score =   132 bits (332),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 81/151 (54%), Positives = 102/151 (68%), Gaps = 11/151 (7%)
 Frame = +3

Query  108  MEMTTSLRSSITVGCG-PVKSGRRF---TTDAPGFVKFGSKALLSAPSIKVKLGNRRVAF  275
            ME  T+     ++G   P KS  R     T+   FV F  K   S      KLG+RRVA+
Sbjct  1    MEAATATVIGSSIGISTPAKSVARLGFLATNKQDFVHFPIKRHSSVS--YSKLGHRRVAY  58

Query  276  GSTKCNSIRASLPLSNSGGSAM-PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQL  452
            GS +C ++RAS   S+    ++ PIAPL+LESPIGQFL+QILVSHPHLV AAV+QQLEQL
Sbjct  59   GSRRCMAVRASSSSSSDSSGSIVPIAPLQLESPIGQFLSQILVSHPHLVPAAVEQQLEQL  118

Query  453  QTDRNLEKQNEKQNDEPSASGTDIVLYRRIA  545
            QTDR+    +EKQ ++PSA+GTD+VLYRRIA
Sbjct  119  QTDRD----SEKQKEDPSATGTDLVLYRRIA  145



>ref|XP_008240405.1| PREDICTED: uncharacterized protein LOC103338912 [Prunus mume]
Length=428

 Score =   132 bits (331),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 90/125 (72%), Gaps = 9/125 (7%)
 Frame = +3

Query  177  FTTDAPGFVKFGSKALLSAPSIKVKLGNRRVAFGSTKCNSIRASL--PLSNSGGSAMPIA  350
            F   +PGF  F  K   S    KV  G+RR+ FGS +C  +RA+   P  +S GS  PIA
Sbjct  37   FLRLSPGF-HFSIKHQFSISQPKV--GHRRMGFGSRRCLVVRAAAASPSPDSTGSTSPIA  93

Query  351  PLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVL  530
            PL+LESPIGQFL+QI++SHPHLV +AV+QQLEQLQTDR+ E++ E    EPSASGTD+VL
Sbjct  94   PLQLESPIGQFLSQIMISHPHLVPSAVEQQLEQLQTDRDTEQKQE----EPSASGTDLVL  149

Query  531  YRRIA  545
            YRRIA
Sbjct  150  YRRIA  154



>ref|XP_002533448.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF28932.1| conserved hypothetical protein [Ricinus communis]
Length=392

 Score =   129 bits (324),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 72/153 (47%), Positives = 98/153 (64%), Gaps = 16/153 (10%)
 Frame = +3

Query  87   IRHCCCMMEMTTSLRSSITVGCGPVKSGRRFTTDAPGFVKFGSKALLSAPSIKVKLGNRR  266
            +R+   M + +T++  S+ +             + PGF++F +    S+ S   K G RR
Sbjct  9    VRYPIGMYKPSTTVGRSVFLAA-----------NGPGFLRFSTTKHYSSVSYG-KQGYRR  56

Query  267  VAFGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLE  446
             AFG+ +  ++RAS   S+  G    IAPL+LESPIGQFL+QIL++HPHLV AAV+QQLE
Sbjct  57   EAFGNRRYTAVRASSSSSDRAGPPAQIAPLQLESPIGQFLSQILINHPHLVPAAVEQQLE  116

Query  447  QLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIA  545
            QLQTDR+ +K  E    EPS SGTD+VLYRRIA
Sbjct  117  QLQTDRDADKHKE----EPSVSGTDLVLYRRIA  145



>ref|XP_007209930.1| hypothetical protein PRUPE_ppa004570mg [Prunus persica]
 gb|EMJ11129.1| hypothetical protein PRUPE_ppa004570mg [Prunus persica]
Length=502

 Score =   129 bits (325),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 89/125 (71%), Gaps = 9/125 (7%)
 Frame = +3

Query  177  FTTDAPGFVKFGSKALLSAPSIKVKLGNRRVAFGSTKCNSIRASL--PLSNSGGSAMPIA  350
            F   +PGF  F  K   S    KV  G+ R+ FGS +C  +RA+   P  +S GS  PIA
Sbjct  111  FLRLSPGF-HFSIKHQFSISQPKV--GHWRMGFGSRRCLVVRAAAASPSPDSTGSTSPIA  167

Query  351  PLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVL  530
            PL+LESPIGQFL+QI++SHPHLV +AV+QQLEQLQTDR+ E++ E    EPSASGTD+VL
Sbjct  168  PLQLESPIGQFLSQIMISHPHLVPSAVEQQLEQLQTDRDTEQKQE----EPSASGTDLVL  223

Query  531  YRRIA  545
            YRRIA
Sbjct  224  YRRIA  228



>ref|XP_010241168.1| PREDICTED: uncharacterized protein LOC104585831 [Nelumbo nucifera]
Length=424

 Score =   129 bits (323),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 93/156 (60%), Gaps = 16/156 (10%)
 Frame = +3

Query  108  MEMTTSLRSSITVGCGP---VKSGRRFTTDAPGFVKFGSKALLSAPSIK-------VKLG  257
            ME    LRSS  + C P   V      T  AP FV F SK  LS   IK        K G
Sbjct  1    MEAVAVLRSSSGI-CKPPNFVTESGFLTARAPDFVFFNSKLRLSNGWIKHSPSTYLSKQG  59

Query  258  NRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQ  437
                 F S K   ++AS    +S  SA PIAPLKLESP+GQFL QIL SHPHLV AAVDQ
Sbjct  60   QSSSVFKSRKRTIMKASAS-QDSTESASPIAPLKLESPVGQFLAQILRSHPHLVPAAVDQ  118

Query  438  QLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIA  545
            QLEQLQTDR+ EKQ E    EPS+S TD+VLYRRIA
Sbjct  119  QLEQLQTDRDAEKQKE----EPSSSSTDLVLYRRIA  150



>ref|XP_011047792.1| PREDICTED: uncharacterized protein LOC105142042 [Populus euphratica]
Length=418

 Score =   126 bits (316),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 103/152 (68%), Gaps = 12/152 (8%)
 Frame = +3

Query  108  MEMTTSLRSSITVGC-GPVKSGRRF---TTDAPGFVKFGSKALLSAPSIKVKLG-NRRVA  272
            ME  T+     ++G  GP KS  R     T+   FV+F  K   S      KLG +RRVA
Sbjct  1    MEAATATVIGSSIGISGPGKSVARLGFLATNKQDFVRFPIKRHSSVS--YSKLGSHRRVA  58

Query  273  FGSTKCNSIRASLPLSNSGGSAM-PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQ  449
            +GS +  ++RAS   S+    ++ PIAPL+LESPIGQFL+QILVSHPHLV AAV+QQLEQ
Sbjct  59   YGSRRYMAVRASSSSSSDSSGSIVPIAPLQLESPIGQFLSQILVSHPHLVPAAVEQQLEQ  118

Query  450  LQTDRNLEKQNEKQNDEPSASGTDIVLYRRIA  545
            LQTDR+    +EKQ ++PSA+GTD+VLYRRIA
Sbjct  119  LQTDRD----SEKQKEDPSATGTDLVLYRRIA  146



>ref|XP_007036963.1| Uncharacterized protein isoform 3, partial [Theobroma cacao]
 gb|EOY21464.1| Uncharacterized protein isoform 3, partial [Theobroma cacao]
Length=360

 Score =   124 bits (312),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 71/130 (55%), Positives = 89/130 (68%), Gaps = 12/130 (9%)
 Frame = +3

Query  177  FTTDAPGFVKFGSKALL------SAPSIKVKLGNRRVAFGSTKCNSIRASLPLSNSGGSA  338
             T + P F++F +K  L       +P    K  NRR+A GS +   +RAS    +S G  
Sbjct  43   LTANEPHFLRFAAKPRLPFSIKHYSPLSYSKPQNRRMALGSRRGMVVRASSS-PDSAGPT  101

Query  339  MPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSAS-G  515
             PIAPL++ESPIGQFL+QIL+SHPHLV AAV+QQLEQLQTDR+ E++ E    EPSAS G
Sbjct  102  APIAPLQMESPIGQFLSQILISHPHLVPAAVEQQLEQLQTDRDAEEKKE----EPSASAG  157

Query  516  TDIVLYRRIA  545
            TD+VLYRRIA
Sbjct  158  TDLVLYRRIA  167



>ref|XP_008393457.1| PREDICTED: uncharacterized protein LOC103455652 isoform X2 [Malus 
domestica]
Length=431

 Score =   125 bits (314),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 94/129 (73%), Gaps = 7/129 (5%)
 Frame = +3

Query  177  FTTDAPGFVKFGSKA---LLSAPSI-KVKLGNRRVAFGSTKCNSIRASLPLSNSGGSAM-  341
             T + PGF++ G K    +    SI + K+G+RR+ +GS +   +RA+   S+   +   
Sbjct  29   LTANGPGFLRLGPKTHSPIKHRFSICQPKVGHRRMGYGSRRGFVVRAAAASSSPDSAGSA  88

Query  342  -PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGT  518
             PIAPL+LESPIGQFL+QI++SHPHLV +AVDQQLEQLQTDR+ E++ E Q +EPSASGT
Sbjct  89   SPIAPLQLESPIGQFLSQIMISHPHLVPSAVDQQLEQLQTDRDAEQKKE-QKEEPSASGT  147

Query  519  DIVLYRRIA  545
            D+VLYRRIA
Sbjct  148  DLVLYRRIA  156



>ref|XP_008393456.1| PREDICTED: uncharacterized protein LOC103455652 isoform X1 [Malus 
domestica]
Length=432

 Score =   124 bits (312),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 68/130 (52%), Positives = 91/130 (70%), Gaps = 8/130 (6%)
 Frame = +3

Query  177  FTTDAPGFVKFGSKALLSAPSIKV-----KLGNRRVAFGSTKCNSIRASLPLSNSGGSAM  341
             T + PGF++ G K        +      K+G+RR+ +GS +   +RA+   S+   +  
Sbjct  29   LTANGPGFLRLGPKTHSPIKQHRFSICQPKVGHRRMGYGSRRGFVVRAAAASSSPDSAGS  88

Query  342  --PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASG  515
              PIAPL+LESPIGQFL+QI++SHPHLV +AVDQQLEQLQTDR+ E++ E Q +EPSASG
Sbjct  89   ASPIAPLQLESPIGQFLSQIMISHPHLVPSAVDQQLEQLQTDRDAEQKKE-QKEEPSASG  147

Query  516  TDIVLYRRIA  545
            TD+VLYRRIA
Sbjct  148  TDLVLYRRIA  157



>ref|XP_007036962.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOY21463.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=428

 Score =   124 bits (311),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 71/130 (55%), Positives = 89/130 (68%), Gaps = 12/130 (9%)
 Frame = +3

Query  177  FTTDAPGFVKFGSKALL------SAPSIKVKLGNRRVAFGSTKCNSIRASLPLSNSGGSA  338
             T + P F++F +K  L       +P    K  NRR+A GS +   +RAS    +S G  
Sbjct  30   LTANEPHFLRFAAKPRLPFSIKHYSPLSYSKPQNRRMALGSRRGMVVRASSS-PDSAGPT  88

Query  339  MPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSAS-G  515
             PIAPL++ESPIGQFL+QIL+SHPHLV AAV+QQLEQLQTDR+ E++ E    EPSAS G
Sbjct  89   APIAPLQMESPIGQFLSQILISHPHLVPAAVEQQLEQLQTDRDAEEKKE----EPSASAG  144

Query  516  TDIVLYRRIA  545
            TD+VLYRRIA
Sbjct  145  TDLVLYRRIA  154



>ref|XP_007036961.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY21462.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=438

 Score =   124 bits (311),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 71/130 (55%), Positives = 89/130 (68%), Gaps = 12/130 (9%)
 Frame = +3

Query  177  FTTDAPGFVKFGSKALL------SAPSIKVKLGNRRVAFGSTKCNSIRASLPLSNSGGSA  338
             T + P F++F +K  L       +P    K  NRR+A GS +   +RAS    +S G  
Sbjct  30   LTANEPHFLRFAAKPRLPFSIKHYSPLSYSKPQNRRMALGSRRGMVVRASSS-PDSAGPT  88

Query  339  MPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSAS-G  515
             PIAPL++ESPIGQFL+QIL+SHPHLV AAV+QQLEQLQTDR+ E++ E    EPSAS G
Sbjct  89   APIAPLQMESPIGQFLSQILISHPHLVPAAVEQQLEQLQTDRDAEEKKE----EPSASAG  144

Query  516  TDIVLYRRIA  545
            TD+VLYRRIA
Sbjct  145  TDLVLYRRIA  154



>ref|XP_002317709.1| hypothetical protein POPTR_0012s03930g [Populus trichocarpa]
 ref|XP_006376704.1| hypothetical protein POPTR_0012s03930g [Populus trichocarpa]
 gb|ABK95039.1| unknown [Populus trichocarpa]
 gb|EEE95929.1| hypothetical protein POPTR_0012s03930g [Populus trichocarpa]
 gb|ERP54501.1| hypothetical protein POPTR_0012s03930g [Populus trichocarpa]
Length=401

 Score =   124 bits (310),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 79/151 (52%), Positives = 99/151 (66%), Gaps = 11/151 (7%)
 Frame = +3

Query  108  MEMTTSLRSSITVG-CGPVKSGRR---FTTDAPGFVKFGSKALLSAPSIKVKLGNRRVAF  275
            ME  T+     ++G C P KS  R     T    FV+F  K   S      K G+RRVA+
Sbjct  1    MEAATATFIGSSIGICRPAKSVARSGFLATIGQDFVRFPHKHCSSVSY--SKPGHRRVAY  58

Query  276  GSTKCNSIRASLPLSNSGGSAMP-IAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQL  452
            GS +C  +RASL  S+    ++  IAPL+LESP+GQFL+QIL+SHPHLV AAV+QQLEQL
Sbjct  59   GSRRCMGVRASLSSSSDSSGSIASIAPLQLESPVGQFLSQILISHPHLVPAAVEQQLEQL  118

Query  453  QTDRNLEKQNEKQNDEPSASGTDIVLYRRIA  545
            QTDR+ EKQ E    EPSA+ TD+VLYR+IA
Sbjct  119  QTDRDAEKQKE----EPSATSTDLVLYRKIA  145



>ref|XP_006493269.1| PREDICTED: uncharacterized protein LOC102611948 isoform X1 [Citrus 
sinensis]
 ref|XP_006493270.1| PREDICTED: uncharacterized protein LOC102611948 isoform X2 [Citrus 
sinensis]
Length=418

 Score =   122 bits (307),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 72/122 (59%), Positives = 87/122 (71%), Gaps = 9/122 (7%)
 Frame = +3

Query  192  PGFVKFGSKALLSAPSIKV----KLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPLK  359
            P F++FG+K+LL           K  +RR  FGS +C  +RAS   S S GS  PIAPL+
Sbjct  29   PDFIRFGTKSLLPIKHYSSVSNPKPRHRRKGFGSRRCMVVRASS-SSESSGSMDPIAPLQ  87

Query  360  LESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRR  539
            LESP+GQFL+QIL+SHPHLV AAV+QQLEQLQTDR+ EK  E    E SASGT++VLYRR
Sbjct  88   LESPVGQFLSQILISHPHLVPAAVEQQLEQLQTDRDAEKHKE----EASASGTELVLYRR  143

Query  540  IA  545
            IA
Sbjct  144  IA  145



>gb|EYU21849.1| hypothetical protein MIMGU_mgv1a007186mg [Erythranthe guttata]
Length=416

 Score =   122 bits (307),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 69/121 (57%), Positives = 89/121 (74%), Gaps = 11/121 (9%)
 Frame = +3

Query  201  VKFGSKALLSAPSIK-------VKLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPLK  359
            ++  S+++LS   I+       +K G+R+V   S K  SIRAS    +SG S+ PIAPL+
Sbjct  29   LRLASRSVLSNAWIQQRQSISHMKFGSRKVEPLSKKRTSIRASKQSPDSGNSSAPIAPLQ  88

Query  360  LESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRR  539
            LESPIGQFL+QIL+SHPHLV AAV+QQLEQLQTDR+ E  NEK++   SASGT++VLYRR
Sbjct  89   LESPIGQFLSQILISHPHLVPAAVEQQLEQLQTDRDAE--NEKED--LSASGTELVLYRR  144

Query  540  I  542
            I
Sbjct  145  I  145



>ref|XP_009355996.1| PREDICTED: uncharacterized protein LOC103946898 isoform X2 [Pyrus 
x bretschneideri]
Length=428

 Score =   122 bits (306),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 70/131 (53%), Positives = 92/131 (70%), Gaps = 14/131 (11%)
 Frame = +3

Query  177  FTTDAPGFVKFGSKALLSAPS------IKVKLGNRRVAFGSTKCNSIRASLPLSNSGGSA  338
             T + PGF++ G KA   +PS       + K+G+RR+ +G+ +   +RA+   S+   + 
Sbjct  29   LTANGPGFLRLGPKA--HSPSKHQFSICQPKVGHRRMGYGTRRGLVVRAAAASSSPDSAG  86

Query  339  M--PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSAS  512
               PIAPLKLESPIGQFL+QI++SHPHLV +AVDQQLEQL TDR+ E++ E    EPSAS
Sbjct  87   SDSPIAPLKLESPIGQFLSQIMISHPHLVPSAVDQQLEQLLTDRDAEEKKE----EPSAS  142

Query  513  GTDIVLYRRIA  545
            GTDIVLYRRIA
Sbjct  143  GTDIVLYRRIA  153



>ref|XP_009355995.1| PREDICTED: uncharacterized protein LOC103946898 isoform X1 [Pyrus 
x bretschneideri]
Length=429

 Score =   122 bits (305),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 92/132 (70%), Gaps = 15/132 (11%)
 Frame = +3

Query  177  FTTDAPGFVKFGSKALLSAPS-------IKVKLGNRRVAFGSTKCNSIRASLPLSNSGGS  335
             T + PGF++ G KA   +PS        + K+G+RR+ +G+ +   +RA+   S+   +
Sbjct  29   LTANGPGFLRLGPKA--HSPSKEHQFSICQPKVGHRRMGYGTRRGLVVRAAAASSSPDSA  86

Query  336  AM--PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSA  509
                PIAPLKLESPIGQFL+QI++SHPHLV +AVDQQLEQL TDR+ E++ E    EPSA
Sbjct  87   GSDSPIAPLKLESPIGQFLSQIMISHPHLVPSAVDQQLEQLLTDRDAEEKKE----EPSA  142

Query  510  SGTDIVLYRRIA  545
            SGTDIVLYRRIA
Sbjct  143  SGTDIVLYRRIA  154



>ref|XP_008798412.1| PREDICTED: uncharacterized protein LOC103713309 [Phoenix dactylifera]
 ref|XP_008798421.1| PREDICTED: uncharacterized protein LOC103713309 [Phoenix dactylifera]
Length=418

 Score =   121 bits (303),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 85/125 (68%), Gaps = 13/125 (10%)
 Frame = +3

Query  192  PGFVKFGSKALLSAPSIK-------VKLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIA  350
            P FV F  ++  S+  +K        KLG R   FG  + + IRASL   NS  S+ PIA
Sbjct  31   PDFVSFDPRSHFSSRWLKGCRSISVRKLGQR--GFGDRRNSGIRASLSSPNSSESSSPIA  88

Query  351  PLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVL  530
            PL+LESPIGQFL+QIL+SHPHLV AAVDQQL+QLQTDR  EK  E    EPS SGTD+VL
Sbjct  89   PLQLESPIGQFLSQILISHPHLVPAAVDQQLDQLQTDREAEKNKE----EPSPSGTDLVL  144

Query  531  YRRIA  545
            YRRIA
Sbjct  145  YRRIA  149



>gb|KDO47166.1| hypothetical protein CISIN_1g014467mg [Citrus sinensis]
Length=424

 Score =   121 bits (303),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 70/122 (57%), Positives = 87/122 (71%), Gaps = 10/122 (8%)
 Frame = +3

Query  192  PGFVKFGSKALLSAPSIKV----KLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPLK  359
            P F++FG+K+LL           K  +RR  FGS +C  +RAS   S S  S  PIAPL+
Sbjct  36   PDFIRFGTKSLLPIKHYSSVSNPKPRHRRKGFGSRRCMVVRASS-SSESSRSMDPIAPLQ  94

Query  360  LESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRR  539
            LESP+GQFL+QIL+SHPHLV AAV+QQLEQLQTDR+ EK     ++E SASGT++VLYRR
Sbjct  95   LESPVGQFLSQILISHPHLVPAAVEQQLEQLQTDRDAEK-----HEEASASGTELVLYRR  149

Query  540  IA  545
            IA
Sbjct  150  IA  151



>ref|XP_006441318.1| hypothetical protein CICLE_v10020337mg [Citrus clementina]
 ref|XP_006441319.1| hypothetical protein CICLE_v10020337mg [Citrus clementina]
 ref|XP_006441320.1| hypothetical protein CICLE_v10020337mg [Citrus clementina]
 gb|ESR54558.1| hypothetical protein CICLE_v10020337mg [Citrus clementina]
 gb|ESR54559.1| hypothetical protein CICLE_v10020337mg [Citrus clementina]
 gb|ESR54560.1| hypothetical protein CICLE_v10020337mg [Citrus clementina]
Length=417

 Score =   121 bits (303),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 70/122 (57%), Positives = 87/122 (71%), Gaps = 10/122 (8%)
 Frame = +3

Query  192  PGFVKFGSKALLSAPSIKV----KLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPLK  359
            P F++FG+K+LL           K  +RR  FGS +C  +RAS   S S  S  PIAPL+
Sbjct  29   PDFIRFGTKSLLPIKHYSSVSNPKPRHRRKGFGSRRCMVVRASS-SSESSRSMDPIAPLQ  87

Query  360  LESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRR  539
            LESP+GQFL+QIL+SHPHLV AAV+QQLEQLQTDR+ EK     ++E SASGT++VLYRR
Sbjct  88   LESPVGQFLSQILISHPHLVPAAVEQQLEQLQTDRDAEK-----HEEASASGTELVLYRR  142

Query  540  IA  545
            IA
Sbjct  143  IA  144



>ref|XP_011003767.1| PREDICTED: uncharacterized protein LOC105110429 [Populus euphratica]
Length=401

 Score =   120 bits (302),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 86/117 (74%), Gaps = 7/117 (6%)
 Frame = +3

Query  198  FVKFGSKALLSAPSIKVKLGNRRVAFGSTKCNSIRASLPLSNSGGSAMP-IAPLKLESPI  374
            FV+F  K   S      K G+RRVA+GS +C  +RASL  S+    ++  IAPL+LESP+
Sbjct  35   FVRFPHKHYSSVSY--SKPGHRRVAYGSRRCMGVRASLSSSSDSSGSIASIAPLQLESPV  92

Query  375  GQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIA  545
            GQFL+QIL+SHPHLV AAV+QQLEQLQTDR+ EKQ E    EPSA+ TD+VLYR+IA
Sbjct  93   GQFLSQILISHPHLVPAAVEQQLEQLQTDRDAEKQKE----EPSATSTDLVLYRKIA  145



>ref|XP_010687245.1| PREDICTED: uncharacterized protein LOC104901374 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010687246.1| PREDICTED: uncharacterized protein LOC104901374 [Beta vulgaris 
subsp. vulgaris]
Length=420

 Score =   120 bits (302),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 78/151 (52%), Positives = 98/151 (65%), Gaps = 11/151 (7%)
 Frame = +3

Query  108  MEMTTSLRSSITVGCGPVKSGRRFTTDAPG---FVKFGSKALLSAPS--IKVKLGNRRVA  272
            ME  T LRS +++   P K   R +   P    F++F +    S  +   +VKL    ++
Sbjct  1    MEAATVLRSPLSISI-PQKLASRPSVSVPNGSSFMRFTNNFRFSKSTSPCRVKLEGGSLS  59

Query  273  FGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQL  452
              S K   +RAS   SNS  S  PIAPL+LESP+GQFL+QILVSHPHLV AAVDQQLEQL
Sbjct  60   SRSRKSLMVRASKS-SNSFDSTAPIAPLQLESPVGQFLSQILVSHPHLVPAAVDQQLEQL  118

Query  453  QTDRNLEKQNEKQNDEPSASGTDIVLYRRIA  545
            QT+     ++EKQ +EPSASGTD+VLYRRIA
Sbjct  119  QTN----CESEKQKEEPSASGTDLVLYRRIA  145



>gb|EPS73872.1| hypothetical protein M569_00881 [Genlisea aurea]
Length=411

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 77/99 (78%), Gaps = 5/99 (5%)
 Frame = +3

Query  252  LGNRRVAFGSTKCNSI-RASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAA  428
            LGNR+ +F S++   + RAS+  S+ G S  PIAPL+LESP+GQFL+ IL+SHPHLV AA
Sbjct  50   LGNRKPSFSSSRQRPVTRASIHPSDFGSSQAPIAPLQLESPVGQFLSNILMSHPHLVPAA  109

Query  429  VDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIA  545
            V+QQLEQLQTDR    Q E+   EPSASGT++VLYRRIA
Sbjct  110  VEQQLEQLQTDR----QAEQTKQEPSASGTELVLYRRIA  144



>ref|XP_010271178.1| PREDICTED: uncharacterized protein LOC104607271 [Nelumbo nucifera]
Length=424

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 82/156 (53%), Positives = 91/156 (58%), Gaps = 16/156 (10%)
 Frame = +3

Query  108  MEMTTSLRSSITVGCGP---VKSGRRFTTDAPGFVKFGSKALLSAPSIK-------VKLG  257
            ME    LRSS  +G  P    KSG   T  AP FV   SK   S   IK        K  
Sbjct  1    MEAVAVLRSSSGIGKHPDFVAKSGV-LTASAPHFVCLSSKLRFSNVWIKHSPSTYLSKQR  59

Query  258  NRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQ  437
              R    S K   +RAS    +S  SA PIAPL+LESP+GQFL QIL SHPHLV AAVDQ
Sbjct  60   QSRSVSRSRKSTIVRASAS-QDSTESAAPIAPLQLESPVGQFLAQILRSHPHLVPAAVDQ  118

Query  438  QLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIA  545
             LEQLQT R+ EKQ E    EP++SGTD+VLYRRIA
Sbjct  119  HLEQLQTSRDAEKQKE----EPASSGTDLVLYRRIA  150



>emb|CBI35458.3| unnamed protein product [Vitis vinifera]
Length=410

 Score =   119 bits (297),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 89/123 (72%), Gaps = 5/123 (4%)
 Frame = +3

Query  177  FTTDAPGFVKFGSKALLSAPSIKVKLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPL  356
            F  +    V+F ++    +  + +K G+R +AFG  KC  +RAS   ++S GSA PIAPL
Sbjct  28   FNVNRSNSVRFPTQFRFFSGWLNLKSGHRNMAFGCKKCTIVRASA-SADSSGSAAPIAPL  86

Query  357  KLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYR  536
            +LESPIGQFL+QIL+SHPHLV AAV+QQLEQLQTDR+ E+  E    E SASGT++VLYR
Sbjct  87   QLESPIGQFLSQILISHPHLVPAAVEQQLEQLQTDRDAEEHKE----ESSASGTELVLYR  142

Query  537  RIA  545
            RIA
Sbjct  143  RIA  145



>ref|XP_002267281.3| PREDICTED: uncharacterized protein LOC100262899 [Vitis vinifera]
Length=443

 Score =   119 bits (297),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 89/123 (72%), Gaps = 5/123 (4%)
 Frame = +3

Query  177  FTTDAPGFVKFGSKALLSAPSIKVKLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPL  356
            F  +    V+F ++    +  + +K G+R +AFG  KC  +RAS   ++S GSA PIAPL
Sbjct  52   FNVNRSNSVRFPTQFRFFSGWLNLKSGHRNMAFGCKKCTIVRASA-SADSSGSAAPIAPL  110

Query  357  KLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYR  536
            +LESPIGQFL+QIL+SHPHLV AAV+QQLEQLQTDR+ E+  E    E SASGT++VLYR
Sbjct  111  QLESPIGQFLSQILISHPHLVPAAVEQQLEQLQTDRDAEEHKE----ESSASGTELVLYR  166

Query  537  RIA  545
            RIA
Sbjct  167  RIA  169



>ref|XP_008356700.1| PREDICTED: uncharacterized protein LOC103420417 isoform X2 [Malus 
domestica]
Length=428

 Score =   118 bits (295),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 69/131 (53%), Positives = 90/131 (69%), Gaps = 14/131 (11%)
 Frame = +3

Query  177  FTTDAPGFVKFGSKALLSAPS------IKVKLGNRRVAFGSTKCNSIRASLPLSNSGGSA  338
             T   PGF++ G KA   +PS       + K+G+RR+ +GS +   +RA+   S+   + 
Sbjct  29   LTAHGPGFLRLGPKA--HSPSKHQFSICQPKVGHRRMGYGSRRGLVVRAAAASSSPDSAG  86

Query  339  M--PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSAS  512
               PIAPLKLESPIGQFL+QI++SHPHLV +AVDQQL+ L TDR+ E++ E    EPSAS
Sbjct  87   SDSPIAPLKLESPIGQFLSQIMISHPHLVPSAVDQQLDLLLTDRDAEEKKE----EPSAS  142

Query  513  GTDIVLYRRIA  545
            GTDIVLYRRIA
Sbjct  143  GTDIVLYRRIA  153



>ref|XP_008356699.1| PREDICTED: uncharacterized protein LOC103420417 isoform X1 [Malus 
domestica]
Length=429

 Score =   117 bits (294),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 90/132 (68%), Gaps = 15/132 (11%)
 Frame = +3

Query  177  FTTDAPGFVKFGSKALLSAPS-------IKVKLGNRRVAFGSTKCNSIRASLPLSNSGGS  335
             T   PGF++ G KA   +PS        + K+G+RR+ +GS +   +RA+   S+   +
Sbjct  29   LTAHGPGFLRLGPKA--HSPSKQHQFSICQPKVGHRRMGYGSRRGLVVRAAAASSSPDSA  86

Query  336  AM--PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSA  509
                PIAPLKLESPIGQFL+QI++SHPHLV +AVDQQL+ L TDR+ E++ E    EPSA
Sbjct  87   GSDSPIAPLKLESPIGQFLSQIMISHPHLVPSAVDQQLDLLLTDRDAEEKKE----EPSA  142

Query  510  SGTDIVLYRRIA  545
            SGTDIVLYRRIA
Sbjct  143  SGTDIVLYRRIA  154



>ref|XP_010936872.1| PREDICTED: uncharacterized protein LOC105056391 [Elaeis guineensis]
Length=418

 Score =   117 bits (294),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 81/125 (65%), Gaps = 13/125 (10%)
 Frame = +3

Query  192  PGFVKFGSKALLSAPSIK-------VKLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIA  350
            P FV F  K+   +  +K        KLG R   F   +   IRASL   NS  S+ PIA
Sbjct  31   PDFVSFDPKSHFRSRWLKGCRPISVRKLGQR--GFSDRRNTGIRASLSSPNSSESSSPIA  88

Query  351  PLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVL  530
            PL+LESPIGQFL+QIL+SHPHLV AAVDQQLEQL TDR  EK  E    EPS SGTD+VL
Sbjct  89   PLRLESPIGQFLSQILISHPHLVPAAVDQQLEQLHTDREAEKSKE----EPSPSGTDLVL  144

Query  531  YRRIA  545
            YRRIA
Sbjct  145  YRRIA  149



>ref|XP_010091765.1| hypothetical protein L484_019353 [Morus notabilis]
 gb|EXB45128.1| hypothetical protein L484_019353 [Morus notabilis]
Length=431

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 70/131 (53%), Positives = 95/131 (73%), Gaps = 9/131 (7%)
 Frame = +3

Query  177  FTTDAPGFVKFGSKALLSAP---SIKVKLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPI  347
             T++   F  FG+   LS     S + KLG++R++FGS +   +RAS   S+SG S  PI
Sbjct  28   LTSNRTSFPCFGTNFGLSMKHKTSSRSKLGHKRISFGSRRFLLVRAST-SSDSGSSDSPI  86

Query  348  APLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQ-----NEKQNDEPSAS  512
            APL+LESP+GQFL+QIL+SHPHLV AAV+QQLEQLQTDR+  +Q     + ++++EPSA+
Sbjct  87   APLQLESPVGQFLSQILMSHPHLVPAAVEQQLEQLQTDRDAAQQLQTDCDAEKSEEPSAT  146

Query  513  GTDIVLYRRIA  545
            GTD+ LYRRIA
Sbjct  147  GTDLALYRRIA  157



>gb|KDP30111.1| hypothetical protein JCGZ_18399 [Jatropha curcas]
Length=431

 Score =   117 bits (292),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 77/101 (76%), Gaps = 9/101 (9%)
 Frame = +3

Query  258  NRRVAFGSTKCNSIRASLPLSNSGGSAM-----PIAPLKLESPIGQFLTQILVSHPHLVS  422
            N+RV FGS +C  ++AS   S+S  S       PIAPL++ESPIGQFL+QIL+SHPHLV 
Sbjct  62   NKRVGFGSRRCTVVKASSSSSSSPSSDSGGSLAPIAPLQMESPIGQFLSQILMSHPHLVP  121

Query  423  AAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIA  545
            AAV+QQLEQLQTDR+ +K+ E    EPS +GTD+VLYRRIA
Sbjct  122  AAVEQQLEQLQTDRDADKEKE----EPSVTGTDLVLYRRIA  158



>gb|EYU24493.1| hypothetical protein MIMGU_mgv1a007418mg [Erythranthe guttata]
Length=408

 Score =   115 bits (288),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 90/127 (71%), Gaps = 15/127 (12%)
 Frame = +3

Query  192  PGFVKFGS-KALLSAPSIKVKL-------GNRRVAFGSTKCNSIRASL-PLSNSGGSAMP  344
            P F++ GS K++LS    + +L       GN  V F +TK + I AS+   S+SGGS  P
Sbjct  31   PNFLRVGSPKSILSGAWPQQRLLISRKNGGNCGVDFMNTKKSWIGASMQKHSDSGGSIDP  90

Query  345  IAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDI  524
            IAPL+LESPIGQFL++I++SHPHLVSAAV+QQLEQLQTD +  K+      E SASGT++
Sbjct  91   IAPLELESPIGQFLSKIMISHPHLVSAAVEQQLEQLQTDLDAVKE------ESSASGTEL  144

Query  525  VLYRRIA  545
            VLYRRIA
Sbjct  145  VLYRRIA  151



>ref|XP_009414789.1| PREDICTED: uncharacterized protein LOC103995816 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=416

 Score =   115 bits (287),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 68/114 (60%), Positives = 83/114 (73%), Gaps = 8/114 (7%)
 Frame = +3

Query  204  KFGSKALLSAPSIKVKLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQF  383
            ++ +  L S  SI +    RR+ FG+ +   +RAS   S+S  S++PIAPL+LESPIGQF
Sbjct  42   RYSTLWLKSDSSISLSKQGRRL-FGARRSIGVRAS---SSSSESSLPIAPLQLESPIGQF  97

Query  384  LTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIA  545
            L+QILVSHPHL+ AAVDQQLEQLQTDR  EK  E    EP+ SGTDIVLYRRIA
Sbjct  98   LSQILVSHPHLLPAAVDQQLEQLQTDREAEKNKE----EPAPSGTDIVLYRRIA  147



>ref|XP_008466989.1| PREDICTED: uncharacterized protein LOC103504355 [Cucumis melo]
Length=422

 Score =   114 bits (286),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 84/124 (68%), Gaps = 16/124 (13%)
 Frame = +3

Query  195  GFVKFGSKALLSAPSIKV-------KLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAP  353
            GFV+F S   LS   I++       KL N+++  G  +   ++AS+  + S  S  PIAP
Sbjct  33   GFVRFPS---LSHVPIRLCPQVSYSKLWNKKLGTGIRRSTIVKASMD-AESSESGEPIAP  88

Query  354  LKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLY  533
            L+LESPIGQFLTQILVSHPHLV AAV+QQL+QLQ DR+ E      N+E S SGTD+VLY
Sbjct  89   LQLESPIGQFLTQILVSHPHLVPAAVEQQLDQLQNDRDAEG-----NNEASGSGTDLVLY  143

Query  534  RRIA  545
            RRIA
Sbjct  144  RRIA  147



>ref|XP_004137518.1| PREDICTED: uncharacterized protein LOC101203627 [Cucumis sativus]
 ref|XP_004167487.1| PREDICTED: uncharacterized protein LOC101228590 [Cucumis sativus]
Length=422

 Score =   114 bits (284),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 74/152 (49%), Positives = 93/152 (61%), Gaps = 17/152 (11%)
 Frame = +3

Query  114  MTTSLRSSITVGCGPVKSGR-RFTTDAPGFVKFGSKALLSAPSIKV-------KLGNRRV  269
            M T + S + V      SGR     +  GFV+F S   LS   I++       KL N+++
Sbjct  5    MATVIGSPVGVFARLNSSGRSEIFGNGLGFVRFPS---LSHVPIRLCPQVSYSKLWNKKL  61

Query  270  AFGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQ  449
              G  +   ++AS+  + S  S  PIAPL+LESPIGQFLTQILVSHPHLV AAV+QQL+Q
Sbjct  62   GTGIRRSTIVKASMD-AESSESDEPIAPLQLESPIGQFLTQILVSHPHLVPAAVEQQLDQ  120

Query  450  LQTDRNLEKQNEKQNDEPSASGTDIVLYRRIA  545
            LQ DR+ E      N E S SGTD+VLYRRIA
Sbjct  121  LQNDRDAEG-----NKEASGSGTDLVLYRRIA  147



>ref|XP_010939981.1| PREDICTED: uncharacterized protein LOC105058679 [Elaeis guineensis]
 ref|XP_010939982.1| PREDICTED: uncharacterized protein LOC105058679 [Elaeis guineensis]
 ref|XP_010939983.1| PREDICTED: uncharacterized protein LOC105058679 [Elaeis guineensis]
 ref|XP_010939984.1| PREDICTED: uncharacterized protein LOC105058679 [Elaeis guineensis]
Length=422

 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 82/125 (66%), Gaps = 13/125 (10%)
 Frame = +3

Query  192  PGFVKFGSKALLSAPSIK-------VKLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIA  350
            PGFV F  K+L    S+K        KLG     F S +   I+AS    N   S+  IA
Sbjct  32   PGFVSFDPKSLFCTRSLKGCRSLSVSKLGQS--GFCSRRNTGIKASFSSPNPSESSSRIA  89

Query  351  PLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVL  530
            PL+LESPIGQFL+QIL+SHPHLV AAVDQQLEQLQTDR  EK N+K    PS SGTD+VL
Sbjct  90   PLQLESPIGQFLSQILISHPHLVPAAVDQQLEQLQTDREAEK-NKKG---PSPSGTDVVL  145

Query  531  YRRIA  545
            YRRIA
Sbjct  146  YRRIA  150



>ref|XP_002894114.1| hypothetical protein ARALYDRAFT_473985 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70373.1| hypothetical protein ARALYDRAFT_473985 [Arabidopsis lyrata subsp. 
lyrata]
Length=426

 Score =   113 bits (282),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 69/137 (50%), Positives = 91/137 (66%), Gaps = 16/137 (12%)
 Frame = +3

Query  165  SGRR--FTTDAPGFVKFGSKALLSAPSIKVKLGNRRVAF------GSTKCNSIRASLPLS  320
            SGR    T + PGF++FGS+       +KV+L N  + F      G+T   S R+ +  +
Sbjct  19   SGRSILLTPNCPGFMRFGSRPQFR---LKVRLQNSSLKFSRPLQSGTTCAKSRRSFVVKA  75

Query  321  NSGGSAM--PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQN  494
            ++ G A    IAPL+L+SP+GQFL+QILVSHPHLV AAV+QQLEQLQ DR+ E+Q++   
Sbjct  76   SASGDASTDSIAPLQLKSPVGQFLSQILVSHPHLVPAAVEQQLEQLQIDRDSEEQSK---  132

Query  495  DEPSASGTDIVLYRRIA  545
            D  S  GTDIVLYRRIA
Sbjct  133  DASSVPGTDIVLYRRIA  149



>ref|XP_004513343.1| PREDICTED: uncharacterized protein LOC101494659 isoform X1 [Cicer 
arietinum]
 ref|XP_004513344.1| PREDICTED: uncharacterized protein LOC101494659 isoform X2 [Cicer 
arietinum]
Length=418

 Score =   112 bits (281),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 67/113 (59%), Positives = 83/113 (73%), Gaps = 5/113 (4%)
 Frame = +3

Query  207  FGSKALLSAPSIKVKLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFL  386
            F  K   S PS K   G R+++ GS +   +RA+   + S GS+  IAPLKLESPIGQFL
Sbjct  42   FSCKLHASVPSSKQGHG-RKLSVGSKRVFVVRAASSSAESSGSSSNIAPLKLESPIGQFL  100

Query  387  TQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIA  545
            +QILVSHPHL+SAAV++QLEQ QTDR+ ++Q EK    PSASGTD+VLYRRIA
Sbjct  101  SQILVSHPHLMSAAVERQLEQFQTDRDGDEQKEK----PSASGTDLVLYRRIA  149



>ref|XP_009414790.1| PREDICTED: uncharacterized protein LOC103995816 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=407

 Score =   112 bits (281),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 65/103 (63%), Positives = 78/103 (76%), Gaps = 9/103 (9%)
 Frame = +3

Query  237  SIKVKLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHL  416
            ++ +K G R   FG+ +   +RAS   S+S  S++PIAPL+LESPIGQFL+QILVSHPHL
Sbjct  45   TLWLKQGRR--LFGARRSIGVRAS---SSSSESSLPIAPLQLESPIGQFLSQILVSHPHL  99

Query  417  VSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIA  545
            + AAVDQQLEQLQTDR  EK  E    EP+ SGTDIVLYRRIA
Sbjct  100  LPAAVDQQLEQLQTDREAEKNKE----EPAPSGTDIVLYRRIA  138



>ref|XP_006374245.1| hypothetical protein POPTR_0015s05360g [Populus trichocarpa]
 gb|ERP52042.1| hypothetical protein POPTR_0015s05360g [Populus trichocarpa]
Length=354

 Score =   111 bits (278),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 53/69 (77%), Positives = 63/69 (91%), Gaps = 4/69 (6%)
 Frame = +3

Query  339  MPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGT  518
            +PIAPL+LESPIGQFL+QILVSHPHLV AAV+QQLEQLQTDR+    +EKQ ++PSA+GT
Sbjct  18   VPIAPLQLESPIGQFLSQILVSHPHLVPAAVEQQLEQLQTDRD----SEKQKEDPSATGT  73

Query  519  DIVLYRRIA  545
            D+VLYRRIA
Sbjct  74   DLVLYRRIA  82



>gb|KGN64195.1| hypothetical protein Csa_1G042990 [Cucumis sativus]
Length=588

 Score =   113 bits (283),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 74/152 (49%), Positives = 93/152 (61%), Gaps = 17/152 (11%)
 Frame = +3

Query  114  MTTSLRSSITVGCGPVKSGR-RFTTDAPGFVKFGSKALLSAPSIKV-------KLGNRRV  269
            M T + S + V      SGR     +  GFV+F S   LS   I++       KL N+++
Sbjct  171  MATVIGSPVGVFARLNSSGRSEIFGNGLGFVRFPS---LSHVPIRLCPQVSYSKLWNKKL  227

Query  270  AFGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQ  449
              G  +   ++AS+  + S  S  PIAPL+LESPIGQFLTQILVSHPHLV AAV+QQL+Q
Sbjct  228  GTGIRRSTIVKASMD-AESSESDEPIAPLQLESPIGQFLTQILVSHPHLVPAAVEQQLDQ  286

Query  450  LQTDRNLEKQNEKQNDEPSASGTDIVLYRRIA  545
            LQ DR+ E      N E S SGTD+VLYRRIA
Sbjct  287  LQNDRDAEG-----NKEASGSGTDLVLYRRIA  313



>ref|XP_006393405.1| hypothetical protein EUTSA_v10011507mg [Eutrema salsugineum]
 gb|ESQ30691.1| hypothetical protein EUTSA_v10011507mg [Eutrema salsugineum]
Length=426

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 84/128 (66%), Gaps = 11/128 (9%)
 Frame = +3

Query  177  FTTDAPGFVKFGSK---ALLSAPSIKVK--LGNRRVAFGSTKCNSIRASLPLSNSGGSAM  341
             T   PGF++FGS     L    S+KV   L +R  +  S +   ++AS   ++   S  
Sbjct  28   LTASCPGFMRFGSGPQFRLRHNSSLKVSRPLQSRTTSVKSRRSLVVKAS---ASGDASTD  84

Query  342  PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTD  521
             IAPL+L+SP+GQFL+QILVSHPHLV AAV+QQLEQLQTDR  E+QN+   D  S  GTD
Sbjct  85   SIAPLELKSPVGQFLSQILVSHPHLVPAAVEQQLEQLQTDREAEEQNK---DASSVPGTD  141

Query  522  IVLYRRIA  545
            IVLYRRIA
Sbjct  142  IVLYRRIA  149



>gb|KFK36092.1| hypothetical protein AALP_AA4G076400 [Arabis alpina]
Length=424

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 82/121 (68%), Gaps = 10/121 (8%)
 Frame = +3

Query  192  PGFVKFGSKALLSAPSIKVK---LGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPLKL  362
            PGF++F SK     P  +++   L  R ++  S +   ++AS    +   S   IAPL+L
Sbjct  33   PGFMRFSSK-----PQFRLRHNSLQTRTISVKSRRSFVVKASAFDDDVSSSTDSIAPLQL  87

Query  363  ESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRI  542
            +SP+GQFL++ILVSHPHLV AAV+QQLEQLQ DR+LE+QN  ++   S  GTDIVLYRRI
Sbjct  88   KSPVGQFLSEILVSHPHLVPAAVEQQLEQLQIDRDLEEQN--KDSSSSVPGTDIVLYRRI  145

Query  543  A  545
            A
Sbjct  146  A  146



>ref|XP_006306266.1| hypothetical protein CARUB_v10012116mg [Capsella rubella]
 gb|EOA39164.1| hypothetical protein CARUB_v10012116mg [Capsella rubella]
Length=421

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 71/145 (49%), Positives = 94/145 (65%), Gaps = 14/145 (10%)
 Frame = +3

Query  126  LRSSITVGCGPVKSGRRFTTDAPGFVKFGSKALLSAPSIKVKLGNRRVAFGSTKCNSIRA  305
            ++SSI++   P KS    T + PGF++FGS      P  +++  + R     T   S R 
Sbjct  9    VQSSISLRQSPDKS-MFLTPNCPGFMRFGS-----GPQFRLRQKSSRPLQSRTSNVSSRR  62

Query  306  SLPL---SNSGGSAM--PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNL  470
            S  +   ++SGG A    IAPL+L+SP+GQFL+QILVSHPHLV AAV+QQLEQLQ DR+ 
Sbjct  63   SFVVKASASSGGDASTDSIAPLQLKSPVGQFLSQILVSHPHLVPAAVEQQLEQLQIDRDA  122

Query  471  EKQNEKQNDEPSASGTDIVLYRRIA  545
            E+Q +   D+ S  GTDIVLYRRIA
Sbjct  123  EEQIK---DDSSVPGTDIVLYRRIA  144



>ref|XP_006849427.1| hypothetical protein AMTR_s00024p00021530 [Amborella trichopoda]
 gb|ERN11008.1| hypothetical protein AMTR_s00024p00021530 [Amborella trichopoda]
Length=439

 Score =   110 bits (275),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 82/114 (72%), Gaps = 8/114 (7%)
 Frame = +3

Query  207  FGSKALLSAPSIKV-KLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQF  383
            F + +L  +PS+ + K  + R+A  S +    +AS+   +S G + PIAPL++ESPIGQF
Sbjct  42   FANSSLKYSPSVVLPKHVHTRMAQRSRRNMVAKASM---DSNGDSGPIAPLQMESPIGQF  98

Query  384  LTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIA  545
            L+QIL +HPHL+ AAVDQQLEQLQTDR+ E + E    EPS SGTD+VLYRRIA
Sbjct  99   LSQILKNHPHLLPAAVDQQLEQLQTDRDSESEKE----EPSPSGTDLVLYRRIA  148



>ref|XP_007160560.1| hypothetical protein PHAVU_002G331900g [Phaseolus vulgaris]
 gb|ESW32554.1| hypothetical protein PHAVU_002G331900g [Phaseolus vulgaris]
Length=405

 Score =   108 bits (271),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 52/67 (78%), Positives = 60/67 (90%), Gaps = 4/67 (6%)
 Frame = +3

Query  345  IAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDI  524
            IAPL+LESP+GQFL+QILV+HPHLV AAVDQQLEQLQTDR+ ++Q E    EPSASGTD+
Sbjct  75   IAPLQLESPVGQFLSQILVNHPHLVPAAVDQQLEQLQTDRDADQQKE----EPSASGTDL  130

Query  525  VLYRRIA  545
            VLYRRIA
Sbjct  131  VLYRRIA  137



>ref|XP_004500125.1| PREDICTED: uncharacterized protein LOC101505128 isoform X1 [Cicer 
arietinum]
 ref|XP_004500126.1| PREDICTED: uncharacterized protein LOC101505128 isoform X2 [Cicer 
arietinum]
 ref|XP_004500127.1| PREDICTED: uncharacterized protein LOC101505128 isoform X3 [Cicer 
arietinum]
 ref|XP_004500128.1| PREDICTED: uncharacterized protein LOC101505128 isoform X4 [Cicer 
arietinum]
Length=142

 Score =   104 bits (259),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 78/103 (76%), Gaps = 5/103 (5%)
 Frame = +3

Query  228  SAPSIKVKLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSH  407
            S PS K   G R+++ GS +   +RA+   + S GS+  IAPLKLESPIGQFL+QILVSH
Sbjct  42   SVPSSKQGHG-RKLSVGSKRVFVVRAASSSAESSGSSCNIAPLKLESPIGQFLSQILVSH  100

Query  408  PHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYR  536
            PHL+SAAV++QLEQ QTDR+ ++Q EK    PSASGTD+VLYR
Sbjct  101  PHLMSAAVEKQLEQFQTDRDGDEQKEK----PSASGTDLVLYR  139



>gb|KHN43658.1| hypothetical protein glysoja_027724, partial [Glycine soja]
Length=370

 Score =   108 bits (270),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 59/99 (60%), Positives = 70/99 (71%), Gaps = 4/99 (4%)
 Frame = +3

Query  249  KLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAA  428
            K G+ R   GS +   +RA+     S   +  IAPLKLESPIGQFL+QIL+SHPHLV AA
Sbjct  7    KQGHARHRVGSKRGFVVRAASFTPESSEPSSKIAPLKLESPIGQFLSQILISHPHLVPAA  66

Query  429  VDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIA  545
            V+QQLEQ QTD +     +KQ  EPSASGTD+VLYRRIA
Sbjct  67   VEQQLEQFQTDCD----GDKQKKEPSASGTDLVLYRRIA  101



>ref|XP_003534126.1| PREDICTED: uncharacterized protein LOC100802697 isoformX1 [Glycine 
max]
 ref|XP_003534127.1| PREDICTED: uncharacterized protein LOC100802697 isoformX2 [Glycine 
max]
 ref|XP_006587458.1| PREDICTED: uncharacterized protein LOC100802697 isoform X3 [Glycine 
max]
Length=414

 Score =   108 bits (270),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 65/128 (51%), Positives = 77/128 (60%), Gaps = 16/128 (13%)
 Frame = +3

Query  162  KSGRRFTTDAPGFVKFGSKALLSAPSIKVKLGNRRVAFGSTKCNSIRASLPLSNSGGSAM  341
            +S  RF+T     V F             K G+ R   GS +   +RA+     S     
Sbjct  34   RSNLRFSTKLSTSVSFS------------KQGHARHRVGSKRGFVVRAASFTPESSEPTS  81

Query  342  PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTD  521
             IAPLKLESPIGQFL+QIL+SHPHLV AAV+QQLEQ QTD +     +KQ  EPSASGTD
Sbjct  82   KIAPLKLESPIGQFLSQILISHPHLVPAAVEQQLEQFQTDCD----GDKQKKEPSASGTD  137

Query  522  IVLYRRIA  545
            +VLYRRIA
Sbjct  138  LVLYRRIA  145



>emb|CBI40011.3| unnamed protein product [Vitis vinifera]
Length=289

 Score =   107 bits (267),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 73/98 (74%), Gaps = 5/98 (5%)
 Frame = +3

Query  255  GNRRVAFGSTKCNSIRASLPLSN-SGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAV  431
            G+R++A G  +   +RAS  + N S  SA PIAPL+LESPIG+FLT+IL+SHPHLV AAV
Sbjct  43   GHRKMASGWKEQTMVRASATVDNDSYESAAPIAPLRLESPIGRFLTEILISHPHLVPAAV  102

Query  432  DQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIA  545
            ++QLEQ QTDR+ E   +    E SASG +++LYRRIA
Sbjct  103  ERQLEQFQTDRDAEGHKQ----ESSASGIELLLYRRIA  136



>ref|XP_010461662.1| PREDICTED: uncharacterized protein LOC104742359 isoform X1 [Camelina 
sativa]
 ref|XP_010461663.1| PREDICTED: uncharacterized protein LOC104742359 isoform X2 [Camelina 
sativa]
 ref|XP_010461664.1| PREDICTED: uncharacterized protein LOC104742359 isoform X3 [Camelina 
sativa]
Length=428

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 82/129 (64%), Gaps = 8/129 (6%)
 Frame = +3

Query  177  FTTDAPGFVKFGSKA----LLSAPSIKVK--LGNRRVAFGSTKCNSIRASLPLSNSGGSA  338
             T + PGF++F        L S  S+K    L +R     S +   ++AS   S    S 
Sbjct  25   LTPNCPGFMRFVGSGPQFRLRSNSSLKFSRPLQSRTSYVNSRRSFVVKASASASGGDAST  84

Query  339  MPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGT  518
              IAPL+L+SP+GQFL+QILVSHPHLV AAV+QQLEQLQ DR+ E+Q   ++D+ S  GT
Sbjct  85   DSIAPLQLKSPVGQFLSQILVSHPHLVPAAVEQQLEQLQIDRDAEEQ--IRDDDSSVPGT  142

Query  519  DIVLYRRIA  545
            DIVLYRRIA
Sbjct  143  DIVLYRRIA  151



>ref|XP_009408539.1| PREDICTED: uncharacterized protein LOC103990949 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=413

 Score =   108 bits (269),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 78/170 (46%), Positives = 91/170 (54%), Gaps = 46/170 (27%)
 Frame = +3

Query  108  MEMTTSLRSSITVGCGPVKSGRRFTTDAPGF--------------VKFGSKALLSAPSIK  245
            ME  TSL+S             RF   APGF              + F  K  LS   +K
Sbjct  1    MEAATSLQSF------------RFLCKAPGFGPRSCVLAAHRSSFLFFDPKPHLSTRGLK  48

Query  246  V----------KLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQI  395
            V          K G RR+  G+ +   +RAS    +S     PIAPL+LESPIGQFL+QI
Sbjct  49   VFDGYCPISLSKQGQRRI--GARRSTIVRASSSSPSSD----PIAPLQLESPIGQFLSQI  102

Query  396  LVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIA  545
            LVSHPHL+ AAVDQQLEQLQTDR   K  E    EP+ + TDIVLYRRIA
Sbjct  103  LVSHPHLLPAAVDQQLEQLQTDREAAKNKE----EPTPADTDIVLYRRIA  148



>gb|KJB30250.1| hypothetical protein B456_005G134400 [Gossypium raimondii]
Length=422

 Score =   108 bits (269),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/79 (70%), Positives = 66/79 (84%), Gaps = 7/79 (9%)
 Frame = +3

Query  318  SNSGGSAMP---IAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEK  488
            S+S  SA P   IAPL++ESPIGQFL+QIL+SHPHLV AAV+QQLEQLQTDR+ +++ E 
Sbjct  75   SSSPDSAEPNAQIAPLRMESPIGQFLSQILISHPHLVPAAVEQQLEQLQTDRDTDEKKE-  133

Query  489  QNDEPSASGTDIVLYRRIA  545
               EPSASGTD+VLYRRIA
Sbjct  134  ---EPSASGTDLVLYRRIA  149



>ref|XP_003528983.1| PREDICTED: uncharacterized protein LOC100777314 isoform X1 [Glycine 
max]
 ref|XP_006583474.1| PREDICTED: uncharacterized protein LOC100777314 isoform X2 [Glycine 
max]
 ref|XP_006583475.1| PREDICTED: uncharacterized protein LOC100777314 isoform X3 [Glycine 
max]
 ref|XP_006583476.1| PREDICTED: uncharacterized protein LOC100777314 isoform X4 [Glycine 
max]
 gb|KHN25098.1| hypothetical protein glysoja_027512 [Glycine soja]
Length=408

 Score =   107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 70/99 (71%), Gaps = 4/99 (4%)
 Frame = +3

Query  249  KLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAA  428
            K G+ R   G+ +   +RA+     S   +  IAPLKLESPIGQFL+QIL+SHPHLV AA
Sbjct  45   KHGHGRHCVGTRRGFVVRAASFTPESSEPSSKIAPLKLESPIGQFLSQILISHPHLVPAA  104

Query  429  VDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIA  545
            V+QQLEQ QTD +     +KQ  EPSASGTD+VLYRRIA
Sbjct  105  VEQQLEQFQTDLD----GDKQKKEPSASGTDLVLYRRIA  139



>gb|ACU24516.1| unknown [Glycine max]
Length=408

 Score =   107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 70/99 (71%), Gaps = 4/99 (4%)
 Frame = +3

Query  249  KLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAA  428
            K G+ R   G+ +   +RA+     S   +  IAPLKLESPIGQFL+QIL+SHPHLV AA
Sbjct  45   KHGHGRHCVGTRRGFVVRAASFTPESSEPSSKIAPLKLESPIGQFLSQILISHPHLVPAA  104

Query  429  VDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIA  545
            V+QQLEQ QTD +     +KQ  EPSASGTD+VLYRRIA
Sbjct  105  VEQQLEQFQTDLD----GDKQKKEPSASGTDLVLYRRIA  139



>ref|XP_002273280.1| PREDICTED: uncharacterized protein LOC100245443 isoform X1 [Vitis 
vinifera]
Length=411

 Score =   107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 73/98 (74%), Gaps = 5/98 (5%)
 Frame = +3

Query  255  GNRRVAFGSTKCNSIRASLPLSN-SGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAV  431
            G+R++A G  +   +RAS  + N S  SA PIAPL+LESPIG+FLT+IL+SHPHLV AAV
Sbjct  43   GHRKMASGWKEQTMVRASATVDNDSYESAAPIAPLRLESPIGRFLTEILISHPHLVPAAV  102

Query  432  DQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIA  545
            ++QLEQ QTDR+ E   +    E SASG +++LYRRIA
Sbjct  103  ERQLEQFQTDRDAEGHKQ----ESSASGIELLLYRRIA  136



>gb|AFK42768.1| unknown [Lotus japonicus]
Length=412

 Score =   107 bits (268),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 53/76 (70%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = +3

Query  318  SNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQND  497
            S+S  SA  IAPL+LESPIGQFL+QIL++ PHLV AAVDQQL QLQTDR+ E    KQN 
Sbjct  68   SDSDESANKIAPLQLESPIGQFLSQILINRPHLVPAAVDQQLLQLQTDRDSESDPNKQNQ  127

Query  498  EPSASGTDIVLYRRIA  545
            +PS+S TD+VLYRRIA
Sbjct  128  DPSSSSTDLVLYRRIA  143



>ref|XP_009408547.1| PREDICTED: uncharacterized protein LOC103990949 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=410

 Score =   106 bits (265),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 77/167 (46%), Positives = 90/167 (54%), Gaps = 43/167 (26%)
 Frame = +3

Query  108  MEMTTSLRSSITVGCGPVKSGRRFTTDAPGF--------------VKFGSKALLSAPSIK  245
            ME  TSL+S             RF   APGF              + F  K  LS   +K
Sbjct  1    MEAATSLQSF------------RFLCKAPGFGPRSCVLAAHRSSFLFFDPKPHLSTRGLK  48

Query  246  -------VKLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVS  404
                    K G RR+  G+ +   +RAS    +S     PIAPL+LESPIGQFL+QILVS
Sbjct  49   GYCPISLSKQGQRRI--GARRSTIVRASSSSPSSD----PIAPLQLESPIGQFLSQILVS  102

Query  405  HPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIA  545
            HPHL+ AAVDQQLEQLQTDR   K  E    EP+ + TDIVLYRRIA
Sbjct  103  HPHLLPAAVDQQLEQLQTDREAAKNKE----EPTPADTDIVLYRRIA  145



>gb|KHG11329.1| Alanine--tRNA ligase [Gossypium arboreum]
 gb|KHG12308.1| Alanine--tRNA ligase [Gossypium arboreum]
Length=428

 Score =   106 bits (264),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 66/79 (84%), Gaps = 7/79 (9%)
 Frame = +3

Query  318  SNSGGSAMP---IAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEK  488
            S+S  SA P   IAPL++ESPIGQFL+QIL+SHPHLV AAV+QQLEQLQ+DR+ +++ E 
Sbjct  81   SSSPDSAEPNAQIAPLRMESPIGQFLSQILISHPHLVPAAVEQQLEQLQSDRDTDEKKE-  139

Query  489  QNDEPSASGTDIVLYRRIA  545
               EPSASGTD+VLYRRIA
Sbjct  140  ---EPSASGTDLVLYRRIA  155



>dbj|BAJ34170.1| unnamed protein product [Thellungiella halophila]
Length=419

 Score =   105 bits (263),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 69/139 (50%), Positives = 81/139 (58%), Gaps = 28/139 (20%)
 Frame = +3

Query  177  FTTDAPGFVKFGSKALLSAPSIKVKLGNRRVAFG--------STKCNSIRASLPLSNSGG  332
             T   PGF + GS          ++L  R+ AFG        ST+    R S  +  S  
Sbjct  29   LTASGPGFTRSGSG---------LQLRLRQNAFGRFSRPLQSSTRAAKTRKSFAIRASAS  79

Query  333  SAM--------PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEK  488
            S          PIAPL+LESP GQFL+QILVSHPHLV AAV+QQLEQLQTDR+ E QN+ 
Sbjct  80   SDDASSGSSSKPIAPLQLESPAGQFLSQILVSHPHLVPAAVEQQLEQLQTDRDSEGQNK-  138

Query  489  QNDEPSASGTDIVLYRRIA  545
              D  S+ GTDIVLYRRIA
Sbjct  139  --DATSSPGTDIVLYRRIA  155



>ref|XP_006406690.1| hypothetical protein EUTSA_v10020677mg [Eutrema salsugineum]
 gb|ESQ48143.1| hypothetical protein EUTSA_v10020677mg [Eutrema salsugineum]
Length=466

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 69/139 (50%), Positives = 81/139 (58%), Gaps = 28/139 (20%)
 Frame = +3

Query  177  FTTDAPGFVKFGSKALLSAPSIKVKLGNRRVAFG--------STKCNSIRASLPLSNSGG  332
             T   PGF + GS          ++L  R+ AFG        ST+    R S  +  S  
Sbjct  76   LTASGPGFTRSGSG---------LQLRLRQNAFGRFSRPLQSSTRAAKTRKSFAIRASAS  126

Query  333  SAM--------PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEK  488
            S          PIAPL+LESP GQFL+QILVSHPHLV AAV+QQLEQLQTDR+ E QN+ 
Sbjct  127  SDDASSGSSSKPIAPLQLESPAGQFLSQILVSHPHLVPAAVEQQLEQLQTDRDSEGQNK-  185

Query  489  QNDEPSASGTDIVLYRRIA  545
              D  S+ GTDIVLYRRIA
Sbjct  186  --DATSSPGTDIVLYRRIA  202



>ref|XP_008375017.1| PREDICTED: uncharacterized protein LOC103438262 isoform X1 [Malus 
domestica]
 ref|XP_008375018.1| PREDICTED: uncharacterized protein LOC103438262 isoform X1 [Malus 
domestica]
Length=429

 Score =   105 bits (262),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 51/68 (75%), Positives = 59/68 (87%), Gaps = 4/68 (6%)
 Frame = +3

Query  342  PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTD  521
            PIAPLKLESPIGQFL+QI++SHPHLV +AVDQQL+ L TDR+ E++ E    EPSASGTD
Sbjct  91   PIAPLKLESPIGQFLSQIMISHPHLVPSAVDQQLDLLLTDRDAEEKKE----EPSASGTD  146

Query  522  IVLYRRIA  545
            IVLYRRIA
Sbjct  147  IVLYRRIA  154



>ref|XP_008375019.1| PREDICTED: uncharacterized protein LOC103438262 isoform X2 [Malus 
domestica]
 ref|XP_008375020.1| PREDICTED: uncharacterized protein LOC103438262 isoform X2 [Malus 
domestica]
Length=428

 Score =   105 bits (262),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 51/68 (75%), Positives = 59/68 (87%), Gaps = 4/68 (6%)
 Frame = +3

Query  342  PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTD  521
            PIAPLKLESPIGQFL+QI++SHPHLV +AVDQQL+ L TDR+ E++ E    EPSASGTD
Sbjct  90   PIAPLKLESPIGQFLSQIMISHPHLVPSAVDQQLDLLLTDRDAEEKKE----EPSASGTD  145

Query  522  IVLYRRIA  545
            IVLYRRIA
Sbjct  146  IVLYRRIA  153



>gb|AGV54799.1| hypothetical protein [Phaseolus vulgaris]
Length=409

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 69/99 (70%), Gaps = 4/99 (4%)
 Frame = +3

Query  249  KLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAA  428
            K G+ R   G+ +   +RA+     S   +  IAPLKLESPIGQFL+QIL+SHPHLV AA
Sbjct  45   KHGHGRHCVGTRRGFVVRAASFTPESSEPSSKIAPLKLESPIGQFLSQILISHPHLVPAA  104

Query  429  VDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIA  545
            V+QQLEQ QTD +     +KQ  EP ASGTD+VLYRRIA
Sbjct  105  VEQQLEQFQTDLD----GDKQKREPPASGTDLVLYRRIA  139



>gb|KEH26747.1| plant/T1N15-5 protein [Medicago truncatula]
Length=418

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 51/67 (76%), Positives = 59/67 (88%), Gaps = 4/67 (6%)
 Frame = +3

Query  345  IAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDI  524
            IAPLKLESP+GQFL+QILVSHPHL+SAAV++QLEQ QTDR+  +Q EK    PSASGTD+
Sbjct  87   IAPLKLESPVGQFLSQILVSHPHLMSAAVERQLEQFQTDRDGYEQKEK----PSASGTDL  142

Query  525  VLYRRIA  545
            VLYRRIA
Sbjct  143  VLYRRIA  149



>emb|CDX95820.1| BnaC05g35710D [Brassica napus]
Length=415

 Score =   104 bits (260),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 58/68 (85%), Gaps = 3/68 (4%)
 Frame = +3

Query  342  PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTD  521
            PIAPL+LESP GQFL+QILV+HPHLV AAV+QQLEQLQTDR+ E QN+   D  SA GTD
Sbjct  86   PIAPLQLESPAGQFLSQILVTHPHLVPAAVEQQLEQLQTDRDSEGQNK---DASSAPGTD  142

Query  522  IVLYRRIA  545
            IVLYRRIA
Sbjct  143  IVLYRRIA  150



>ref|XP_010549034.1| PREDICTED: uncharacterized protein LOC104820333 isoform X2 [Tarenaya 
hassleriana]
Length=412

 Score =   103 bits (258),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 51/69 (74%), Positives = 58/69 (84%), Gaps = 4/69 (6%)
 Frame = +3

Query  339  MPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGT  518
            +PIAPL+LESP+GQFL+QILVSHPHLV AAV+QQLEQLQT R+     E+Q D PS  GT
Sbjct  79   VPIAPLQLESPVGQFLSQILVSHPHLVPAAVEQQLEQLQTVRD----AEEQKDSPSVPGT  134

Query  519  DIVLYRRIA  545
            DIVLYRRIA
Sbjct  135  DIVLYRRIA  143



>ref|XP_010549033.1| PREDICTED: uncharacterized protein LOC104820333 isoform X1 [Tarenaya 
hassleriana]
Length=413

 Score =   103 bits (258),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 51/69 (74%), Positives = 58/69 (84%), Gaps = 4/69 (6%)
 Frame = +3

Query  339  MPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGT  518
            +PIAPL+LESP+GQFL+QILVSHPHLV AAV+QQLEQLQT R+     E+Q D PS  GT
Sbjct  80   VPIAPLQLESPVGQFLSQILVSHPHLVPAAVEQQLEQLQTVRD----AEEQKDSPSVPGT  135

Query  519  DIVLYRRIA  545
            DIVLYRRIA
Sbjct  136  DIVLYRRIA  144



>gb|KFK39108.1| hypothetical protein AALP_AA3G202000 [Arabis alpina]
Length=418

 Score =   103 bits (258),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 67/136 (49%), Positives = 85/136 (63%), Gaps = 12/136 (9%)
 Frame = +3

Query  165  SGRRF-TTDAPGFVKFGSKALLSAPSIKVKLGNRRVAFGSTKCNSIRASL--------PL  317
            SG  F T   PGF +FGS+  L +        +R     +T   + R+ +          
Sbjct  23   SGSMFLTASGPGFTRFGSELQLRSKQNAFSRVSRPSQSLTTSAKTRRSFVVRAAASSDGD  82

Query  318  SNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQND  497
             +SG S+ PIAPL+L+SP GQFL+QILVSHPHLV AAV+QQLEQLQTDR+ E QN+  + 
Sbjct  83   GSSGSSSKPIAPLELQSPAGQFLSQILVSHPHLVPAAVEQQLEQLQTDRDSEGQNKDASS  142

Query  498  EPSASGTDIVLYRRIA  545
            +P   GTDIVLYRRIA
Sbjct  143  KP---GTDIVLYRRIA  155



>emb|CDX92162.1| BnaA05g22450D [Brassica napus]
Length=415

 Score =   103 bits (256),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 51/68 (75%), Positives = 57/68 (84%), Gaps = 3/68 (4%)
 Frame = +3

Query  342  PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTD  521
            PIAPL+LESP GQFL+QILV+HPHLV AAV+QQLEQLQTDR+ E QN+   D  S  GTD
Sbjct  86   PIAPLQLESPAGQFLSQILVTHPHLVPAAVEQQLEQLQTDRDSEGQNK---DASSVPGTD  142

Query  522  IVLYRRIA  545
            IVLYRRIA
Sbjct  143  IVLYRRIA  150



>ref|XP_009145975.1| PREDICTED: uncharacterized protein LOC103869650 [Brassica rapa]
Length=415

 Score =   103 bits (256),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 51/68 (75%), Positives = 57/68 (84%), Gaps = 3/68 (4%)
 Frame = +3

Query  342  PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTD  521
            PIAPL+LESP GQFL+QILV+HPHLV AAV+QQLEQLQTDR+ E QN+   D  S  GTD
Sbjct  86   PIAPLQLESPAGQFLSQILVTHPHLVPAAVEQQLEQLQTDRDSEGQNK---DASSVPGTD  142

Query  522  IVLYRRIA  545
            IVLYRRIA
Sbjct  143  IVLYRRIA  150



>ref|XP_010465837.1| PREDICTED: uncharacterized protein LOC104746127 [Camelina sativa]
Length=410

 Score =   102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/68 (75%), Positives = 57/68 (84%), Gaps = 3/68 (4%)
 Frame = +3

Query  342  PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTD  521
            PIAPL+LESP GQFL+QIL+SHPHLV AAV+QQLEQLQTDR+ E QN+   D  S  GTD
Sbjct  84   PIAPLRLESPAGQFLSQILLSHPHLVPAAVEQQLEQLQTDRDSEGQNK---DASSVPGTD  140

Query  522  IVLYRRIA  545
            IVLYRRIA
Sbjct  141  IVLYRRIA  148



>ref|XP_006297794.1| hypothetical protein CARUB_v10013829mg [Capsella rubella]
 gb|EOA30692.1| hypothetical protein CARUB_v10013829mg [Capsella rubella]
Length=412

 Score =   102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/68 (75%), Positives = 57/68 (84%), Gaps = 3/68 (4%)
 Frame = +3

Query  342  PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTD  521
            PIAPL+LESP GQFL+QILV+HPHLV AAV+QQLEQLQTDR+ E QN+   D  S  GTD
Sbjct  83   PIAPLQLESPAGQFLSQILVTHPHLVPAAVEQQLEQLQTDRDSEGQNK---DASSVPGTD  139

Query  522  IVLYRRIA  545
            IVLYRRIA
Sbjct  140  IVLYRRIA  147



>emb|CAN79123.1| hypothetical protein VITISV_030635 [Vitis vinifera]
Length=411

 Score =   102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 71/98 (72%), Gaps = 5/98 (5%)
 Frame = +3

Query  255  GNRRVAFGSTKCNSIRASLPLSN-SGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAV  431
            G+R++A G  +   +RA   + N S  SA  IAPL+LESPIG+FLT+IL+SHPHLV AAV
Sbjct  43   GHRKMASGWKEQTMVRAXATVDNDSYESAAXIAPLRLESPIGRFLTEILISHPHLVPAAV  102

Query  432  DQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIA  545
            ++QLEQ QTDR+ E   +    E SASG +++LYRRIA
Sbjct  103  ERQLEQFQTDRDAEGHKQ----ESSASGIELLLYRRIA  136



>ref|XP_010487675.1| PREDICTED: uncharacterized protein LOC104765624 [Camelina sativa]
Length=409

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/68 (75%), Positives = 57/68 (84%), Gaps = 3/68 (4%)
 Frame = +3

Query  342  PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTD  521
            PIAPL+LESP GQFL+QIL+SHPHLV AAV+QQLEQLQTDR+ E QN+   D  S  GTD
Sbjct  83   PIAPLQLESPAGQFLSQILLSHPHLVPAAVEQQLEQLQTDRDSEGQNK---DASSVPGTD  139

Query  522  IVLYRRIA  545
            IVLYRRIA
Sbjct  140  IVLYRRIA  147



>ref|XP_010505920.1| PREDICTED: uncharacterized protein LOC104782624 [Camelina sativa]
Length=409

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/68 (75%), Positives = 57/68 (84%), Gaps = 3/68 (4%)
 Frame = +3

Query  342  PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTD  521
            PIAPL+LESP GQFL+QIL+SHPHLV AAV+QQLEQLQTDR+ E QN+   D  S  GTD
Sbjct  83   PIAPLQLESPAGQFLSQILLSHPHLVPAAVEQQLEQLQTDRDSEGQNK---DASSVPGTD  139

Query  522  IVLYRRIA  545
            IVLYRRIA
Sbjct  140  IVLYRRIA  147



>ref|XP_010661178.1| PREDICTED: uncharacterized protein LOC100245443 isoform X2 [Vitis 
vinifera]
Length=365

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 69/94 (73%), Gaps = 5/94 (5%)
 Frame = +3

Query  267  VAFGSTKCNSIRASLPLSN-SGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQL  443
            +A G  +   +RAS  + N S  SA PIAPL+LESPIG+FLT+IL+SHPHLV AAV++QL
Sbjct  1    MASGWKEQTMVRASATVDNDSYESAAPIAPLRLESPIGRFLTEILISHPHLVPAAVERQL  60

Query  444  EQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIA  545
            EQ QTDR+ E   +    E SASG +++LYRRIA
Sbjct  61   EQFQTDRDAEGHKQ----ESSASGIELLLYRRIA  90



>dbj|BAH56904.1| AT1G48450 [Arabidopsis thaliana]
Length=321

 Score =   101 bits (252),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 62/130 (48%), Positives = 84/130 (65%), Gaps = 17/130 (13%)
 Frame = +3

Query  180  TTDAPGFVKFGSKALLSAPSIKVKLGNRRVAF------GSTKCNSIRASLPLSNSGGSA-  338
            T + PGF++  S      P  +++  N  + F      G+T   S R+ +  +++ G A 
Sbjct  26   TPNCPGFMRISS-----GPQFRLR-QNSSLKFSRPFQSGTTCVKSRRSFVVKASASGDAS  79

Query  339  -MPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASG  515
               IAPL+L+SP+GQFL+QILVSHPHLV AAV+QQLEQLQ DR+ E+Q++   D  S  G
Sbjct  80   TESIAPLQLKSPVGQFLSQILVSHPHLVPAAVEQQLEQLQIDRDAEEQSK---DASSVLG  136

Query  516  TDIVLYRRIA  545
            TDIVLYRRIA
Sbjct  137  TDIVLYRRIA  146



>ref|XP_009135549.1| PREDICTED: uncharacterized protein LOC103859727 [Brassica rapa]
Length=408

 Score =   101 bits (252),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 77/127 (61%), Gaps = 7/127 (6%)
 Frame = +3

Query  177  FTTDAPGFVKFGSKALLSAPSIKVKLGNRRVAFGSTKCNSIRASLPLSNSGGSAM----P  344
             TT APGF   GSK  L          ++ +   ST  +  R S  +  S  S      P
Sbjct  28   LTTSAPGFTPSGSKLQLRLKQNPFTRFSKPLQ-SSTTASKTRRSFVVKASAASDDASSKP  86

Query  345  IAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDI  524
            IAPL+LESP GQFL+QILVSHPHLV AAV+QQLEQLQTDR+ + QN   +   S  GTDI
Sbjct  87   IAPLQLESPAGQFLSQILVSHPHLVPAAVEQQLEQLQTDRDSQGQN--TDSSSSLPGTDI  144

Query  525  VLYRRIA  545
            VLYRRIA
Sbjct  145  VLYRRIA  151



>gb|AAL32564.1| Unknown protein [Arabidopsis thaliana]
 gb|AAM13275.1| unknown protein [Arabidopsis thaliana]
Length=421

 Score =   101 bits (252),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 50/68 (74%), Positives = 57/68 (84%), Gaps = 3/68 (4%)
 Frame = +3

Query  342  PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTD  521
            PIAPL+L+SP GQFL+QILVSHPHLV AAV+QQLEQLQTDR+ + QN+   D  S  GTD
Sbjct  91   PIAPLQLQSPAGQFLSQILVSHPHLVPAAVEQQLEQLQTDRDSQGQNK---DSASVPGTD  147

Query  522  IVLYRRIA  545
            IVLYRRIA
Sbjct  148  IVLYRRIA  155



>ref|NP_566588.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAB02703.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAM20406.1| unknown protein [Arabidopsis thaliana]
 gb|AEE76008.1| uncharacterized protein AT3G17800 [Arabidopsis thaliana]
Length=421

 Score =   101 bits (252),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 50/68 (74%), Positives = 57/68 (84%), Gaps = 3/68 (4%)
 Frame = +3

Query  342  PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTD  521
            PIAPL+L+SP GQFL+QILVSHPHLV AAV+QQLEQLQTDR+ + QN+   D  S  GTD
Sbjct  91   PIAPLQLQSPAGQFLSQILVSHPHLVPAAVEQQLEQLQTDRDSQGQNK---DSASVPGTD  147

Query  522  IVLYRRIA  545
            IVLYRRIA
Sbjct  148  IVLYRRIA  155



>dbj|BAF01343.1| hypothetical protein [Arabidopsis thaliana]
Length=421

 Score =   101 bits (252),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 50/68 (74%), Positives = 57/68 (84%), Gaps = 3/68 (4%)
 Frame = +3

Query  342  PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTD  521
            PIAPL+L+SP GQFL+QILVSHPHLV AAV+QQLEQLQTDR+ + QN+   D  S  GTD
Sbjct  91   PIAPLQLQSPAGQFLSQILVSHPHLVPAAVEQQLEQLQTDRDSQGQNK---DSASVPGTD  147

Query  522  IVLYRRIA  545
            IVLYRRIA
Sbjct  148  IVLYRRIA  155



>ref|NP_001031154.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE32294.1| uncharacterized protein AT1G48450 [Arabidopsis thaliana]
Length=342

 Score =   101 bits (251),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 62/130 (48%), Positives = 84/130 (65%), Gaps = 17/130 (13%)
 Frame = +3

Query  180  TTDAPGFVKFGSKALLSAPSIKVKLGNRRVAF------GSTKCNSIRASLPLSNSGGSA-  338
            T + PGF++  S      P  +++  N  + F      G+T   S R+ +  +++ G A 
Sbjct  26   TPNCPGFMRISS-----GPQFRLR-QNSSLKFSRPFQSGTTCVKSRRSFVVKASASGDAS  79

Query  339  -MPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASG  515
               IAPL+L+SP+GQFL+QILVSHPHLV AAV+QQLEQLQ DR+ E+Q++   D  S  G
Sbjct  80   TESIAPLQLKSPVGQFLSQILVSHPHLVPAAVEQQLEQLQIDRDAEEQSK---DASSVLG  136

Query  516  TDIVLYRRIA  545
            TDIVLYRRIA
Sbjct  137  TDIVLYRRIA  146



>ref|NP_001078173.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE76009.1| uncharacterized protein AT3G17800 [Arabidopsis thaliana]
Length=427

 Score =   101 bits (252),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 50/68 (74%), Positives = 57/68 (84%), Gaps = 3/68 (4%)
 Frame = +3

Query  342  PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTD  521
            PIAPL+L+SP GQFL+QILVSHPHLV AAV+QQLEQLQTDR+ + QN+   D  S  GTD
Sbjct  97   PIAPLQLQSPAGQFLSQILVSHPHLVPAAVEQQLEQLQTDRDSQGQNK---DSASVPGTD  153

Query  522  IVLYRRIA  545
            IVLYRRIA
Sbjct  154  IVLYRRIA  161



>ref|NP_001185170.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE32295.1| uncharacterized protein AT1G48450 [Arabidopsis thaliana]
Length=333

 Score =   100 bits (250),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 62/130 (48%), Positives = 84/130 (65%), Gaps = 17/130 (13%)
 Frame = +3

Query  180  TTDAPGFVKFGSKALLSAPSIKVKLGNRRVAF------GSTKCNSIRASLPLSNSGGSA-  338
            T + PGF++  S      P  +++  N  + F      G+T   S R+ +  +++ G A 
Sbjct  26   TPNCPGFMRISS-----GPQFRLR-QNSSLKFSRPFQSGTTCVKSRRSFVVKASASGDAS  79

Query  339  -MPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASG  515
               IAPL+L+SP+GQFL+QILVSHPHLV AAV+QQLEQLQ DR+ E+Q++   D  S  G
Sbjct  80   TESIAPLQLKSPVGQFLSQILVSHPHLVPAAVEQQLEQLQIDRDAEEQSK---DASSVLG  136

Query  516  TDIVLYRRIA  545
            TDIVLYRRIA
Sbjct  137  TDIVLYRRIA  146



>ref|NP_175278.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAF79715.1|AC020889_23 T1N15.6 [Arabidopsis thaliana]
 gb|AAL57686.1| At1g48450/T1N15_5 [Arabidopsis thaliana]
 gb|AAN41342.1| unknown protein [Arabidopsis thaliana]
 gb|AEE32293.1| uncharacterized protein AT1G48450 [Arabidopsis thaliana]
Length=423

 Score =   101 bits (251),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 62/130 (48%), Positives = 84/130 (65%), Gaps = 17/130 (13%)
 Frame = +3

Query  180  TTDAPGFVKFGSKALLSAPSIKVKLGNRRVAF------GSTKCNSIRASLPLSNSGGSA-  338
            T + PGF++  S      P  +++  N  + F      G+T   S R+ +  +++ G A 
Sbjct  26   TPNCPGFMRISS-----GPQFRLR-QNSSLKFSRPFQSGTTCVKSRRSFVVKASASGDAS  79

Query  339  -MPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASG  515
               IAPL+L+SP+GQFL+QILVSHPHLV AAV+QQLEQLQ DR+ E+Q++   D  S  G
Sbjct  80   TESIAPLQLKSPVGQFLSQILVSHPHLVPAAVEQQLEQLQIDRDAEEQSK---DASSVLG  136

Query  516  TDIVLYRRIA  545
            TDIVLYRRIA
Sbjct  137  TDIVLYRRIA  146



>ref|XP_002885230.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61489.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=426

 Score =   100 bits (250),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 50/68 (74%), Positives = 57/68 (84%), Gaps = 3/68 (4%)
 Frame = +3

Query  342  PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTD  521
            PIAPL+L+SP GQFL+QILVSHPHLV AAV+QQLEQLQTDR+ + QN+   D  S  GTD
Sbjct  97   PIAPLQLQSPAGQFLSQILVSHPHLVPAAVEQQLEQLQTDRDSDGQNK---DASSVPGTD  153

Query  522  IVLYRRIA  545
            IVLYRRIA
Sbjct  154  IVLYRRIA  161



>emb|CDX75937.1| BnaC03g40200D [Brassica napus]
Length=414

 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 50/68 (74%), Positives = 56/68 (82%), Gaps = 2/68 (3%)
 Frame = +3

Query  342  PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTD  521
            PIAPL+LESP GQFL+QILVSHPHLV AAV+QQLEQLQTDR+ + QN   +   S  GTD
Sbjct  86   PIAPLQLESPAGQFLSQILVSHPHLVPAAVEQQLEQLQTDRDSQGQN--TDSSSSVPGTD  143

Query  522  IVLYRRIA  545
            IVLYRRIA
Sbjct  144  IVLYRRIA  151



>ref|XP_009145005.1| PREDICTED: uncharacterized protein LOC103868678 [Brassica rapa]
 emb|CDY23684.1| BnaA05g17450D [Brassica napus]
Length=407

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 61/127 (48%), Positives = 78/127 (61%), Gaps = 13/127 (10%)
 Frame = +3

Query  177  FTTDAPGFVKFGSKALLSAPSIKVK----LGNRRVAFGSTKCNSIRASLPLSNSGGSAMP  344
             T  +PGF++F S      P  + +    L   R +   T     R S  + +S   +  
Sbjct  22   LTASSPGFIRFSS-----GPQFRHRHSTCLKLSRPSQSRTTSLKSRRSFVVKSSASDS--  74

Query  345  IAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDI  524
            IAPL+L+SP+GQFL+QILVSHPHLV AAV+QQLEQLQTDR  E+Q   ++   S  GTDI
Sbjct  75   IAPLELKSPVGQFLSQILVSHPHLVPAAVEQQLEQLQTDREAEEQ--IKDSSSSLPGTDI  132

Query  525  VLYRRIA  545
            VLYRRIA
Sbjct  133  VLYRRIA  139



>ref|XP_007152648.1| hypothetical protein PHAVU_004G147200g [Phaseolus vulgaris]
 gb|ESW24642.1| hypothetical protein PHAVU_004G147200g [Phaseolus vulgaris]
Length=403

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 69/94 (73%), Gaps = 4/94 (4%)
 Frame = +3

Query  264  RVAFGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQL  443
            R + GS +   +RA+     S   +  +APLKLESPIGQFL+QIL+SHPHLV AAV++QL
Sbjct  56   RHSVGSKRGFVVRATSSFPESSEPSSNVAPLKLESPIGQFLSQILMSHPHLVPAAVERQL  115

Query  444  EQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIA  545
            EQ QTD  ++  N+K+  EP ASGTD+VLYRRIA
Sbjct  116  EQFQTD--IDGDNQKR--EPPASGTDLVLYRRIA  145



>ref|XP_011464472.1| PREDICTED: uncharacterized protein LOC101299089 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=412

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 73/143 (51%), Positives = 94/143 (66%), Gaps = 14/143 (10%)
 Frame = +3

Query  117  TTSLRSSITVGCGPVKSGRRFTTDAPGFVKFGSKALLSAPSIKVKLGNRRVAFGSTKCNS  296
              + R S +VG  P+  G       P F+  G     S  SIK +LG     FG  +C  
Sbjct  14   VAAFRPSNSVGRSPLLMG-------PKFLPLGPLGAKSHSSIKHQLG-----FGRRRCLV  61

Query  297  IRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEK  476
            +RA+   S+SGGS+ PIAPL+LESPIGQFL+Q+++SHPHLV  AV+QQLEQLQT R+ E+
Sbjct  62   VRAASSSSDSGGSSAPIAPLQLESPIGQFLSQMMISHPHLVPTAVEQQLEQLQTARDAEE  121

Query  477  QNEKQNDEPSASGTDIVLYRRIA  545
            + EK+    SASGTD+VLYRRIA
Sbjct  122  KKEKEEA--SASGTDLVLYRRIA  142



>emb|CDX82345.1| BnaA03g34760D [Brassica napus]
Length=406

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/68 (74%), Positives = 56/68 (82%), Gaps = 2/68 (3%)
 Frame = +3

Query  342  PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTD  521
            PIAPL+LESP GQFL+QILVSHPHLV AAV+QQLEQLQTDR+ + QN   +   S  GTD
Sbjct  85   PIAPLQLESPAGQFLSQILVSHPHLVPAAVEQQLEQLQTDRDSQGQN--TDTSSSLPGTD  142

Query  522  IVLYRRIA  545
            IVLYRRIA
Sbjct  143  IVLYRRIA  150



>ref|XP_010479269.1| PREDICTED: uncharacterized protein LOC104758146 [Camelina sativa]
Length=429

 Score = 98.2 bits (243),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 63/129 (49%), Positives = 80/129 (62%), Gaps = 7/129 (5%)
 Frame = +3

Query  177  FTTDAPGFVKFGSKA----LLSAPSIKVK--LGNRRVAFGSTKCNSIRASLPLSNSGGSA  338
             T + PGF++F        L S  S+K    L +R     S +   ++AS   S    S 
Sbjct  25   LTPNCPGFMRFVGSGPQFRLRSNSSLKFSRPLQSRTSYVNSRRSFVVKASASASGGESST  84

Query  339  MPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGT  518
              IAPL+L+SP+GQFL+QILVSHPHLV AAV+QQLEQLQ DR+ E+Q    +  P  +GT
Sbjct  85   DSIAPLQLKSPVGQFLSQILVSHPHLVPAAVEQQLEQLQIDRDAEEQIRDDSSVP-GTGT  143

Query  519  DIVLYRRIA  545
            DIVLYRRIA
Sbjct  144  DIVLYRRIA  152



>ref|XP_010500371.1| PREDICTED: uncharacterized protein LOC104777762 [Camelina sativa]
Length=429

 Score = 97.8 bits (242),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 56/67 (84%), Gaps = 3/67 (4%)
 Frame = +3

Query  345  IAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDI  524
            IAPL+L+SP+GQFL+QILVSHPHLV AAV+QQLEQLQ DR+ E+Q     D+ S  GTDI
Sbjct  89   IAPLQLKSPVGQFLSQILVSHPHLVPAAVEQQLEQLQIDRDAEEQI---RDDSSVPGTDI  145

Query  525  VLYRRIA  545
            VLYRRIA
Sbjct  146  VLYRRIA  152



>ref|XP_004299503.1| PREDICTED: uncharacterized protein LOC101299089 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=413

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 71/143 (50%), Positives = 93/143 (65%), Gaps = 13/143 (9%)
 Frame = +3

Query  117  TTSLRSSITVGCGPVKSGRRFTTDAPGFVKFGSKALLSAPSIKVKLGNRRVAFGSTKCNS  296
              + R S +VG  P+  G       P F+  G     S  SIK      ++ FG  +C  
Sbjct  14   VAAFRPSNSVGRSPLLMG-------PKFLPLGPLGAKSHSSIK----QHQLGFGRRRCLV  62

Query  297  IRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEK  476
            +RA+   S+SGGS+ PIAPL+LESPIGQFL+Q+++SHPHLV  AV+QQLEQLQT R+ E+
Sbjct  63   VRAASSSSDSGGSSAPIAPLQLESPIGQFLSQMMISHPHLVPTAVEQQLEQLQTARDAEE  122

Query  477  QNEKQNDEPSASGTDIVLYRRIA  545
            + EK+    SASGTD+VLYRRIA
Sbjct  123  KKEKEEA--SASGTDLVLYRRIA  143



>gb|KJB53076.1| hypothetical protein B456_008G292100 [Gossypium raimondii]
Length=411

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 70/97 (72%), Gaps = 5/97 (5%)
 Frame = +3

Query  255  GNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVD  434
             N+R+   S +   +RAS    ++  S   IAPL++ESP GQFL+QIL+SHPHLV AAV+
Sbjct  54   WNKRMVLESRRGIVVRASSSPDSTDPSDP-IAPLRMESPTGQFLSQILISHPHLVPAAVE  112

Query  435  QQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIA  545
            QQL+QLQT+ + E++ E    E SASGTD+VLYRRIA
Sbjct  113  QQLKQLQTEWDTEQKKE----ELSASGTDLVLYRRIA  145



>ref|XP_003525180.1| PREDICTED: uncharacterized protein LOC100817892 isoform X1 [Glycine 
max]
 gb|KHN10526.1| hypothetical protein glysoja_040681 [Glycine soja]
Length=399

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 53/67 (79%), Gaps = 4/67 (6%)
 Frame = +3

Query  345  IAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDI  524
            IAPL+LESPIGQFL+QIL  HPHLV AAVDQQL QLQTDR+   QN++Q   P    TD+
Sbjct  69   IAPLQLESPIGQFLSQILKDHPHLVPAAVDQQLHQLQTDRDAHLQNQQQPSSP----TDL  124

Query  525  VLYRRIA  545
            VLYRRIA
Sbjct  125  VLYRRIA  131



>ref|XP_006580389.1| PREDICTED: uncharacterized protein LOC100817892 isoform X2 [Glycine 
max]
Length=400

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 53/67 (79%), Gaps = 4/67 (6%)
 Frame = +3

Query  345  IAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDI  524
            IAPL+LESPIGQFL+QIL  HPHLV AAVDQQL QLQTDR+   QN++Q   P    TD+
Sbjct  70   IAPLQLESPIGQFLSQILKDHPHLVPAAVDQQLHQLQTDRDAHLQNQQQPSSP----TDL  125

Query  525  VLYRRIA  545
            VLYRRIA
Sbjct  126  VLYRRIA  132



>ref|XP_004503251.1| PREDICTED: uncharacterized protein LOC101489103 [Cicer arietinum]
Length=401

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 55/67 (82%), Gaps = 3/67 (4%)
 Frame = +3

Query  345  IAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDI  524
            IAPL+L SPIGQFL+QIL +HPHL+ AAVDQQL QLQ+D + ++QN+   D PS + TD+
Sbjct  69   IAPLQLHSPIGQFLSQILTNHPHLLPAAVDQQLHQLQSDHDADQQNQ---DPPSTTATDL  125

Query  525  VLYRRIA  545
            VLYRRIA
Sbjct  126  VLYRRIA  132



>emb|CDY58279.1| BnaCnng32840D [Brassica napus]
Length=425

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 55/67 (82%), Gaps = 2/67 (3%)
 Frame = +3

Query  345  IAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDI  524
            IAPL+L+SP+GQFL+QILVSHPHLV AA++QQLEQLQTDR  E +   ++   S  GTDI
Sbjct  85   IAPLQLKSPVGQFLSQILVSHPHLVPAAIEQQLEQLQTDR--EAEEHIKDSFSSLPGTDI  142

Query  525  VLYRRIA  545
            VLYRRIA
Sbjct  143  VLYRRIA  149



>gb|EAY91660.1| hypothetical protein OsI_13299 [Oryza sativa Indica Group]
 gb|EAZ28380.1| hypothetical protein OsJ_12360 [Oryza sativa Japonica Group]
Length=413

 Score = 93.2 bits (230),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 54/67 (81%), Gaps = 2/67 (3%)
 Frame = +3

Query  345  IAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDI  524
            IAPL++ESP+GQFL+QIL +HPHL+ AA +QQLEQLQTDR+  K N    D+P+ S  DI
Sbjct  81   IAPLQMESPVGQFLSQILATHPHLLPAAAEQQLEQLQTDRDAAKDN--GGDKPAPSDGDI  138

Query  525  VLYRRIA  545
            VLYRRIA
Sbjct  139  VLYRRIA  145



>ref|NP_001051084.1| Os03g0717900 [Oryza sativa Japonica Group]
 gb|ABF98564.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF12998.1| Os03g0717900 [Oryza sativa Japonica Group]
 dbj|BAG94154.1| unnamed protein product [Oryza sativa Japonica Group]
Length=455

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 54/67 (81%), Gaps = 2/67 (3%)
 Frame = +3

Query  345  IAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDI  524
            IAPL++ESP+GQFL+QIL +HPHL+ AA +QQLEQLQTDR+  K N    D+P+ S  DI
Sbjct  123  IAPLQMESPVGQFLSQILATHPHLLPAAAEQQLEQLQTDRDAAKDN--GGDKPAPSDGDI  180

Query  525  VLYRRIA  545
            VLYRRIA
Sbjct  181  VLYRRIA  187



>ref|XP_002276652.1| PREDICTED: uncharacterized protein LOC100260823 [Vitis vinifera]
Length=403

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 64/98 (65%), Gaps = 13/98 (13%)
 Frame = +3

Query  264  RVAFGSTKCN----SIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAV  431
            ++  G  KC     ++RAS+   NS    +P+APL+LESPIGQ L QIL +HPHL+ AA+
Sbjct  49   KLGVGLDKCRVRGLTVRASV---NSDDELVPVAPLQLESPIGQLLAQILQTHPHLLPAAI  105

Query  432  DQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIA  545
            DQQLE LQTDR+       Q +E   S  D++LYRRIA
Sbjct  106  DQQLENLQTDRD------AQREETPPSSHDLLLYRRIA  137



>ref|XP_010919980.1| PREDICTED: uncharacterized protein LOC105043949 [Elaeis guineensis]
Length=404

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 66/99 (67%), Gaps = 7/99 (7%)
 Frame = +3

Query  252  LGNRRVAFGSTKCNSIRASL-PLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAA  428
            +G   + F   K  + R  +  L NSG + +PIAPL+ ESPIGQ L+QI+ +HPHL+ AA
Sbjct  52   IGWPNIGFQLEKYRARRLKVKALENSGENQIPIAPLQFESPIGQLLSQIMQTHPHLLPAA  111

Query  429  VDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIA  545
            +DQQLE+LQ+DR+ EK+      E   +  D++LYRRIA
Sbjct  112  IDQQLERLQSDRDAEKE------ETPPATQDLLLYRRIA  144



>gb|AFK36208.1| unknown [Medicago truncatula]
Length=421

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 54/67 (81%), Gaps = 1/67 (1%)
 Frame = +3

Query  345  IAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDI  524
            IAPL+ +SPIGQFL+QIL++HPHLV AAVDQQL QLQ DR++    + Q+  P+ S TD+
Sbjct  87   IAPLQFQSPIGQFLSQILINHPHLVPAAVDQQLLQLQPDRDVAHHQQNQDPSPTTS-TDL  145

Query  525  VLYRRIA  545
            VLYRRIA
Sbjct  146  VLYRRIA  152



>gb|ACJ84884.1| unknown [Medicago truncatula]
Length=421

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 54/67 (81%), Gaps = 1/67 (1%)
 Frame = +3

Query  345  IAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDI  524
            IAPL+ +SPIGQFL+QIL++HPHLV AAVDQQL QLQ DR++    + Q+  P+ S TD+
Sbjct  87   IAPLQFQSPIGQFLSQILINHPHLVPAAVDQQLLQLQPDRDVAHHQQNQDPSPTTS-TDL  145

Query  525  VLYRRIA  545
            VLYRRIA
Sbjct  146  VLYRRIA  152



>emb|CBI33818.3| unnamed protein product [Vitis vinifera]
Length=423

 Score = 90.9 bits (224),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 64/98 (65%), Gaps = 13/98 (13%)
 Frame = +3

Query  264  RVAFGSTKCN----SIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAV  431
            ++  G  KC     ++RAS+   NS    +P+APL+LESPIGQ L QIL +HPHL+ AA+
Sbjct  49   KLGVGLDKCRVRGLTVRASV---NSDDELVPVAPLQLESPIGQLLAQILQTHPHLLPAAI  105

Query  432  DQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIA  545
            DQQLE LQTDR+       Q +E   S  D++LYRRIA
Sbjct  106  DQQLENLQTDRD------AQREETPPSSHDLLLYRRIA  137



>gb|ACF87802.1| unknown [Zea mays]
 tpg|DAA51042.1| TPA: hypothetical protein ZEAMMB73_539342 [Zea mays]
Length=423

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 57/70 (81%), Gaps = 3/70 (4%)
 Frame = +3

Query  345  IAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQN---DEPSASG  515
            IAPL++ESP GQ L+QIL +HPHL+SAA +QQLEQLQTDR  +K+ +K++   D+ + +G
Sbjct  85   IAPLRMESPAGQLLSQILHTHPHLLSAAAEQQLEQLQTDREADKEKDKESDAGDKLAPTG  144

Query  516  TDIVLYRRIA  545
             D+VLYRRIA
Sbjct  145  GDLVLYRRIA  154



>gb|ADE77481.1| unknown [Picea sitchensis]
Length=435

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 52/67 (78%), Gaps = 4/67 (6%)
 Frame = +3

Query  345  IAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDI  524
            IAPL  ESPIGQFL+QIL +HPHL+ AA+DQQLE+L  DR+   Q+E    +PS S TD+
Sbjct  86   IAPLDFESPIGQFLSQILKNHPHLLPAAIDQQLERLAADRDAASQHE----QPSTSSTDL  141

Query  525  VLYRRIA  545
            VLYRRIA
Sbjct  142  VLYRRIA  148



>gb|ABR17692.1| unknown [Picea sitchensis]
 gb|ACN40252.1| unknown [Picea sitchensis]
Length=434

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 53/118 (45%), Positives = 70/118 (59%), Gaps = 14/118 (12%)
 Frame = +3

Query  195  GFVKFGSKALLSAPSIKVKLGNR-RVAFGSTKCNSIRASLPLSNSGGSAMPIAPLKLESP  371
            G +KF    +   P  +     R R  FG      +RA+    N   S+ PIAPL+LESP
Sbjct  52   GSLKFSQSIITPGPQWRCTYSKRSRRNFG------VRAA---GNYDESSKPIAPLQLESP  102

Query  372  IGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIA  545
             GQFL+Q+L  HPHL+ AAV+QQLE+L  DR+       Q D PS++ T++VLYRRIA
Sbjct  103  TGQFLSQLLKDHPHLLPAAVEQQLERLVADRD----AAAQQDPPSSTSTELVLYRRIA  156



>ref|XP_006854071.1| hypothetical protein AMTR_s00048p00111750 [Amborella trichopoda]
 gb|ERN15538.1| hypothetical protein AMTR_s00048p00111750 [Amborella trichopoda]
Length=383

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 61/87 (70%), Gaps = 7/87 (8%)
 Frame = +3

Query  285  KCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDR  464
            K  ++R    ++ SG ++ PIAPL+ ESPIGQFL QIL +HPHL+ AAVDQQLE+LQ+DR
Sbjct  57   KLANLRVRRGINASGETSTPIAPLQFESPIGQFLAQILRTHPHLLPAAVDQQLERLQSDR  116

Query  465  NLEKQNEKQNDEPSASGTDIVLYRRIA  545
                  E Q +E S S TD+ L RRIA
Sbjct  117  ------ESQKEEKSPSATDL-LSRRIA  136



>ref|XP_006385682.1| hypothetical protein POPTR_0003s09620g [Populus trichocarpa]
 gb|ERP63479.1| hypothetical protein POPTR_0003s09620g [Populus trichocarpa]
Length=145

 Score = 84.3 bits (207),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 61/160 (38%), Positives = 87/160 (54%), Gaps = 26/160 (16%)
 Frame = +3

Query  87   IRHCCCMMEMTTSLRSSITVGCGPVKSGRRFTTDAPGFVKFGSKALLSAPSIKVK----L  254
            IR       ++ S+ S+ T G G +KS +    +      F S + LS PS   K     
Sbjct  4    IRGGAASEVLSVSIPSTSTTG-GALKSPQLLAQN------FHSLSFLSPPSHLTKRCPSF  56

Query  255  GNRRVAFGSTKCN----SIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVS  422
            G  R+  G  KC     ++RAS    +S G+ +P++PL+ ESP+GQ L QIL +HPHL+ 
Sbjct  57   GIPRLGAGMYKCRPRGLTVRAS---GDSAGNPVPVSPLEFESPVGQLLAQILQTHPHLLP  113

Query  423  AAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRI  542
            AA+DQQLE LQTDR+ +K       E +AS  D  LY+ +
Sbjct  114  AAIDQQLENLQTDRDAQK-------EEAASSQDF-LYKDV  145



>ref|XP_009413223.1| PREDICTED: uncharacterized protein LOC103994576 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=402

 Score = 87.4 bits (215),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 68/113 (60%), Gaps = 14/113 (12%)
 Frame = +3

Query  207  FGSKALLSAPSIKVKLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFL  386
            F +K+ +  P I ++L N R     T+   +RA   L NS     PIAPL+ ESP GQ L
Sbjct  44   FSAKSSIGWPKIGIRLENHR-----TRILQVRA---LGNSSDGQTPIAPLQFESPTGQLL  95

Query  387  TQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIA  545
            +QI+ +HPHL+ AA+DQQLE+LQ+D + E      N +   +  D+ LYRRIA
Sbjct  96   SQIMQTHPHLLPAAIDQQLERLQSDIDAE------NAKTPVASQDLPLYRRIA  142



>emb|CAN81624.1| hypothetical protein VITISV_014254 [Vitis vinifera]
Length=169

 Score = 84.3 bits (207),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 61/95 (64%), Gaps = 13/95 (14%)
 Frame = +3

Query  264  RVAFGSTKCN----SIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAV  431
            ++  G  KC     ++RAS+   NS    +P+APL+LESPIGQ L QIL +HPHL+ AA+
Sbjct  84   KLGVGLDKCRVRGLTVRASV---NSDDELVPVAPLQLESPIGQLLAQILQTHPHLLPAAI  140

Query  432  DQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYR  536
            DQQLE LQTDR+       Q +E   S  D++LYR
Sbjct  141  DQQLENLQTDRD------AQREEAPPSSHDLLLYR  169



>ref|NP_001143815.1| uncharacterized protein LOC100276591 [Zea mays]
 gb|ACG35630.1| hypothetical protein [Zea mays]
Length=424

 Score = 87.0 bits (214),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 57/70 (81%), Gaps = 3/70 (4%)
 Frame = +3

Query  345  IAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQN---DEPSASG  515
            IAPL++ESP GQ L+QIL +HPHL+SAA +QQLEQLQTDR  +K+ +K++   D+ + +G
Sbjct  86   IAPLRMESPAGQLLSQILHTHPHLLSAAAEQQLEQLQTDREADKEKDKESDAGDKLAPTG  145

Query  516  TDIVLYRRIA  545
             ++VLYRRIA
Sbjct  146  GNLVLYRRIA  155



>ref|XP_008800077.1| PREDICTED: uncharacterized protein LOC103714566 isoform X1 [Phoenix 
dactylifera]
Length=405

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 56/77 (73%), Gaps = 6/77 (8%)
 Frame = +3

Query  315  LSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQN  494
            L NSG +  PIAPL+ ESP+GQ L+QI+ +HPHL+ AA+DQQLE+LQ+DR+ +K+     
Sbjct  75   LENSGENHTPIAPLQFESPVGQLLSQIMQTHPHLLPAAIDQQLEKLQSDRDAQKE-----  129

Query  495  DEPSASGTDIVLYRRIA  545
             E   +  D+ LYRRIA
Sbjct  130  -ETPPATQDLPLYRRIA  145



>ref|XP_011028101.1| PREDICTED: uncharacterized protein LOC105128231 [Populus euphratica]
Length=413

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 54/121 (45%), Positives = 72/121 (60%), Gaps = 19/121 (16%)
 Frame = +3

Query  207  FGSKALLSAPSIKVK----LGNRRVAFGSTKCN----SIRASLPLSNSGGSAMPIAPLKL  362
            F S + LS PS   K     G  R+  G  K      ++RAS    +S G+ +P++PL+ 
Sbjct  37   FHSLSFLSPPSHLTKRCPSFGIPRLGAGMYKFRPRGLTVRAS---GDSAGNPVPVSPLEF  93

Query  363  ESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRI  542
            ESP+GQ L QIL +HPHL+ AA+DQQLE LQTDR+ +K       E +AS  D  LY+RI
Sbjct  94   ESPVGQLLAQILQTHPHLLPAAIDQQLENLQTDRDAQK-------EEAASSQDF-LYKRI  145

Query  543  A  545
            A
Sbjct  146  A  146



>gb|ABF98565.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAG87500.1| unnamed protein product [Oryza sativa Japonica Group]
Length=328

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 49/62 (79%), Gaps = 2/62 (3%)
 Frame = +3

Query  360  LESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRR  539
            +ESP+GQFL+QIL +HPHL+ AA +QQLEQLQTDR+  K N    D+P+ S  DIVLYRR
Sbjct  1    MESPVGQFLSQILATHPHLLPAAAEQQLEQLQTDRDAAKDN--GGDKPAPSDGDIVLYRR  58

Query  540  IA  545
            IA
Sbjct  59   IA  60



>emb|CDP11681.1| unnamed protein product [Coffea canephora]
Length=405

 Score = 84.7 bits (208),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 60/84 (71%), Gaps = 9/84 (11%)
 Frame = +3

Query  294  SIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLE  473
            ++RAS   S   G  +PIAP++LESP+GQFL QIL +HPHL+ AA+DQQLE LQ++R+ E
Sbjct  64   AVRASESFS---GDLVPIAPVQLESPVGQFLAQILQNHPHLLPAAIDQQLENLQSERDAE  120

Query  474  KQNEKQNDEPSASGTDIVLYRRIA  545
                  N++   S  D++LY+RIA
Sbjct  121  ------NEKNPPSSQDLLLYKRIA  138



>ref|NP_001169730.1| hypothetical protein [Zea mays]
 gb|ACN34695.1| unknown [Zea mays]
 gb|AFW67799.1| hypothetical protein ZEAMMB73_826524 [Zea mays]
Length=416

 Score = 84.7 bits (208),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 54/70 (77%), Gaps = 3/70 (4%)
 Frame = +3

Query  345  IAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQN---DEPSASG  515
            +APL++ESP GQ L+QIL +HPHL+ AA +QQLE LQTDR  EK  +K++   D+ + +G
Sbjct  77   MAPLRMESPAGQLLSQILHTHPHLLPAAAEQQLELLQTDREAEKNKDKESDAGDKLAPTG  136

Query  516  TDIVLYRRIA  545
             D+VLYRRIA
Sbjct  137  VDLVLYRRIA  146



>ref|XP_006650499.1| PREDICTED: uncharacterized protein LOC102715191 [Oryza brachyantha]
Length=327

 Score = 83.6 bits (205),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 49/62 (79%), Gaps = 2/62 (3%)
 Frame = +3

Query  360  LESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRR  539
            +ESP+GQFL+QIL +HPHL+ AA +QQLEQLQTDR+  K  E   D+P+ S  DIVLYRR
Sbjct  1    MESPVGQFLSQILATHPHLLPAAAEQQLEQLQTDRDAAK--EDGGDKPTPSDGDIVLYRR  58

Query  540  IA  545
            IA
Sbjct  59   IA  60



>dbj|BAJ85118.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=408

 Score = 84.3 bits (207),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 55/67 (82%), Gaps = 3/67 (4%)
 Frame = +3

Query  345  IAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDI  524
            IAPL++ESPIGQFL+QILV+HPHL+ AA +QQLEQLQT ++  ++ + Q   P A+G DI
Sbjct  77   IAPLQMESPIGQFLSQILVTHPHLLPAAAEQQLEQLQTVQDSAEKKDAQA--PPAAG-DI  133

Query  525  VLYRRIA  545
            VLYRRIA
Sbjct  134  VLYRRIA  140



>ref|XP_011081424.1| PREDICTED: uncharacterized protein LOC105164476 [Sesamum indicum]
Length=408

 Score = 84.3 bits (207),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 51/119 (43%), Positives = 75/119 (63%), Gaps = 17/119 (14%)
 Frame = +3

Query  189  APGFVKFGSKALLSAPSIKVKLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPLKLES  368
            +PGF K       S P+ K+++G  ++    T+   +RAS    NSGG  +P+APL+LES
Sbjct  40   SPGFSKN-----CSFPNPKLEIGPEKL---RTRGFMVRAS---GNSGGDLIPVAPLQLES  88

Query  369  PIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIA  545
            P+GQ L QIL +HPHL+ A  +QQLE LQ+ R+     +K+   PS+   D++LY+RIA
Sbjct  89   PVGQLLAQILQTHPHLLLATAEQQLENLQSQRD----GQKETTAPSSQ--DLLLYKRIA  141



>ref|XP_003530975.1| PREDICTED: uncharacterized protein LOC100793300 [Glycine max]
 gb|KHN00132.1| hypothetical protein glysoja_028660 [Glycine soja]
Length=404

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 68/145 (47%), Positives = 84/145 (58%), Gaps = 15/145 (10%)
 Frame = +3

Query  117  TTSLRSSITVGCGPVK--SGRRFTTDAPGFVKFGSKALLSAPSIKVKLGNRRVAFGSTKC  290
             T+ RS + +   PV   +  RF +   GF +    + +  P  K K G RR        
Sbjct  5    VTAFRSPLIILRRPVNESASARFGSTF-GFSRKQRFSSVCIPKHKHKQGRRR-------G  56

Query  291  NSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNL  470
              +RAS   S     A  IAPL+ ES IGQFL+QIL  HPHLV AAVDQQL+QLQTDR+ 
Sbjct  57   FVVRASASSSPESDDA-KIAPLQFESSIGQFLSQILKDHPHLVPAAVDQQLQQLQTDRDA  115

Query  471  EKQNEKQNDEPSASGTDIVLYRRIA  545
             +QNE    +PSAS TD+VLYRRIA
Sbjct  116  HQQNE----QPSASTTDLVLYRRIA  136



>gb|EMT10781.1| hypothetical protein F775_30852 [Aegilops tauschii]
Length=493

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 54/67 (81%), Gaps = 3/67 (4%)
 Frame = +3

Query  345  IAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDI  524
            IAPL++ESPIGQFL+QILV+HPHL+ AA +QQLEQLQT ++    ++K    P A+G DI
Sbjct  126  IAPLQMESPIGQFLSQILVTHPHLLPAAAEQQLEQLQTVQD--SADKKDAQAPPAAG-DI  182

Query  525  VLYRRIA  545
            VLYRRIA
Sbjct  183  VLYRRIA  189



>ref|XP_003560595.1| PREDICTED: uncharacterized protein LOC100829350 [Brachypodium 
distachyon]
Length=413

 Score = 82.4 bits (202),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = +3

Query  345  IAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDI  524
            IAPL++ES +GQFL+QILV+HPHL+ AA +QQLEQLQT  +  K+    + +    G DI
Sbjct  80   IAPLQMESAVGQFLSQILVTHPHLLPAAAEQQLEQLQTVHDAAKKENGSDTQAPPPGGDI  139

Query  525  VLYRRIA  545
            VLYRRIA
Sbjct  140  VLYRRIA  146



>ref|XP_009413222.1| PREDICTED: uncharacterized protein LOC103994576 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=406

 Score = 81.6 bits (200),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 46/110 (42%), Positives = 65/110 (59%), Gaps = 14/110 (13%)
 Frame = +3

Query  207  FGSKALLSAPSIKVKLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFL  386
            F +K+ +  P I ++L N R     T+   +RA   L NS     PIAPL+ ESP GQ L
Sbjct  44   FSAKSSIGWPKIGIRLENHR-----TRILQVRA---LGNSSDGQTPIAPLQFESPTGQLL  95

Query  387  TQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYR  536
            +QI+ +HPHL+ AA+DQQLE+LQ+D + E      N +   +  D+ LYR
Sbjct  96   SQIMQTHPHLLPAAIDQQLERLQSDIDAE------NAKTPVASQDLPLYR  139



>ref|XP_006471483.1| PREDICTED: uncharacterized protein LOC102623998 [Citrus sinensis]
Length=408

 Score = 81.6 bits (200),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 45/103 (44%), Positives = 65/103 (63%), Gaps = 22/103 (21%)
 Frame = +3

Query  249  KLGNRRVAFGSTKCN----SIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHL  416
            KLGN     G  KC     ++RAS    +S  + +PIAPL+ ESP+GQ L QIL +HPHL
Sbjct  54   KLGN-----GMDKCRMRDLTVRAS---GSSDRNVVPIAPLQFESPVGQLLAQILQTHPHL  105

Query  417  VSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIA  545
            + AA+DQQLE +Q D+N+++++  Q+          +LY+RIA
Sbjct  106  LPAAIDQQLENIQIDKNVQREDTSQD----------LLYQRIA  138



>gb|KDO57187.1| hypothetical protein CISIN_1g035864mg [Citrus sinensis]
Length=135

 Score = 78.2 bits (191),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 43/94 (46%), Positives = 62/94 (66%), Gaps = 13/94 (14%)
 Frame = +3

Query  228  SAPSIKV-KLGNRRVAFGSTKCN----SIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQ  392
            S PS  + KLGN     G  KC     ++RAS    +S  + +PIAPL+ ESP+GQ L Q
Sbjct  46   SCPSFCIPKLGN-----GMDKCRMRDLTVRAS---GSSDQNVVPIAPLQFESPVGQLLAQ  97

Query  393  ILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQN  494
            IL +HPHL+ AA+DQQLE +Q D+N+++++  Q+
Sbjct  98   ILQTHPHLLPAAIDQQLENIQIDKNVQREDTSQD  131



>ref|XP_007209264.1| hypothetical protein PRUPE_ppa007392mg [Prunus persica]
 gb|EMJ10463.1| hypothetical protein PRUPE_ppa007392mg [Prunus persica]
Length=369

 Score = 80.9 bits (198),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 64/103 (62%), Gaps = 19/103 (18%)
 Frame = +3

Query  249  KLGNRRVAFGSTKCNS----IRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHL  416
            KLGN     G  KC +    +RAS    +S  + +P+APL+ ESP GQ L QIL +HPHL
Sbjct  55   KLGN-----GLYKCRARGLIVRAS---KDSSDNLVPVAPLQFESPAGQLLAQILQNHPHL  106

Query  417  VSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIA  545
            +SAA+DQQLE LQ DR+  ++      E SAS  D  LY+RIA
Sbjct  107  LSAAIDQQLENLQKDRDARRE------ETSASSAD-PLYKRIA  142



>ref|XP_010261560.1| PREDICTED: uncharacterized protein LOC104600354 [Nelumbo nucifera]
Length=409

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 53/125 (42%), Positives = 70/125 (56%), Gaps = 29/125 (23%)
 Frame = +3

Query  207  FGSKALLSA------PSIKVKLGNRRVAFGSTKCN----SIRASLPLSNSGGSAMPIAPL  356
            + +K+LLS       PS  ++LG      G  KC     S+RAS    +S     PIAPL
Sbjct  33   YDTKSLLSGGILKRYPSCFLRLGA-----GLEKCRTRSLSVRAS---GHSNNDTTPIAPL  84

Query  357  KLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNE--KQNDEPSASGTDIVL  530
            + ESP+GQ L QI+ +HPHL+ AA+DQQLE LQTD+  + +     QND         +L
Sbjct  85   RFESPVGQLLVQIMQTHPHLLPAAIDQQLENLQTDQGAQGEESLPPQND---------LL  135

Query  531  YRRIA  545
            YRRIA
Sbjct  136  YRRIA  140



>ref|XP_010677383.1| PREDICTED: uncharacterized protein LOC104893042 [Beta vulgaris 
subsp. vulgaris]
Length=415

 Score = 79.0 bits (193),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 56/83 (67%), Gaps = 9/83 (11%)
 Frame = +3

Query  297  IRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEK  476
            +RAS    NSG +  PIAP++LESP G  LTQIL +HPHL+ AA+DQQLE LQ D++ +K
Sbjct  73   VRAS---DNSGENLTPIAPVQLESPAGLLLTQILQTHPHLLPAAIDQQLENLQNDKDAQK  129

Query  477  QNEKQNDEPSASGTDIVLYRRIA  545
            +      E  +S   + LYRRIA
Sbjct  130  E------ETPSSSQGLPLYRRIA  146



>gb|KJB21160.1| hypothetical protein B456_003G185600 [Gossypium raimondii]
 gb|KJB21161.1| hypothetical protein B456_003G185600 [Gossypium raimondii]
Length=400

 Score = 79.0 bits (193),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 62/99 (63%), Gaps = 11/99 (11%)
 Frame = +3

Query  249  KLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAA  428
            KLG     +   +C ++RAS     SG +  PIAP++ ESP+GQ L QIL +HPHL+ AA
Sbjct  47   KLGMVPDKYRGGRCLTMRAS---GESGDNLSPIAPVEFESPVGQLLAQILRTHPHLLPAA  103

Query  429  VDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIA  545
            VDQQL+ LQ+D+N + +   Q+ +        +LY+RIA
Sbjct  104  VDQQLDNLQSDKNDQTEETPQSQD--------LLYKRIA  134



>ref|XP_010088656.1| hypothetical protein L484_007878 [Morus notabilis]
 gb|EXB36816.1| hypothetical protein L484_007878 [Morus notabilis]
Length=255

 Score = 77.0 bits (188),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 50/117 (43%), Positives = 69/117 (59%), Gaps = 18/117 (15%)
 Frame = +3

Query  207  FGSKALLSA------PSIKV-KLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPLKLE  365
            + SK+ LS+      PS    KLGN    +   K  ++RAS    +S G+ +P APL+ E
Sbjct  34   YDSKSFLSSGFFRSCPSFYFPKLGNALYKY-RAKDVTVRAS---EHSSGNLVPFAPLQFE  89

Query  366  SPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYR  536
            SP+GQ L QIL +HPHL+  A+DQQLE L+TDR+       Q  E S+S  D+ LY+
Sbjct  90   SPVGQLLCQILQTHPHLLPVAIDQQLENLETDRD------AQEKEVSSSPQDL-LYK  139



>gb|KHG08376.1| Beta-casein [Gossypium arboreum]
Length=399

 Score = 78.6 bits (192),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 62/99 (63%), Gaps = 11/99 (11%)
 Frame = +3

Query  249  KLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAA  428
            KLG     +   +C ++RA   L  SG +  PIAP++ ESP+GQ L QIL +HPHL+ AA
Sbjct  47   KLGMVPDKYRGGRCLTMRA---LGESGDNLSPIAPVEFESPVGQLLAQILRTHPHLLPAA  103

Query  429  VDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIA  545
            VDQQL+ LQ+D+N + +   Q+ +        +LY+RIA
Sbjct  104  VDQQLDNLQSDKNDQTEETLQSHD--------LLYKRIA  134



>ref|XP_008238169.1| PREDICTED: uncharacterized protein LOC103336834 [Prunus mume]
Length=405

 Score = 78.6 bits (192),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 50/102 (49%), Positives = 65/102 (64%), Gaps = 17/102 (17%)
 Frame = +3

Query  249  KLGN---RRVAFGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLV  419
            KLGN   +R A G      +RAS    +S  + +P+APL+ ESP GQ L QIL +HPHL+
Sbjct  55   KLGNGLHKRRARGLI----VRAS---KDSSDNLVPVAPLQFESPAGQLLAQILQNHPHLL  107

Query  420  SAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIA  545
            SAA+DQQLE LQ DR+ +++      E SAS  D  LY+RIA
Sbjct  108  SAAIDQQLENLQKDRDAQRK------ETSASSED-PLYKRIA  142



>gb|KDO36404.1| hypothetical protein CISIN_1g034247mg [Citrus sinensis]
Length=100

 Score = 74.3 bits (181),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 51/67 (76%), Gaps = 3/67 (4%)
 Frame = +3

Query  294  SIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLE  473
            ++RAS    +S  + +PIAPL+ ESP+GQ L QIL +HPHL+ AA+DQQLE +Q D+N++
Sbjct  10   TVRAS---GSSDRNVVPIAPLQFESPVGQLLAQILQTHPHLLPAAIDQQLENIQIDKNVQ  66

Query  474  KQNEKQN  494
            +++  Q+
Sbjct  67   REDTSQD  73



>gb|KDP30713.1| hypothetical protein JCGZ_15541 [Jatropha curcas]
Length=405

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 54/118 (46%), Positives = 70/118 (59%), Gaps = 26/118 (22%)
 Frame = +3

Query  222  LLSAPSIKV------KLGNRRVAFGSTKCNS----IRASLPLSNSGGSAMPIAPLKLESP  371
            L SAPS +       KLGN     G TK       +RAS   SN    ++PI+PL+ ESP
Sbjct  35   LSSAPSRRYPSFGMPKLGN-----GMTKFRERGFIVRASGDPSNY---SVPISPLQFESP  86

Query  372  IGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIA  545
            +GQ L QIL +HPHL+ AAVDQQLE LQTDR     + K+++ P +     +LY+RIA
Sbjct  87   VGQLLAQILQTHPHLLPAAVDQQLENLQTDR-----DTKRDETPPSQD---LLYKRIA  136



>ref|XP_004300191.1| PREDICTED: uncharacterized protein LOC101292798 [Fragaria vesca 
subsp. vesca]
Length=405

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/98 (45%), Positives = 64/98 (65%), Gaps = 15/98 (15%)
 Frame = +3

Query  264  RVAFGSTKCNS----IRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAV  431
            +V  G  KC +    +RAS    +S  + +P+APL+ ESP GQ L QIL +HPHL+ AAV
Sbjct  55   KVGNGLYKCRARGLIVRAS---EDSSANLVPVAPLQFESPAGQLLGQILQTHPHLLPAAV  111

Query  432  DQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIA  545
            DQQLE+LQT+R+ +++     + P++ G    LY+RIA
Sbjct  112  DQQLEKLQTERDAQEE-----ESPASKGP---LYKRIA  141



>ref|XP_004981973.1| PREDICTED: uncharacterized protein LOC101781190 isoform X1 [Setaria 
italica]
Length=411

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 70/106 (66%), Gaps = 11/106 (10%)
 Frame = +3

Query  261  RRVAFGSTKCNS--------IRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHL  416
            R  AFGS + NS        +RAS   S S   +  IAPL++ESP GQ L+QIL +HPHL
Sbjct  37   RGFAFGSKQLNSRTKRRSSVVRASWSPSESLPPSSSIAPLRMESPAGQLLSQILHTHPHL  96

Query  417  VSAAVDQQLEQLQTDRNLEKQNEKQN---DEPSASGTDIVLYRRIA  545
            + AA +QQL+QLQTDR  EK  +K++   ++P+ +  D+VLYRRIA
Sbjct  97   LPAAAEQQLQQLQTDREAEKDKDKESGAGEKPAPASGDLVLYRRIA  142



>ref|XP_008373529.1| PREDICTED: uncharacterized protein LOC103436859 [Malus domestica]
Length=403

 Score = 75.5 bits (184),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 50/122 (41%), Positives = 71/122 (58%), Gaps = 27/122 (22%)
 Frame = +3

Query  213  SKALLSA------PSIKV-KLGNRRVAFGSTKCNS----IRASLPLSNSGGSAMPIAPLK  359
            SK+ LSA      PS  + KLGN     G   C +    +RAS    +S  + +P+APL+
Sbjct  42   SKSFLSASFFRSCPSFCIPKLGN-----GLYNCRARGLVVRAS---KDSSDNLVPVAPLQ  93

Query  360  LESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRR  539
             ESP GQ L QIL +HPHL+ AA+DQQLE LQ D++ +++         A+ +  +LY+R
Sbjct  94   FESPAGQLLAQILZTHPHLLPAAIDQQLENLQIDKDAQRKE--------AASSANLLYKR  145

Query  540  IA  545
            IA
Sbjct  146  IA  147



>ref|XP_007040722.1| Uncharacterized protein TCM_016604 [Theobroma cacao]
 gb|EOY25223.1| Uncharacterized protein TCM_016604 [Theobroma cacao]
Length=402

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 55/84 (65%), Gaps = 11/84 (13%)
 Frame = +3

Query  294  SIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLE  473
            ++RAS     S  S  PIAP++ ESP+GQ L QIL +HPHL+ AA+DQQLE LQ+D    
Sbjct  61   TMRAS---GESDDSLSPIAPVQFESPVGQLLAQILRTHPHLLPAAIDQQLENLQSD----  113

Query  474  KQNEKQNDEPSASGTDIVLYRRIA  545
            K ++K+   PS      +LY+RIA
Sbjct  114  KDDQKEETTPSQD----LLYKRIA  133



>ref|XP_008466019.1| PREDICTED: uncharacterized protein LOC103503577 isoform X1 [Cucumis 
melo]
Length=405

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 54/84 (64%), Gaps = 11/84 (13%)
 Frame = +3

Query  294  SIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLE  473
            SIRAS    +   +  P+APL+ ESP+GQ L QIL SHPHL+ A VDQQL+ LQT+R+  
Sbjct  67   SIRAS----DDSRNVYPVAPLQFESPVGQLLAQILQSHPHLLPATVDQQLDNLQTERD--  120

Query  474  KQNEKQNDEPSASGTDIVLYRRIA  545
                 Q +E  +S  D  LY+RIA
Sbjct  121  ----SQTEEAPSSSQD-PLYKRIA  139



>ref|XP_006352932.1| PREDICTED: uncharacterized protein LOC102595128 [Solanum tuberosum]
Length=402

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 61/89 (69%), Gaps = 10/89 (11%)
 Frame = +3

Query  282  TKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTD  461
            T+  +IRA+    +SGG  +P+AP++LES +GQFL Q+L +HPHL+ AA++QQLE LQ +
Sbjct  57   TRSWTIRATAS-GSSGGDLVPVAPVQLESAVGQFLAQMLQTHPHLLPAAIEQQLENLQNE  115

Query  462  RNLE-KQNEKQNDEPSASGTDIVLYRRIA  545
            R+ + K+N+        S T  VL +RIA
Sbjct  116  RDAQLKENQ--------SSTKDVLQKRIA  136



>ref|XP_003612708.1| hypothetical protein MTR_5g028020 [Medicago truncatula]
 gb|AES95666.1| plant/F3C3-6 protein [Medicago truncatula]
Length=410

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 68/123 (55%), Gaps = 18/123 (15%)
 Frame = +3

Query  198  FVKFGSKALLSA-------PSIKVKLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPL  356
            F  F +K +LS        PS   K  N   +F   +   +RAS   ++S  + +P  PL
Sbjct  29   FHSFDAKNVLSTGFLKSCPPSYNAKHYNEPYSFRG-RGLVVRAS---TDSSDNFVPSPPL  84

Query  357  KLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYR  536
            + ESP+GQ L QIL +HPHL  A +DQQLE+LQT+R+        N E S++  +  LY+
Sbjct  85   QFESPVGQLLEQILQTHPHLFLATIDQQLEKLQTERD-------ANKEESSTSYEDSLYK  137

Query  537  RIA  545
            RIA
Sbjct  138  RIA  140



>ref|XP_010055250.1| PREDICTED: uncharacterized protein LOC104443499 [Eucalyptus grandis]
Length=408

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 56/83 (67%), Gaps = 11/83 (13%)
 Frame = +3

Query  297  IRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEK  476
            IRAS    +S  + +P+APL  ESPIGQ L QIL +HPHL+ AA DQQLE LQ++R+ EK
Sbjct  71   IRAS---GDSSDNPVPVAPLTFESPIGQLLAQILQNHPHLLLAAADQQLENLQSERDAEK  127

Query  477  QNEKQNDEPSASGTDIVLYRRIA  545
            +       P+++    +LY+RIA
Sbjct  128  EK-----NPASAD---LLYQRIA  142



>gb|KCW71713.1| hypothetical protein EUGRSUZ_E00224 [Eucalyptus grandis]
Length=465

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 56/83 (67%), Gaps = 11/83 (13%)
 Frame = +3

Query  297  IRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEK  476
            IRAS    +S  + +P+APL  ESPIGQ L QIL +HPHL+ AA DQQLE LQ++R+ EK
Sbjct  128  IRAS---GDSSDNPVPVAPLTFESPIGQLLAQILQNHPHLLLAAADQQLENLQSERDAEK  184

Query  477  QNEKQNDEPSASGTDIVLYRRIA  545
            +       P+++    +LY+RIA
Sbjct  185  EK-----NPASAD---LLYQRIA  199



>ref|XP_004981974.1| PREDICTED: uncharacterized protein LOC101781190 isoform X2 [Setaria 
italica]
Length=410

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 53/106 (50%), Positives = 70/106 (66%), Gaps = 12/106 (11%)
 Frame = +3

Query  261  RRVAFGSTKCNS--------IRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHL  416
            R  AFGS K NS        +RAS   S S   +  IAPL++ESP GQ L+QIL +HPHL
Sbjct  37   RGFAFGS-KLNSRTKRRSSVVRASWSPSESLPPSSSIAPLRMESPAGQLLSQILHTHPHL  95

Query  417  VSAAVDQQLEQLQTDRNLEKQNEKQN---DEPSASGTDIVLYRRIA  545
            + AA +QQL+QLQTDR  EK  +K++   ++P+ +  D+VLYRRIA
Sbjct  96   LPAAAEQQLQQLQTDREAEKDKDKESGAGEKPAPASGDLVLYRRIA  141



>ref|XP_009804854.1| PREDICTED: uncharacterized protein LOC104250017 [Nicotiana sylvestris]
Length=405

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 42/98 (43%), Positives = 64/98 (65%), Gaps = 12/98 (12%)
 Frame = +3

Query  264  RVAFGSTKCNS----IRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAV  431
            R+  G  K  +    IRA+    +SGG  +P+AP++LES +GQFL QIL +HPHL+ AA+
Sbjct  50   RLGIGPEKAQNRNWMIRATAS-GSSGGDLVPVAPVQLESAVGQFLAQILQTHPHLLPAAI  108

Query  432  DQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIA  545
            +QQLE LQ +R+     + + ++PS+     VL++RIA
Sbjct  109  EQQLENLQNERD----TQLKENQPSSKD---VLHKRIA  139



>ref|XP_004136206.1| PREDICTED: uncharacterized protein LOC101213975 [Cucumis sativus]
 ref|XP_004163203.1| PREDICTED: uncharacterized LOC101213975 [Cucumis sativus]
 gb|KGN60350.1| hypothetical protein Csa_3G895960 [Cucumis sativus]
Length=405

 Score = 73.6 bits (179),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 54/84 (64%), Gaps = 11/84 (13%)
 Frame = +3

Query  294  SIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLE  473
            SIRAS    +   +  P+AP++ ESP+GQ L QIL SHPHL+ A VDQQL+ LQT+R+  
Sbjct  67   SIRAS----DDSRNVYPVAPVQFESPVGQLLAQILQSHPHLLPATVDQQLDNLQTERD--  120

Query  474  KQNEKQNDEPSASGTDIVLYRRIA  545
                 Q +E  +S  D  LY+RIA
Sbjct  121  ----SQTEEAPSSSQD-PLYKRIA  139



>ref|XP_009373461.1| PREDICTED: uncharacterized protein LOC103962488 [Pyrus x bretschneideri]
Length=403

 Score = 73.6 bits (179),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 71/122 (58%), Gaps = 27/122 (22%)
 Frame = +3

Query  213  SKALLSA------PSIKV-KLGNRRVAFGSTKCNS----IRASLPLSNSGGSAMPIAPLK  359
            SK+ LSA      PS  + KLGNR        C +    +RAS    +S  + +P++PL+
Sbjct  42   SKSFLSASIFRSCPSFCIPKLGNR-----PYNCRARGLVVRAS---KDSSDNLVPVSPLQ  93

Query  360  LESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRR  539
             ESP GQ L QIL +HPHL+ AA+DQQLE LQ D++ +++         A+ +  +LY+R
Sbjct  94   FESPPGQLLAQILQTHPHLLPAAIDQQLENLQIDKDAQRKE--------AASSANLLYKR  145

Query  540  IA  545
            IA
Sbjct  146  IA  147



>ref|XP_004512464.1| PREDICTED: uncharacterized protein LOC101507671 [Cicer arietinum]
Length=410

 Score = 72.8 bits (177),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 56/83 (67%), Gaps = 10/83 (12%)
 Frame = +3

Query  297  IRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEK  476
            +RAS   ++S  +++P  PL+ E+P+GQ L QIL +HPHLVSA +DQQLE+L T+R+  K
Sbjct  70   VRAS---TDSSDNSVPSPPLQFETPVGQLLEQILQTHPHLVSATIDQQLEKLLTERDAHK  126

Query  477  QNEKQNDEPSASGTDIVLYRRIA  545
                   E S++  +  LY+RIA
Sbjct  127  -------EESSASYENSLYKRIA  142



>ref|XP_009607216.1| PREDICTED: uncharacterized protein LOC104101473 [Nicotiana tomentosiformis]
Length=405

 Score = 72.8 bits (177),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 75/133 (56%), Gaps = 15/133 (11%)
 Frame = +3

Query  153  GPVKSGRRFTTDAPGFVK--FGSKALLSAPSIKVKLGNRRVAFGSTKCNSIRASLPLSNS  326
            G +K    F+     F+   F   +  S P + +  G        T+   IRA+    +S
Sbjct  20   GGLKQFHAFSEPTKSFLSHSFSKSSPFSVPRLGIGPGK-----AQTRNWMIRATSS-GSS  73

Query  327  GGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPS  506
            GG  +P+AP++LES +GQFL Q+L +HPHL+ AA++QQLE LQ +R+     + + ++PS
Sbjct  74   GGDLVPVAPVQLESAVGQFLAQMLQTHPHLLPAAIEQQLENLQNERD----TQLKENQPS  129

Query  507  ASGTDIVLYRRIA  545
            +     VL++RIA
Sbjct  130  SKD---VLHKRIA  139



>ref|XP_004245960.1| PREDICTED: uncharacterized protein LOC101262445 [Solanum lycopersicum]
Length=402

 Score = 72.4 bits (176),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 60/89 (67%), Gaps = 10/89 (11%)
 Frame = +3

Query  282  TKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTD  461
            T+   IRA+    +SGG  +P+AP++LES +GQFL Q+L +HPHL+ AA++QQL+ LQ +
Sbjct  57   TRSWKIRATAS-GSSGGDLVPVAPVQLESAVGQFLAQMLQTHPHLLPAAIEQQLDNLQNE  115

Query  462  RNLE-KQNEKQNDEPSASGTDIVLYRRIA  545
            R+ + K+N+        S T  VL +RIA
Sbjct  116  RDAQLKENQ--------SSTKDVLQKRIA  136



>gb|EPS63452.1| hypothetical protein M569_11331, partial [Genlisea aurea]
Length=342

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 58/93 (62%), Gaps = 14/93 (15%)
 Frame = +3

Query  285  KCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDR  464
            +   +RAS   S SG    PI+PL+LESP+GQ L+Q L +HPHL+ AAV+QQLE LQ  R
Sbjct  5    RSTMVRAS---STSGRD--PISPLELESPVGQLLSQALQTHPHLLMAAVEQQLENLQRQR  59

Query  465  NLEKQNEKQNDEPSASGT------DIVLYRRIA  545
            +   + +K+   P +  T      D VLY+RIA
Sbjct  60   D---EGKKEPSRPQSKNTASTPSSDDVLYKRIA  89



>gb|AAQ14307.1| ABRH7, partial [Marsilea quadrifolia]
Length=176

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 44/70 (63%), Gaps = 4/70 (6%)
 Frame = +3

Query  330  GSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSA  509
             S  P+APL  ESP GQFLT++L SHPHLV AA +QQLE L   R      E    +P+ 
Sbjct  110  ASTTPLAPLIPESPSGQFLTELLQSHPHLVPAAAEQQLETLAEAREAASSQE----QPTP  165

Query  510  SGTDIVLYRR  539
             G ++VLY+R
Sbjct  166  DGNELVLYKR  175



>ref|XP_002518989.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF43522.1| conserved hypothetical protein [Ricinus communis]
Length=408

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 56/84 (67%), Gaps = 11/84 (13%)
 Frame = +3

Query  294  SIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLE  473
            ++RAS    ++   ++P+ PLK ESP+GQ L QIL +HPHL+ +A+DQQLE LQ+DR+  
Sbjct  73   TLRAS---GDANNYSVPLPPLKFESPVGQLLAQILQTHPHLLPSAIDQQLENLQSDRD--  127

Query  474  KQNEKQNDEPSASGTDIVLYRRIA  545
                  + + S S  D+ LY+RIA
Sbjct  128  -----ASTDQSPSSQDL-LYKRIA  145



>ref|XP_007158234.1| hypothetical protein PHAVU_002G135300g [Phaseolus vulgaris]
 gb|ESW30228.1| hypothetical protein PHAVU_002G135300g [Phaseolus vulgaris]
Length=408

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 63/102 (62%), Gaps = 7/102 (7%)
 Frame = +3

Query  180  TTDAPGFVKFGSKALLSAPS-IKVKLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPL  356
             +DA GF+  G   L S PS    KL N    F + + +  RAS   +NS  + +P APL
Sbjct  33   VSDAKGFLSGG--FLKSCPSSYNPKLYNEFYNFRA-RGSVARAS---ANSRDNPVPFAPL  86

Query  357  KLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQN  482
            + ESP+GQ L QI  +HPHL+ AA+DQQLE LQT R+ +K++
Sbjct  87   QFESPVGQLLEQISNTHPHLLPAAIDQQLENLQTARDAQKES  128



>ref|XP_010240349.1| PREDICTED: uncharacterized protein LOC104585415 [Brachypodium 
distachyon]
Length=391

 Score = 69.7 bits (169),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 48/75 (64%), Gaps = 7/75 (9%)
 Frame = +3

Query  321  NSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDE  500
            +SG     +APLK E+P GQ L QIL SHPHL+   VDQQLE LQ++++       QN+E
Sbjct  62   DSGDGETQLAPLKFETPSGQLLVQILQSHPHLIPVTVDQQLENLQSEKD------AQNEE  115

Query  501  PSASGTDIVLYRRIA  545
             +    D+ LY+RIA
Sbjct  116  AAKVPQDL-LYKRIA  129



>gb|AFK33975.1| unknown [Lotus japonicus]
Length=157

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 53/83 (64%), Gaps = 10/83 (12%)
 Frame = +3

Query  297  IRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEK  476
            +RAS   ++S  + +P APL+ ESP+GQ L QI+ +H HL+S A+DQQLE LQT R+  K
Sbjct  72   MRAS---ADSSDNLVPSAPLQFESPVGQLLGQIMQNHSHLLSTAIDQQLENLQTARDAPK  128

Query  477  QNEKQNDEPSASGTDIVLYRRIA  545
                   E S + +   LY+RIA
Sbjct  129  -------EESFTSSPDPLYKRIA  144



>ref|XP_003534296.1| PREDICTED: uncharacterized protein LOC100802337 [Glycine max]
Length=408

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 50/76 (66%), Gaps = 9/76 (12%)
 Frame = +3

Query  318  SNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQND  497
            ++S  + +P APL+LESP+GQ L +I  +HPHL++A +DQQLE LQ  R+ +K+++   D
Sbjct  74   ADSRDNLVPFAPLQLESPVGQLLEKISNTHPHLLTAVIDQQLENLQNVRDAQKESDPSQD  133

Query  498  EPSASGTDIVLYRRIA  545
                      LY+RIA
Sbjct  134  S---------LYKRIA  140



>gb|AFW59314.1| hypothetical protein ZEAMMB73_007794 [Zea mays]
Length=400

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 49/76 (64%), Gaps = 7/76 (9%)
 Frame = +3

Query  318  SNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQND  497
            + SG     +APL+ ESP GQ L QIL SHPHL+ A VDQQLE LQ++++       Q++
Sbjct  70   AESGDGYTRLAPLRFESPSGQLLIQILQSHPHLIPATVDQQLENLQSEKS------AQSE  123

Query  498  EPSASGTDIVLYRRIA  545
            E S    D+ LY+RIA
Sbjct  124  EASKVPQDL-LYKRIA  138



>ref|XP_004976664.1| PREDICTED: uncharacterized protein LOC101761297 [Setaria italica]
Length=402

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 54/88 (61%), Gaps = 10/88 (11%)
 Frame = +3

Query  282  TKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTD  461
            T+   I+A    + SG     +APL+ ESP GQ L QIL SHPHL+ A VDQQLE LQ++
Sbjct  63   TRTFKIKAK---AESGDGYTRLAPLRFESPSGQLLVQILQSHPHLLPATVDQQLENLQSE  119

Query  462  RNLEKQNEKQNDEPSASGTDIVLYRRIA  545
            ++ +K+      E S    D+ LY+RIA
Sbjct  120  KDAQKE------EASKVPQDL-LYKRIA  140



>gb|EEC77902.1| hypothetical protein OsI_17223 [Oryza sativa Indica Group]
Length=420

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 52/150 (35%), Positives = 71/150 (47%), Gaps = 20/150 (13%)
 Frame = +3

Query  96   CCCMMEMTTSLRSSITVGCGPVKSGRRFTTDAPGFVKFGSKALLSAPSIKVKLGNRRVAF  275
            CCC+       R S ++G      G  F+     F  F  K+ L   S K          
Sbjct  29   CCCLR------RPSASLGPATPPQGASFSIRDMVFRLF-DKSFLYTSSPKSGF-----LI  76

Query  276  GSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQ  455
             S +  S++    + +SG     +APL  E+P GQ L QIL SHPHL+ A VDQQLE LQ
Sbjct  77   NSCRARSLKVKAKM-DSGDGLTRLAPLMFETPSGQLLVQILQSHPHLLPATVDQQLENLQ  135

Query  456  TDRNLEKQNEKQNDEPSASGTDIVLYRRIA  545
            ++++       Q  E S    D+ LY+RIA
Sbjct  136  SEKD------AQEKEASKVPQDL-LYKRIA  158



>ref|XP_008800078.1| PREDICTED: uncharacterized protein LOC103714566 isoform X2 [Phoenix 
dactylifera]
Length=390

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 64/114 (56%), Gaps = 20/114 (18%)
 Frame = +3

Query  234  PSIKVKL-----GNRRVAFGSTKCNSIRASLPLSNSGGS-----AMPIAPLKLESPIGQF  383
            P + +KL      + R  F S KC S   S+   N GG      A  +    LE+ +GQ 
Sbjct  27   PPVDLKLLPSLSSDSRAGF-SNKCYS---SVGWPNIGGQLEKYRARSLKVKALENSVGQL  82

Query  384  LTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIA  545
            L+QI+ +HPHL+ AA+DQQLE+LQ+DR+ +K+      E   +  D+ LYRRIA
Sbjct  83   LSQIMQTHPHLLPAAIDQQLEKLQSDRDAQKE------ETPPATQDLPLYRRIA  130



>ref|XP_002448446.1| hypothetical protein SORBIDRAFT_06g027240 [Sorghum bicolor]
 gb|EES12774.1| hypothetical protein SORBIDRAFT_06g027240 [Sorghum bicolor]
Length=402

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 45/67 (67%), Gaps = 7/67 (10%)
 Frame = +3

Query  345  IAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDI  524
            +APL+ ESP GQ L QIL SHPHL+ A VDQQLE LQ+++        Q++E S    D+
Sbjct  81   LAPLRFESPSGQLLVQILQSHPHLIPATVDQQLENLQSEKT------AQSEEASKVPQDL  134

Query  525  VLYRRIA  545
             LY+RIA
Sbjct  135  -LYKRIA  140



>gb|EYU43718.1| hypothetical protein MIMGU_mgv1a007450mg [Erythranthe guttata]
Length=407

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 46/119 (39%), Positives = 66/119 (55%), Gaps = 23/119 (19%)
 Frame = +3

Query  192  PGFVKFGSKALLSAPSIKVKLGNRRVAFGSTKCNSIRASLPLSNSGGSAMP--IAPLKLE  365
            PGF K  S      P ++V L   R     T+  ++RAS    NS G  +     P+++E
Sbjct  36   PGFSKNWSS---RNPKLEVGLDKLR-----TRSFTVRAS---GNSDGDLVEENKNPVQME  84

Query  366  SPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRI  542
            SP+GQ L QIL +HPHL+ A  +QQLE LQ++R      E ++D    S  D++LY+RI
Sbjct  85   SPVGQLLAQILQTHPHLLLATAEQQLENLQSER------EAKDD----SSKDLLLYKRI  133



>gb|AFW59313.1| hypothetical protein ZEAMMB73_007794 [Zea mays]
Length=135

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 46/73 (63%), Gaps = 7/73 (10%)
 Frame = +3

Query  318  SNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQND  497
            + SG     +APL+ ESP GQ L QIL SHPHL+ A VDQQLE LQ++++       Q++
Sbjct  70   AESGDGYTRLAPLRFESPSGQLLIQILQSHPHLIPATVDQQLENLQSEKS------AQSE  123

Query  498  EPSASGTDIVLYR  536
            E S    D+ LY+
Sbjct  124  EASKVPQDL-LYK  135



>ref|NP_001053731.1| Os04g0595100 [Oryza sativa Japonica Group]
 emb|CAE03929.1| OSJNba0093F12.3 [Oryza sativa Japonica Group]
 emb|CAD41566.3| OSJNBa0006A01.21 [Oryza sativa Japonica Group]
 dbj|BAF15645.1| Os04g0595100 [Oryza sativa Japonica Group]
 gb|EAZ31841.1| hypothetical protein OsJ_16003 [Oryza sativa Japonica Group]
 dbj|BAG90593.1| unnamed protein product [Oryza sativa Japonica Group]
Length=405

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 46/75 (61%), Gaps = 7/75 (9%)
 Frame = +3

Query  321  NSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDE  500
            +SG     +APL  E+P GQ L QIL SHPHL+ A VDQQLE LQ++++       Q  E
Sbjct  76   DSGDGLTRLAPLMFETPSGQLLVQILQSHPHLLPATVDQQLENLQSEKD------AQEKE  129

Query  501  PSASGTDIVLYRRIA  545
             S    D+ LY+RIA
Sbjct  130  ASKVPQDL-LYKRIA  143



>ref|NP_001145533.1| uncharacterized protein LOC100278968 [Zea mays]
 gb|ACG48280.1| hypothetical protein [Zea mays]
Length=400

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 48/76 (63%), Gaps = 7/76 (9%)
 Frame = +3

Query  318  SNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQND  497
            + SG     +APL+ ESP GQ L QIL SHPHL+ A VDQQL  LQ++++       Q++
Sbjct  70   AESGDGYTRLAPLRFESPSGQLLIQILQSHPHLIPATVDQQLGNLQSEKS------AQSE  123

Query  498  EPSASGTDIVLYRRIA  545
            E S    D+ LY+RIA
Sbjct  124  EASKVPQDL-LYKRIA  138



>ref|NP_001242537.1| uncharacterized protein LOC100810147 [Glycine max]
 gb|ACU21518.1| unknown [Glycine max]
Length=406

 Score = 63.5 bits (153),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 37/49 (76%), Gaps = 2/49 (4%)
 Frame = +3

Query  339  MPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNE  485
            +P APL+ ESP+GQ L QI  +HPHL+ AA+DQQLE LQT R+   QNE
Sbjct  81   VPFAPLQFESPVGQLLEQISNTHPHLLPAAIDQQLENLQTARD--AQNE  127



>gb|KHN40428.1| hypothetical protein glysoja_000926 [Glycine soja]
Length=406

 Score = 63.5 bits (153),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 37/49 (76%), Gaps = 2/49 (4%)
 Frame = +3

Query  339  MPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNE  485
            +P APL+ ESP+GQ L QI  +HPHL+ AA+DQQLE LQT R+   QNE
Sbjct  81   VPFAPLQFESPVGQLLEQISNTHPHLLPAAIDQQLENLQTARD--AQNE  127



>ref|XP_009145204.1| PREDICTED: uncharacterized protein LOC103868901 [Brassica rapa]
Length=401

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 46/68 (68%), Gaps = 8/68 (12%)
 Frame = +3

Query  342  PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTD  521
            PIAP++LESP+GQ L QIL +HPHL+   VDQQL++L T      +N+    EPS+S   
Sbjct  72   PIAPVELESPVGQLLDQILRTHPHLLPVTVDQQLDKLST------ENDNLKAEPSSSQD-  124

Query  522  IVLYRRIA  545
             +L +RI+
Sbjct  125  -ILSKRIS  131



>emb|CDY35549.1| BnaA05g16370D [Brassica napus]
Length=402

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 46/68 (68%), Gaps = 8/68 (12%)
 Frame = +3

Query  342  PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTD  521
            PIAP++LESP+GQ L QIL +HPHL+   VDQQL++L T      +N+    EPS+S   
Sbjct  72   PIAPVELESPVGQLLDQILRTHPHLLPVTVDQQLDKLST------ENDNLKAEPSSSQD-  124

Query  522  IVLYRRIA  545
             +L +RI+
Sbjct  125  -ILSKRIS  131



>ref|XP_002977160.1| hypothetical protein SELMODRAFT_106276 [Selaginella moellendorffii]
 gb|EFJ21769.1| hypothetical protein SELMODRAFT_106276 [Selaginella moellendorffii]
Length=333

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 44/67 (66%), Gaps = 5/67 (7%)
 Frame = +3

Query  345  IAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDI  524
            + P + ESPIGQFL  +L SHPHL   A +Q ++QL  D+N     EK  +   +SG+++
Sbjct  2    VGPWEPESPIGQFLVSLLQSHPHLFLEAAEQHIQQLAADKN--AAAEKSTN---SSGSEL  56

Query  525  VLYRRIA  545
            VLY+RIA
Sbjct  57   VLYKRIA  63



>ref|XP_010540738.1| PREDICTED: uncharacterized protein LOC104814412 [Tarenaya hassleriana]
Length=407

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 44/108 (41%), Positives = 58/108 (54%), Gaps = 22/108 (20%)
 Frame = +3

Query  231  APSIKVKLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHP  410
            AP +     N     G  +  ++RAS     S  ++  IAPL+LESP+GQ L QIL +HP
Sbjct  47   APKLGAAFDN-----GRGRGVTVRAS---GESNENSDLIAPLELESPVGQLLVQILRTHP  98

Query  411  HLVSAAVDQQLEQLQTDRNLEKQNEKQ---NDEPSASGTDIVLYRRIA  545
            HL+   VDQQLE L         NEK+   N+ PS+      LY+RIA
Sbjct  99   HLLPITVDQQLENL--------ANEKEARGNELPSSQDP---LYKRIA  135



>ref|XP_002890970.1| hypothetical protein ARALYDRAFT_473397 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67229.1| hypothetical protein ARALYDRAFT_473397 [Arabidopsis lyrata subsp. 
lyrata]
Length=406

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 53/90 (59%), Gaps = 9/90 (10%)
 Frame = +3

Query  276  GSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQ  455
            G  +  ++RAS    +S G+  P+AP++LESP+GQ L QIL +HPHL+   VD+QLE+  
Sbjct  56   GRGRIVTVRASGE-EDSNGNFAPLAPVELESPVGQLLEQILRTHPHLLPVTVDEQLEKFA  114

Query  456  TDRNLEKQNEKQNDEPSASGTDIVLYRRIA  545
                     E +  +  +S T  +L +RI+
Sbjct  115  A--------ENETLKADSSATQDILQKRIS  136



>ref|XP_006415245.1| hypothetical protein EUTSA_v10007794mg [Eutrema salsugineum]
 gb|ESQ33598.1| hypothetical protein EUTSA_v10007794mg [Eutrema salsugineum]
Length=405

 Score = 60.8 bits (146),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 51/84 (61%), Gaps = 8/84 (10%)
 Frame = +3

Query  294  SIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLE  473
            ++RAS    +S  S  P+AP++LESP+GQ L QIL +HPHL+   VDQQLE+        
Sbjct  60   TVRASGGEEDSNESFAPLAPVELESPVGQLLEQILRTHPHLLPITVDQQLEKFAA-----  114

Query  474  KQNEKQNDEPSASGTDIVLYRRIA  545
             +NE    E S+S    +L +RI+
Sbjct  115  -ENESLKAESSSSQD--LLSKRIS  135



>ref|XP_006653725.1| PREDICTED: uncharacterized protein LOC102702753 [Oryza brachyantha]
Length=399

 Score = 60.5 bits (145),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 44/75 (59%), Gaps = 7/75 (9%)
 Frame = +3

Query  321  NSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDE  500
            +SG     +APL  ESP GQ L QIL SHPHL+ A VD QLE LQ++++       Q  E
Sbjct  70   DSGDGRTRLAPLIFESPSGQLLVQILQSHPHLLPATVDHQLENLQSEKD------AQEKE  123

Query  501  PSASGTDIVLYRRIA  545
                  D+ LY+RIA
Sbjct  124  ALKVPQDL-LYKRIA  137



>ref|XP_006307539.1| hypothetical protein CARUB_v10009166mg, partial [Capsella rubella]
 gb|EOA40437.1| hypothetical protein CARUB_v10009166mg, partial [Capsella rubella]
Length=440

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = +3

Query  276  GSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQL  452
            G  +C ++RA     ++  +  P+AP++LESP+GQ L QIL +HPHL+   VD+QLE+ 
Sbjct  90   GRGRCVTVRALGDEDSNNENFAPLAPVELESPVGQLLEQILRTHPHLLPVTVDEQLEKF  148



>gb|EMT04061.1| hypothetical protein F775_32804 [Aegilops tauschii]
Length=392

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 44/75 (59%), Gaps = 7/75 (9%)
 Frame = +3

Query  321  NSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDE  500
            +SG     +AP+K E+P GQ L QIL S PHL+   VDQQLE L  ++  +K       E
Sbjct  61   DSGDGETQLAPVKFETPSGQLLAQILQSQPHLIPVTVDQQLENLTAEKIAQK-------E  113

Query  501  PSASGTDIVLYRRIA  545
             +A   + +LY+RIA
Sbjct  114  KAAKVPEDLLYKRIA  128



>emb|CDY29940.1| BnaC05g28960D [Brassica napus]
Length=401

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +3

Query  318  SNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTD  461
            S    +  PIAP++LESP+GQ L QIL +HPHL+   VDQQL++L T+
Sbjct  64   SGEDDNFAPIAPVELESPVGQLLDQILRTHPHLLPVTVDQQLDKLSTE  111



>ref|XP_002965311.1| hypothetical protein SELMODRAFT_82738 [Selaginella moellendorffii]
 gb|EFJ34149.1| hypothetical protein SELMODRAFT_82738 [Selaginella moellendorffii]
Length=333

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 43/67 (64%), Gaps = 5/67 (7%)
 Frame = +3

Query  345  IAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDI  524
            + P + ESPIGQFL  +L SHPHL   A +Q ++QL  D+N     EK  +   +S +++
Sbjct  2    VGPWEPESPIGQFLVSLLQSHPHLFLEAAEQHIQQLAADKN--AAAEKSTN---SSDSEL  56

Query  525  VLYRRIA  545
            VLY+RIA
Sbjct  57   VLYKRIA  63



>dbj|BAJ87444.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=392

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 43/74 (58%), Gaps = 7/74 (9%)
 Frame = +3

Query  324  SGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEP  503
            SG     +AP+K E+P GQ L QIL S PHL+   VDQQLE L  ++  +K       E 
Sbjct  62   SGDGEAQLAPVKFETPSGQLLAQILQSQPHLIPVTVDQQLENLTAEKIAQK-------EK  114

Query  504  SASGTDIVLYRRIA  545
            +A   + +LY+RIA
Sbjct  115  AAKVPEDLLYKRIA  128



>gb|EMS68345.1| hypothetical protein TRIUR3_07699 [Triticum urartu]
Length=391

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 44/75 (59%), Gaps = 7/75 (9%)
 Frame = +3

Query  321  NSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDE  500
            +SG     +AP+K E+P GQ L Q+L S PHL+   VDQQLE L  ++  +K       E
Sbjct  60   DSGDGETQLAPVKFETPSGQLLAQMLQSQPHLIPVTVDQQLENLTAEKIAQK-------E  112

Query  501  PSASGTDIVLYRRIA  545
             +A   + +LY+RIA
Sbjct  113  KAAKVPEDLLYKRIA  127



>ref|NP_564389.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAG23441.1|AC084165_7 unknown protein [Arabidopsis thaliana]
 gb|AAK59781.1| At1g32160/F3C3_6 [Arabidopsis thaliana]
 gb|AAM65447.1| unknown [Arabidopsis thaliana]
 gb|AAO11596.1| At1g32160/F3C3_6 [Arabidopsis thaliana]
 gb|AEE31442.1| uncharacterized protein AT1G32160 [Arabidopsis thaliana]
Length=406

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 53/90 (59%), Gaps = 9/90 (10%)
 Frame = +3

Query  276  GSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQ  455
            G  +  ++RAS    +S  +  P+AP++LESP+GQ L QIL +HPHL+   VD+QLE+  
Sbjct  56   GRGRSVTVRASGD-EDSNENFAPLAPVELESPVGQLLEQILRTHPHLLPVTVDEQLEKFA  114

Query  456  TDRNLEKQNEKQNDEPSASGTDIVLYRRIA  545
                     E ++ +  +S T  +L +RI+
Sbjct  115  A--------ESESRKADSSSTQDILQKRIS  136



>ref|XP_010478637.1| PREDICTED: uncharacterized protein LOC104757587 [Camelina sativa]
Length=407

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +3

Query  318  SNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQL  452
             +S  +  P+AP++LESP+GQ L QIL +HPHL    VD+QLE+ 
Sbjct  69   EDSNENFAPLAPVELESPVGQLLEQILRTHPHLFPVTVDEQLEKF  113



>ref|XP_010461033.1| PREDICTED: uncharacterized protein LOC104741810 [Camelina sativa]
Length=406

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +3

Query  321  NSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQL  452
            +S  +  P+AP++LESP+GQ L QIL +HPHL    VD+QLE+ 
Sbjct  70   DSNENFAPLAPVELESPVGQLLDQILRTHPHLFPVTVDEQLEKF  113



>gb|KFK44959.1| hypothetical protein AALP_AA1G325800 [Arabis alpina]
Length=405

 Score = 55.1 bits (131),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 42/67 (63%), Gaps = 8/67 (12%)
 Frame = +3

Query  345  IAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDI  524
            +AP+ LESP+GQ L QIL +HPHL+   VD+QLE+L +      +NE    E   S T  
Sbjct  77   LAPVDLESPVGQLLMQILRTHPHLLPVTVDEQLEKLAS------ENESLKAE--LSSTQD  128

Query  525  VLYRRIA  545
            VL +RI+
Sbjct  129  VLSKRIS  135



>ref|XP_010499760.1| PREDICTED: uncharacterized protein LOC104777247 [Camelina sativa]
Length=410

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 43/75 (57%), Gaps = 8/75 (11%)
 Frame = +3

Query  321  NSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDE  500
            +S  +  P+AP++LES +GQ L QIL +HPHL    VD+QLE+   +    K +      
Sbjct  74   DSFENFAPLAPVELESHVGQLLEQILRTHPHLFPVTVDEQLEKFAAENETLKAD------  127

Query  501  PSASGTDIVLYRRIA  545
              AS +  +L +RI+
Sbjct  128  --ASSSQDILSKRIS  140



>gb|ABR16101.1| unknown [Picea sitchensis]
Length=420

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 43/136 (32%), Positives = 60/136 (44%), Gaps = 16/136 (12%)
 Frame = +3

Query  150  CGPVK---SGRRFTTDAPGFVKF-GSKALLSAPSIKVKLGNRRVAFGSTKCNSIRASLPL  317
            CG +    S  RF  D      F GS+ L      K K           K + I  +   
Sbjct  22   CGRLSRSCSASRFYKDKRVCTDFQGSRDLYGKAVFKSK--------NWHKISGIHIARAE  73

Query  318  SNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQND  497
             + G  +   APL+L+S  GQ L+ IL + PHL   A  +QLE+L  DR+    +     
Sbjct  74   YHEGYVSSQFAPLELKSSAGQLLSDILQNQPHLFHVAAAKQLEELAADRD----DAITRQ  129

Query  498  EPSASGTDIVLYRRIA  545
            E S+S    VL+R+IA
Sbjct  130  ELSSSDAYSVLHRKIA  145



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 592801777335