BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002A21

Length=356
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009620720.1|  PREDICTED: beta-amyrin 28-oxidase-like             106   2e-24   Nicotiana tomentosiformis
emb|CDP18172.1|  unnamed protein product                                105   5e-24   Coffea canephora [robusta coffee]
ref|XP_009768074.1|  PREDICTED: beta-amyrin 28-oxidase-like             103   1e-23   Nicotiana sylvestris
emb|CDP18056.1|  unnamed protein product                                102   3e-23   Coffea canephora [robusta coffee]
ref|XP_006353629.1|  PREDICTED: cytochrome P450 716B2-like              103   3e-23   Solanum tuberosum [potatoes]
ref|XP_011099144.1|  PREDICTED: beta-amyrin 28-oxidase-like             102   3e-23   Sesamum indicum [beniseed]
gb|KCW72951.1|  hypothetical protein EUGRSUZ_E01403                     102   5e-23   Eucalyptus grandis [rose gum]
ref|XP_006353706.1|  PREDICTED: cytochrome P450 716B2-like              102   5e-23   Solanum tuberosum [potatoes]
ref|XP_010056285.1|  PREDICTED: beta-amyrin 28-oxidase-like             102   7e-23   Eucalyptus grandis [rose gum]
ref|XP_009601238.1|  PREDICTED: beta-amyrin 28-oxidase-like             100   2e-22   Nicotiana tomentosiformis
ref|XP_004242231.1|  PREDICTED: beta-amyrin 28-oxidase-like             100   2e-22   Solanum lycopersicum
gb|EYU22847.1|  hypothetical protein MIMGU_mgv1a022104mg                100   2e-22   Erythranthe guttata [common monkey flower]
ref|XP_010252185.1|  PREDICTED: beta-amyrin 28-oxidase-like           99.0    9e-22   Nelumbo nucifera [Indian lotus]
ref|XP_007023620.1|  Cytochrome P450                                  98.6    2e-21   
ref|XP_002521782.1|  cytochrome P450, putative                        98.2    2e-21   
gb|AGN04219.1|  cytochrome P450                                       98.2    2e-21   Salvia miltiorrhiza [Chinese salvia]
ref|XP_009768075.1|  PREDICTED: beta-amyrin 28-oxidase isoform X1     97.8    2e-21   Nicotiana sylvestris
ref|XP_010070480.1|  PREDICTED: beta-amyrin 28-oxidase-like           97.8    3e-21   Eucalyptus grandis [rose gum]
ref|XP_010056287.1|  PREDICTED: beta-amyrin 28-oxidase-like           96.3    8e-21   Eucalyptus grandis [rose gum]
ref|XP_002537996.1|  cytochrome P450, putative                        91.7    9e-21   
ref|XP_004241821.1|  PREDICTED: beta-amyrin 28-oxidase-like           96.3    9e-21   Solanum lycopersicum
ref|XP_010063751.1|  PREDICTED: beta-amyrin 28-oxidase-like           96.3    1e-20   Eucalyptus grandis [rose gum]
ref|XP_011048247.1|  PREDICTED: beta-amyrin 28-oxidase-like           96.3    1e-20   Populus euphratica
ref|XP_007014637.1|  Cytochrome P450                                  94.7    3e-20   
ref|XP_007023618.1|  Cytochrome P450                                  94.7    4e-20   Theobroma cacao [chocolate]
ref|XP_010044930.1|  PREDICTED: cytochrome P450 716B1-like            94.4    4e-20   Eucalyptus grandis [rose gum]
gb|EYU22845.1|  hypothetical protein MIMGU_mgv1a021193mg              94.4    4e-20   Erythranthe guttata [common monkey flower]
ref|XP_008348466.1|  PREDICTED: beta-amyrin 28-oxidase-like           92.8    5e-20   
ref|XP_008353962.1|  PREDICTED: beta-amyrin 28-oxidase-like           92.8    5e-20   
ref|XP_002528002.1|  cytochrome P450, putative                        94.0    6e-20   Ricinus communis
ref|XP_002325964.2|  hypothetical protein POPTR_0019s10730g           94.0    7e-20   Populus trichocarpa [western balsam poplar]
ref|XP_009617504.1|  PREDICTED: beta-amyrin 28-oxidase-like isofo...  92.4    1e-19   Nicotiana tomentosiformis
gb|KJB81290.1|  hypothetical protein B456_013G137300                  93.2    1e-19   Gossypium raimondii
ref|NP_001268115.1|  cytochrome P450 CYP716A15                        93.2    1e-19   Vitis vinifera
gb|EYU22846.1|  hypothetical protein MIMGU_mgv1a006514mg              92.4    2e-19   Erythranthe guttata [common monkey flower]
emb|CAN76484.1|  hypothetical protein VITISV_000800                   90.5    2e-19   Vitis vinifera
ref|XP_002266024.1|  PREDICTED: beta-amyrin 28-oxidase                92.8    2e-19   Vitis vinifera
gb|AHL46848.1|  cytochrome P450                                       92.4    3e-19   Betula platyphylla [Asian white birch]
gb|AFO67237.1|  putative cytochrome P450                              88.2    3e-19   Aralia elata
ref|XP_003531849.1|  PREDICTED: cytochrome P450 716B2 isoform X1      92.0    3e-19   Glycine max [soybeans]
ref|XP_010048517.1|  PREDICTED: beta-amyrin 28-oxidase-like           92.0    3e-19   Eucalyptus grandis [rose gum]
ref|XP_007139495.1|  hypothetical protein PHAVU_008G034400g           92.0    3e-19   Phaseolus vulgaris [French bean]
ref|XP_002299099.2|  hypothetical protein POPTR_0001s04030g           91.3    3e-19   
ref|XP_007020151.1|  Cytochrome P450                                  92.0    4e-19   
ref|XP_002279623.1|  PREDICTED: beta-amyrin 28-oxidase                91.7    4e-19   Vitis vinifera
emb|CAN72302.1|  hypothetical protein VITISV_041935                   91.7    4e-19   Vitis vinifera
ref|NP_001268076.1|  cytochrome P450 CYP716A17                        91.7    4e-19   Vitis vinifera
gb|KDO73360.1|  hypothetical protein CISIN_1g036125mg                 89.7    4e-19   Citrus sinensis [apfelsine]
ref|XP_010661150.1|  PREDICTED: beta-amyrin 28-oxidase isoform X2     91.3    5e-19   Vitis vinifera
emb|CBI39948.3|  unnamed protein product                              91.7    5e-19   Vitis vinifera
ref|XP_009376339.1|  PREDICTED: beta-amyrin 28-oxidase-like           91.7    5e-19   Pyrus x bretschneideri [bai li]
ref|XP_002263499.1|  PREDICTED: beta-amyrin 28-oxidase isoform X1     91.7    5e-19   Vitis vinifera
ref|XP_011031513.1|  PREDICTED: beta-amyrin 28-oxidase-like           91.3    5e-19   Populus euphratica
ref|XP_010060835.1|  PREDICTED: beta-amyrin 28-oxidase-like           91.3    5e-19   Eucalyptus grandis [rose gum]
ref|XP_007020144.1|  Cytochrome P450                                  91.3    5e-19   
ref|XP_009345334.1|  PREDICTED: beta-amyrin 28-oxidase-like           91.3    6e-19   Pyrus x bretschneideri [bai li]
ref|XP_008391096.1|  PREDICTED: beta-amyrin 28-oxidase                91.3    6e-19   Malus domestica [apple tree]
ref|XP_007160209.1|  hypothetical protein PHAVU_002G302100g           91.3    6e-19   Phaseolus vulgaris [French bean]
ref|XP_007222742.1|  hypothetical protein PRUPE_ppa004988mg           91.3    7e-19   Prunus persica
ref|XP_008224572.1|  PREDICTED: beta-amyrin 28-oxidase-like           91.3    7e-19   Prunus mume [ume]
ref|XP_011085174.1|  PREDICTED: beta-amyrin 28-oxidase-like           90.9    8e-19   Sesamum indicum [beniseed]
emb|CBI24045.3|  unnamed protein product                              90.1    1e-18   Vitis vinifera
ref|XP_011031249.1|  PREDICTED: beta-amyrin 28-oxidase-like           90.9    1e-18   Populus euphratica
gb|ACU20818.1|  unknown                                               90.5    1e-18   Glycine max [soybeans]
emb|CDP14237.1|  unnamed protein product                              90.5    1e-18   Coffea canephora [robusta coffee]
gb|AGM38076.1|  putative cytochrome P450                              86.3    1e-18   Stenocereus gummosus
ref|XP_011078182.1|  PREDICTED: beta-amyrin 28-oxidase-like           90.1    1e-18   
ref|XP_003530525.1|  PREDICTED: cytochrome P450 716B2                 90.1    2e-18   Glycine max [soybeans]
gb|KJB56450.1|  hypothetical protein B456_009G120200                  90.1    2e-18   Gossypium raimondii
ref|XP_010669702.1|  PREDICTED: beta-amyrin 28-oxidase-like           89.7    2e-18   Beta vulgaris subsp. vulgaris [field beet]
dbj|BAP59951.1|  cytochrome P450 monooxygenase CYP716A50              89.7    2e-18   Coffea arabica [arabica coffee]
gb|KDP42281.1|  hypothetical protein JCGZ_01605                       89.7    2e-18   Jatropha curcas
ref|XP_010095208.1|  Cytochrome P450                                  89.7    3e-18   Morus notabilis
gb|AGC31652.1|  cytochrome P450 CYP6H                                 89.4    3e-18   Panax quinquefolius
gb|KEH21306.1|  cytochrome P450 family protein                        88.6    3e-18   Medicago truncatula
ref|XP_002529893.1|  cytochrome P450, putative                        89.4    3e-18   Ricinus communis
gb|AHA50080.1|  cytochrome P450                                       89.4    3e-18   Eleutherococcus senticosus
gb|AHK23636.1|  cytochrome P450                                       89.4    3e-18   Panax notoginseng [san-qi]
gb|EYU26567.1|  hypothetical protein MIMGU_mgv1a005379mg              89.4    3e-18   Erythranthe guttata [common monkey flower]
ref|XP_009617496.1|  PREDICTED: beta-amyrin 28-oxidase-like isofo...  89.0    4e-18   Nicotiana tomentosiformis
ref|XP_006376223.1|  hypothetical protein POPTR_0013s11080g           89.0    5e-18   Populus trichocarpa [western balsam poplar]
emb|CAN67939.1|  hypothetical protein VITISV_013692                   89.0    5e-18   Vitis vinifera
ref|XP_009778451.1|  PREDICTED: beta-amyrin 28-oxidase-like           88.6    5e-18   Nicotiana sylvestris
ref|XP_006338129.1|  PREDICTED: cytochrome P450 716B2-like            88.6    6e-18   Solanum tuberosum [potatoes]
ref|XP_011003980.1|  PREDICTED: beta-amyrin 28-oxidase-like           86.7    6e-18   Populus euphratica
gb|AIT93302.1|  cytochrome P450 monooxygenase CYP716A12               88.2    7e-18   Medicago sativa [alfalfa]
ref|XP_002526799.1|  cytochrome P450, putative                        88.2    8e-18   Ricinus communis
ref|XP_011048169.1|  PREDICTED: beta-amyrin 28-oxidase-like           88.2    8e-18   Populus euphratica
gb|AHF22083.1|  CYP716A14v2                                           88.2    8e-18   Artemisia annua [sweet Annie]
gb|ABC94483.1|  putative taxadiene 5-alpha-hydroxylase cytochrome...  88.2    8e-18   Artemisia annua [sweet Annie]
gb|AED99872.1|  cytochrome P450                                       87.8    9e-18   Panax notoginseng [san-qi]
emb|CDP10718.1|  unnamed protein product                              88.2    9e-18   Coffea canephora [robusta coffee]
gb|ACJ84447.1|  unknown                                               87.8    1e-17   Medicago truncatula
gb|AFK47215.1|  unknown                                               87.8    1e-17   Medicago truncatula
emb|CBN88268.1|  cytochrome P450 monoxygenase                         87.8    1e-17   Medicago truncatula
ref|XP_006474348.1|  PREDICTED: cytochrome P450 716B1-like            86.7    1e-17   
gb|EYU26566.1|  hypothetical protein MIMGU_mgv1a021994mg              87.8    1e-17   Erythranthe guttata [common monkey flower]
gb|ABC59076.1|  cytochrome P450 monooxygenase CYP716A12               87.8    1e-17   Medicago truncatula
sp|I7CT85.1|C7A53_PANGI  RecName: Full=Protopanaxadiol 6-hydroxyl...  87.4    1e-17   Panax ginseng [Asiatic ginseng]
ref|XP_011093941.1|  PREDICTED: beta-amyrin 28-oxidase-like           87.4    1e-17   Sesamum indicum [beniseed]
emb|CDP10717.1|  unnamed protein product                              87.4    2e-17   Coffea canephora [robusta coffee]
gb|KJB21914.1|  hypothetical protein B456_004G020800                  87.4    2e-17   Gossypium raimondii
gb|EYU25770.1|  hypothetical protein MIMGU_mgv1a005482mg              87.0    2e-17   Erythranthe guttata [common monkey flower]
ref|XP_009598096.1|  PREDICTED: beta-amyrin 28-oxidase-like           87.0    2e-17   Nicotiana tomentosiformis
ref|XP_010031614.1|  PREDICTED: cytochrome P450 716B1-like            87.0    2e-17   Eucalyptus grandis [rose gum]
ref|XP_007020143.1|  Cytochrome P450                                  87.0    2e-17   
ref|XP_007011469.1|  Cytochrome P450                                  87.0    2e-17   
emb|CBI24076.3|  unnamed protein product                              87.0    2e-17   Vitis vinifera
ref|XP_009758679.1|  PREDICTED: beta-amyrin 28-oxidase-like           86.7    2e-17   Nicotiana sylvestris
ref|XP_002513183.1|  cytochrome P450, putative                        86.7    3e-17   Ricinus communis
ref|XP_011003986.1|  PREDICTED: beta-amyrin 28-oxidase-like           86.7    3e-17   Populus euphratica
gb|AJD25249.1|  cytochrome P450 CYP716C12                             86.7    3e-17   Salvia miltiorrhiza [Chinese salvia]
ref|XP_010696134.1|  PREDICTED: beta-amyrin 28-oxidase-like           86.7    3e-17   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002264643.3|  PREDICTED: beta-amyrin 28-oxidase-like           86.7    3e-17   
ref|XP_009591188.1|  PREDICTED: beta-amyrin 28-oxidase-like           86.3    4e-17   Nicotiana tomentosiformis
gb|AJD25248.1|  cytochrome P450 CYP716A89                             86.3    4e-17   Salvia miltiorrhiza [Chinese salvia]
ref|XP_002279608.1|  PREDICTED: beta-amyrin 28-oxidase                86.3    4e-17   Vitis vinifera
sp|I7C6E8.1|C7A52_PANGI  RecName: Full=Beta-amyrin 28-oxidase; Al...  86.3    5e-17   Panax ginseng [Asiatic ginseng]
ref|XP_009609682.1|  PREDICTED: beta-amyrin 28-oxidase-like           85.9    5e-17   Nicotiana tomentosiformis
emb|CBI39268.3|  unnamed protein product                              85.9    5e-17   Vitis vinifera
ref|XP_006453162.1|  hypothetical protein CICLE_v10010450mg           85.5    5e-17   
ref|XP_003525322.1|  PREDICTED: cytochrome P450 716B2-like            85.9    5e-17   Glycine max [soybeans]
ref|XP_011001074.1|  PREDICTED: beta-amyrin 28-oxidase-like           85.9    6e-17   Populus euphratica
ref|XP_011001073.1|  PREDICTED: beta-amyrin 28-oxidase-like           85.9    6e-17   Populus euphratica
gb|EYU39276.1|  hypothetical protein MIMGU_mgv1a023490mg              84.7    6e-17   Erythranthe guttata [common monkey flower]
emb|CBI39253.3|  unnamed protein product                              85.5    6e-17   Vitis vinifera
gb|KCW87056.1|  hypothetical protein EUGRSUZ_B03598                   85.5    7e-17   Eucalyptus grandis [rose gum]
ref|XP_002278948.1|  PREDICTED: beta-amyrin 28-oxidase                85.5    7e-17   Vitis vinifera
ref|XP_010044931.1|  PREDICTED: beta-amyrin 28-oxidase-like           85.5    7e-17   Eucalyptus grandis [rose gum]
ref|XP_002309057.1|  hypothetical protein POPTR_0006s08560g           85.5    7e-17   Populus trichocarpa [western balsam poplar]
ref|XP_011019870.1|  PREDICTED: beta-amyrin 28-oxidase-like           85.5    8e-17   Populus euphratica
gb|AJD25250.1|  cytochrome P450 CYP716D25                             85.5    8e-17   Salvia miltiorrhiza [Chinese salvia]
ref|XP_010048515.1|  PREDICTED: beta-amyrin 28-oxidase-like           85.5    8e-17   Eucalyptus grandis [rose gum]
emb|CBI39273.3|  unnamed protein product                              86.3    9e-17   Vitis vinifera
ref|XP_006372247.1|  cytochrome P450 family protein                   85.1    1e-16   
emb|CAN63680.1|  hypothetical protein VITISV_036273                   84.7    1e-16   Vitis vinifera
ref|XP_011459801.1|  PREDICTED: beta-amyrin 28-oxidase-like           82.4    1e-16   Fragaria vesca subsp. vesca
emb|CBI39267.3|  unnamed protein product                              84.7    1e-16   Vitis vinifera
ref|XP_006340080.1|  PREDICTED: cytochrome P450 716B2-like isofor...  84.7    2e-16   Solanum tuberosum [potatoes]
ref|XP_006340079.1|  PREDICTED: cytochrome P450 716B2-like isofor...  84.3    2e-16   Solanum tuberosum [potatoes]
ref|XP_002319920.2|  hypothetical protein POPTR_0013s11090g           84.7    2e-16   
ref|XP_002279472.1|  PREDICTED: beta-amyrin 28-oxidase                84.3    2e-16   Vitis vinifera
ref|XP_004239296.1|  PREDICTED: beta-amyrin 28-oxidase                84.3    2e-16   Solanum lycopersicum
ref|XP_002317072.2|  hypothetical protein POPTR_0011s15910g           84.3    2e-16   
gb|AED99868.1|  cytochrome P450                                       84.3    2e-16   Panax notoginseng [san-qi]
ref|XP_007213798.1|  hypothetical protein PRUPE_ppa004984m2g          83.2    2e-16   
ref|XP_009759030.1|  PREDICTED: beta-amyrin 28-oxidase-like           84.0    2e-16   Nicotiana sylvestris
ref|XP_009787233.1|  PREDICTED: beta-amyrin 28-oxidase-like           84.0    3e-16   Nicotiana sylvestris
gb|AEX07772.1|  cytochrome P450                                       84.0    3e-16   Catharanthus roseus [chatas]
ref|XP_011096738.1|  PREDICTED: beta-amyrin 28-oxidase-like           83.6    3e-16   Sesamum indicum [beniseed]
ref|XP_011040561.1|  PREDICTED: beta-amyrin 28-oxidase-like           83.6    3e-16   Populus euphratica
ref|XP_006353795.1|  PREDICTED: cytochrome P450 716B2-like            83.6    3e-16   Solanum tuberosum [potatoes]
gb|KCW78587.1|  hypothetical protein EUGRSUZ_C00059                   83.2    4e-16   Eucalyptus grandis [rose gum]
ref|XP_004503562.1|  PREDICTED: cytochrome P450 716B2-like            83.6    4e-16   Cicer arietinum [garbanzo]
gb|KDP33425.1|  hypothetical protein JCGZ_06996                       83.6    4e-16   Jatropha curcas
gb|KDO54465.1|  hypothetical protein CISIN_1g013728mg                 83.2    4e-16   Citrus sinensis [apfelsine]
ref|XP_006445580.1|  hypothetical protein CICLE_v10015070mg           83.6    4e-16   
ref|XP_011089169.1|  PREDICTED: beta-amyrin 28-oxidase-like           83.6    4e-16   Sesamum indicum [beniseed]
ref|XP_006488945.1|  PREDICTED: cytochrome P450 716B2-like            83.6    4e-16   Citrus sinensis [apfelsine]
emb|CDP19706.1|  unnamed protein product                              83.2    4e-16   Coffea canephora [robusta coffee]
gb|AHF22088.1|  CYP716A75                                             83.2    4e-16   Maesa lanceolata
emb|CDP12479.1|  unnamed protein product                              83.2    4e-16   Coffea canephora [robusta coffee]
ref|XP_002325975.1|  hypothetical protein POPTR_0019s10970g           83.2    5e-16   
ref|XP_011048168.1|  PREDICTED: beta-amyrin 28-oxidase-like           83.2    5e-16   Populus euphratica
ref|XP_004296643.1|  PREDICTED: beta-amyrin 28-oxidase-like           83.2    5e-16   Fragaria vesca subsp. vesca
ref|XP_010245748.1|  PREDICTED: beta-amyrin 28-oxidase-like           83.2    5e-16   Nelumbo nucifera [Indian lotus]
ref|XP_003532790.1|  PREDICTED: cytochrome P450 716B2-like            83.2    5e-16   Glycine max [soybeans]
emb|CBI16553.3|  unnamed protein product                              80.9    6e-16   Vitis vinifera
dbj|BAP59949.1|  cytochrome P450 monooxygenase CYP716A48              82.8    7e-16   Olea europaea
emb|CAN77161.1|  hypothetical protein VITISV_020236                   82.8    7e-16   Vitis vinifera
ref|XP_010046875.1|  PREDICTED: beta-amyrin 28-oxidase-like           82.8    7e-16   Eucalyptus grandis [rose gum]
emb|CAN71865.1|  hypothetical protein VITISV_033123                   82.4    8e-16   Vitis vinifera
emb|CAN75788.1|  hypothetical protein VITISV_041016                   81.6    8e-16   Vitis vinifera
ref|XP_011017588.1|  PREDICTED: beta-amyrin 28-oxidase-like           82.4    8e-16   Populus euphratica
ref|XP_008225708.1|  PREDICTED: beta-amyrin 28-oxidase-like isofo...  82.4    8e-16   Prunus mume [ume]
ref|XP_006353745.1|  PREDICTED: cytochrome P450 716B2-like            82.4    8e-16   Solanum tuberosum [potatoes]
ref|XP_008358589.1|  PREDICTED: beta-amyrin 28-oxidase-like isofo...  82.4    8e-16   Malus domestica [apple tree]
ref|XP_010098502.1|  Cytochrome P450                                  82.4    9e-16   Morus notabilis
emb|CBI20810.3|  unnamed protein product                              82.0    9e-16   Vitis vinifera
ref|XP_008358591.1|  PREDICTED: beta-amyrin 28-oxidase-like isofo...  82.4    9e-16   Malus domestica [apple tree]
ref|XP_002280969.1|  PREDICTED: beta-amyrin 28-oxidase                82.4    9e-16   Vitis vinifera
ref|XP_004243906.1|  PREDICTED: beta-amyrin 28-oxidase-like           82.4    1e-15   Solanum lycopersicum
ref|XP_007213963.1|  hypothetical protein PRUPE_ppa004999mg           82.4    1e-15   Prunus persica
ref|XP_008225705.1|  PREDICTED: beta-amyrin 28-oxidase-like isofo...  82.4    1e-15   Prunus mume [ume]
dbj|BAP59952.1|  cytochrome P450 monooxygenase CYP716A51              82.4    1e-15   Lotus japonicus
ref|XP_008225706.1|  PREDICTED: beta-amyrin 28-oxidase-like isofo...  82.0    1e-15   
ref|XP_003633047.1|  PREDICTED: beta-amyrin 28-oxidase-like           82.0    1e-15   Vitis vinifera
ref|XP_009617512.1|  PREDICTED: beta-amyrin 28-oxidase-like           82.0    1e-15   Nicotiana tomentosiformis
emb|CDO98601.1|  unnamed protein product                              82.0    1e-15   Coffea canephora [robusta coffee]
ref|XP_004504209.1|  PREDICTED: cytochrome P450 716B1-like            81.6    2e-15   Cicer arietinum [garbanzo]
gb|AFK44313.1|  unknown                                               79.7    2e-15   Lotus japonicus
ref|XP_009353896.1|  PREDICTED: beta-amyrin 28-oxidase-like           81.6    2e-15   Pyrus x bretschneideri [bai li]
ref|XP_004296583.1|  PREDICTED: beta-amyrin 28-oxidase-like           81.6    2e-15   Fragaria vesca subsp. vesca
gb|EPS59491.1|  hypothetical protein M569_15315                       81.6    2e-15   Genlisea aurea
ref|XP_002299097.1|  hypothetical protein POPTR_0001s04010g           81.3    2e-15   Populus trichocarpa [western balsam poplar]
ref|XP_004308426.1|  PREDICTED: beta-amyrin 28-oxidase-like           79.0    2e-15   Fragaria vesca subsp. vesca
ref|XP_008388261.1|  PREDICTED: beta-amyrin 28-oxidase-like           81.3    2e-15   
ref|XP_008350555.1|  PREDICTED: beta-amyrin 28-oxidase-like           81.3    2e-15   
ref|XP_007022977.1|  Cytochrome P450 716B1                            81.6    2e-15   
ref|XP_007213882.1|  hypothetical protein PRUPE_ppa005225mg           81.3    3e-15   Prunus persica
ref|XP_004300936.1|  PREDICTED: beta-amyrin 28-oxidase-like           79.7    3e-15   Fragaria vesca subsp. vesca
ref|XP_009760011.1|  PREDICTED: beta-amyrin 28-oxidase-like           80.1    3e-15   Nicotiana sylvestris
ref|XP_008349137.1|  PREDICTED: beta-amyrin 28-oxidase-like           80.9    3e-15   
ref|XP_008340177.1|  PREDICTED: beta-amyrin 28-oxidase-like           80.9    3e-15   Malus domestica [apple tree]
ref|XP_010247736.1|  PREDICTED: beta-amyrin 28-oxidase-like           80.1    4e-15   Nelumbo nucifera [Indian lotus]
ref|XP_006488697.1|  PREDICTED: cytochrome P450 716B2-like            80.5    5e-15   
gb|EYU43204.1|  hypothetical protein MIMGU_mgv1a005450mg              80.5    5e-15   Erythranthe guttata [common monkey flower]
ref|XP_008243439.1|  PREDICTED: beta-amyrin 28-oxidase-like           75.9    6e-15   
gb|AEY75213.1|  cytochrome P450 CYP716A47                             80.1    6e-15   Panax ginseng [Asiatic ginseng]
gb|KDO67048.1|  hypothetical protein CISIN_1g037867mg                 80.1    6e-15   Citrus sinensis [apfelsine]
sp|H2DH16.2|C7A47_PANGI  RecName: Full=Dammarenediol 12-hydroxyla...  80.1    6e-15   Panax ginseng [Asiatic ginseng]
gb|AFU93031.1|  cytochrome P450                                       80.1    6e-15   Panax quinquefolius
ref|XP_010052577.1|  PREDICTED: beta-amyrin 28-oxidase-like           79.7    7e-15   Eucalyptus grandis [rose gum]
ref|XP_010252179.1|  PREDICTED: beta-amyrin 28-oxidase-like           79.7    8e-15   Nelumbo nucifera [Indian lotus]
ref|XP_007159554.1|  hypothetical protein PHAVU_002G247300g           79.7    8e-15   Phaseolus vulgaris [French bean]
ref|XP_002527982.1|  cytochrome P450, putative                        79.7    8e-15   Ricinus communis
ref|XP_002522937.1|  cytochrome P450, putative                        79.7    8e-15   Ricinus communis
ref|XP_004228960.1|  PREDICTED: beta-amyrin 28-oxidase-like           77.8    9e-15   Solanum lycopersicum
ref|XP_004291627.1|  PREDICTED: beta-amyrin 28-oxidase-like           79.7    1e-14   Fragaria vesca subsp. vesca
ref|XP_008389235.1|  PREDICTED: beta-amyrin 28-oxidase-like           79.3    1e-14   
gb|AFO67229.1|  putative cytochrome P450                              76.3    1e-14   Aralia elata
ref|XP_010034533.1|  PREDICTED: beta-amyrin 28-oxidase-like           79.0    1e-14   Eucalyptus grandis [rose gum]
gb|AFK79029.1|  cytochrome P450 CYP716A41                             79.3    1e-14   Bupleurum chinense
ref|XP_002325242.2|  hypothetical protein POPTR_0018s13490g           79.0    1e-14   
ref|XP_011470545.1|  PREDICTED: beta-amyrin 28-oxidase-like           79.7    1e-14   Fragaria vesca subsp. vesca
ref|XP_004293684.1|  PREDICTED: beta-amyrin 28-oxidase-like           79.0    1e-14   Fragaria vesca subsp. vesca
ref|XP_004295460.1|  PREDICTED: beta-amyrin 28-oxidase-like           79.0    1e-14   Fragaria vesca subsp. vesca
gb|KCW52345.1|  hypothetical protein EUGRSUZ_J01761                   79.0    2e-14   Eucalyptus grandis [rose gum]
gb|ACL10147.1|  cytochrome P450 monooxygenase                         79.0    2e-14   Stevia rebaudiana
gb|ABD60225.1|  ent-kaurenoic acid 13-hydroxylase                     79.0    2e-14   Stevia rebaudiana
ref|XP_007139496.1|  hypothetical protein PHAVU_008G034500g           78.6    2e-14   Phaseolus vulgaris [French bean]
emb|CDP19705.1|  unnamed protein product                              78.6    2e-14   Coffea canephora [robusta coffee]
emb|CDP19704.1|  unnamed protein product                              78.6    2e-14   Coffea canephora [robusta coffee]
emb|CDP17152.1|  unnamed protein product                              78.6    2e-14   Coffea canephora [robusta coffee]
emb|CAN66589.1|  hypothetical protein VITISV_017098                   74.7    2e-14   Vitis vinifera
gb|AED99867.1|  cytochrome P450                                       78.6    2e-14   Panax notoginseng [san-qi]
gb|KDP43440.1|  hypothetical protein JCGZ_16727                       78.2    2e-14   Jatropha curcas
gb|AIN44011.1|  cytochrome P450                                       78.6    2e-14   Panax notoginseng [san-qi]
ref|XP_002523409.1|  cytochrome P450, putative                        77.8    3e-14   
ref|XP_011089170.1|  PREDICTED: beta-amyrin 28-oxidase-like           77.8    4e-14   Sesamum indicum [beniseed]
ref|NP_198463.1|  cytochrome P450, family 716, subfamily A, polyp...  76.3    4e-14   Arabidopsis thaliana [mouse-ear cress]
gb|ABC94482.1|  putative taxane 13-alpha-hydroxylase cytochrome P450  77.8    4e-14   Artemisia annua [sweet Annie]
ref|XP_008388262.1|  PREDICTED: beta-amyrin 28-oxidase-like           77.4    5e-14   
ref|XP_004308257.1|  PREDICTED: beta-amyrin 28-oxidase-like           77.0    7e-14   Fragaria vesca subsp. vesca
ref|XP_010533078.1|  PREDICTED: beta-amyrin 28-oxidase-like           77.0    7e-14   Tarenaya hassleriana [spider flower]
emb|CBI39947.3|  unnamed protein product                              74.7    8e-14   Vitis vinifera
ref|XP_002325238.1|  hypothetical protein POPTR_0018s13420g           77.0    8e-14   
ref|XP_004172744.1|  PREDICTED: cytochrome P450 716B1-like            74.3    8e-14   
ref|XP_006425177.1|  hypothetical protein CICLE_v10030148mg           77.0    8e-14   
ref|XP_002325239.2|  hypothetical protein POPTR_0018s13420g           75.9    9e-14   
ref|XP_003531282.1|  PREDICTED: cytochrome P450 716B2-like isoformX1  76.6    1e-13   Glycine max [soybeans]
gb|EYU33953.1|  hypothetical protein MIMGU_mgv1a023105mg              76.6    1e-13   Erythranthe guttata [common monkey flower]
ref|XP_006353039.1|  PREDICTED: cytochrome P450 716B2-like            76.3    1e-13   Solanum tuberosum [potatoes]
ref|XP_004233188.1|  PREDICTED: beta-amyrin 28-oxidase-like           76.3    1e-13   Solanum lycopersicum
ref|XP_003524231.1|  PREDICTED: cytochrome P450 716B2-like            76.3    1e-13   Glycine max [soybeans]
ref|XP_006585214.1|  PREDICTED: cytochrome P450 716B2-like isofor...  75.9    1e-13   Glycine max [soybeans]
ref|XP_006852240.1|  hypothetical protein AMTR_s00049p00153870        76.3    2e-13   Amborella trichopoda
ref|XP_002529895.1|  cytochrome P450, putative                        75.9    2e-13   Ricinus communis
gb|KHG26601.1|  Cytochrome P450 protein                               75.9    2e-13   Gossypium arboreum [tree cotton]
gb|KCW72928.1|  hypothetical protein EUGRSUZ_E01367                   75.5    2e-13   Eucalyptus grandis [rose gum]
ref|XP_010058451.1|  PREDICTED: beta-amyrin 28-oxidase-like           75.5    2e-13   Eucalyptus grandis [rose gum]
emb|CDP21078.1|  unnamed protein product                              75.5    2e-13   Coffea canephora [robusta coffee]
gb|AHF22082.1|  CYP716D22                                             75.5    2e-13   Artemisia annua [sweet Annie]
ref|XP_003629928.1|  Cytochrome P450                                  76.3    2e-13   
ref|XP_004306884.1|  PREDICTED: beta-amyrin 28-oxidase-like           75.5    3e-13   Fragaria vesca subsp. vesca
ref|XP_004293194.1|  PREDICTED: beta-amyrin 28-oxidase-like           75.1    3e-13   Fragaria vesca subsp. vesca
gb|KDP27043.1|  hypothetical protein JCGZ_20978                       74.7    3e-13   Jatropha curcas
ref|XP_006370477.1|  hypothetical protein POPTR_0001s43070g           75.1    4e-13   
gb|KJB69116.1|  hypothetical protein B456_011G006100                  75.1    4e-13   Gossypium raimondii
ref|XP_004139087.1|  PREDICTED: cytochrome P450 716B1-like            74.7    5e-13   Cucumis sativus [cucumbers]
gb|KCW52344.1|  hypothetical protein EUGRSUZ_J01759                   74.3    5e-13   Eucalyptus grandis [rose gum]
ref|XP_010098504.1|  Cytochrome P450                                  74.7    5e-13   Morus notabilis
ref|XP_008443638.1|  PREDICTED: beta-amyrin 28-oxidase isoform X1     74.7    5e-13   Cucumis melo [Oriental melon]
emb|CDP04721.1|  unnamed protein product                              74.3    6e-13   Coffea canephora [robusta coffee]
gb|EYU26126.1|  hypothetical protein MIMGU_mgv1a017761mg              73.9    7e-13   Erythranthe guttata [common monkey flower]
ref|XP_011004881.1|  PREDICTED: beta-amyrin 28-oxidase-like           73.9    7e-13   Populus euphratica
ref|XP_007206798.1|  hypothetical protein PRUPE_ppa025666mg           73.9    9e-13   
ref|XP_010093483.1|  Cytochrome P450                                  73.2    1e-12   
gb|EYU25767.1|  hypothetical protein MIMGU_mgv1a025883mg              73.6    1e-12   Erythranthe guttata [common monkey flower]
ref|XP_008227229.1|  PREDICTED: beta-amyrin 28-oxidase-like           73.6    1e-12   
ref|XP_010262485.1|  PREDICTED: dammarenediol 12-hydroxylase-like     72.0    1e-12   
gb|EYU25763.1|  hypothetical protein MIMGU_mgv1a024885mg              73.2    2e-12   
ref|XP_002325241.2|  hypothetical protein POPTR_0018s13450g           73.2    2e-12   
ref|XP_006340081.1|  PREDICTED: cytochrome P450 716B1-like            72.8    2e-12   
ref|XP_006852242.1|  hypothetical protein AMTR_s00049p00155050        72.4    3e-12   
ref|XP_006852237.1|  hypothetical protein AMTR_s00049p00151640        72.0    3e-12   
dbj|BAC23044.1|  cytochrome P450                                      72.4    3e-12   
ref|XP_011016385.1|  PREDICTED: beta-amyrin 28-oxidase-like           71.6    5e-12   
gb|EPS63621.1|  hypothetical protein M569_11161                       71.6    5e-12   
gb|EYU26850.1|  hypothetical protein MIMGU_mgv1a018058mg              71.2    6e-12   
ref|XP_002868459.1|  CYP716A1                                         71.6    6e-12   
gb|EYU38301.1|  hypothetical protein MIMGU_mgv1a005334mg              71.6    7e-12   
ref|XP_002310350.1|  hypothetical protein POPTR_0007s15190g           70.5    8e-12   
gb|KHN16705.1|  Cytochrome P450 716B2                                 71.2    8e-12   
ref|XP_008227237.1|  PREDICTED: beta-amyrin 28-oxidase-like isofo...  71.2    9e-12   
ref|XP_004306780.1|  PREDICTED: beta-amyrin 28-oxidase-like           70.9    1e-11   
ref|XP_006405735.1|  hypothetical protein EUTSA_v10027740mg           70.9    1e-11   
gb|EYU26851.1|  hypothetical protein MIMGU_mgv1a005213mg              70.9    1e-11   
gb|EYU26852.1|  hypothetical protein MIMGU_mgv1a005293mg              70.9    1e-11   
ref|XP_004299475.1|  PREDICTED: beta-amyrin 28-oxidase-like           70.9    1e-11   
emb|CDP21077.1|  unnamed protein product                              70.5    1e-11   
ref|XP_008385452.1|  PREDICTED: beta-amyrin 28-oxidase-like isofo...  70.5    1e-11   
gb|KFK23969.1|  hypothetical protein AALP_AAs58682U000100             70.5    1e-11   
gb|EPS63622.1|  hypothetical protein M569_11162                       71.2    1e-11   
ref|XP_004250858.1|  PREDICTED: beta-amyrin 28-oxidase                70.1    2e-11   
ref|XP_006852236.1|  hypothetical protein AMTR_s00049p00150940        70.1    2e-11   
ref|XP_009337414.1|  PREDICTED: beta-amyrin 28-oxidase-like           70.1    2e-11   
emb|CDP21516.1|  unnamed protein product                              69.7    2e-11   
ref|XP_008385453.1|  PREDICTED: beta-amyrin 28-oxidase-like isofo...  69.7    2e-11   
ref|NP_198460.1|  cytochrome P450, family 716, subfamily A, polyp...  69.7    3e-11   
ref|XP_006351699.1|  PREDICTED: cytochrome P450 716B2-like            68.9    4e-11   
gb|KCW87053.1|  hypothetical protein EUGRSUZ_B03595                   68.2    6e-11   
ref|XP_008225710.1|  PREDICTED: beta-amyrin 28-oxidase-like isofo...  68.2    7e-11   
ref|XP_008225709.1|  PREDICTED: beta-amyrin 28-oxidase-like isofo...  68.2    7e-11   
ref|XP_009784783.1|  PREDICTED: dammarenediol 12-hydroxylase-like     66.6    1e-10   
ref|XP_002324669.1|  hypothetical protein POPTR_0018s13390g           67.4    2e-10   
ref|XP_002279492.2|  PREDICTED: beta-amyrin 28-oxidase                67.4    2e-10   
emb|CDP11383.1|  unnamed protein product                              67.0    2e-10   
gb|KDO51686.1|  hypothetical protein CISIN_1g011873mg                 67.0    2e-10   
ref|XP_011017728.1|  PREDICTED: beta-amyrin 28-oxidase-like           67.0    2e-10   
ref|XP_010046682.1|  PREDICTED: beta-amyrin 28-oxidase-like           67.0    3e-10   
ref|XP_006829767.1|  hypothetical protein AMTR_s00119p00024530        66.6    3e-10   
ref|XP_006829764.1|  hypothetical protein AMTR_s00119p00023540        63.5    3e-10   
ref|XP_011017724.1|  PREDICTED: beta-amyrin 28-oxidase-like           66.2    4e-10   
gb|AHF45909.1|  CYP716Y1                                              66.2    5e-10   
ref|XP_006432202.1|  hypothetical protein CICLE_v10001024mg           65.9    5e-10   
gb|EYU38302.1|  hypothetical protein MIMGU_mgv1a006499mg              65.9    5e-10   
gb|KCW72929.1|  hypothetical protein EUGRSUZ_E01368                   65.9    6e-10   
ref|XP_006852239.1|  hypothetical protein AMTR_s00049p00153260        65.5    7e-10   
ref|XP_010450437.1|  PREDICTED: beta-amyrin 28-oxidase-like           65.5    7e-10   
ref|XP_009620428.1|  PREDICTED: beta-amyrin 28-oxidase-like           65.1    9e-10   
gb|AAX59903.1|  13-alpha-hydroxylase                                  65.1    1e-09   
sp|Q8W4T9.1|T13H_TAXCU  RecName: Full=Taxane 13-alpha-hydroxylase...  65.1    1e-09   
ref|XP_004301516.1|  PREDICTED: beta-amyrin 28-oxidase-like           65.1    1e-09   
ref|XP_006351700.1|  PREDICTED: cytochrome P450 716B2-like            65.1    1e-09   
ref|XP_006283657.1|  hypothetical protein CARUB_v10004715mg           64.3    1e-09   
ref|XP_010435488.1|  PREDICTED: beta-amyrin 28-oxidase-like           64.7    1e-09   
gb|EYU25766.1|  hypothetical protein MIMGU_mgv1a005367mg              63.9    2e-09   
ref|XP_009786412.1|  PREDICTED: beta-amyrin 28-oxidase-like           63.5    3e-09   
ref|XP_006283658.1|  hypothetical protein CARUB_v10004715mg           63.5    4e-09   
ref|XP_010440783.1|  PREDICTED: beta-amyrin 28-oxidase-like           63.2    4e-09   
gb|AAX20147.1|  taxane 13-alpha-hydroxylase                           63.2    4e-09   
gb|KDP34865.1|  hypothetical protein JCGZ_09153                       63.2    4e-09   
gb|AAN52360.1|  5-alpha-taxadienol-10-beta-hydroxylase                63.2    6e-09   
sp|Q9AXM6.1|T10H_TAXCU  RecName: Full=Taxane 10-beta-hydroxylase;...  63.2    6e-09   
gb|AFD32419.1|  10-beta-hydroxylase                                   62.8    6e-09   
gb|AAS49032.1|  5-alpha-taxadienol-10-beta-hydroxylase                62.8    6e-09   
gb|EYU38303.1|  hypothetical protein MIMGU_mgv1a025102mg              62.8    7e-09   
ref|XP_006852238.1|  hypothetical protein AMTR_s00049p00152020        62.8    7e-09   
ref|XP_006580231.1|  PREDICTED: cytochrome P450 716B2-like            62.4    8e-09   
ref|XP_011074931.1|  PREDICTED: beta-amyrin 28-oxidase-like isofo...  62.0    8e-09   
gb|AAW03151.1|  taxane 10-beta-hydroxylase                            62.0    1e-08   
ref|XP_007159604.1|  hypothetical protein PHAVU_002G251200g           61.6    1e-08   
ref|WP_006527105.1|  cytochrome P450                                  60.1    4e-08   
ref|XP_008369414.1|  PREDICTED: cytochrome P450 716B1-like            60.1    5e-08   
ref|XP_011074929.1|  PREDICTED: beta-amyrin 28-oxidase-like isofo...  59.7    6e-08   
gb|AFD32415.1|  taxane 14b-hydroxylase                                59.7    7e-08   
gb|AHF49536.1|  CYP450 716-like protein                               59.7    7e-08   
gb|EYU25511.1|  hypothetical protein MIMGU_mgv1a014435mg              57.4    8e-08   
gb|KEH20722.1|  cytochrome P450 family protein                        58.9    1e-07   
ref|XP_009363898.1|  PREDICTED: taxadiene 5-alpha hydroxylase-like    58.9    1e-07   
gb|EYU29474.1|  hypothetical protein MIMGU_mgv1a020714mg              58.9    1e-07   
gb|AAV54171.1|  taxoid 2-alpha-hydroxylase                            58.9    1e-07   
ref|XP_003630001.1|  Abscisic acid 8'-hydroxylase                     58.5    2e-07   
gb|AAT47183.1|  taxoid 10-beta hydroxylase                            58.2    3e-07   
sp|Q84KI1.1|T14H_TAXCU  RecName: Full=Taxoid 14-beta-hydroxylase;...  58.2    3e-07   
ref|XP_010103649.1|  Taxadiene 5-alpha hydroxylase                    57.8    3e-07   
gb|AAS89065.2|  taxoid 2-alpha-hydroxylase                            57.8    3e-07   
gb|ADR78280.1|  CYP720B8                                              57.4    5e-07   
gb|KHN48078.1|  Cytochrome P450 716B2                                 57.0    5e-07   
gb|KJB67937.1|  hypothetical protein B456_010G218500                  57.0    7e-07   
gb|KHN48077.1|  Cytochrome P450 716B2                                 56.6    7e-07   
gb|ADR78274.1|  CYP720B17v2                                           56.2    1e-06   
ref|WP_015170525.1|  cytochrome P450                                  56.2    1e-06   
ref|NP_001059799.2|  Os07g0519500                                     55.5    2e-06   
ref|XP_007011311.1|  Cytochrome P450, putative                        56.2    2e-06   
emb|CDM81539.1|  unnamed protein product                              55.5    2e-06   
dbj|BAC19981.1|  putative 5-alpha-taxadienol-10-beta-hydroxylase      55.1    2e-06   
gb|ACN41063.1|  unknown                                               55.1    3e-06   
gb|ADR78273.1|  CYP720B17v1                                           55.1    3e-06   
gb|EAZ04083.1|  hypothetical protein OsI_26220                        55.1    3e-06   
ref|XP_011083840.1|  PREDICTED: abscisic acid 8'-hydroxylase 4-like   55.1    3e-06   
gb|ADR78271.1|  CYP720B15                                             54.7    3e-06   
gb|KHN06480.1|  Cytochrome P450 716B2                                 54.7    3e-06   
gb|AJD25239.1|  cytochrome P450 CYP707A99                             54.7    4e-06   
dbj|BAC19985.1|  putative 5-alpha-taxadienol-10-beta-hydroxylase      54.3    4e-06   
gb|EYU29834.1|  hypothetical protein MIMGU_mgv1a005289mg              54.3    4e-06   
gb|ELT96343.1|  hypothetical protein CAPTEDRAFT_95922                 54.3    5e-06   
gb|ADR78278.1|  CYP720B5v2                                            54.3    5e-06   
gb|ACM04453.1|  CYP720B4                                              54.3    5e-06   
sp|Q50EK1.1|C16B1_PICSI  RecName: Full=Cytochrome P450 716B1; Alt...  54.3    5e-06   
sp|Q50EK0.1|C16B2_PICSI  RecName: Full=Cytochrome P450 716B2; Alt...  53.9    6e-06   
ref|XP_008803662.1|  PREDICTED: cytochrome P450 716B1-like            53.9    6e-06   
ref|XP_002299955.2|  hypothetical protein POPTR_0001s27750g           53.9    7e-06   
ref|XP_011025041.1|  PREDICTED: cytochrome P450 87A3-like             53.5    8e-06   
ref|XP_011025045.1|  PREDICTED: cytochrome P450 87A3-like             53.5    8e-06   
ref|XP_002299954.1|  hypothetical protein POPTR_0001s27710g           53.5    8e-06   
gb|ABR16707.1|  unknown                                               53.5    9e-06   
ref|XP_011025046.1|  PREDICTED: cytochrome P450 87A3-like             53.5    9e-06   
ref|XP_010658310.1|  PREDICTED: cytochrome P450 716B1                 53.5    1e-05   
emb|CAN70350.1|  hypothetical protein VITISV_012582                   53.5    1e-05   
ref|XP_002510669.1|  cytochrome P450, putative                        53.1    1e-05   
gb|EEC82153.1|  hypothetical protein OsI_26214                        52.8    1e-05   
dbj|BAC19978.1|  putative 5-alpha-taxadienol-10-beta-hydroxylase      53.1    1e-05   
ref|XP_011081025.1|  PREDICTED: cytochrome P450 87A3-like             53.1    1e-05   
ref|WP_012165379.1|  cytochrome P450                                  52.8    1e-05   
ref|XP_003607971.1|  Abscisic acid 8'-hydroxylase                     52.8    1e-05   
gb|ADR78283.1|  CYP720B9                                              52.8    1e-05   
ref|XP_002313286.1|  hypothetical protein POPTR_0009s06920g           52.8    1e-05   
ref|XP_011007350.1|  PREDICTED: cytochrome P450 87A3-like             52.8    1e-05   
dbj|BAC56029.1|  putative taxane 10-beta-hydroxylase(5-alpha-taxa...  52.8    2e-05   
ref|XP_002299956.1|  hypothetical protein POPTR_0001s27760g           52.4    2e-05   
ref|XP_004500365.1|  PREDICTED: taxadiene 5-alpha hydroxylase-like    52.4    2e-05   
ref|XP_011025042.1|  PREDICTED: cytochrome P450 87A3-like             52.4    2e-05   
ref|WP_017740377.1|  cytochrome P450                                  52.4    2e-05   
gb|AAR21106.1|  hydroxylase                                           52.4    2e-05   
ref|XP_011088261.1|  PREDICTED: abscisic acid 8'-hydroxylase 4        52.4    2e-05   
gb|ACN40968.1|  unknown                                               52.4    2e-05   
sp|Q6JTJ0.1|T7H_TAXCU  RecName: Full=Taxoid 7-beta-hydroxylase        52.4    2e-05   
gb|AFD32418.1|  cytochrome P450 taxane 7-beta-hydroxylase             52.4    2e-05   
ref|XP_009627452.1|  PREDICTED: cytochrome P450 87A3                  52.0    2e-05   
ref|XP_009782612.1|  PREDICTED: cytochrome P450 87A3                  52.0    3e-05   
emb|CCI06746.1|  putative cytochrome P450 120                         52.0    3e-05   
ref|WP_012305582.1|  cytochrome P450                                  52.0    3e-05   
ref|WP_030008121.1|  cytochrome P450                                  52.0    3e-05   
dbj|BAJ87475.1|  predicted protein                                    52.0    3e-05   
ref|WP_042711484.1|  cytochrome P450                                  50.1    3e-05   
gb|ADR78276.1|  CYP720B4                                              52.0    3e-05   
gb|AFY47549.1|  cytochrome P450                                       52.0    3e-05   
ref|WP_027403851.1|  cytochrome P450                                  52.0    3e-05   
gb|AJD25241.1|  cytochrome P450 CYP707A101                            52.0    3e-05   
emb|CDP17249.1|  unnamed protein product                              52.0    3e-05   
gb|EYU25765.1|  hypothetical protein MIMGU_mgv1a013212mg              50.8    3e-05   
ref|XP_002463009.1|  hypothetical protein SORBIDRAFT_02g036140        52.0    3e-05   
ref|XP_006369643.1|  hypothetical protein POPTR_0001s27720g           52.0    3e-05   
gb|EAM50941.1|  similar to Cytochrome P450                            50.1    3e-05   
ref|WP_043997354.1|  cytochrome P450                                  51.6    3e-05   
emb|CCQ63811.1|  cytochrome P450                                      50.1    3e-05   
ref|WP_041555627.1|  cytochrome P450                                  51.6    3e-05   
ref|XP_011001398.1|  PREDICTED: taxane 13-alpha-hydroxylase-like      51.6    3e-05   
ref|XP_006369642.1|  hypothetical protein POPTR_0001s27700g           51.6    3e-05   
ref|WP_019498061.1|  hypothetical protein                             51.6    3e-05   
ref|XP_009344155.1|  PREDICTED: cytochrome P450 87A3-like             51.6    4e-05   
gb|ADR78272.1|  CYP720B16                                             51.6    4e-05   
ref|XP_009344797.1|  PREDICTED: cytochrome P450 87A3-like             51.6    4e-05   
ref|XP_006369644.1|  hypothetical protein POPTR_0001s27730g           51.6    4e-05   
ref|XP_004246127.1|  PREDICTED: cytochrome P450 87A3-like             51.6    4e-05   
ref|XP_008241378.1|  PREDICTED: taxadiene 5-alpha hydroxylase-lik...  51.2    4e-05   
ref|XP_006358916.1|  PREDICTED: cytochrome P450 87A3-like             51.6    4e-05   
gb|ADR78277.1|  CYP720B5v1                                            51.6    4e-05   
ref|WP_040656231.1|  cytochrome P450                                  51.2    4e-05   
gb|AHW42466.1|  KAO1                                                  51.6    4e-05   
ref|WP_015223843.1|  cytochrome P450                                  51.2    4e-05   
ref|XP_006414542.1|  hypothetical protein EUTSA_v10027495mg           51.2    4e-05   
ref|XP_002325485.2|  hypothetical protein POPTR_0019s08620g           51.2    5e-05   
gb|ERN40616.1|  cytochrome P450                                       51.2    5e-05   
ref|XP_002299957.1|  hypothetical protein POPTR_0001s27770g           51.2    5e-05   
ref|XP_010911500.1|  PREDICTED: taxane 10-beta-hydroxylase-like       50.1    5e-05   
gb|KHN35678.1|  Abscisic acid 8'-hydroxylase 4                        51.2    5e-05   
ref|XP_006595967.1|  PREDICTED: abscisic acid 8'-hydroxylase 4-like   51.2    5e-05   
ref|WP_039748033.1|  cytochrome P450                                  51.2    5e-05   
gb|EPS71636.1|  hypothetical protein M569_03122                       51.2    5e-05   
gb|EMT05251.1|  Cytochrome P450 87A3                                  51.2    5e-05   
gb|AFJ04868.1|  taxadiene 5nalpha hydroxylase                         50.8    5e-05   
ref|XP_011037680.1|  PREDICTED: cytochrome P450 716B1-like            51.2    5e-05   
gb|EEE67283.1|  hypothetical protein OsJ_24475                        51.2    5e-05   
ref|XP_006414544.1|  hypothetical protein EUTSA_v10025084mg           51.2    6e-05   
gb|AIA99529.1|  CYP720                                                50.8    6e-05   
ref|XP_003563018.2|  PREDICTED: cytochrome P450 716B1-like            51.2    6e-05   
ref|XP_006425891.1|  hypothetical protein CICLE_v10027226mg           50.8    6e-05   
ref|XP_010256885.1|  PREDICTED: abscisic acid 8'-hydroxylase 2-like   50.8    6e-05   
gb|EMT25093.1|  Cytochrome P450 87A3                                  50.8    7e-05   
ref|XP_003528511.1|  PREDICTED: abscisic acid 8'-hydroxylase 4-like   50.8    7e-05   
ref|XP_010923918.1|  PREDICTED: cytochrome P450 716B2-like            50.8    7e-05   
gb|AAB60918.1|  Similar to Arabidopsis cytochrome P450 CYP90 (gb|...  50.8    7e-05   
gb|AAF23843.1|AC007234_15  F1E22.5                                    50.8    7e-05   
ref|XP_003550339.1|  PREDICTED: abscisic acid 8'-hydroxylase 4        50.8    7e-05   
gb|KHN12784.1|  Abscisic acid 8'-hydroxylase 4                        50.8    7e-05   
ref|XP_002510214.1|  cytochrome P450, putative                        50.8    7e-05   
ref|XP_010055602.1|  PREDICTED: cytochrome P450 87A3-like isoform X2  50.8    8e-05   
gb|ABK28450.1|  unknown                                               50.8    8e-05   
ref|NP_176744.1|  cytochrome P450, family 702, subfamily A, polyp...  50.4    8e-05   
ref|NP_001042297.1|  Os01g0197100                                     50.4    8e-05   
gb|EAY72890.1|  hypothetical protein OsI_00765                        50.4    8e-05   
gb|AIU94756.1|  abscisic acid 8'-hydroxylase                          50.4    8e-05   
ref|WP_015178055.1|  (+)-abscisic acid 8'-hydroxylase                 50.4    8e-05   
gb|ACR78247.1|  taxoid 7-beta-hydroxylase                             50.4    8e-05   
ref|XP_002304920.1|  hypothetical protein POPTR_0004s01730g           50.4    9e-05   
ref|WP_009756666.1|  MULTISPECIES: cytochrome P450                    50.4    9e-05   
ref|XP_002971610.1|  hypothetical protein SELMODRAFT_231756           50.4    9e-05   
gb|ACN40244.1|  unknown                                               50.4    1e-04   
gb|ADR78270.1|  CYP720B12                                             50.4    1e-04   
gb|AIK01731.1|  CYP720B10v1                                           50.4    1e-04   
ref|WP_041226522.1|  cytochrome P450                                  50.1    1e-04   
ref|XP_010055601.1|  PREDICTED: cytochrome P450 87A3-like isoform X1  50.1    1e-04   
gb|AFZ12802.1|  (+)-abscisic acid 8'-hydroxylase                      50.1    1e-04   
gb|AIK01732.1|  CYP720B10v2                                           50.1    1e-04   
ref|XP_008241301.1|  PREDICTED: taxadiene 5-alpha hydroxylase-lik...  50.1    1e-04   
ref|XP_002450249.1|  hypothetical protein SORBIDRAFT_05g002580        50.1    1e-04   
ref|WP_015183764.1|  cytochrome P450                                  50.1    1e-04   



>ref|XP_009620720.1| PREDICTED: beta-amyrin 28-oxidase-like [Nicotiana tomentosiformis]
Length=477

 Score =   106 bits (264),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 76/89 (85%), Gaps = 2/89 (2%)
 Frame = +2

Query  95   IIYFITKANTSKPNLPPGSTGWPVIGENID--LMVPEKYISDRMKKYSPEVFKTSILGEK  268
             I+F+ K +++   LPPG++GWP++GEN++  L+ PEK+I +RM+KYSP+VF+TSI+GEK
Sbjct  17   FIFFLRKRDSNSKKLPPGTSGWPLLGENMEFALLGPEKFIKNRMEKYSPQVFQTSIMGEK  76

Query  269  VAVFCGAAGNKffftnentllttWWPQSV  355
            +AVFCGA GNKF F++EN LLT+WWPQS+
Sbjct  77   MAVFCGAQGNKFLFSSENKLLTSWWPQSM  105



>emb|CDP18172.1| unnamed protein product [Coffea canephora]
Length=478

 Score =   105 bits (261),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 54/89 (61%), Positives = 74/89 (83%), Gaps = 2/89 (2%)
 Frame = +2

Query  95   IIYFITKANTSKPNLPPGSTGWPVIGENID--LMVPEKYISDRMKKYSPEVFKTSILGEK  268
             I+ I K N+S   LPPG++GWP++GE++   L+ P+K++ DRMKKYSP+VF+TS++GEK
Sbjct  20   FIFLIRKRNSSSLKLPPGTSGWPMVGESLQFALLGPQKFVKDRMKKYSPDVFQTSLMGEK  79

Query  269  VAVFCGAAGNKffftnentllttWWPQSV  355
            +A+FCGA GNKF FTNEN LLT+WWPQS+
Sbjct  80   MAIFCGAQGNKFLFTNENKLLTSWWPQSM  108



>ref|XP_009768074.1| PREDICTED: beta-amyrin 28-oxidase-like [Nicotiana sylvestris]
Length=480

 Score =   103 bits (258),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 75/89 (84%), Gaps = 2/89 (2%)
 Frame = +2

Query  95   IIYFITKANTSKPNLPPGSTGWPVIGENID--LMVPEKYISDRMKKYSPEVFKTSILGEK  268
             I+F+ K +++   LPPG++GWP++GEN++  L+ PEK+I  RM+KYSP+VF+TSI+GEK
Sbjct  20   FIFFLRKRHSNSKKLPPGTSGWPLLGENMEFALLGPEKFIKKRMEKYSPQVFQTSIMGEK  79

Query  269  VAVFCGAAGNKffftnentllttWWPQSV  355
            +AVFCGA GNKF F+NEN LLT+WWP+S+
Sbjct  80   MAVFCGAQGNKFLFSNENKLLTSWWPKSM  108



>emb|CDP18056.1| unnamed protein product [Coffea canephora]
Length=381

 Score =   102 bits (254),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 51/89 (57%), Positives = 75/89 (84%), Gaps = 2/89 (2%)
 Frame = +2

Query  95   IIYFITKANTSKPNLPPGSTGWPVIGENID--LMVPEKYISDRMKKYSPEVFKTSILGEK  268
            +++F+ K ++ + NLPPG++GWP++GENI   L+  +K++ DRM+K+SPEVF+TS++GE+
Sbjct  20   LVFFLRKRSSGRVNLPPGTSGWPMLGENIPFALLGSQKFVKDRMRKHSPEVFQTSLMGER  79

Query  269  VAVFCGAAGNKffftnentllttWWPQSV  355
             A+FCGA GNKF FTNEN LLT+WWPQS+
Sbjct  80   TAIFCGAQGNKFLFTNENKLLTSWWPQSM  108



>ref|XP_006353629.1| PREDICTED: cytochrome P450 716B2-like [Solanum tuberosum]
Length=481

 Score =   103 bits (256),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 74/93 (80%), Gaps = 6/93 (6%)
 Frame = +2

Query  95   IIYFITKANTS---KPNLPPGSTGWPVIGENIDLMV---PEKYISDRMKKYSPEVFKTSI  256
            +I+FI K N S     NLPPGS GWP++GENID+     PEK+I +RM+K+S +VFKTS+
Sbjct  20   LIFFILKGNYSNNKHTNLPPGSYGWPILGENIDMAYSSSPEKFIHERMEKHSSQVFKTSL  79

Query  257  LGEKVAVFCGAAGNKffftnentllttWWPQSV  355
             GEK+A+FCG++GNKF F+NEN LLTTWWPQS+
Sbjct  80   FGEKIAIFCGSSGNKFLFSNENKLLTTWWPQSL  112



>ref|XP_011099144.1| PREDICTED: beta-amyrin 28-oxidase-like [Sesamum indicum]
Length=477

 Score =   102 bits (255),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 53/76 (70%), Positives = 66/76 (87%), Gaps = 2/76 (3%)
 Frame = +2

Query  134  NLPPGSTGWPVIGENIDLMV--PEKYISDRMKKYSPEVFKTSILGEKVAVFCGAAGNKff  307
            NLPPGS GWP++GENI+  V  P+K++ DRM+KYSPEVF+TS+LGEK+A+FCGA GNKF 
Sbjct  34   NLPPGSRGWPMLGENIEFAVLGPQKFVKDRMEKYSPEVFQTSLLGEKMAIFCGAQGNKFL  93

Query  308  ftnentllttWWPQSV  355
            F NEN LLT+WWPQS+
Sbjct  94   FMNENKLLTSWWPQSM  109



>gb|KCW72951.1| hypothetical protein EUGRSUZ_E01403 [Eucalyptus grandis]
Length=459

 Score =   102 bits (254),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 70/93 (75%), Gaps = 6/93 (6%)
 Frame = +2

Query  95   IIYFITKANTSKPNLPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSPEVFKTSI  256
            +++ + +  +S PNLPPG  GWP+IGE++D +       PEK+I+DR  KYSPEVF+TS+
Sbjct  20   LLFLVFRKKSSSPNLPPGKKGWPIIGESLDFVGAAKSGCPEKFINDRTAKYSPEVFRTSL  79

Query  257  LGEKVAVFCGAAGNKffftnentllttWWPQSV  355
            LGE +AVFCGA+GNKF F+ ++  +TTWWP S+
Sbjct  80   LGEDMAVFCGASGNKFLFSGQDKYITTWWPSSM  112



>ref|XP_006353706.1| PREDICTED: cytochrome P450 716B2-like [Solanum tuberosum]
Length=474

 Score =   102 bits (254),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 52/83 (63%), Positives = 71/83 (86%), Gaps = 2/83 (2%)
 Frame = +2

Query  113  KANTSKPNLPPGSTGWPVIGENID--LMVPEKYISDRMKKYSPEVFKTSILGEKVAVFCG  286
            K ++S   LPPG++GWP++GEN++  L+ P+K+I DRM+KYSPEVF+TSI+GEK+A FCG
Sbjct  24   KRDSSSKTLPPGTSGWPLLGENMEFALLGPQKFIKDRMEKYSPEVFQTSIMGEKMAFFCG  83

Query  287  AAGNKffftnentllttWWPQSV  355
            A GNKF F++EN LLT+WWPQS+
Sbjct  84   AQGNKFLFSSENKLLTSWWPQSM  106



>ref|XP_010056285.1| PREDICTED: beta-amyrin 28-oxidase-like [Eucalyptus grandis]
 gb|KCW72950.1| hypothetical protein EUGRSUZ_E01401 [Eucalyptus grandis]
Length=479

 Score =   102 bits (253),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 70/93 (75%), Gaps = 6/93 (6%)
 Frame = +2

Query  95   IIYFITKANTSKPNLPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSPEVFKTSI  256
            +++ + +  +S PNLPPG  GWP+IGE++D +       PEK+I+DR  KYSPEVF+TS+
Sbjct  20   LLFLVFRKKSSAPNLPPGKKGWPIIGESLDFVGAGKSGCPEKFINDRTAKYSPEVFRTSL  79

Query  257  LGEKVAVFCGAAGNKffftnentllttWWPQSV  355
            LGE +AVFCGA+GNKF F+ ++  +TTWWP S+
Sbjct  80   LGEDMAVFCGASGNKFLFSGQDKYITTWWPSSM  112



>ref|XP_009601238.1| PREDICTED: beta-amyrin 28-oxidase-like [Nicotiana tomentosiformis]
Length=477

 Score =   100 bits (250),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/89 (56%), Positives = 75/89 (84%), Gaps = 2/89 (2%)
 Frame = +2

Query  95   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV--PEKYISDRMKKYSPEVFKTSILGEK  268
             I+F+ K +++    PPG++GWP++GEN++L +  PEK+I +RM+KYSP+VF+T+I+GEK
Sbjct  17   FIFFLRKRDSNSKKHPPGTSGWPLLGENMELALLGPEKFIKNRMEKYSPQVFQTTIVGEK  76

Query  269  VAVFCGAAGNKffftnentllttWWPQSV  355
            +AVFCGA GNKF F++EN LLT+WWP+S+
Sbjct  77   MAVFCGAQGNKFLFSSENILLTSWWPKSM  105



>ref|XP_004242231.1| PREDICTED: beta-amyrin 28-oxidase-like [Solanum lycopersicum]
Length=475

 Score =   100 bits (249),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/88 (56%), Positives = 73/88 (83%), Gaps = 2/88 (2%)
 Frame = +2

Query  98   IYFITKANTSKPNLPPGSTGWPVIGENID--LMVPEKYISDRMKKYSPEVFKTSILGEKV  271
            ++ + K ++S  +LPPG+ GWP++GEN++  L+ P+K+I DRM+KYS +VF+TSI+GEK+
Sbjct  20   MFILRKRDSSSKSLPPGTCGWPLLGENVEFALLGPQKFIKDRMEKYSAQVFQTSIMGEKM  79

Query  272  AVFCGAAGNKffftnentllttWWPQSV  355
            A FCGA GNKF F++EN L+T+WWPQS+
Sbjct  80   AFFCGAQGNKFLFSSENKLVTSWWPQSM  107



>gb|EYU22847.1| hypothetical protein MIMGU_mgv1a022104mg [Erythranthe guttata]
Length=477

 Score =   100 bits (249),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/89 (61%), Positives = 72/89 (81%), Gaps = 3/89 (3%)
 Frame = +2

Query  98   IYFITKAN-TSKPNLPPGSTGWPVIGENIDLMV--PEKYISDRMKKYSPEVFKTSILGEK  268
            + F+ K   T   NLPPGS GWP++GEN++  +  P++++ +RM+KYSPEVF+TS+LGEK
Sbjct  21   VSFLRKTGPTESKNLPPGSNGWPMLGENMEFALSGPQQFVKERMQKYSPEVFRTSLLGEK  80

Query  269  VAVFCGAAGNKffftnentllttWWPQSV  355
            +AVFCGA GNKF FTNEN LLT+WWPQS+
Sbjct  81   MAVFCGAQGNKFLFTNENKLLTSWWPQSM  109



>ref|XP_010252185.1| PREDICTED: beta-amyrin 28-oxidase-like [Nelumbo nucifera]
Length=488

 Score = 99.0 bits (245),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 69/94 (73%), Gaps = 7/94 (7%)
 Frame = +2

Query  95   IIYFITK-ANTSKPNLPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSPEVFKTS  253
            + YF+ K   T    LPPGS GWPV+GE+++ +       PEK+  DRMKKYSPEVFKTS
Sbjct  29   LRYFVCKYKRTGGAYLPPGSLGWPVVGESLEFLSTGRNGTPEKFFEDRMKKYSPEVFKTS  88

Query  254  ILGEKVAVFCGAAGNKffftnentllttWWPQSV  355
            +LGE  AVFCGA GNKF F+NEN L+T+WWP+SV
Sbjct  89   LLGEPAAVFCGAGGNKFLFSNENKLVTSWWPRSV  122



>ref|XP_007023620.1| Cytochrome P450 [Theobroma cacao]
 gb|EOY26242.1| Cytochrome P450 [Theobroma cacao]
Length=482

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 67/93 (72%), Gaps = 6/93 (6%)
 Frame = +2

Query  95   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  256
            I  +  K N S+PNLPPG TG P IGE+++ +       PEK+I DRM K+S +VF+TSI
Sbjct  23   IFSYACKTNASQPNLPPGKTGLPYIGESLEFLSTGRKGHPEKFIYDRMAKFSSQVFRTSI  82

Query  257  LGEKVAVFCGAAGNKffftnentllttWWPQSV  355
            LGE  AVFCGAAGNKF F+NEN L+T WWP SV
Sbjct  83   LGEATAVFCGAAGNKFLFSNENKLVTAWWPNSV  115



>ref|XP_002521782.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF40592.1| cytochrome P450, putative [Ricinus communis]
Length=483

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 66/92 (72%), Gaps = 6/92 (7%)
 Frame = +2

Query  98   IYFITKANTSKPNLPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSPEVFKTSIL  259
            I+ I K+  + P  PPG TGWPVIGE +D +      VP+K++  RMK YSP+VF+TS+L
Sbjct  17   IFLIYKSKPANPQFPPGKTGWPVIGETLDYLINARHGVPDKFVIKRMKTYSPDVFQTSLL  76

Query  260  GEKVAVFCGAAGNKffftnentllttWWPQSV  355
            G+++AVFCGA+GNKF F+  N  +  WWP+S+
Sbjct  77   GDRMAVFCGASGNKFIFSTGNKFVQAWWPRSL  108



>gb|AGN04219.1| cytochrome P450 [Salvia miltiorrhiza]
Length=474

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/92 (57%), Positives = 65/92 (71%), Gaps = 6/92 (7%)
 Frame = +2

Query  98   IYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSIL  259
            +YF+     +   LPPG TGWPVIGE+++ +       PEK+I DRM KYSP VF+T +L
Sbjct  17   LYFLFYKTKAGARLPPGRTGWPVIGESLEFLSIGWKGHPEKFIFDRMAKYSPTVFRTHLL  76

Query  260  GEKVAVFCGAAGNKffftnentllttWWPQSV  355
            GE+ AVFCGAAGNKF F+NEN L+  WWP SV
Sbjct  77   GERAAVFCGAAGNKFLFSNENKLVQAWWPASV  108



>ref|XP_009768075.1| PREDICTED: beta-amyrin 28-oxidase isoform X1 [Nicotiana sylvestris]
Length=476

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/89 (56%), Positives = 72/89 (81%), Gaps = 2/89 (2%)
 Frame = +2

Query  95   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV--PEKYISDRMKKYSPEVFKTSILGEK  268
             I+F+   +++   LPPG++GWP++GENI+L +  PEK++ +R +KYSP VF+T I+GEK
Sbjct  17   FIFFLRNRDSNSKKLPPGTSGWPLLGENIELALLGPEKFLKNRTEKYSPHVFQTLIMGEK  76

Query  269  VAVFCGAAGNKffftnentllttWWPQSV  355
            +AVFCGA GNKF F+NEN LLT+WWP+S+
Sbjct  77   LAVFCGAQGNKFLFSNENKLLTSWWPKSM  105



>ref|XP_010070480.1| PREDICTED: beta-amyrin 28-oxidase-like [Eucalyptus grandis]
 gb|KCW59275.1| hypothetical protein EUGRSUZ_H01951 [Eucalyptus grandis]
Length=479

 Score = 97.8 bits (242),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 68/93 (73%), Gaps = 6/93 (6%)
 Frame = +2

Query  95   IIYFITKANTSKPNLPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSPEVFKTSI  256
            +++ + +  +S PNLPPG  GWP+IGE+++         PEK+I+DR  KYSPEVF+TS+
Sbjct  20   LLFLVFRKKSSAPNLPPGKKGWPIIGESLEFFGAAKSGCPEKFINDRTTKYSPEVFRTSL  79

Query  257  LGEKVAVFCGAAGNKffftnentllttWWPQSV  355
            LGE +AVFC A+GNKF F+ ++  +TTWWP S+
Sbjct  80   LGEDMAVFCSASGNKFLFSGQDKYITTWWPSSM  112



>ref|XP_010056287.1| PREDICTED: beta-amyrin 28-oxidase-like [Eucalyptus grandis]
 gb|KCW72954.1| hypothetical protein EUGRSUZ_E01406 [Eucalyptus grandis]
Length=479

 Score = 96.3 bits (238),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 68/93 (73%), Gaps = 6/93 (6%)
 Frame = +2

Query  95   IIYFITKANTSKPNLPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSPEVFKTSI  256
            +++   +  +  PNLPPG  GWP+IGE+++ +       PEK+I+DR  KYSPEVF+TS+
Sbjct  20   LLFLAFRKKSPAPNLPPGKKGWPIIGESLEFVGTAKSGCPEKFINDRTAKYSPEVFRTSL  79

Query  257  LGEKVAVFCGAAGNKffftnentllttWWPQSV  355
            LGE +AVFCGA+GNKF F+ +N  +TTWWP S+
Sbjct  80   LGEDMAVFCGASGNKFLFSGQNKYVTTWWPTSM  112



>ref|XP_002537996.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF24387.1| cytochrome P450, putative, partial [Ricinus communis]
Length=134

 Score = 91.7 bits (226),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 68/95 (72%), Gaps = 8/95 (8%)
 Frame = +2

Query  95   IIYFITKANTSKPN--LPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKT  250
            +I+ +   +   P+  LPPG+ GWP +GE++  ++      PEK++ DR+KKYSP+VF+T
Sbjct  24   LIFLVYFKHNKSPHVKLPPGTKGWPFLGESLAFLMTARRGHPEKFVKDRVKKYSPDVFQT  83

Query  251  SILGEKVAVFCGAAGNKffftnentllttWWPQSV  355
            S+LGE +AVFCGA+GNK  FT+EN  +  WWP+S+
Sbjct  84   SLLGENMAVFCGASGNKLLFTSENKYVKAWWPKSL  118



>ref|XP_004241821.1| PREDICTED: beta-amyrin 28-oxidase-like [Solanum lycopersicum]
Length=475

 Score = 96.3 bits (238),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 55/92 (60%), Positives = 71/92 (77%), Gaps = 6/92 (7%)
 Frame = +2

Query  98   IYFITKANTS---KPNLPPGSTGWPVIGENIDLMV---PEKYISDRMKKYSPEVFKTSIL  259
            +YFI K N S     NLP GS GWP++GENID+     PEK+I +RM+K+S +VFKTS+L
Sbjct  18   LYFIFKGNYSNNKHTNLPLGSNGWPILGENIDMAYSSSPEKFIHERMEKHSSQVFKTSLL  77

Query  260  GEKVAVFCGAAGNKffftnentllttWWPQSV  355
            G+K+A+FCG +GNKF F+NEN LLTTWWP S+
Sbjct  78   GQKIAIFCGTSGNKFLFSNENKLLTTWWPPSL  109



>ref|XP_010063751.1| PREDICTED: beta-amyrin 28-oxidase-like [Eucalyptus grandis]
 gb|KCW71006.1| hypothetical protein EUGRSUZ_F04112 [Eucalyptus grandis]
Length=482

 Score = 96.3 bits (238),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 68/93 (73%), Gaps = 6/93 (6%)
 Frame = +2

Query  95   IIYFITKANTSKPNLPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSPEVFKTSI  256
            I++ + +   S PNLPPG  GWP+IGE+++ +       PEK+I+DR  KYS EVF+TS+
Sbjct  20   ILFLVFRKKPSPPNLPPGRRGWPLIGESLEFVGTAKGGCPEKFIADRTAKYSSEVFQTSL  79

Query  257  LGEKVAVFCGAAGNKffftnentllttWWPQSV  355
            LGE +AVFCGA+GNKF F+ +N  +TTWWP S+
Sbjct  80   LGENLAVFCGASGNKFLFSGQNKYITTWWPSSM  112



>ref|XP_011048247.1| PREDICTED: beta-amyrin 28-oxidase-like [Populus euphratica]
Length=505

 Score = 96.3 bits (238),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 49/81 (60%), Positives = 60/81 (74%), Gaps = 6/81 (7%)
 Frame = +2

Query  131  PNLPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSPEVFKTSILGEKVAVFCGAA  292
            P LPPGS GWP++GE +  +       PE+++SDRMKKY+P+VFKTS+ GE VAVFCG A
Sbjct  97   PQLPPGSLGWPLLGETLQFLPTRRTPKPERFVSDRMKKYNPQVFKTSLFGETVAVFCGPA  156

Query  293  GNKffftnentllttWWPQSV  355
            GNKF F NEN L+  WWP SV
Sbjct  157  GNKFLFHNENKLVNLWWPTSV  177



>ref|XP_007014637.1| Cytochrome P450 [Theobroma cacao]
 gb|EOY32256.1| Cytochrome P450 [Theobroma cacao]
Length=480

 Score = 94.7 bits (234),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 52/93 (56%), Positives = 69/93 (74%), Gaps = 6/93 (6%)
 Frame = +2

Query  95   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  256
            ++++  K+N S PNLPPG  G P++GE+++ +       PEK+I DR+ KYS +VFKT+I
Sbjct  22   VLFYRHKSNYSAPNLPPGKPGLPIVGESLEFLSTGWKGHPEKFIFDRIAKYSSQVFKTNI  81

Query  257  LGEKVAVFCGAAGNKffftnentllttWWPQSV  355
            LGE  AVFCGAAGNKF F+NEN L+T WWP SV
Sbjct  82   LGEPAAVFCGAAGNKFLFSNENKLVTAWWPSSV  114



>ref|XP_007023618.1| Cytochrome P450 [Theobroma cacao]
 gb|EOY26240.1| Cytochrome P450 [Theobroma cacao]
Length=478

 Score = 94.7 bits (234),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 52/93 (56%), Positives = 68/93 (73%), Gaps = 6/93 (6%)
 Frame = +2

Query  95   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  256
            ++ +    N S PNLPPG  G P+IGE+++ ++      PEK+++DRM KYS +VFKTSI
Sbjct  20   VLLYSKNPNASHPNLPPGRMGLPLIGESLEYLLTGRKGYPEKFLNDRMAKYSSQVFKTSI  79

Query  257  LGEKVAVFCGAAGNKffftnentllttWWPQSV  355
            LGE +AV CGAAGNKF F+NEN L+T WWP SV
Sbjct  80   LGESMAVVCGAAGNKFLFSNENKLVTAWWPDSV  112



>ref|XP_010044930.1| PREDICTED: cytochrome P450 716B1-like [Eucalyptus grandis]
 gb|KCW87054.1| hypothetical protein EUGRSUZ_B03596 [Eucalyptus grandis]
Length=475

 Score = 94.4 bits (233),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 47/89 (53%), Positives = 61/89 (69%), Gaps = 6/89 (7%)
 Frame = +2

Query  107  ITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSILGEK  268
            + K  T++ NLPPGS GWP+IGE+++ +       PEK+I DRM KY   VFKTS+LGE 
Sbjct  22   LLKLKTARRNLPPGSFGWPIIGESLEFLRCQRGGHPEKFIQDRMSKYDSPVFKTSVLGEP  81

Query  269  VAVFCGAAGNKffftnentllttWWPQSV  355
            +A+ CG AGNKF F+NE   +  WWP SV
Sbjct  82   IAILCGPAGNKFLFSNEGKKVALWWPSSV  110



>gb|EYU22845.1| hypothetical protein MIMGU_mgv1a021193mg [Erythranthe guttata]
Length=473

 Score = 94.4 bits (233),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 63/80 (79%), Gaps = 2/80 (3%)
 Frame = +2

Query  122  TSKPNLPPGSTGWPVIGENIDLMV--PEKYISDRMKKYSPEVFKTSILGEKVAVFCGAAG  295
            T   NLPPGS GWP++GEN++     P+K+I DRM+KYSPEVF TS+LG+K+A+FCGA G
Sbjct  28   TGSKNLPPGSNGWPLLGENMEFAFSGPQKFIQDRMRKYSPEVFMTSLLGQKIAIFCGAKG  87

Query  296  NKffftnentllttWWPQSV  355
            NKF F N++ L T++W QS+
Sbjct  88   NKFLFMNDDKLFTSFWLQSM  107



>ref|XP_008348466.1| PREDICTED: beta-amyrin 28-oxidase-like [Malus domestica]
Length=321

 Score = 92.8 bits (229),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 64/93 (69%), Gaps = 6/93 (6%)
 Frame = +2

Query  95   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  256
            ++++  +A     NLPPG  G+PVIGE    +       PEK+I DRM KYS EVFKTS+
Sbjct  22   VLFYRHRAQFVGTNLPPGKVGYPVIGETYQFLATGWKGHPEKFIFDRMTKYSSEVFKTSL  81

Query  257  LGEKVAVFCGAAGNKffftnentllttWWPQSV  355
            +GEK A+FCGAA NKF F+NEN L+T WWP SV
Sbjct  82   MGEKAAIFCGAACNKFLFSNENKLVTAWWPSSV  114



>ref|XP_008353962.1| PREDICTED: beta-amyrin 28-oxidase-like [Malus domestica]
Length=321

 Score = 92.8 bits (229),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 64/93 (69%), Gaps = 6/93 (6%)
 Frame = +2

Query  95   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  256
            ++++  +A     NLPPG  G+PVIGE    +       PEK+I DRM KYS EVFKTS+
Sbjct  22   VLFYRHRAQFVGTNLPPGKVGYPVIGETYQFLATGWKGHPEKFIFDRMTKYSSEVFKTSL  81

Query  257  LGEKVAVFCGAAGNKffftnentllttWWPQSV  355
            +GEK A+FCGAA NKF F+NEN L+T WWP SV
Sbjct  82   MGEKAAIFCGAACNKFLFSNENKLVTAWWPSSV  114



>ref|XP_002528002.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF34414.1| cytochrome P450, putative [Ricinus communis]
Length=471

 Score = 94.0 bits (232),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 71/93 (76%), Gaps = 7/93 (8%)
 Frame = +2

Query  98   IYFITKAN-TSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  256
            + F  K+N +S+ NLPPG+TGWP+IGE+I+ +       PEK+I DRM+K+S +VFKTS+
Sbjct  16   LIFKHKSNASSRKNLPPGNTGWPLIGESIEFLSTGRKGHPEKFIFDRMEKFSSKVFKTSL  75

Query  257  LGEKVAVFCGAAGNKffftnentllttWWPQSV  355
            L E  AVFCGAAGNKF F+NEN L+T WWP SV
Sbjct  76   LLEPAAVFCGAAGNKFLFSNENKLVTAWWPNSV  108



>ref|XP_002325964.2| hypothetical protein POPTR_0019s10730g [Populus trichocarpa]
 gb|EEF00346.2| hypothetical protein POPTR_0019s10730g [Populus trichocarpa]
Length=476

 Score = 94.0 bits (232),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 65/93 (70%), Gaps = 6/93 (6%)
 Frame = +2

Query  95   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  256
             I F  +   S   LPPG+TGWP+IGE ++  +      PEK++ DRM K+SPEVFKTS+
Sbjct  17   FIIFFHRRKLSGFRLPPGNTGWPIIGETLEFAMNHRRGCPEKFVIDRMCKFSPEVFKTSL  76

Query  257  LGEKVAVFCGAAGNKffftnentllttWWPQSV  355
             GEK+ VFCGA+GNKF FT+ N  +T+WWP S+
Sbjct  77   FGEKIVVFCGASGNKFLFTSHNKSVTSWWPPSM  109



>ref|XP_009617504.1| PREDICTED: beta-amyrin 28-oxidase-like isoform X2 [Nicotiana 
tomentosiformis]
Length=388

 Score = 92.4 bits (228),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 49/88 (56%), Positives = 61/88 (69%), Gaps = 6/88 (7%)
 Frame = +2

Query  110  TKANTSKPNLPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSPEVFKTSILGEKV  271
            T+  T   NLPPGS GWPVIGE  + +       PEK+++DR++KY  ++FKT I+GEKV
Sbjct  25   TRNRTKTLNLPPGSYGWPVIGETPEFLRSRRDGSPEKFVTDRIEKYQSQIFKTCIVGEKV  84

Query  272  AVFCGAAGNKffftnentllttWWPQSV  355
            AV CG AGNKF F NEN L+  WWP SV
Sbjct  85   AVLCGPAGNKFLFGNENKLVNVWWPSSV  112



>gb|KJB81290.1| hypothetical protein B456_013G137300 [Gossypium raimondii]
Length=482

 Score = 93.2 bits (230),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 68/98 (69%), Gaps = 11/98 (11%)
 Frame = +2

Query  95   IIYFITKANTS-----KPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEV  241
            + YF+ K  +S      PNLPPG  G P IGE +D ++      PEK+++DR  KYSP+V
Sbjct  23   LFYFLYKYKSSGGGGPTPNLPPGKKGLPYIGETLDFVLASRRGTPEKFVTDRTTKYSPDV  82

Query  242  FKTSILGEKVAVFCGAAGNKffftnentllttWWPQSV  355
            F+TS+LGE +AVFCG+AGNKF F+ +N  +T+WWP S+
Sbjct  83   FRTSLLGEDMAVFCGSAGNKFLFSGQNKYVTSWWPDSI  120



>ref|NP_001268115.1| cytochrome P450 CYP716A15 [Vitis vinifera]
 dbj|BAJ84106.1| cytochrome P450 [Vitis vinifera]
Length=480

 Score = 93.2 bits (230),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 68/93 (73%), Gaps = 6/93 (6%)
 Frame = +2

Query  95   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  256
            ++++  +++ + PNLPPG  GWP++GE+++ +       PEK+I DR+ KYS EVFKTS+
Sbjct  22   LLFYKHRSHFTGPNLPPGKIGWPMVGESLEFLSTGWKGHPEKFIFDRISKYSSEVFKTSL  81

Query  257  LGEKVAVFCGAAGNKffftnentllttWWPQSV  355
            LGE  AVF GAAGNKF F+NEN L+  WWP SV
Sbjct  82   LGEPAAVFAGAAGNKFLFSNENKLVHAWWPSSV  114



>gb|EYU22846.1| hypothetical protein MIMGU_mgv1a006514mg [Erythranthe guttata]
Length=441

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 51/89 (57%), Positives = 66/89 (74%), Gaps = 5/89 (6%)
 Frame = +2

Query  104  FITKA--NTSKPNLPPGSTGWPVIGENIDLMV--PEKYISDRMKKYSPEVFKTSILGEK-  268
            FI K     S+  LPPGS GWP++GEN+      P K++ DRM+KYSP VF+TS+LGEK 
Sbjct  25   FIRKTGITESRKTLPPGSNGWPMLGENMAFAFSGPHKFVEDRMRKYSPHVFRTSLLGEKN  84

Query  269  VAVFCGAAGNKffftnentllttWWPQSV  355
            +++FCGA GNKF +TNE  LLT+WWPQS+
Sbjct  85   ISIFCGAQGNKFIYTNEQKLLTSWWPQSM  113



>emb|CAN76484.1| hypothetical protein VITISV_000800 [Vitis vinifera]
Length=224

 Score = 90.5 bits (223),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 60/86 (70%), Gaps = 2/86 (2%)
 Frame = +2

Query  98   IYFITKANTSKPNLPPGSTGWPVIGENIDLMV--PEKYISDRMKKYSPEVFKTSILGEKV  271
            I+   K++ +K  LPPGS GWP+IGE I+ +   PEK++ +RMKKYSP VFKT ILGEK 
Sbjct  21   IFTSKKSSATKTKLPPGSFGWPIIGETIEFLYGKPEKFVGERMKKYSPHVFKTKILGEKT  80

Query  272  AVFCGAAGNKffftnentllttWWPQ  349
            AV CG AGNKF F NE  L+  W P 
Sbjct  81   AVICGPAGNKFLFANEQKLVVAWRPH  106



>ref|XP_002266024.1| PREDICTED: beta-amyrin 28-oxidase [Vitis vinifera]
Length=480

 Score = 92.8 bits (229),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 67/93 (72%), Gaps = 6/93 (6%)
 Frame = +2

Query  95   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  256
             +++  +++ + PNLPPG  GWP++GE+++ +       PEK+I DR+ KYS EVFKTS+
Sbjct  22   FLFYKHRSHFTGPNLPPGRIGWPMVGESLEFLSTGWKGHPEKFIFDRISKYSSEVFKTSL  81

Query  257  LGEKVAVFCGAAGNKffftnentllttWWPQSV  355
            LGE  AVF GAAGNKF F+NEN L+  WWP SV
Sbjct  82   LGEPAAVFAGAAGNKFLFSNENKLVHAWWPSSV  114



>gb|AHL46848.1| cytochrome P450, partial [Betula platyphylla]
Length=481

 Score = 92.4 bits (228),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 50/92 (54%), Positives = 69/92 (75%), Gaps = 6/92 (7%)
 Frame = +2

Query  98   IYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSIL  259
            +++  +++ + PNLPPG TG+P+IGE+++ +       PEK+I DRM K+S EVFKTS+L
Sbjct  23   LFYKHRSHFTGPNLPPGKTGYPMIGESLEFLSTGWKGHPEKFIFDRMTKFSSEVFKTSLL  82

Query  260  GEKVAVFCGAAGNKffftnentllttWWPQSV  355
            G+  AVFCGAA NKF F+NEN L+T WWP SV
Sbjct  83   GQPAAVFCGAACNKFLFSNENKLVTAWWPDSV  114



>gb|AFO67237.1| putative cytochrome P450, partial [Aralia elata]
Length=154

 Score = 88.2 bits (217),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 61/79 (77%), Gaps = 6/79 (8%)
 Frame = +2

Query  137  LPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSPEVFKTSILGEKVAVFCGAAGN  298
            LPPG TGWP+IGE ++ +       PEK+I+ RM KYSP VFKT++ GEK+AVFCGA+GN
Sbjct  31   LPPGKTGWPIIGETLEFISLGRKGYPEKFITKRMNKYSPHVFKTTLAGEKMAVFCGASGN  90

Query  299  KffftnentllttWWPQSV  355
            KF F+NEN L+ +WWP ++
Sbjct  91   KFMFSNENKLVVSWWPPAI  109



>ref|XP_003531849.1| PREDICTED: cytochrome P450 716B2 isoform X1 [Glycine max]
 gb|KHN17287.1| Cytochrome P450 716B2 [Glycine soja]
Length=482

 Score = 92.0 bits (227),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 68/93 (73%), Gaps = 6/93 (6%)
 Frame = +2

Query  95   IIYFITKANTSKPNLPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSPEVFKTSI  256
            II++  ++  S PNLPPG  G+PVIGE+++ +      +PEK+ SDRM +YS +VFKTSI
Sbjct  23   IIFYRHRSPFSVPNLPPGKAGFPVIGESLEFLSAGRKGLPEKFFSDRMTEYSSKVFKTSI  82

Query  257  LGEKVAVFCGAAGNKffftnentllttWWPQSV  355
            LGE   +FCGAA NKF F+NEN  + +WWP++V
Sbjct  83   LGEPTVIFCGAACNKFLFSNENKHVISWWPENV  115



>ref|XP_010048517.1| PREDICTED: beta-amyrin 28-oxidase-like [Eucalyptus grandis]
 gb|KCW80785.1| hypothetical protein EUGRSUZ_C02162 [Eucalyptus grandis]
 gb|KCW80786.1| hypothetical protein EUGRSUZ_C02162 [Eucalyptus grandis]
Length=480

 Score = 92.0 bits (227),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 67/93 (72%), Gaps = 6/93 (6%)
 Frame = +2

Query  95   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  256
             +++  +++ + PNLPPGS G P IGE++D +       PE++I DR+ +YS  VFKTS+
Sbjct  22   FLFYKHRSHYAGPNLPPGSIGLPFIGESLDFLSTGWKGHPERFIFDRIARYSSHVFKTSL  81

Query  257  LGEKVAVFCGAAGNKffftnentllttWWPQSV  355
            LGE  A+FCGAAGNKF F+NEN L+ +WWP SV
Sbjct  82   LGEPAAIFCGAAGNKFLFSNENKLVVSWWPNSV  114



>ref|XP_007139495.1| hypothetical protein PHAVU_008G034400g [Phaseolus vulgaris]
 gb|ESW11489.1| hypothetical protein PHAVU_008G034400g [Phaseolus vulgaris]
Length=481

 Score = 92.0 bits (227),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 67/93 (72%), Gaps = 6/93 (6%)
 Frame = +2

Query  95   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  256
             +++   A +S PNLPPG+ G+PVIGE+I+ +       PEK+I +RM KYS +VFKTS+
Sbjct  22   FLFYSHHAQSSHPNLPPGNMGFPVIGESIEFLSLGWKGHPEKFIYERMAKYSSKVFKTSL  81

Query  257  LGEKVAVFCGAAGNKffftnentllttWWPQSV  355
             GEK  +FCGAA NKF F+NEN L+ +WWP SV
Sbjct  82   FGEKTVMFCGAACNKFLFSNENKLVVSWWPDSV  114



>ref|XP_002299099.2| hypothetical protein POPTR_0001s04030g [Populus trichocarpa]
 gb|EEE83904.2| hypothetical protein POPTR_0001s04030g [Populus trichocarpa]
Length=403

 Score = 91.3 bits (225),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 50/96 (52%), Positives = 67/96 (70%), Gaps = 10/96 (10%)
 Frame = +2

Query  98   IYFITKANTSK----PNLPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSPEVFK  247
            +Y ITK    +    P+LPPGS GWP+IGE ++ +       P+ ++ DRM+K+ P+VFK
Sbjct  20   LYIITKTLKERLIPNPHLPPGSLGWPLIGETLNYLGTCLAGRPDWFLRDRMEKHDPQVFK  79

Query  248  TSILGEKVAVFCGAAGNKffftnentllttWWPQSV  355
            TS+ GE VAVFCG AGNKF F+NEN L+  WWP+SV
Sbjct  80   TSLFGETVAVFCGPAGNKFLFSNENKLVNLWWPRSV  115



>ref|XP_007020151.1| Cytochrome P450 [Theobroma cacao]
 gb|EOY17376.1| Cytochrome P450 [Theobroma cacao]
Length=476

 Score = 92.0 bits (227),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 67/95 (71%), Gaps = 8/95 (8%)
 Frame = +2

Query  95   IIYFITK--ANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKT  250
            +IY + K  +  + PN PPG  G P +GE +D ++      PEK+++DR  KYSP+VF+T
Sbjct  22   VIYLVYKYKSRPATPNFPPGRKGLPYLGETLDYVLASRRGTPEKFVTDRTTKYSPDVFRT  81

Query  251  SILGEKVAVFCGAAGNKffftnentllttWWPQSV  355
            S+LGE +A+FCGAAGNKF F+ +N  +T+WWP S+
Sbjct  82   SLLGEDMAIFCGAAGNKFLFSGQNKYVTSWWPHSI  116



>ref|XP_002279623.1| PREDICTED: beta-amyrin 28-oxidase [Vitis vinifera]
Length=476

 Score = 91.7 bits (226),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 68/93 (73%), Gaps = 6/93 (6%)
 Frame = +2

Query  95   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  256
            II+ +++  ++   LPPG  GWP+IGE  +  +      PE++I+DRMKKYSP VF+TS+
Sbjct  19   IIFLVSRRKSACSKLPPGKLGWPIIGETSEFALGGKNSNPERFINDRMKKYSPIVFRTSL  78

Query  257  LGEKVAVFCGAAGNKffftnentllttWWPQSV  355
            LGEKVAVFCG AGNKF F+N N L+TTW P S+
Sbjct  79   LGEKVAVFCGPAGNKFLFSNHNKLITTWKPPSM  111



>emb|CAN72302.1| hypothetical protein VITISV_041935 [Vitis vinifera]
Length=480

 Score = 91.7 bits (226),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 67/93 (72%), Gaps = 6/93 (6%)
 Frame = +2

Query  95   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  256
            ++ +  +++ + PNLPPG  GWP++GE+++ +       PEK+I DR+ KYS EVFKTS+
Sbjct  22   LLLYKHRSHFTGPNLPPGKIGWPMVGESLEFLSTGWKGHPEKFIFDRISKYSSEVFKTSL  81

Query  257  LGEKVAVFCGAAGNKffftnentllttWWPQSV  355
            LGE  AVF GAAGNKF F+NEN L+  WWP SV
Sbjct  82   LGEPAAVFAGAAGNKFLFSNENKLVHAWWPSSV  114



>ref|NP_001268076.1| cytochrome P450 CYP716A17 [Vitis vinifera]
 dbj|BAJ84107.1| Cytochrome P450 [Vitis vinifera]
Length=480

 Score = 91.7 bits (226),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 67/93 (72%), Gaps = 6/93 (6%)
 Frame = +2

Query  95   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  256
            ++ +  +++ + PNLPPG  GWP++GE+++ +       PEK+I DR+ KYS EVFKTS+
Sbjct  22   LLLYKHRSHFTGPNLPPGKIGWPMVGESLEFLSTGWKGHPEKFIFDRISKYSSEVFKTSL  81

Query  257  LGEKVAVFCGAAGNKffftnentllttWWPQSV  355
            LGE  AVF GAAGNKF F+NEN L+  WWP SV
Sbjct  82   LGEPAAVFAGAAGNKFLFSNENKLVHAWWPSSV  114



>gb|KDO73360.1| hypothetical protein CISIN_1g036125mg, partial [Citrus sinensis]
Length=283

 Score = 89.7 bits (221),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 63/93 (68%), Gaps = 6/93 (6%)
 Frame = +2

Query  95   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  256
            II++   +N S+PN+PPGS G+P IGE+ + +       PEK+I  RM KYS   FKTS+
Sbjct  22   IIFYNHNSNLSQPNVPPGSFGFPFIGESFEFLSYGWKGHPEKFIFTRMTKYSSHAFKTSL  81

Query  257  LGEKVAVFCGAAGNKffftnentllttWWPQSV  355
            LGE  AV CG AGNKF  +NEN L+ +WWP SV
Sbjct  82   LGEPTAVLCGPAGNKFLSSNENNLVNSWWPDSV  114



>ref|XP_010661150.1| PREDICTED: beta-amyrin 28-oxidase isoform X2 [Vitis vinifera]
Length=447

 Score = 91.3 bits (225),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 69/94 (73%), Gaps = 7/94 (7%)
 Frame = +2

Query  95   IIYFIT-KANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTS  253
            I++ IT +  +S PNLPPG  GWP+IGE ++  +      PE++++DRM KYSP+VFKTS
Sbjct  19   IVFLITYRHKSSNPNLPPGRMGWPIIGETLEFALACQGGNPERFLNDRMNKYSPQVFKTS  78

Query  254  ILGEKVAVFCGAAGNKffftnentllttWWPQSV  355
            +L   +AV CGA+GNKF F+NE+ L+ +WW +S+
Sbjct  79   LLEANMAVMCGASGNKFLFSNEDKLVVSWWQRSM  112



>emb|CBI39948.3| unnamed protein product [Vitis vinifera]
Length=488

 Score = 91.7 bits (226),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 69/94 (73%), Gaps = 7/94 (7%)
 Frame = +2

Query  95   IIYFIT-KANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTS  253
            I++ IT +  +S PNLPPG  GWP+IGE ++  +      PE++++DRM KYSP+VFKTS
Sbjct  24   IVFLITYRHKSSNPNLPPGRMGWPIIGETLEFALACQGGNPERFLNDRMNKYSPQVFKTS  83

Query  254  ILGEKVAVFCGAAGNKffftnentllttWWPQSV  355
            +L   +AV CGA+GNKF F+NE+ L+ +WW +S+
Sbjct  84   LLEANMAVMCGASGNKFLFSNEDKLVVSWWQRSM  117



>ref|XP_009376339.1| PREDICTED: beta-amyrin 28-oxidase-like [Pyrus x bretschneideri]
Length=484

 Score = 91.7 bits (226),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 64/93 (69%), Gaps = 6/93 (6%)
 Frame = +2

Query  95   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  256
            ++++  +A     NLPPG  G+PVIGE    +       PEK+I DRM KYS EVFKTS+
Sbjct  22   VLFYRHRAQFVGTNLPPGKVGYPVIGETYQFLATGWKGHPEKFIFDRMTKYSSEVFKTSL  81

Query  257  LGEKVAVFCGAAGNKffftnentllttWWPQSV  355
            +GEK A+FCGAA NKF F+NEN L+T WWP SV
Sbjct  82   MGEKAAIFCGAACNKFLFSNENKLVTAWWPSSV  114



>ref|XP_002263499.1| PREDICTED: beta-amyrin 28-oxidase isoform X1 [Vitis vinifera]
 emb|CAN67793.1| hypothetical protein VITISV_001314 [Vitis vinifera]
Length=483

 Score = 91.7 bits (226),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 69/94 (73%), Gaps = 7/94 (7%)
 Frame = +2

Query  95   IIYFIT-KANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTS  253
            I++ IT +  +S PNLPPG  GWP+IGE ++  +      PE++++DRM KYSP+VFKTS
Sbjct  19   IVFLITYRHKSSNPNLPPGRMGWPIIGETLEFALACQGGNPERFLNDRMNKYSPQVFKTS  78

Query  254  ILGEKVAVFCGAAGNKffftnentllttWWPQSV  355
            +L   +AV CGA+GNKF F+NE+ L+ +WW +S+
Sbjct  79   LLEANMAVMCGASGNKFLFSNEDKLVVSWWQRSM  112



>ref|XP_011031513.1| PREDICTED: beta-amyrin 28-oxidase-like [Populus euphratica]
Length=476

 Score = 91.3 bits (225),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 63/93 (68%), Gaps = 6/93 (6%)
 Frame = +2

Query  95   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  256
             I F  +   S   LPPG+ GWP+IGE ++  +      PE ++ DRM KYSPEVFKTS+
Sbjct  17   FIMFFRRRKLSGLRLPPGNKGWPIIGETLEFAMNHRRGCPENFVIDRMCKYSPEVFKTSL  76

Query  257  LGEKVAVFCGAAGNKffftnentllttWWPQSV  355
             GEK+ VFCGA+GNKF FTN N  +T+WWP S+
Sbjct  77   FGEKIVVFCGASGNKFLFTNHNKYVTSWWPPSM  109



>ref|XP_010060835.1| PREDICTED: beta-amyrin 28-oxidase-like [Eucalyptus grandis]
 gb|KCW67713.1| hypothetical protein EUGRSUZ_F01453 [Eucalyptus grandis]
Length=479

 Score = 91.3 bits (225),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 49/89 (55%), Positives = 62/89 (70%), Gaps = 2/89 (2%)
 Frame = +2

Query  95   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV--PEKYISDRMKKYSPEVFKTSILGEK  268
            I        +S P LPPGS GWP++GE ++ +   P+K++ DRM+KYS  VFKT ILGEK
Sbjct  18   IFLLFKHTLSSGPKLPPGSFGWPILGETVEFLFGNPDKFVGDRMRKYSSTVFKTKILGEK  77

Query  269  VAVFCGAAGNKffftnentllttWWPQSV  355
            VAVFCG AGNKF F+NE  L+T W P S+
Sbjct  78   VAVFCGPAGNKFIFSNEQKLVTEWRPHSM  106



>ref|XP_007020144.1| Cytochrome P450 [Theobroma cacao]
 gb|EOY17369.1| Cytochrome P450 [Theobroma cacao]
Length=476

 Score = 91.3 bits (225),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 49/95 (52%), Positives = 66/95 (69%), Gaps = 8/95 (8%)
 Frame = +2

Query  95   IIYFITK--ANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKT  250
            +IY + K  +  + PNLPPG  G P IGE +D ++      P K+I+DR  KYSP+VF+T
Sbjct  22   VIYLVYKYKSRAATPNLPPGRKGLPYIGETLDYVLGLRRGTPVKFINDRSTKYSPDVFRT  81

Query  251  SILGEKVAVFCGAAGNKffftnentllttWWPQSV  355
            S+LGE +AVFCGAAGNKF F+  N  +T WWP+S+
Sbjct  82   SLLGEDMAVFCGAAGNKFLFSGHNKYVTAWWPRSM  116



>ref|XP_009345334.1| PREDICTED: beta-amyrin 28-oxidase-like [Pyrus x bretschneideri]
 ref|XP_009351212.1| PREDICTED: beta-amyrin 28-oxidase-like [Pyrus x bretschneideri]
Length=484

 Score = 91.3 bits (225),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 64/93 (69%), Gaps = 6/93 (6%)
 Frame = +2

Query  95   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  256
            ++++  +A     NLPPG  G+PVIGE    +       PEK+I DRM KYS EVFKTS+
Sbjct  22   VLFYRHRAQFVGTNLPPGKVGYPVIGETYQFLATGWKGHPEKFIFDRMTKYSSEVFKTSL  81

Query  257  LGEKVAVFCGAAGNKffftnentllttWWPQSV  355
            +GEK A+FCGAA NKF F+NEN L+T WWP SV
Sbjct  82   MGEKAAIFCGAACNKFLFSNENKLVTAWWPSSV  114



>ref|XP_008391096.1| PREDICTED: beta-amyrin 28-oxidase [Malus domestica]
Length=484

 Score = 91.3 bits (225),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 64/93 (69%), Gaps = 6/93 (6%)
 Frame = +2

Query  95   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  256
            ++++  +A     NLPPG  G+PVIGE    +       PEK+I DRM KYS EVFKTS+
Sbjct  22   VLFYRHRAQFVGTNLPPGKVGYPVIGETYQFLATGWKGHPEKFIFDRMTKYSSEVFKTSL  81

Query  257  LGEKVAVFCGAAGNKffftnentllttWWPQSV  355
            +GEK A+FCGAA NKF F+NEN L+T WWP SV
Sbjct  82   MGEKAAIFCGAACNKFLFSNENKLVTAWWPSSV  114



>ref|XP_007160209.1| hypothetical protein PHAVU_002G302100g [Phaseolus vulgaris]
 gb|ESW32203.1| hypothetical protein PHAVU_002G302100g [Phaseolus vulgaris]
Length=480

 Score = 91.3 bits (225),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 66/93 (71%), Gaps = 6/93 (6%)
 Frame = +2

Query  95   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  256
            I++   ++  S PNLPPG+TG PVIGE++  +       PEK+I DRM KYS ++FKTSI
Sbjct  22   ILFHKHRSPFSAPNLPPGATGLPVIGESLQFLSTGWKGHPEKFIFDRMIKYSSDLFKTSI  81

Query  257  LGEKVAVFCGAAGNKffftnentllttWWPQSV  355
            LGE   VFCGAA NKF F+NEN L+T WWP SV
Sbjct  82   LGEPAVVFCGAASNKFLFSNENKLVTAWWPDSV  114



>ref|XP_007222742.1| hypothetical protein PRUPE_ppa004988mg [Prunus persica]
 gb|EMJ23941.1| hypothetical protein PRUPE_ppa004988mg [Prunus persica]
Length=482

 Score = 91.3 bits (225),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 65/92 (71%), Gaps = 6/92 (7%)
 Frame = +2

Query  98   IYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSIL  259
            +++  +A  +  NLPPG  G+PVIGE+ + +       PEK+I DRM KYS +VFKTSI 
Sbjct  23   LFYRHRAQFTGNNLPPGKVGYPVIGESYEFLASGWKGHPEKFIFDRMTKYSSDVFKTSIF  82

Query  260  GEKVAVFCGAAGNKffftnentllttWWPQSV  355
            GEK A+FCGAA NKF F+NEN L+T WWP SV
Sbjct  83   GEKAAIFCGAACNKFLFSNENKLVTAWWPSSV  114



>ref|XP_008224572.1| PREDICTED: beta-amyrin 28-oxidase-like [Prunus mume]
Length=482

 Score = 91.3 bits (225),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 65/92 (71%), Gaps = 6/92 (7%)
 Frame = +2

Query  98   IYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSIL  259
            +++  +A  +  NLPPG  G+PVIGE+ + +       PEK+I DRM KYS +VFKTSI 
Sbjct  23   LFYRHRAQFTGNNLPPGKVGYPVIGESYEFLASGWKGHPEKFIFDRMTKYSSDVFKTSIF  82

Query  260  GEKVAVFCGAAGNKffftnentllttWWPQSV  355
            GEK A+FCGAA NKF F+NEN L+T WWP SV
Sbjct  83   GEKAAIFCGAACNKFLFSNENKLVTAWWPSSV  114



>ref|XP_011085174.1| PREDICTED: beta-amyrin 28-oxidase-like [Sesamum indicum]
Length=480

 Score = 90.9 bits (224),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 53/71 (75%), Gaps = 2/71 (3%)
 Frame = +2

Query  95   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV--PEKYISDRMKKYSPEVFKTSILGEK  268
            I++  ++ + S PNLPPG+ GWP+IGE I+ +   PE ++ DRMKKYSP++FKT ILGEK
Sbjct  17   ILFITSRRSASDPNLPPGTFGWPIIGETIEFLFGKPENFVGDRMKKYSPDIFKTKILGEK  76

Query  269  VAVFCGAAGNK  301
             AV CG  G+K
Sbjct  77   TAVICGPNGHK  87



>emb|CBI24045.3| unnamed protein product [Vitis vinifera]
Length=426

 Score = 90.1 bits (222),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 67/93 (72%), Gaps = 6/93 (6%)
 Frame = +2

Query  95   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  256
            ++ +  +++ + PNLPPG  GWP++GE+++ +       PEK+I DR+ KYS EVFKTS+
Sbjct  1    MLRYEIESHFTGPNLPPGKIGWPMVGESLEFLSTGWKGHPEKFIFDRISKYSSEVFKTSL  60

Query  257  LGEKVAVFCGAAGNKffftnentllttWWPQSV  355
            LGE  AVF GAAGNKF F+NEN L+  WWP SV
Sbjct  61   LGEPAAVFAGAAGNKFLFSNENKLVHAWWPSSV  93



>ref|XP_011031249.1| PREDICTED: beta-amyrin 28-oxidase-like [Populus euphratica]
Length=481

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 66/93 (71%), Gaps = 6/93 (6%)
 Frame = +2

Query  95   IIYFITKANTSKPNLPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSPEVFKTSI  256
            ++  + K+N S PNLPPG  G+P+IGE+++ +       PEK+I DR+ KYS +VFKT I
Sbjct  21   LLICVHKSNVSHPNLPPGKMGFPIIGESLEFLSAGRKGYPEKFIYDRIAKYSSQVFKTCI  80

Query  257  LGEKVAVFCGAAGNKffftnentllttWWPQSV  355
            LG+   V CGAAGNKF F+NEN L+ +WWP SV
Sbjct  81   LGQPTTVVCGAAGNKFLFSNENKLVASWWPDSV  113



>gb|ACU20818.1| unknown [Glycine max]
Length=445

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 67/93 (72%), Gaps = 6/93 (6%)
 Frame = +2

Query  95   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  256
            ++++  ++  + PNLPPG+TG+PVIGE+++ +       PEK+I DRM +YS ++FKTSI
Sbjct  24   VLFYKHRSAFAAPNLPPGATGYPVIGESLEFLSTGWKGHPEKFIFDRMIRYSSQLFKTSI  83

Query  257  LGEKVAVFCGAAGNKffftnentllttWWPQSV  355
            LGE   +FCGA  NKF F+NEN L+  WWP SV
Sbjct  84   LGEPAVIFCGATCNKFLFSNENKLVAAWWPNSV  116



>emb|CDP14237.1| unnamed protein product [Coffea canephora]
Length=479

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 66/93 (71%), Gaps = 7/93 (8%)
 Frame = +2

Query  95   IIYFITKANTSKPNLPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSPEVFKTSI  256
             ++F +K+ +S   LPPG +GWPVIGE+ + +       PEK+I DR+ KYS  VF+T +
Sbjct  22   FLFFKSKSGSSG-RLPPGKSGWPVIGESYEFLSTGWKGYPEKFILDRIAKYSSNVFRTHL  80

Query  257  LGEKVAVFCGAAGNKffftnentllttWWPQSV  355
            LGEK AVFCGAAGNKF F+NEN L+  WWP SV
Sbjct  81   LGEKAAVFCGAAGNKFLFSNENKLVQAWWPDSV  113



>gb|AGM38076.1| putative cytochrome P450 [Stenocereus gummosus]
Length=141

 Score = 86.3 bits (212),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 62/94 (66%), Gaps = 7/94 (7%)
 Frame = +2

Query  95   IIYFITKANTSKPNLPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSP-EVFKTS  253
            ++Y  T A      LPPG  GWPVIGE+ + M       PEK+I DR+ KY+P +VFKTS
Sbjct  22   LLYHHTSARGQAGRLPPGRFGWPVIGESWEFMSTGWKGFPEKFIFDRLAKYAPCQVFKTS  81

Query  254  ILGEKVAVFCGAAGNKffftnentllttWWPQSV  355
            IL EK  V CGAAGNKF F+NE  L+  WWP+SV
Sbjct  82   ILLEKTVVMCGAAGNKFLFSNEGKLVQVWWPKSV  115



>ref|XP_011078182.1| PREDICTED: beta-amyrin 28-oxidase-like [Sesamum indicum]
Length=478

 Score = 90.1 bits (222),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 52/93 (56%), Positives = 66/93 (71%), Gaps = 8/93 (9%)
 Frame = +2

Query  95   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  256
            +I++ TK  +    LPPG TGWPVIGE+++ +       PEK+I DRM +YS  VFKT +
Sbjct  22   LIFYKTKPASGA--LPPGRTGWPVIGESLEFLSTGWKGHPEKFIFDRMVRYSSYVFKTHL  79

Query  257  LGEKVAVFCGAAGNKffftnentllttWWPQSV  355
            LGE+ AVFCGAAGNKF F+NEN L+  WWP SV
Sbjct  80   LGEQAAVFCGAAGNKFLFSNENKLVQAWWPSSV  112



>ref|XP_003530525.1| PREDICTED: cytochrome P450 716B2 [Glycine max]
Length=482

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 67/93 (72%), Gaps = 6/93 (6%)
 Frame = +2

Query  95   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  256
            ++++  ++  + PNLPPG+TG+PVIGE+++ +       PEK+I DRM +YS ++FKTSI
Sbjct  24   VLFYKHRSAFAAPNLPPGATGYPVIGESLEFLSTGWKGHPEKFIFDRMIRYSSQLFKTSI  83

Query  257  LGEKVAVFCGAAGNKffftnentllttWWPQSV  355
            LGE   +FCGA  NKF F+NEN L+  WWP SV
Sbjct  84   LGEPAVIFCGATCNKFLFSNENKLVAAWWPNSV  116



>gb|KJB56450.1| hypothetical protein B456_009G120200 [Gossypium raimondii]
Length=476

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 66/93 (71%), Gaps = 6/93 (6%)
 Frame = +2

Query  95   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  256
            +I++      S PNLPPG  G+P IGE+I+ ++      PEK++ DRM KYS +VFKTSI
Sbjct  20   LIFYKKSNYASNPNLPPGRMGFPYIGESIEYLLTGRRGHPEKFLKDRMAKYSSQVFKTSI  79

Query  257  LGEKVAVFCGAAGNKffftnentllttWWPQSV  355
             GE +AV CGA GNKF F+NEN L+T+WWP SV
Sbjct  80   FGEPMAVVCGAVGNKFLFSNENKLVTSWWPDSV  112



>ref|XP_010669702.1| PREDICTED: beta-amyrin 28-oxidase-like [Beta vulgaris subsp. 
vulgaris]
Length=482

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 65/93 (70%), Gaps = 6/93 (6%)
 Frame = +2

Query  95   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  256
            I+++  K+     NLPPG TGWP++GE ++ +       PEK++ DRM KYS E FKT+I
Sbjct  22   IVFYKNKSIFFSANLPPGRTGWPLLGETLEFLSTGWRGHPEKFVYDRMVKYSQECFKTNI  81

Query  257  LGEKVAVFCGAAGNKffftnentllttWWPQSV  355
            LGE VA+ CGA GNKF F+NEN L+T WWP SV
Sbjct  82   LGEPVAIVCGATGNKFLFSNENKLVTAWWPDSV  114



>dbj|BAP59951.1| cytochrome P450 monooxygenase CYP716A50 [Coffea arabica]
Length=479

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 66/93 (71%), Gaps = 7/93 (8%)
 Frame = +2

Query  95   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  256
             +++ +++  S P LPPG TGWP++GE+++ +       PEK++ DRM KYS  VFKT +
Sbjct  22   FLFYKSRSALSGP-LPPGKTGWPMVGESLEFLSCGWKGHPEKFVFDRMAKYSSHVFKTHL  80

Query  257  LGEKVAVFCGAAGNKffftnentllttWWPQSV  355
            LGEK AVFCGA GNKF F+NEN L+  WWP SV
Sbjct  81   LGEKAAVFCGAPGNKFLFSNENKLVQAWWPASV  113



>gb|KDP42281.1| hypothetical protein JCGZ_01605 [Jatropha curcas]
Length=474

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 61/80 (76%), Gaps = 6/80 (8%)
 Frame = +2

Query  134  NLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSILGEKVAVFCGAAG  295
            NLPPGSTGWP+IGE+I+ +       PEK+I DRM K+S +VFKTS+  E  AVFCGAAG
Sbjct  29   NLPPGSTGWPLIGESIEFLTTGRKGQPEKFIFDRMVKFSNKVFKTSLFCEPAAVFCGAAG  88

Query  296  NKffftnentllttWWPQSV  355
            NKF F+NEN L+T WWP SV
Sbjct  89   NKFLFSNENKLVTAWWPSSV  108



>ref|XP_010095208.1| Cytochrome P450 [Morus notabilis]
 gb|EXB58669.1| Cytochrome P450 [Morus notabilis]
Length=490

 Score = 89.7 bits (221),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 67/93 (72%), Gaps = 6/93 (6%)
 Frame = +2

Query  95   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  256
            ++++  +++ S  NLPPG  G+PVIGE ++ +       PEK+I DRM K+S EVFKTS+
Sbjct  25   VVFYKHRSHYSGANLPPGKIGYPVIGETMEFLSTGWRGHPEKFIFDRMTKFSTEVFKTSL  84

Query  257  LGEKVAVFCGAAGNKffftnentllttWWPQSV  355
            +GE  AVFCGAA NKF F+NEN L+T WWP SV
Sbjct  85   VGEPAAVFCGAACNKFLFSNENKLVTAWWPSSV  117



>gb|AGC31652.1| cytochrome P450 CYP6H [Panax quinquefolius]
Length=469

 Score = 89.4 bits (220),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 46/84 (55%), Positives = 64/84 (76%), Gaps = 6/84 (7%)
 Frame = +2

Query  122  TSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSILGEKVAVFC  283
            +S+  LPPG TGWP+IGE ++ +       PEK+++ RMKKYSP+VF TS+ GEK+ VFC
Sbjct  26   SSQNKLPPGKTGWPIIGETLEFISCGQKGNPEKFVTQRMKKYSPDVFTTSLAGEKMVVFC  85

Query  284  GAAGNKffftnentllttWWPQSV  355
            GA+GNKF F+NEN L+ +WWP ++
Sbjct  86   GASGNKFIFSNENKLVVSWWPPAI  109



>gb|KEH21306.1| cytochrome P450 family protein [Medicago truncatula]
Length=402

 Score = 88.6 bits (218),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 50/92 (54%), Positives = 64/92 (70%), Gaps = 6/92 (7%)
 Frame = +2

Query  98   IYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSIL  259
            ++FI     S  NLPPG  G+P+IGE+++ +       PEK+I DRM+KYS E+FKTSI+
Sbjct  21   LFFIFYKQKSPLNLPPGKMGYPIIGESLEFLSTGWKGHPEKFIFDRMRKYSSELFKTSIV  80

Query  260  GEKVAVFCGAAGNKffftnentllttWWPQSV  355
            GE   V CGAA NKF F+NEN L+T WWP SV
Sbjct  81   GESTVVCCGAASNKFLFSNENKLVTAWWPDSV  112



>ref|XP_002529893.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF32496.1| cytochrome P450, putative [Ricinus communis]
Length=474

 Score = 89.4 bits (220),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 49/89 (55%), Positives = 62/89 (70%), Gaps = 2/89 (2%)
 Frame = +2

Query  95   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV--PEKYISDRMKKYSPEVFKTSILGEK  268
            +  F  ++     NLPPGS GWPVIGE I+ +   PEK++ DRMKKYSPE+FKT+ILGEK
Sbjct  19   LFAFKIRSKNGSKNLPPGSLGWPVIGETIEFLFGKPEKFVFDRMKKYSPEIFKTNILGEK  78

Query  269  VAVFCGAAGNKffftnentllttWWPQSV  355
             AV CG  G+KF F+NE  L T + P S+
Sbjct  79   TAVICGPNGHKFLFSNEQKLFTAFRPHSM  107



>gb|AHA50080.1| cytochrome P450 [Eleutherococcus senticosus]
Length=469

 Score = 89.4 bits (220),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 46/84 (55%), Positives = 63/84 (75%), Gaps = 6/84 (7%)
 Frame = +2

Query  122  TSKPNLPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSPEVFKTSILGEKVAVFC  283
            +S+  LPPG TGWP+IGE ++ +       PEK+I+ RM KYSP VF TS+ GEK+A+FC
Sbjct  26   SSQNKLPPGKTGWPIIGETLEYLSWGQKGCPEKFITQRMNKYSPHVFTTSLAGEKMAIFC  85

Query  284  GAAGNKffftnentllttWWPQSV  355
            GA+GNKF F+NEN L+ +WWP ++
Sbjct  86   GASGNKFMFSNENKLVVSWWPPAI  109



>gb|AHK23636.1| cytochrome P450 [Panax notoginseng]
Length=469

 Score = 89.4 bits (220),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 46/84 (55%), Positives = 64/84 (76%), Gaps = 6/84 (7%)
 Frame = +2

Query  122  TSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSILGEKVAVFC  283
            +S+  LPPG TGWP+IGE ++ +       PEK+++ RMKKYSP+VF TS+ GEK+ VFC
Sbjct  26   SSQNKLPPGKTGWPIIGETLEFISWGQKGNPEKFVTQRMKKYSPDVFTTSLAGEKMVVFC  85

Query  284  GAAGNKffftnentllttWWPQSV  355
            GA+GNKF F+NEN L+ +WWP ++
Sbjct  86   GASGNKFIFSNENKLVVSWWPPAI  109



>gb|EYU26567.1| hypothetical protein MIMGU_mgv1a005379mg [Erythranthe guttata]
Length=486

 Score = 89.4 bits (220),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 61/80 (76%), Gaps = 6/80 (8%)
 Frame = +2

Query  134  NLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSILGEKVAVFCGAAG  295
            +LPPG TGWPVIGE+++ +       PEK++ DRM KYS +VF+T +LGEK AVFCGA G
Sbjct  41   SLPPGKTGWPVIGESLEFLSTGWKGHPEKFVFDRMAKYSSQVFRTHLLGEKAAVFCGANG  100

Query  296  NKffftnentllttWWPQSV  355
            NKF F+NEN L+ +WWP SV
Sbjct  101  NKFLFSNENKLVQSWWPVSV  120



>ref|XP_009617496.1| PREDICTED: beta-amyrin 28-oxidase-like isoform X1 [Nicotiana 
tomentosiformis]
Length=480

 Score = 89.0 bits (219),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 49/89 (55%), Positives = 61/89 (69%), Gaps = 6/89 (7%)
 Frame = +2

Query  107  ITKANTSKPNLPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSPEVFKTSILGEK  268
             T+  T   NLPPGS GWPVIGE  + +       PEK+++DR++KY  ++FKT I+GEK
Sbjct  24   FTRNRTKTLNLPPGSYGWPVIGETPEFLRSRRDGSPEKFVTDRIEKYQSQIFKTCIVGEK  83

Query  269  VAVFCGAAGNKffftnentllttWWPQSV  355
            VAV CG AGNKF F NEN L+  WWP SV
Sbjct  84   VAVLCGPAGNKFLFGNENKLVNVWWPSSV  112



>ref|XP_006376223.1| hypothetical protein POPTR_0013s11080g [Populus trichocarpa]
 gb|ERP54020.1| hypothetical protein POPTR_0013s11080g [Populus trichocarpa]
Length=486

 Score = 89.0 bits (219),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 65/93 (70%), Gaps = 6/93 (6%)
 Frame = +2

Query  95   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  256
            +I+ + K  +S    PPG  GWP+IGE    ++      PEK+ +DRMKKYS EVF+TS+
Sbjct  21   LIFLVYKKKSSNIKFPPGRIGWPIIGEAWGFVMAGKRGTPEKFFNDRMKKYSTEVFQTSL  80

Query  257  LGEKVAVFCGAAGNKffftnentllttWWPQSV  355
             G+ +AVFCGA+GNKF F++EN  + TWWP+++
Sbjct  81   FGDNMAVFCGASGNKFLFSSENKYVATWWPRTI  113



>emb|CAN67939.1| hypothetical protein VITISV_013692 [Vitis vinifera]
Length=484

 Score = 89.0 bits (219),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 69/94 (73%), Gaps = 7/94 (7%)
 Frame = +2

Query  95   IIYFIT-KANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTS  253
            I++ IT +  +S PNLPPG+ GWP+IGE ++  +      P ++++DRM KYSP+VFKTS
Sbjct  20   IVFLITYRHKSSNPNLPPGTMGWPIIGETLEFSLACQGGNPGRFLNDRMNKYSPQVFKTS  79

Query  254  ILGEKVAVFCGAAGNKffftnentllttWWPQSV  355
            +L   +AV CGA+GNKF F+NE+ L+ +WW +S+
Sbjct  80   LLEANMAVMCGASGNKFLFSNEDKLVVSWWQRSM  113



>ref|XP_009778451.1| PREDICTED: beta-amyrin 28-oxidase-like [Nicotiana sylvestris]
Length=483

 Score = 88.6 bits (218),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 63/93 (68%), Gaps = 7/93 (8%)
 Frame = +2

Query  95   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  256
            ++YF  K++     LPPG TGWPVIGE ++ +       PEK+I DRM KYS  VFKT +
Sbjct  24   LLYF-NKSSVLAGTLPPGKTGWPVIGETLEFLSTGWKGHPEKFIFDRMSKYSSSVFKTHL  82

Query  257  LGEKVAVFCGAAGNKffftnentllttWWPQSV  355
            L EK AVFCGA GNKF F+NEN L+  WWP S+
Sbjct  83   LMEKSAVFCGATGNKFLFSNENKLVQVWWPNSI  115



>ref|XP_006338129.1| PREDICTED: cytochrome P450 716B2-like [Solanum tuberosum]
Length=476

 Score = 88.6 bits (218),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 49/85 (58%), Positives = 60/85 (71%), Gaps = 6/85 (7%)
 Frame = +2

Query  119  NTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSILGEKVAVF  280
            N S   LPPG TGWPV GE+++ +       PEK+I DR+ KYS  VFKT +LGE+ AVF
Sbjct  24   NKSGEGLPPGKTGWPVFGESLEFLSTGWKGHPEKFIFDRVAKYSSSVFKTHLLGEEAAVF  83

Query  281  CGAAGNKffftnentllttWWPQSV  355
            CGA+GNKF F+NEN L+  WWP SV
Sbjct  84   CGASGNKFLFSNENKLVQAWWPNSV  108



>ref|XP_011003980.1| PREDICTED: beta-amyrin 28-oxidase-like [Populus euphratica]
Length=333

 Score = 86.7 bits (213),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 62/87 (71%), Gaps = 6/87 (7%)
 Frame = +2

Query  113  KANTSKPNLPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSPEVFKTSILGEKVA  274
            +  +S    PPG TGWP+IGE  D +       PEK+++DRM KYS +VF TS+LG+ +A
Sbjct  34   RRKSSNAEFPPGKTGWPIIGETWDFVRDGRSGTPEKFVNDRMSKYSTDVFHTSLLGDNLA  93

Query  275  VFCGAAGNKffftnentllttWWPQSV  355
            +FCGA+GNKF F++EN  +TTWWP+ +
Sbjct  94   MFCGASGNKFLFSSENKYVTTWWPRPI  120



>gb|AIT93302.1| cytochrome P450 monooxygenase CYP716A12 [Medicago sativa]
Length=479

 Score = 88.2 bits (217),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 50/92 (54%), Positives = 65/92 (71%), Gaps = 6/92 (7%)
 Frame = +2

Query  98   IYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSIL  259
            ++FI   + S  NLPPG  G+P+IGE+++ +       PEK+I DRM+KYS E+FKTSI+
Sbjct  21   LFFIFYKHKSPLNLPPGKMGYPIIGESLEFLSTGWKGHPEKFIFDRMRKYSSELFKTSIV  80

Query  260  GEKVAVFCGAAGNKffftnentllttWWPQSV  355
            GE   V CGAA NKF F+NEN L+T WWP SV
Sbjct  81   GESTVVCCGAASNKFLFSNENKLVTAWWPDSV  112



>ref|XP_002526799.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF35534.1| cytochrome P450, putative [Ricinus communis]
Length=480

 Score = 88.2 bits (217),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 67/95 (71%), Gaps = 8/95 (8%)
 Frame = +2

Query  95   IIYFITKANTSKP--NLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKT  250
            +I+ +   ++  P   LPPG+ GWP IGE++  ++      PEK+I+DR+ KYS +VF+T
Sbjct  20   LIFLVYFKHSKFPPVKLPPGTKGWPFIGESLAFLMTSRRGHPEKFINDRVTKYSADVFQT  79

Query  251  SILGEKVAVFCGAAGNKffftnentllttWWPQSV  355
            S+LGE +AVFCGAAGNK  FT+EN  +  WWP+S+
Sbjct  80   SLLGENMAVFCGAAGNKLLFTSENKYVKAWWPKSL  114



>ref|XP_011048169.1| PREDICTED: beta-amyrin 28-oxidase-like [Populus euphratica]
Length=478

 Score = 88.2 bits (217),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 66/96 (69%), Gaps = 10/96 (10%)
 Frame = +2

Query  98   IYFITKANTSK----PNLPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSPEVFK  247
            +Y ITK    +    P+LPPGS GWP+IGE ++ +       P+ ++ DRM+K  P++FK
Sbjct  18   LYIITKTLKERLIPNPHLPPGSLGWPLIGETLNYLGACLAGRPDWFLRDRMEKLDPQIFK  77

Query  248  TSILGEKVAVFCGAAGNKffftnentllttWWPQSV  355
            TS+ GE VAVFCG AGNKF F+NEN L+  WWP+SV
Sbjct  78   TSLFGETVAVFCGPAGNKFLFSNENKLVNLWWPRSV  113



>gb|AHF22083.1| CYP716A14v2 [Artemisia annua]
Length=474

 Score = 88.2 bits (217),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 65/96 (68%), Gaps = 12/96 (13%)
 Frame = +2

Query  98   IYFITKANTSKP----NLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFK  247
            +YF+     SKP     LPPG TGWPVIGE ++ +       PEK+I DRM ++SP VFK
Sbjct  23   LYFVF--YKSKPVVDRKLPPGQTGWPVIGETLEFLTNGWKGHPEKFIFDRMARFSPHVFK  80

Query  248  TSILGEKVAVFCGAAGNKffftnentllttWWPQSV  355
            TS++ E  AVFCG+AGNKF F+NEN L+  WWP SV
Sbjct  81   TSLMLEDAAVFCGSAGNKFLFSNENKLVKAWWPASV  116



>gb|ABC94483.1| putative taxadiene 5-alpha-hydroxylase cytochrome P450 [Artemisia 
annua]
Length=474

 Score = 88.2 bits (217),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 47/79 (59%), Positives = 58/79 (73%), Gaps = 6/79 (8%)
 Frame = +2

Query  137  LPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSILGEKVAVFCGAAGN  298
            LPPG TGWPVIGE ++ +       PEK+I DRM ++SP VFKTS++ E  AVFCG+AGN
Sbjct  38   LPPGQTGWPVIGETLEFLTNGWKGHPEKFIFDRMARFSPHVFKTSLMLEDAAVFCGSAGN  97

Query  299  KffftnentllttWWPQSV  355
            KF F+NEN L+  WWP SV
Sbjct  98   KFLFSNENKLVKAWWPASV  116



>gb|AED99872.1| cytochrome P450 [Panax notoginseng]
Length=469

 Score = 87.8 bits (216),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 46/84 (55%), Positives = 63/84 (75%), Gaps = 6/84 (7%)
 Frame = +2

Query  122  TSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSILGEKVAVFC  283
            +S+  LPPG TGWP+IGE ++ +       PEK+++ RMKKYSP+VF TS  GEK+ VFC
Sbjct  26   SSQNKLPPGKTGWPIIGETLEFISCGQKGNPEKFVTQRMKKYSPDVFTTSXAGEKMVVFC  85

Query  284  GAAGNKffftnentllttWWPQSV  355
            GA+GNKF F+NEN L+ +WWP ++
Sbjct  86   GASGNKFIFSNENKLVVSWWPPAI  109



>emb|CDP10718.1| unnamed protein product [Coffea canephora]
Length=482

 Score = 88.2 bits (217),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 47/83 (57%), Positives = 62/83 (75%), Gaps = 2/83 (2%)
 Frame = +2

Query  113  KANTSKPNLPPGSTGWPVIGENIDLMV--PEKYISDRMKKYSPEVFKTSILGEKVAVFCG  286
            K   +K  LPPG+ GWPV+GEN+D     P K+I +RM KYS +VFKTS +GEKV+VFCG
Sbjct  27   KPKFNKSKLPPGNIGWPVLGENVDFARGGPRKFIEERMSKYSSQVFKTSFMGEKVSVFCG  86

Query  287  AAGNKffftnentllttWWPQSV  355
             AGNKF F+NE+  +T+W P+S+
Sbjct  87   PAGNKFLFSNEDKAVTSWLPRSM  109



>gb|ACJ84447.1| unknown [Medicago truncatula]
Length=479

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 50/92 (54%), Positives = 64/92 (70%), Gaps = 6/92 (7%)
 Frame = +2

Query  98   IYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSIL  259
            ++FI     S  NLPPG  G+P+IGE+++ +       PEK+I DRM+KYS E+FKTSI+
Sbjct  21   LFFIFYKQKSPLNLPPGKMGYPIIGESLEFLSTGWKGHPEKFIFDRMRKYSSELFKTSIV  80

Query  260  GEKVAVFCGAAGNKffftnentllttWWPQSV  355
            GE   V CGAA NKF F+NEN L+T WWP SV
Sbjct  81   GESTVVCCGAASNKFLFSNENKLVTAWWPDSV  112



>gb|AFK47215.1| unknown [Medicago truncatula]
Length=479

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 50/92 (54%), Positives = 64/92 (70%), Gaps = 6/92 (7%)
 Frame = +2

Query  98   IYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSIL  259
            ++FI     S  NLPPG  G+P+IGE+++ +       PEK+I DRM+KYS E+FKTSI+
Sbjct  21   LFFIFYKQKSPLNLPPGKMGYPIIGESLEFLSTGWKGHPEKFIFDRMRKYSSELFKTSIV  80

Query  260  GEKVAVFCGAAGNKffftnentllttWWPQSV  355
            GE   V CGAA NKF F+NEN L+T WWP SV
Sbjct  81   GESTVVCCGAASNKFLFSNENKLVTAWWPDSV  112



>emb|CBN88268.1| cytochrome P450 monoxygenase [Medicago truncatula]
 emb|CBN88269.1| cytochrome P450 monoxygenase [Medicago truncatula]
Length=479

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 50/92 (54%), Positives = 64/92 (70%), Gaps = 6/92 (7%)
 Frame = +2

Query  98   IYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSIL  259
            ++FI     S  NLPPG  G+P+IGE+++ +       PEK+I DRM+KYS E+FKTSI+
Sbjct  21   LFFIFYKQKSPLNLPPGKMGYPIIGESLEFLSTGWKGHPEKFIFDRMRKYSSELFKTSIV  80

Query  260  GEKVAVFCGAAGNKffftnentllttWWPQSV  355
            GE   V CGAA NKF F+NEN L+T WWP SV
Sbjct  81   GESTVVCCGAASNKFLFSNENKLVTAWWPDSV  112



>ref|XP_006474348.1| PREDICTED: cytochrome P450 716B1-like [Citrus sinensis]
Length=376

 Score = 86.7 bits (213),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 48/93 (52%), Positives = 64/93 (69%), Gaps = 6/93 (6%)
 Frame = +2

Query  95   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  256
            II++   +N S+PN+PPGS G+P IGE+ + +        EK+I +RM KYS   FKTS+
Sbjct  22   IIFYNHNSNLSQPNVPPGSFGFPFIGESFEFLSYGWKGHTEKFIFNRMIKYSSHAFKTSL  81

Query  257  LGEKVAVFCGAAGNKffftnentllttWWPQSV  355
            LGE  AV CG AGN+F  +NEN L+T+WWP SV
Sbjct  82   LGEPTAVLCGPAGNRFLSSNENNLVTSWWPDSV  114



>gb|EYU26566.1| hypothetical protein MIMGU_mgv1a021994mg [Erythranthe guttata]
Length=469

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 58/80 (73%), Gaps = 6/80 (8%)
 Frame = +2

Query  134  NLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSILGEKVAVFCGAAG  295
             LPPG TGWPVIGE+++ +       PEK+I DRM KYS  +F+T +LGE+ AV CGAAG
Sbjct  32   TLPPGRTGWPVIGESLEFLSTGWKGHPEKFIFDRMAKYSIHIFRTHLLGEQAAVLCGAAG  91

Query  296  NKffftnentllttWWPQSV  355
            NKF F+NEN L+  WWP SV
Sbjct  92   NKFLFSNENKLVQAWWPSSV  111



>gb|ABC59076.1| cytochrome P450 monooxygenase CYP716A12 [Medicago truncatula]
 gb|KEH21305.1| cytochrome P450 family protein [Medicago truncatula]
Length=479

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 50/92 (54%), Positives = 64/92 (70%), Gaps = 6/92 (7%)
 Frame = +2

Query  98   IYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSIL  259
            ++FI     S  NLPPG  G+P+IGE+++ +       PEK+I DRM+KYS E+FKTSI+
Sbjct  21   LFFIFYKQKSPLNLPPGKMGYPIIGESLEFLSTGWKGHPEKFIFDRMRKYSSELFKTSIV  80

Query  260  GEKVAVFCGAAGNKffftnentllttWWPQSV  355
            GE   V CGAA NKF F+NEN L+T WWP SV
Sbjct  81   GESTVVCCGAASNKFLFSNENKLVTAWWPDSV  112



>sp|I7CT85.1|C7A53_PANGI RecName: Full=Protopanaxadiol 6-hydroxylase; Short=P6H; AltName: 
Full=Cytochrome P450 CYP716A53v2; AltName: Full=Protopanaxatriol 
synthase [Panax ginseng]
 gb|AFO63031.1| cytochrome P450 CYP716A53v2 [Panax ginseng]
Length=469

 Score = 87.4 bits (215),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 63/84 (75%), Gaps = 6/84 (7%)
 Frame = +2

Query  122  TSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSILGEKVAVFC  283
            +S+  LPPG TGWP+IGE ++ +       PEK+++ RM KYSP+VF TS+ GEK+ VFC
Sbjct  26   SSQNKLPPGKTGWPIIGETLEFISCGQKGNPEKFVTQRMNKYSPDVFTTSLAGEKMVVFC  85

Query  284  GAAGNKffftnentllttWWPQSV  355
            GA+GNKF F+NEN L+ +WWP ++
Sbjct  86   GASGNKFIFSNENKLVVSWWPPAI  109



>ref|XP_011093941.1| PREDICTED: beta-amyrin 28-oxidase-like [Sesamum indicum]
Length=478

 Score = 87.4 bits (215),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 65/93 (70%), Gaps = 7/93 (8%)
 Frame = +2

Query  95   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  256
             +++  K+ +  P LPPG TGWPV+GE+++ +       PEK+I DR+ KYS  VF+T +
Sbjct  22   FLFYKNKSASGGP-LPPGRTGWPVLGESLEFLSTGWKGHPEKFIFDRIAKYSSSVFRTHL  80

Query  257  LGEKVAVFCGAAGNKffftnentllttWWPQSV  355
            LGEK  VFCGA+GNKF F+NEN L+  WWP SV
Sbjct  81   LGEKAVVFCGASGNKFLFSNENKLVQAWWPSSV  113



>emb|CDP10717.1| unnamed protein product [Coffea canephora]
Length=477

 Score = 87.4 bits (215),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/83 (55%), Positives = 61/83 (73%), Gaps = 2/83 (2%)
 Frame = +2

Query  113  KANTSKPNLPPGSTGWPVIGENIDLMV--PEKYISDRMKKYSPEVFKTSILGEKVAVFCG  286
            K   +K  LPPG+ GW ++GEN+D     P K+I +RM KYS +VFKTS +GEKVAVFCG
Sbjct  27   KPKVNKSKLPPGNLGWAILGENVDFATGGPRKFIEERMSKYSSQVFKTSFMGEKVAVFCG  86

Query  287  AAGNKffftnentllttWWPQSV  355
             AGNKF F+NE+  +T+W P+S+
Sbjct  87   PAGNKFLFSNEDKTVTSWLPRSM  109



>gb|KJB21914.1| hypothetical protein B456_004G020800 [Gossypium raimondii]
Length=480

 Score = 87.4 bits (215),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 64/93 (69%), Gaps = 6/93 (6%)
 Frame = +2

Query  95   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  256
            ++++  ++N S  NLPPG  G P +GE ++ +       PEK+I DRM KYS +VFKT+I
Sbjct  22   VLFYKHRSNYSADNLPPGRPGLPFVGETLEFLSTGWKGHPEKFIFDRMAKYSSQVFKTNI  81

Query  257  LGEKVAVFCGAAGNKffftnentllttWWPQSV  355
            LGE  AVFCG A NKF F+NEN L+T WWP SV
Sbjct  82   LGEPAAVFCGVACNKFLFSNENKLVTAWWPSSV  114



>gb|EYU25770.1| hypothetical protein MIMGU_mgv1a005482mg [Erythranthe guttata]
Length=482

 Score = 87.0 bits (214),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/79 (59%), Positives = 58/79 (73%), Gaps = 6/79 (8%)
 Frame = +2

Query  137  LPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSILGEKVAVFCGAAGN  298
            LPPG TGWPV+GE+++ +       PEK+I DR+ KYS  VF+T +LGEK AVFCGA GN
Sbjct  38   LPPGKTGWPVLGESLEFLSTGWKGHPEKFIFDRIAKYSSTVFRTHLLGEKAAVFCGAGGN  97

Query  299  KffftnentllttWWPQSV  355
            KF F+NEN L+  WWP SV
Sbjct  98   KFLFSNENKLVQAWWPSSV  116



>ref|XP_009598096.1| PREDICTED: beta-amyrin 28-oxidase-like [Nicotiana tomentosiformis]
Length=477

 Score = 87.0 bits (214),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 51/65 (78%), Gaps = 2/65 (3%)
 Frame = +2

Query  113  KANTSKPNLPPGSTGWPVIGENIDLMV--PEKYISDRMKKYSPEVFKTSILGEKVAVFCG  286
            + +++K  LPPGS GWPVIGE ID +   PEK++S+RMKKYSP++FKT I+GEK AV CG
Sbjct  25   RRSSNKTKLPPGSFGWPVIGETIDFLFSNPEKFVSNRMKKYSPDIFKTKIMGEKTAVICG  84

Query  287  AAGNK  301
              G+K
Sbjct  85   PNGHK  89



>ref|XP_010031614.1| PREDICTED: cytochrome P450 716B1-like [Eucalyptus grandis]
 gb|KCW88130.1| hypothetical protein EUGRSUZ_A00523 [Eucalyptus grandis]
Length=475

 Score = 87.0 bits (214),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 44/87 (51%), Positives = 57/87 (66%), Gaps = 6/87 (7%)
 Frame = +2

Query  113  KANTSKPNLPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSPEVFKTSILGEKVA  274
            +  T   NLPPG  GWP+IGE+++ +       PEK+I DRM KY+  VFKTS+LGE + 
Sbjct  23   RPKTDHLNLPPGRFGWPIIGESLEFLRSQLEGSPEKFIKDRMTKYNSPVFKTSVLGEPMV  82

Query  275  VFCGAAGNKffftnentllttWWPQSV  355
            + CG AGNKF F+NE   +  WWP SV
Sbjct  83   ILCGPAGNKFLFSNEGKKVVLWWPSSV  109



>ref|XP_007020143.1| Cytochrome P450 [Theobroma cacao]
 gb|EOY17368.1| Cytochrome P450 [Theobroma cacao]
Length=476

 Score = 87.0 bits (214),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 65/93 (70%), Gaps = 8/93 (9%)
 Frame = +2

Query  95   IIYFITK--ANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKT  250
            +IY + K  +  + P LPPG  G P IGE +D ++      PEK+++DR  KYS +VF+T
Sbjct  22   VIYLVYKYKSRAATPKLPPGRKGLPYIGETLDYVLASRRGTPEKFVTDRNTKYSSDVFRT  81

Query  251  SILGEKVAVFCGAAGNKffftnentllttWWPQ  349
            S+LGE +AVFCGAAGNKF F+ +N  +T+WWP+
Sbjct  82   SLLGEDMAVFCGAAGNKFLFSGQNKYVTSWWPR  114



>ref|XP_007011469.1| Cytochrome P450 [Theobroma cacao]
 gb|EOY29088.1| Cytochrome P450 [Theobroma cacao]
Length=482

 Score = 87.0 bits (214),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 50/95 (53%), Positives = 66/95 (69%), Gaps = 8/95 (8%)
 Frame = +2

Query  95   IIYFITK--ANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKT  250
            ++Y I +  A  +  NLPPG+TG P +GE+I  +       PEK++ DRM K+S +VFKT
Sbjct  23   LVYLIHRRIAPVASKNLPPGTTGLPFLGESIQFLRAGQKGHPEKFVYDRMTKFSSKVFKT  82

Query  251  SILGEKVAVFCGAAGNKffftnentllttWWPQSV  355
            S+LGE  AVFCG+ GNKF F+NEN L+T WWP SV
Sbjct  83   SLLGETAAVFCGSTGNKFLFSNENKLVTAWWPNSV  117



>emb|CBI24076.3| unnamed protein product [Vitis vinifera]
Length=506

 Score = 87.0 bits (214),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 66/94 (70%), Gaps = 7/94 (7%)
 Frame = +2

Query  95   IIYFITK-ANTSKPNLPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSPEVFKTS  253
            I +F+ K   +S  NLPPG  G+P IGE+++ +       PE++I DRM KYS ++FKT 
Sbjct  81   IRFFVHKLEKSSGINLPPGKMGFPFIGESLEFLRMGRKGTPERFIQDRMAKYSTQIFKTC  140

Query  254  ILGEKVAVFCGAAGNKffftnentllttWWPQSV  355
            +LGE  AV CGAAGNK  F+NEN L+T+WWP+SV
Sbjct  141  LLGEPTAVVCGAAGNKLLFSNENKLVTSWWPRSV  174



>ref|XP_009758679.1| PREDICTED: beta-amyrin 28-oxidase-like [Nicotiana sylvestris]
Length=476

 Score = 86.7 bits (213),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 50/65 (77%), Gaps = 2/65 (3%)
 Frame = +2

Query  113  KANTSKPNLPPGSTGWPVIGENIDLMV--PEKYISDRMKKYSPEVFKTSILGEKVAVFCG  286
            + +++K  LPPGS GWPVIGE ID +   PEK++SDRMKKYSP++F T I+GEK AV CG
Sbjct  25   RLSSNKTKLPPGSFGWPVIGETIDFLFSNPEKFVSDRMKKYSPDIFMTKIMGEKTAVICG  84

Query  287  AAGNK  301
              G+K
Sbjct  85   PNGHK  89



>ref|XP_002513183.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF49174.1| cytochrome P450, putative [Ricinus communis]
Length=477

 Score = 86.7 bits (213),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 62/80 (78%), Gaps = 6/80 (8%)
 Frame = +2

Query  134  NLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSILGEKVAVFCGAAG  295
            NLPPG TG P IGE+++ +       PEK++SDRM+K+S +VF+TSILGE+ AV CGA G
Sbjct  31   NLPPGKTGLPYIGESLEFLSTGRKGHPEKFLSDRMEKFSRQVFRTSILGEQTAVVCGAQG  90

Query  296  NKffftnentllttWWPQSV  355
            NKF F+NEN L+T WWP+S+
Sbjct  91   NKFLFSNENKLVTAWWPKSI  110



>ref|XP_011003986.1| PREDICTED: beta-amyrin 28-oxidase-like [Populus euphratica]
Length=478

 Score = 86.7 bits (213),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 62/93 (67%), Gaps = 6/93 (6%)
 Frame = +2

Query  95   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  256
            +I  + K        PPG TGWP+IGE  D M+      PEK+I+DR+ KYSPEVF+TS+
Sbjct  20   LIVLLHKRKYWNTKFPPGKTGWPIIGETWDFMMAARCGTPEKFINDRVGKYSPEVFQTSL  79

Query  257  LGEKVAVFCGAAGNKffftnentllttWWPQSV  355
            LG  +AVFCG+ GNKF +++EN  +T W P S+
Sbjct  80   LGHNMAVFCGSGGNKFLYSSENKCVTGWLPHSI  112



>gb|AJD25249.1| cytochrome P450 CYP716C12 [Salvia miltiorrhiza]
Length=476

 Score = 86.7 bits (213),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 55/72 (76%), Gaps = 3/72 (4%)
 Frame = +2

Query  95   IIYFITKANTSKPN-LPPGSTGWPVIGENIDLMV--PEKYISDRMKKYSPEVFKTSILGE  265
            + +F+ + +T K + LPPGS GWPV+GE+++ +   PE ++ DRMKKYSP++FKT ILGE
Sbjct  15   LTFFLLRRSTDKGDALPPGSFGWPVLGESVEFLFGKPENFVGDRMKKYSPDIFKTKILGE  74

Query  266  KVAVFCGAAGNK  301
            K AV CG AG+K
Sbjct  75   KTAVICGPAGHK  86



>ref|XP_010696134.1| PREDICTED: beta-amyrin 28-oxidase-like [Beta vulgaris subsp. 
vulgaris]
 dbj|BAP59950.1| cytochrome P450 monooxygenase CYP716A49 [Beta vulgaris]
Length=483

 Score = 86.7 bits (213),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 62/81 (77%), Gaps = 7/81 (9%)
 Frame = +2

Query  134  NLPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSP-EVFKTSILGEKVAVFCGAA  292
             +PPG+ GWPV+GE+++ +       PEK+I DR+ KY+P ++FKTSILGEKVAV CGAA
Sbjct  33   RVPPGTMGWPVVGESLEFLSTGWKGYPEKFIFDRLSKYAPNQIFKTSILGEKVAVICGAA  92

Query  293  GNKffftnentllttWWPQSV  355
            GNKF ++NEN L+  WWP SV
Sbjct  93   GNKFLYSNENKLVQAWWPSSV  113



>ref|XP_002264643.3| PREDICTED: beta-amyrin 28-oxidase-like [Vitis vinifera]
Length=509

 Score = 86.7 bits (213),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 66/94 (70%), Gaps = 7/94 (7%)
 Frame = +2

Query  95   IIYFITK-ANTSKPNLPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSPEVFKTS  253
            I +F+ K   +S  NLPPG  G+P IGE+++ +       PE++I DRM KYS ++FKT 
Sbjct  51   IRFFVHKLEKSSGINLPPGKMGFPFIGESLEFLRMGRKGTPERFIQDRMAKYSTQIFKTC  110

Query  254  ILGEKVAVFCGAAGNKffftnentllttWWPQSV  355
            +LGE  AV CGAAGNK  F+NEN L+T+WWP+SV
Sbjct  111  LLGEPTAVVCGAAGNKLLFSNENKLVTSWWPRSV  144



>ref|XP_009591188.1| PREDICTED: beta-amyrin 28-oxidase-like [Nicotiana tomentosiformis]
Length=483

 Score = 86.3 bits (212),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 60/85 (71%), Gaps = 6/85 (7%)
 Frame = +2

Query  119  NTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSILGEKVAVF  280
            +T    LPPG +GWPVIGE+++ +       PEK+I DR+ KYS  VFKT +LGEK AVF
Sbjct  33   STFSGQLPPGKSGWPVIGESLEFLSTGWKGHPEKFIFDRISKYSSNVFKTHLLGEKAAVF  92

Query  281  CGAAGNKffftnentllttWWPQSV  355
            CG +GNKF F+NEN L+  WWP SV
Sbjct  93   CGDSGNKFLFSNENKLVQAWWPSSV  117



>gb|AJD25248.1| cytochrome P450 CYP716A89 [Salvia miltiorrhiza]
Length=479

 Score = 86.3 bits (212),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 64/93 (69%), Gaps = 8/93 (9%)
 Frame = +2

Query  95   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  256
            ++++ TK  +    LPPG TGWPVIGE+++ +       PEK+I DRM +YS  VF+T +
Sbjct  22   LLFYKTKPASG--GLPPGKTGWPVIGESLEFLSTGWKGHPEKFIFDRMARYSSHVFRTHL  79

Query  257  LGEKVAVFCGAAGNKffftnentllttWWPQSV  355
            LGE  AV CG+AGNKF F+NEN L+  WWP SV
Sbjct  80   LGEPAAVLCGSAGNKFLFSNENKLVQAWWPSSV  112



>ref|XP_002279608.1| PREDICTED: beta-amyrin 28-oxidase [Vitis vinifera]
Length=481

 Score = 86.3 bits (212),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 66/93 (71%), Gaps = 6/93 (6%)
 Frame = +2

Query  95   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  256
            +++ + +  ++   LPPG+ GWP+IGE +   +      P ++I +RM KYSP+VF+TS+
Sbjct  19   VVFLVRRYKSATAKLPPGNQGWPIIGETLAFALGSKSGNPTRFIKERMMKYSPDVFRTSL  78

Query  257  LGEKVAVFCGAAGNKffftnentllttWWPQSV  355
            +GEKVAVFCG AGNKF F+N N L+ TW P+S+
Sbjct  79   VGEKVAVFCGPAGNKFLFSNHNKLVATWKPRSM  111



>sp|I7C6E8.1|C7A52_PANGI RecName: Full=Beta-amyrin 28-oxidase; AltName: Full=Cytochrome 
P450 CYP716A52v2 [Panax ginseng]
 gb|AFO63032.1| cytochrome P450 CYP716A52v2 [Panax ginseng]
Length=481

 Score = 86.3 bits (212),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 49/79 (62%), Positives = 56/79 (71%), Gaps = 6/79 (8%)
 Frame = +2

Query  137  LPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSPEVFKTSILGEKVAVFCGAAGN  298
            LPPG TGWP+IGE+ + +       PEK+I DRM KYS  VFKTSI GE  AVFCGAA N
Sbjct  37   LPPGKTGWPIIGESYEFLSTGWKGYPEKFIFDRMTKYSSNVFKTSIFGEPAAVFCGAACN  96

Query  299  KffftnentllttWWPQSV  355
            KF F+NEN L+  WWP SV
Sbjct  97   KFLFSNENKLVQAWWPDSV  115



>ref|XP_009609682.1| PREDICTED: beta-amyrin 28-oxidase-like [Nicotiana tomentosiformis]
Length=480

 Score = 85.9 bits (211),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 62/95 (65%), Gaps = 9/95 (9%)
 Frame = +2

Query  98   IYFI-TKANTSK--PNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKT  250
            IYFI  K N+S     LPPG TGWP IGE+ + +       PEK+I DRM KYS  VFKT
Sbjct  20   IYFIFYKRNSSSLIGTLPPGKTGWPFIGESFEFLSTGWKGHPEKFIFDRMSKYSSSVFKT  79

Query  251  SILGEKVAVFCGAAGNKffftnentllttWWPQSV  355
             +LGEK AVFCG   NKF F+NEN L+  WWP SV
Sbjct  80   HLLGEKAAVFCGPTCNKFLFSNENKLVQAWWPDSV  114



>emb|CBI39268.3| unnamed protein product [Vitis vinifera]
Length=484

 Score = 85.9 bits (211),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 45/94 (48%), Positives = 68/94 (72%), Gaps = 7/94 (7%)
 Frame = +2

Query  95   IIYFIT-KANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTS  253
            I++ IT +  +S PNLPPG+ GWP+IGE ++  +      P ++++DRM KYSP+VFKTS
Sbjct  20   IVFLITYRHKSSYPNLPPGTMGWPIIGETLEFALSCQGGNPGRFLNDRMNKYSPQVFKTS  79

Query  254  ILGEKVAVFCGAAGNKffftnentllttWWPQSV  355
            +L   +AV CG +GNKF F+NE+ L+ +WW +S+
Sbjct  80   LLEANMAVMCGPSGNKFLFSNEDKLVVSWWQRSM  113



>ref|XP_006453162.1| hypothetical protein CICLE_v10010450mg [Citrus clementina]
 gb|ESR66402.1| hypothetical protein CICLE_v10010450mg [Citrus clementina]
Length=440

 Score = 85.5 bits (210),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 64/93 (69%), Gaps = 6/93 (6%)
 Frame = +2

Query  95   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  256
            II++   +N S+PN+PPGS G+P IGE+ + +        EK+I +RM KYS   FKTS+
Sbjct  22   IIFYNHNSNLSQPNVPPGSFGFPFIGESFEFLSYGWKGHTEKFIFNRMIKYSSHAFKTSL  81

Query  257  LGEKVAVFCGAAGNKffftnentllttWWPQSV  355
            LGE  AV CG AGN+F  +NEN L+T+WWP SV
Sbjct  82   LGEPTAVLCGPAGNRFLSSNENNLVTSWWPDSV  114



>ref|XP_003525322.1| PREDICTED: cytochrome P450 716B2-like [Glycine max]
Length=482

 Score = 85.9 bits (211),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 64/93 (69%), Gaps = 6/93 (6%)
 Frame = +2

Query  95   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  256
             +++  ++    PNLPPG+TG+PVIGE+++ +       PEK+I DRM +YS ++FKTSI
Sbjct  24   FLFYKHRSPFVAPNLPPGATGYPVIGESLEFLSTGWKGHPEKFIFDRMIRYSSQLFKTSI  83

Query  257  LGEKVAVFCGAAGNKffftnentllttWWPQSV  355
             GE   +FCGA  NKF F+NEN L+  WWP SV
Sbjct  84   FGEPAVIFCGATCNKFLFSNENKLVAAWWPNSV  116



>ref|XP_011001074.1| PREDICTED: beta-amyrin 28-oxidase-like [Populus euphratica]
Length=509

 Score = 85.9 bits (211),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 64/93 (69%), Gaps = 6/93 (6%)
 Frame = +2

Query  95   IIYFITKANTSKPNLPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSPEVFKTSI  256
            +++      +S    PPG TGWP+IGE  D +       PEK+++DRM KYS +VF TS+
Sbjct  46   LVFSAYSRKSSNAKFPPGKTGWPIIGETWDFVRAGRSGTPEKFVNDRMSKYSTDVFHTSL  105

Query  257  LGEKVAVFCGAAGNKffftnentllttWWPQSV  355
            LG+ +A+FCGA+GNKF F++EN  +TTWWP+ +
Sbjct  106  LGDNLAMFCGASGNKFLFSSENKYVTTWWPRPI  138



>ref|XP_011001073.1| PREDICTED: beta-amyrin 28-oxidase-like [Populus euphratica]
Length=509

 Score = 85.9 bits (211),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 64/93 (69%), Gaps = 6/93 (6%)
 Frame = +2

Query  95   IIYFITKANTSKPNLPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSPEVFKTSI  256
            +++      +S    PPG TGWP+IGE  D +       PEK+++DRM KYS +VF TS+
Sbjct  46   LVFSAYSRKSSNAKFPPGKTGWPIIGETWDFVRAGRSGTPEKFVNDRMSKYSTDVFHTSL  105

Query  257  LGEKVAVFCGAAGNKffftnentllttWWPQSV  355
            LG+ +A+FCGA+GNKF F++EN  +TTWWP+ +
Sbjct  106  LGDNLAMFCGASGNKFLFSSENKYVTTWWPRPI  138



>gb|EYU39276.1| hypothetical protein MIMGU_mgv1a023490mg, partial [Erythranthe 
guttata]
Length=380

 Score = 84.7 bits (208),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 61/86 (71%), Gaps = 6/86 (7%)
 Frame = +2

Query  116  ANTSKPNLPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSPEVFKTSILGEKVAV  277
            + T   NLPPGS GWP++GE ++ +       PEK++ +R  KY  +VFKT ++GE +AV
Sbjct  28   SRTKSLNLPPGSYGWPILGETLEFLRAGLDGTPEKFVKERSDKYKSQVFKTLLMGENMAV  87

Query  278  FCGAAGNKffftnentllttWWPQSV  355
            FCG++GNKF F+NEN L+T WWP SV
Sbjct  88   FCGSSGNKFLFSNENKLVTVWWPSSV  113



>emb|CBI39253.3| unnamed protein product [Vitis vinifera]
Length=459

 Score = 85.5 bits (210),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 66/93 (71%), Gaps = 6/93 (6%)
 Frame = +2

Query  95   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  256
            +I F+     S   LPPG  G P+IGE+I+  +      P+ +I+DRM +YSP+VF+TS+
Sbjct  20   LIIFVFLYKPSNTKLPPGKMGLPIIGESIEYGLAAARGNPQGFIADRMTQYSPDVFRTSL  79

Query  257  LGEKVAVFCGAAGNKffftnentllttWWPQSV  355
            +GE +AV CGAAGNKF F+NEN L+ +WWP+SV
Sbjct  80   MGENMAVMCGAAGNKFLFSNENKLVKSWWPRSV  112



>gb|KCW87056.1| hypothetical protein EUGRSUZ_B03598 [Eucalyptus grandis]
Length=485

 Score = 85.5 bits (210),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 43/87 (49%), Positives = 58/87 (67%), Gaps = 6/87 (7%)
 Frame = +2

Query  113  KANTSKPNLPPGSTGWPVIGENIDLMVPE------KYISDRMKKYSPEVFKTSILGEKVA  274
            K  TS+P+LPPGS GWPV+GE+++ +         K+I DRM ++   +FKTS+LGE + 
Sbjct  29   KTKTSRPDLPPGSLGWPVLGESLEFLQASRDGNLGKFIRDRMGEHGAPIFKTSLLGEPMV  88

Query  275  VFCGAAGNKffftnentllttWWPQSV  355
            V CG AGNKF F+NE   +  WWP SV
Sbjct  89   VLCGPAGNKFLFSNEGKKVALWWPSSV  115



>ref|XP_002278948.1| PREDICTED: beta-amyrin 28-oxidase [Vitis vinifera]
Length=483

 Score = 85.5 bits (210),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 66/93 (71%), Gaps = 6/93 (6%)
 Frame = +2

Query  95   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  256
            +I F+     S   LPPG  G P+IGE+I+  +      P+ +I+DRM +YSP+VF+TS+
Sbjct  20   LIIFVFLYKPSNTKLPPGKMGLPIIGESIEYGLAAARGNPQGFIADRMTQYSPDVFRTSL  79

Query  257  LGEKVAVFCGAAGNKffftnentllttWWPQSV  355
            +GE +AV CGAAGNKF F+NEN L+ +WWP+SV
Sbjct  80   MGENMAVMCGAAGNKFLFSNENKLVKSWWPRSV  112



>ref|XP_010044931.1| PREDICTED: beta-amyrin 28-oxidase-like [Eucalyptus grandis]
Length=509

 Score = 85.5 bits (210),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 43/87 (49%), Positives = 58/87 (67%), Gaps = 6/87 (7%)
 Frame = +2

Query  113  KANTSKPNLPPGSTGWPVIGENIDLMVPE------KYISDRMKKYSPEVFKTSILGEKVA  274
            K  TS+P+LPPGS GWPV+GE+++ +         K+I DRM ++   +FKTS+LGE + 
Sbjct  53   KTKTSRPDLPPGSLGWPVLGESLEFLQASRDGNLGKFIRDRMGEHGAPIFKTSLLGEPMV  112

Query  275  VFCGAAGNKffftnentllttWWPQSV  355
            V CG AGNKF F+NE   +  WWP SV
Sbjct  113  VLCGPAGNKFLFSNEGKKVALWWPSSV  139



>ref|XP_002309057.1| hypothetical protein POPTR_0006s08560g [Populus trichocarpa]
 gb|EEE92580.1| hypothetical protein POPTR_0006s08560g [Populus trichocarpa]
Length=484

 Score = 85.5 bits (210),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 50/91 (55%), Positives = 65/91 (71%), Gaps = 10/91 (11%)
 Frame = +2

Query  101  YFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSILG  262
            Y+++  N    NLPPG+TG P+IGE+++ +       PEK+I DRM K+S +VFKTS+  
Sbjct  31   YYLSSLN----NLPPGNTGLPLIGESLEFLTTGQKGQPEKFILDRMAKFSSKVFKTSLFC  86

Query  263  EKVAVFCGAAGNKffftnentllttWWPQSV  355
            E  AVFCGAAGNKF F+NEN L+T WWP SV
Sbjct  87   EPTAVFCGAAGNKFLFSNENKLVTAWWPDSV  117



>ref|XP_011019870.1| PREDICTED: beta-amyrin 28-oxidase-like [Populus euphratica]
Length=484

 Score = 85.5 bits (210),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 65/94 (69%), Gaps = 9/94 (10%)
 Frame = +2

Query  101  YFITKAN---TSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTS  253
            Y I K     +S  NLPPG+TG P+IGE+++ +       PEK+I DRM K+S +VFKTS
Sbjct  24   YLINKHRYSLSSLNNLPPGNTGLPLIGESLEFLTTGQKGQPEKFILDRMAKFSSKVFKTS  83

Query  254  ILGEKVAVFCGAAGNKffftnentllttWWPQSV  355
            +  E  AVFCGAAGNKF F+NEN L+T WWP SV
Sbjct  84   LFCEPTAVFCGAAGNKFLFSNENKLVTAWWPDSV  117



>gb|AJD25250.1| cytochrome P450 CYP716D25 [Salvia miltiorrhiza]
Length=477

 Score = 85.5 bits (210),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 62/90 (69%), Gaps = 6/90 (7%)
 Frame = +2

Query  104  FITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSILGE  265
            F   +     NLPPGS GWPV+GE  + +       PEK++ +RM+KY+ +VFKT I+GE
Sbjct  21   FTRSSRNGALNLPPGSYGWPVLGETAEFLRAGLDGKPEKFVRERMEKYNSQVFKTWIMGE  80

Query  266  KVAVFCGAAGNKffftnentllttWWPQSV  355
             +AV CGAAGNKF F+NEN L+T WWP SV
Sbjct  81   PMAVLCGAAGNKFLFSNENKLVTVWWPSSV  110



>ref|XP_010048515.1| PREDICTED: beta-amyrin 28-oxidase-like [Eucalyptus grandis]
 gb|KCW80784.1| hypothetical protein EUGRSUZ_C02161 [Eucalyptus grandis]
Length=480

 Score = 85.5 bits (210),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 65/96 (68%), Gaps = 9/96 (9%)
 Frame = +2

Query  95   IIYFITK---ANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFK  247
             +++IT    A+ +  NLPPG TG P IGE ++ +       PEK+I DR+ +YS EVFK
Sbjct  19   FLFYITYKHIAHFTGANLPPGKTGLPFIGETLEFLSSGWKGHPEKFIFDRIARYSSEVFK  78

Query  248  TSILGEKVAVFCGAAGNKffftnentllttWWPQSV  355
            TSIL E  AV CGAAGNKF F+NEN L+T WWP S+
Sbjct  79   TSILAEPTAVLCGAAGNKFLFSNENKLVTAWWPDSI  114



>emb|CBI39273.3| unnamed protein product [Vitis vinifera]
Length=933

 Score = 86.3 bits (212),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 66/93 (71%), Gaps = 6/93 (6%)
 Frame = +2

Query  95   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  256
            +++ + +  ++   LPPG+ GWP+IGE +   +      P ++I +RM KYSP+VF+TS+
Sbjct  19   VVFLVRRYKSATAKLPPGNQGWPIIGETLAFALGSKSGNPTRFIKERMMKYSPDVFRTSL  78

Query  257  LGEKVAVFCGAAGNKffftnentllttWWPQSV  355
            +GEKVAVFCG AGNKF F+N N L+ TW P+S+
Sbjct  79   VGEKVAVFCGPAGNKFLFSNHNKLVATWKPRSM  111


 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/79 (62%), Positives = 60/79 (76%), Gaps = 6/79 (8%)
 Frame = +2

Query  137  LPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSILGEKVAVFCGAAGN  298
            LPPG  GWP+IGE  +  +      PE++I+DRMKKYSP VF+TS+LGEKVAVFCG AGN
Sbjct  490  LPPGKLGWPIIGETSEFALGGKNSNPERFINDRMKKYSPIVFRTSLLGEKVAVFCGPAGN  549

Query  299  KffftnentllttWWPQSV  355
            KF F+N N L+TTW P S+
Sbjct  550  KFLFSNHNKLITTWKPPSM  568



>ref|XP_006372247.1| cytochrome P450 family protein [Populus trichocarpa]
 gb|ERP50044.1| cytochrome P450 family protein [Populus trichocarpa]
Length=481

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 63/93 (68%), Gaps = 6/93 (6%)
 Frame = +2

Query  95   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  256
            +I++  ++  S PNLPPG  G P++GE+ + +       PEK+I DR+ KYS  +FKT+I
Sbjct  23   LIFYNHRSQNSHPNLPPGKLGLPLVGESFEFLATGWKGHPEKFIFDRIAKYSSHIFKTNI  82

Query  257  LGEKVAVFCGAAGNKffftnentllttWWPQSV  355
            LG+   VFCG A NKF F+NEN L+ +WWP SV
Sbjct  83   LGQPAVVFCGVACNKFLFSNENKLVVSWWPDSV  115



>emb|CAN63680.1| hypothetical protein VITISV_036273 [Vitis vinifera]
Length=467

 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 64/93 (69%), Gaps = 6/93 (6%)
 Frame = +2

Query  95   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  256
            II+      +S   LPPG  GWP+IGE +   +      PE++I+DRM KYSPEVF+ S+
Sbjct  21   IIFLAYHHKSSNSKLPPGRKGWPIIGETMQFALAAQRGNPERFINDRMNKYSPEVFRISL  80

Query  257  LGEKVAVFCGAAGNKffftnentllttWWPQSV  355
            + E +AV CGA GNKFFF+NEN L+T+WW +S+
Sbjct  81   MEENMAVMCGAPGNKFFFSNENKLVTSWWHRSM  113



>ref|XP_011459801.1| PREDICTED: beta-amyrin 28-oxidase-like [Fragaria vesca subsp. 
vesca]
Length=209

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 56/91 (62%), Gaps = 7/91 (8%)
 Frame = +2

Query  104  FITKANTSKP-----NLPPGSTGWPVIGENIDLMVPE--KYISDRMKKYSPEVFKTSILG  262
            F+ +A  SK      NLPPGS GWP+IGE    +  +  K++ DRMKKYS ++FKT ILG
Sbjct  23   FLVRAYKSKLHEQSINLPPGSFGWPIIGETFAFLQSDHNKFVGDRMKKYSSKIFKTKILG  82

Query  263  EKVAVFCGAAGNKffftnentllttWWPQSV  355
            E+  V CG AG+KF   NE  L   W P S+
Sbjct  83   ERTVVLCGTAGHKFVAANEEKLFVAWRPHSM  113



>emb|CBI39267.3| unnamed protein product [Vitis vinifera]
Length=483

 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 64/93 (69%), Gaps = 6/93 (6%)
 Frame = +2

Query  95   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  256
            II+      +S   LPPG  GWP+IGE +   +      PE++I+DRM KYSPEVF+ S+
Sbjct  54   IIFLAYHHKSSNSKLPPGRKGWPIIGETMQFALAAQRGNPERFINDRMNKYSPEVFRISL  113

Query  257  LGEKVAVFCGAAGNKffftnentllttWWPQSV  355
            + E +AV CGA GNKFFF+NEN L+T+WW +S+
Sbjct  114  MEENMAVMCGAPGNKFFFSNENKLVTSWWHRSM  146



>ref|XP_006340080.1| PREDICTED: cytochrome P450 716B2-like isoform X2 [Solanum tuberosum]
Length=480

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/91 (51%), Positives = 57/91 (63%), Gaps = 6/91 (7%)
 Frame = +2

Query  101  YFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSILG  262
            + + K   S  NLPPG  GWP+IGE ++ +        EK++ DRM KY  EVFKTSI+G
Sbjct  19   HLLKKRRKSSSNLPPGRYGWPLIGETLEFLRLNREGKSEKFVQDRMDKYESEVFKTSIMG  78

Query  263  EKVAVFCGAAGNKffftnentllttWWPQSV  355
             K+ V CG A NKF F N N L+T WWP SV
Sbjct  79   AKMVVLCGPAANKFLFGNHNKLVTAWWPTSV  109



>ref|XP_006340079.1| PREDICTED: cytochrome P450 716B2-like isoform X1 [Solanum tuberosum]
Length=481

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/91 (51%), Positives = 57/91 (63%), Gaps = 6/91 (7%)
 Frame = +2

Query  101  YFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSILG  262
            + + K   S  NLPPG  GWP+IGE ++ +        EK++ DRM KY  EVFKTSI+G
Sbjct  19   HLLKKRRKSSSNLPPGRYGWPLIGETLEFLRLNREGKSEKFVQDRMDKYESEVFKTSIMG  78

Query  263  EKVAVFCGAAGNKffftnentllttWWPQSV  355
             K+ V CG A NKF F N N L+T WWP SV
Sbjct  79   AKMVVLCGPAANKFLFGNHNKLVTAWWPTSV  109



>ref|XP_002319920.2| hypothetical protein POPTR_0013s11090g [Populus trichocarpa]
 gb|EEE95843.2| hypothetical protein POPTR_0013s11090g [Populus trichocarpa]
Length=500

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 64/95 (67%), Gaps = 9/95 (9%)
 Frame = +2

Query  98   IYFITKA---NTSKPNLPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSPEVFKT  250
            +Y +  A    +S    PPG TGWP+IGE  D +       PEK+++DRM KYS +VF T
Sbjct  35   LYLVVSAYRRKSSNAKFPPGKTGWPIIGETWDFVRAGRSGTPEKFVNDRMSKYSTDVFHT  94

Query  251  SILGEKVAVFCGAAGNKffftnentllttWWPQSV  355
            S+LG+ +A+FCG +GNKF F++EN  +TTWWP+ +
Sbjct  95   SLLGDNLAMFCGVSGNKFLFSSENKYVTTWWPRPI  129



>ref|XP_002279472.1| PREDICTED: beta-amyrin 28-oxidase [Vitis vinifera]
Length=483

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 64/93 (69%), Gaps = 6/93 (6%)
 Frame = +2

Query  95   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  256
            II+      +S   LPPG  GWP+IGE +   +      PE++I+DRM KYSPEVF+ S+
Sbjct  21   IIFLAYHHKSSNSKLPPGRKGWPIIGETMQFALAAQRGNPERFINDRMNKYSPEVFRISL  80

Query  257  LGEKVAVFCGAAGNKffftnentllttWWPQSV  355
            + E +AV CGA GNKFFF+NEN L+T+WW +S+
Sbjct  81   MEENMAVMCGAPGNKFFFSNENKLVTSWWHRSM  113



>ref|XP_004239296.1| PREDICTED: beta-amyrin 28-oxidase [Solanum lycopersicum]
Length=476

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/83 (57%), Positives = 58/83 (70%), Gaps = 6/83 (7%)
 Frame = +2

Query  125  SKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSILGEKVAVFCG  286
            S   LPPG TGWPV GE+++ +       PEK+I DR+ KYS  VFKT +LGE+ AVFCG
Sbjct  26   SGEGLPPGKTGWPVFGESLEFLSSGWKGHPEKFIFDRVAKYSSSVFKTHLLGEEAAVFCG  85

Query  287  AAGNKffftnentllttWWPQSV  355
            A+ NKF F+NEN L+  WWP SV
Sbjct  86   ASANKFLFSNENKLVQAWWPNSV  108



>ref|XP_002317072.2| hypothetical protein POPTR_0011s15910g [Populus trichocarpa]
 gb|EEE97684.2| hypothetical protein POPTR_0011s15910g [Populus trichocarpa]
Length=482

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 37/70 (53%), Positives = 50/70 (71%), Gaps = 2/70 (3%)
 Frame = +2

Query  98   IYFITKANTSKPNLPPGSTGWPVIGENIDLMV--PEKYISDRMKKYSPEVFKTSILGEKV  271
            I+    ++ S  NLPPGS GWP+ GE +D +   PEK++SDRMK+YS ++FKT ILGE+ 
Sbjct  21   IFAFKHSSHSAKNLPPGSLGWPIFGETLDFLFGKPEKFVSDRMKRYSSDIFKTKILGEET  80

Query  272  AVFCGAAGNK  301
            AV CG  G+K
Sbjct  81   AVICGPGGHK  90



>gb|AED99868.1| cytochrome P450 [Panax notoginseng]
Length=481

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/79 (61%), Positives = 55/79 (70%), Gaps = 6/79 (8%)
 Frame = +2

Query  137  LPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSPEVFKTSILGEKVAVFCGAAGN  298
            LPPG TGWP+IGE+ + +       PEK+I DRM KYS  VFKTSI GE  AVFCGA  N
Sbjct  37   LPPGKTGWPIIGESYEFLSTGWKGYPEKFIFDRMTKYSSNVFKTSIFGEPAAVFCGAXCN  96

Query  299  KffftnentllttWWPQSV  355
            KF F+NEN L+  WWP SV
Sbjct  97   KFLFSNENKLVQAWWPDSV  115



>ref|XP_007213798.1| hypothetical protein PRUPE_ppa004984m2g, partial [Prunus persica]
 gb|EMJ14997.1| hypothetical protein PRUPE_ppa004984m2g, partial [Prunus persica]
Length=384

 Score = 83.2 bits (204),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/89 (52%), Positives = 61/89 (69%), Gaps = 3/89 (3%)
 Frame = +2

Query  95   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV--PEKYISDRMKKYSPEVFKTSILGEK  268
            I  F  K++  K NLPPGS GWP++GE ++ +   PE ++S RMK+YSPE+FKT ILGEK
Sbjct  19   IFAFKGKSDDGK-NLPPGSMGWPIVGETLEFLFGKPEIFVSKRMKRYSPEIFKTKILGEK  77

Query  269  VAVFCGAAGNKffftnentllttWWPQSV  355
             AV CG  G+KF F+NE    T + P S+
Sbjct  78   TAVICGPNGHKFLFSNEQKYFTAFRPHSM  106



>ref|XP_009759030.1| PREDICTED: beta-amyrin 28-oxidase-like [Nicotiana sylvestris]
Length=480

 Score = 84.0 bits (206),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 59/93 (63%), Gaps = 6/93 (6%)
 Frame = +2

Query  95   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  256
             I++   + +    LPPG TGWP IGE+ + +       PEK++ DRM KYS  VFKT +
Sbjct  22   FIFYKRNSGSLTGTLPPGKTGWPFIGESFEFLSTGWKGHPEKFVFDRMTKYSSSVFKTHL  81

Query  257  LGEKVAVFCGAAGNKffftnentllttWWPQSV  355
            LGEK AVFCG   NKF F+NEN L+  WWP SV
Sbjct  82   LGEKAAVFCGPTCNKFLFSNENKLVQAWWPDSV  114



>ref|XP_009787233.1| PREDICTED: beta-amyrin 28-oxidase-like [Nicotiana sylvestris]
Length=482

 Score = 84.0 bits (206),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 60/88 (68%), Gaps = 6/88 (7%)
 Frame = +2

Query  110  TKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSILGEKV  271
             K+  S   LPPG++GW VIGE+++ +       PE +I DR+ KYS  VFKT + GEK 
Sbjct  29   NKSTFSGGQLPPGNSGWAVIGESLEFLSTGWKGHPENFIFDRISKYSSNVFKTHLFGEKA  88

Query  272  AVFCGAAGNKffftnentllttWWPQSV  355
            AVFCGA+GNKF F+NEN L+  WWP SV
Sbjct  89   AVFCGASGNKFLFSNENKLVQAWWPSSV  116



>gb|AEX07772.1| cytochrome P450 [Catharanthus roseus]
 gb|AEX07773.1| cytochrome P450 [Catharanthus roseus]
Length=480

 Score = 84.0 bits (206),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 62/93 (67%), Gaps = 7/93 (8%)
 Frame = +2

Query  95   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  256
             +++  K+    P LPPG TGWP++GE++  +       PEK+I DRM KYS  VF++ +
Sbjct  22   FLFYKNKSTLPGP-LPPGRTGWPMVGESLQFLSAGWKGHPEKFIFDRMAKYSSNVFRSHL  80

Query  257  LGEKVAVFCGAAGNKffftnentllttWWPQSV  355
            LGE  AVFCGA GNKF F+NEN L+  WWP SV
Sbjct  81   LGEPAAVFCGAIGNKFLFSNENKLVQAWWPDSV  113



>ref|XP_011096738.1| PREDICTED: beta-amyrin 28-oxidase-like [Sesamum indicum]
Length=475

 Score = 83.6 bits (205),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 49/65 (75%), Gaps = 2/65 (3%)
 Frame = +2

Query  113  KANTSKPNLPPGSTGWPVIGENIDLMV--PEKYISDRMKKYSPEVFKTSILGEKVAVFCG  286
            + N +   LPPGS GWP++GE+++ +   PEK++ DRMKKYSP++FKT ILGEK AV CG
Sbjct  23   RRNNAGAKLPPGSFGWPILGESVEFLFGKPEKFVGDRMKKYSPDIFKTKILGEKTAVICG  82

Query  287  AAGNK  301
              G+K
Sbjct  83   PNGHK  87



>ref|XP_011040561.1| PREDICTED: beta-amyrin 28-oxidase-like [Populus euphratica]
Length=482

 Score = 83.6 bits (205),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 37/70 (53%), Positives = 50/70 (71%), Gaps = 2/70 (3%)
 Frame = +2

Query  98   IYFITKANTSKPNLPPGSTGWPVIGENIDLMV--PEKYISDRMKKYSPEVFKTSILGEKV  271
            I+    ++ S  NLPPGS GWP+ GE +D +   PEK++SDRMK+YS ++FKT ILGE+ 
Sbjct  21   IFAFKHSSHSAKNLPPGSLGWPIFGETLDFLFGKPEKFVSDRMKRYSSDIFKTKILGEET  80

Query  272  AVFCGAAGNK  301
            AV CG  G+K
Sbjct  81   AVICGPRGHK  90



>ref|XP_006353795.1| PREDICTED: cytochrome P450 716B2-like [Solanum tuberosum]
Length=486

 Score = 83.6 bits (205),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 59/91 (65%), Gaps = 6/91 (7%)
 Frame = +2

Query  101  YFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSILG  262
            YF   ++     LPPG TGWP IGE ++ +       PEK+I DRM KYS  VF+T +L 
Sbjct  24   YFNKNSSVLPGTLPPGKTGWPFIGETLEFLSTGWKGHPEKFIFDRMSKYSSSVFRTHLLL  83

Query  263  EKVAVFCGAAGNKffftnentllttWWPQSV  355
            E  AVFCGA+GNKF F+NEN L+  WWP S+
Sbjct  84   ENSAVFCGASGNKFLFSNENKLVQVWWPDSI  114



>gb|KCW78587.1| hypothetical protein EUGRSUZ_C00059 [Eucalyptus grandis]
Length=449

 Score = 83.2 bits (204),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 49/80 (61%), Positives = 54/80 (68%), Gaps = 6/80 (8%)
 Frame = +2

Query  134  NLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSILGEKVAVFCGAAG  295
            NLPPG  G P IGE +  +       PEK+I DRM  YSP VFKTSIL E  AVFCGA G
Sbjct  37   NLPPGRFGLPFIGETLHFLRSGWNGHPEKFIFDRMSAYSPRVFKTSILAEPTAVFCGAPG  96

Query  296  NKffftnentllttWWPQSV  355
            NKF F+NEN L+T WWP SV
Sbjct  97   NKFLFSNENKLVTAWWPDSV  116



>ref|XP_004503562.1| PREDICTED: cytochrome P450 716B2-like [Cicer arietinum]
Length=478

 Score = 83.6 bits (205),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 50/91 (55%), Positives = 64/91 (70%), Gaps = 6/91 (7%)
 Frame = +2

Query  101  YFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSILG  262
            +F+   + S  NLPPG  G+PVIGE+++ +       PEK+I DRM KYS E+FKTSILG
Sbjct  22   FFLFYKHKSPWNLPPGKMGYPVIGESLEFLSTGWKGHPEKFIFDRMIKYSSELFKTSILG  81

Query  263  EKVAVFCGAAGNKffftnentllttWWPQSV  355
            +   V CGAA NKF F+NEN L+T WWP+SV
Sbjct  82   QPTVVCCGAACNKFLFSNENKLVTVWWPESV  112



>gb|KDP33425.1| hypothetical protein JCGZ_06996 [Jatropha curcas]
Length=473

 Score = 83.6 bits (205),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 69/100 (69%), Gaps = 15/100 (15%)
 Frame = +2

Query  95   IIYFITK-------ANTSKPNLPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSP  235
            +IYF+ +       A TS P  PPGSTGWP+IGE ++ +      +PEK+I+DR  KYS 
Sbjct  20   VIYFLRQKPRKNGEARTSPP--PPGSTGWPLIGETMEYLSTTREGIPEKFINDRRNKYSS  77

Query  236  EVFKTSILGEKVAVFCGAAGNKffftnentllttWWPQSV  355
            ++FKTS+LG+ + + C A GNKF F+NEN L+++WWP SV
Sbjct  78   KLFKTSLLGQPMVLLCNAEGNKFVFSNENRLVSSWWPSSV  117



>gb|KDO54465.1| hypothetical protein CISIN_1g013728mg [Citrus sinensis]
Length=437

 Score = 83.2 bits (204),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 57/81 (70%), Gaps = 6/81 (7%)
 Frame = +2

Query  131  PNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSILGEKVAVFCGAA  292
            P+LPPG+ GWPVIGE +  +       PE++I +RM+KY   VFKT +LGE + VFCG A
Sbjct  36   PHLPPGNLGWPVIGETLGFIRAGFEGKPERFIRERMEKYDSRVFKTCLLGEDMIVFCGTA  95

Query  293  GNKffftnentllttWWPQSV  355
            G+K  F+NEN L+ TWWP SV
Sbjct  96   GHKLLFSNENKLVRTWWPSSV  116



>ref|XP_006445580.1| hypothetical protein CICLE_v10015070mg [Citrus clementina]
 gb|ESR58820.1| hypothetical protein CICLE_v10015070mg [Citrus clementina]
Length=484

 Score = 83.6 bits (205),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 57/81 (70%), Gaps = 6/81 (7%)
 Frame = +2

Query  131  PNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSILGEKVAVFCGAA  292
            P+LPPG+ GWPVIGE +  +       PE++I +RM+KY   VFKT +LGE + VFCG A
Sbjct  39   PHLPPGNLGWPVIGETLGFIRAGFEGKPERFIRERMEKYDSRVFKTCLLGEDMIVFCGTA  98

Query  293  GNKffftnentllttWWPQSV  355
            G+K  F+NEN L+ TWWP SV
Sbjct  99   GHKLLFSNENKLVRTWWPSSV  119



>ref|XP_011089169.1| PREDICTED: beta-amyrin 28-oxidase-like [Sesamum indicum]
Length=479

 Score = 83.6 bits (205),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 59/80 (74%), Gaps = 6/80 (8%)
 Frame = +2

Query  134  NLPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSPEVFKTSILGEKVAVFCGAAG  295
            NLPPGS GWP++GE ++ +       PEK+I +R +KY  +VFKTS++GE + + CGAAG
Sbjct  33   NLPPGSYGWPILGETVEFLRAGLEGTPEKFIKERSEKYKSQVFKTSLMGEPMVMLCGAAG  92

Query  296  NKffftnentllttWWPQSV  355
            NKF F+NEN L+T WWP SV
Sbjct  93   NKFLFSNENKLVTVWWPSSV  112



>ref|XP_006488945.1| PREDICTED: cytochrome P450 716B2-like [Citrus sinensis]
Length=500

 Score = 83.6 bits (205),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 57/81 (70%), Gaps = 6/81 (7%)
 Frame = +2

Query  131  PNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSILGEKVAVFCGAA  292
            P+LPPG+ GWPVIGE +  +       PE++I +RM+KY   VFKT +LGE + VFCG A
Sbjct  55   PHLPPGNLGWPVIGETLGFIRAGFEGKPERFIRERMEKYDSRVFKTCLLGEDMIVFCGTA  114

Query  293  GNKffftnentllttWWPQSV  355
            G+K  F+NEN L+ TWWP SV
Sbjct  115  GHKLLFSNENKLVRTWWPSSV  135



>emb|CDP19706.1| unnamed protein product [Coffea canephora]
Length=458

 Score = 83.2 bits (204),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 59/87 (68%), Gaps = 2/87 (2%)
 Frame = +2

Query  101  YFITKANTSKPNLPPGSTGWPVIGENIDLMV--PEKYISDRMKKYSPEVFKTSILGEKVA  274
            +   ++ + K  LPPGS+G+P++GE +  ++  PEK+I  RM+KYS EVF TS++G+ +A
Sbjct  22   FLCHRSKSKKSKLPPGSSGFPLVGETLHFLMSGPEKFIHQRMEKYSDEVFATSLMGQNLA  81

Query  275  VFCGAAGNKffftnentllttWWPQSV  355
            V CGAAGNKF     N  ++ W P S+
Sbjct  82   VICGAAGNKFLLCTANDFVSPWLPDSL  108



>gb|AHF22088.1| CYP716A75 [Maesa lanceolata]
Length=487

 Score = 83.2 bits (204),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 62/88 (70%), Gaps = 6/88 (7%)
 Frame = +2

Query  110  TKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSILGEKV  271
            T+AN +  NLPPG TGWPV+GE+   +       PEK+I DR+ KYS  V+KT+++ E+ 
Sbjct  34   TEANKNSANLPPGLTGWPVVGESFQFLAAGWRGNPEKFIFDRIAKYSSYVYKTNLMLERT  93

Query  272  AVFCGAAGNKffftnentllttWWPQSV  355
            AVFCGA  +KF F+NEN L+ +WWP SV
Sbjct  94   AVFCGAPAHKFLFSNENKLVQSWWPSSV  121



>emb|CDP12479.1| unnamed protein product [Coffea canephora]
Length=474

 Score = 83.2 bits (204),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 48/91 (53%), Positives = 59/91 (65%), Gaps = 6/91 (7%)
 Frame = +2

Query  98   IYFITKANTSKPNLPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSPEVFKTSIL  259
            + F  K   SK  LPPG TGWP++GE ++         PEK+  DRM KYS EVFKTS+L
Sbjct  25   LSFKLKEPISKLQLPPGKTGWPIVGETLEFAAMGRNGTPEKFFKDRMSKYSQEVFKTSLL  84

Query  260  GEKVAVFCGAAGNKffftnentllttWWPQS  352
             E++AVFCG A NKF F+NEN L+   WP S
Sbjct  85   CEQIAVFCGPAANKFVFSNENKLVALSWPSS  115



>ref|XP_002325975.1| hypothetical protein POPTR_0019s10970g [Populus trichocarpa]
 gb|EEF00357.1| hypothetical protein POPTR_0019s10970g [Populus trichocarpa]
Length=478

 Score = 83.2 bits (204),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 61/93 (66%), Gaps = 6/93 (6%)
 Frame = +2

Query  95   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  256
            +I  + K        PPG TGWP+IGE  D M+      PEK+I+DR+ K+SPEVF+TS+
Sbjct  20   LIVLLHKRKFWNSKFPPGKTGWPIIGETWDFMMAARCGTPEKFINDRVGKFSPEVFQTSL  79

Query  257  LGEKVAVFCGAAGNKffftnentllttWWPQSV  355
            LG  +AVFCG+ GNKF +++EN  +T W P  +
Sbjct  80   LGHNMAVFCGSGGNKFLYSSENKCVTGWLPHPI  112



>ref|XP_011048168.1| PREDICTED: beta-amyrin 28-oxidase-like [Populus euphratica]
Length=497

 Score = 83.2 bits (204),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 48/95 (51%), Positives = 63/95 (66%), Gaps = 8/95 (8%)
 Frame = +2

Query  95   IIYFITKANTSK----PNLPPGSTGWPVIGENIDLMV----PEKYISDRMKKYSPEVFKT  250
            ++YF+ K    +    P+LPPGS GWP++GE +  +     PE +++ RMKKY   VFKT
Sbjct  35   LLYFVIKTLKERLFPNPHLPPGSLGWPLVGETLQFLPINLPPEIFVNYRMKKYDSPVFKT  94

Query  251  SILGEKVAVFCGAAGNKffftnentllttWWPQSV  355
            S+ GE VAVF G AGNKF F+NEN L+  WWP SV
Sbjct  95   SLFGETVAVFVGPAGNKFLFSNENKLVNVWWPTSV  129



>ref|XP_004296643.1| PREDICTED: beta-amyrin 28-oxidase-like [Fragaria vesca subsp. 
vesca]
Length=485

 Score = 83.2 bits (204),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 63/93 (68%), Gaps = 6/93 (6%)
 Frame = +2

Query  95   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  256
             +++  ++  +  NLPPG  G+PVIGE+ + +       PEK+I DRM K+S EVFKTS+
Sbjct  23   FLFYRHRSQFTGNNLPPGKVGYPVIGESYEFLSTGWKGHPEKFIFDRMNKFSSEVFKTSL  82

Query  257  LGEKVAVFCGAAGNKffftnentllttWWPQSV  355
             GEK  +F GAA NKF F+NEN L+T WWP SV
Sbjct  83   FGEKACIFAGAACNKFLFSNENKLVTAWWPSSV  115



>ref|XP_010245748.1| PREDICTED: beta-amyrin 28-oxidase-like [Nelumbo nucifera]
Length=484

 Score = 83.2 bits (204),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 62/92 (67%), Gaps = 6/92 (7%)
 Frame = +2

Query  98   IYFITKANTSKPNLPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSPEVFKTSIL  259
            + +  K+N S   LPPG  G P +GE+I  +       PEK++ DRM K+S EVF+TS+ 
Sbjct  28   LVYKRKSNPSGGKLPPGKMGLPFVGESIQFLSLGRKGTPEKFMYDRMAKFSKEVFRTSLF  87

Query  260  GEKVAVFCGAAGNKffftnentllttWWPQSV  355
            GE  AVFCG +GNKF F+NEN L+T WWP+SV
Sbjct  88   GENTAVFCGPSGNKFLFSNENKLVTAWWPRSV  119



>ref|XP_003532790.1| PREDICTED: cytochrome P450 716B2-like [Glycine max]
Length=481

 Score = 83.2 bits (204),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 46/96 (48%), Positives = 58/96 (60%), Gaps = 10/96 (10%)
 Frame = +2

Query  98   IYFITK----ANTSKPNLPPGSTGWPVIGENIDLMVPE------KYISDRMKKYSPEVFK  247
            +YFITK          NLPPG  GWP++GE  D M         ++I +R++KY   VFK
Sbjct  20   LYFITKVVRLGKHPNLNLPPGRLGWPIVGETFDFMRTMNEGNVLRFIQERVEKYDARVFK  79

Query  248  TSILGEKVAVFCGAAGNKffftnentllttWWPQSV  355
            TS+ G+ V VFCG AGNKF F+NEN  +  WWP SV
Sbjct  80   TSMFGDPVVVFCGPAGNKFLFSNENKNVQVWWPSSV  115



>emb|CBI16553.3| unnamed protein product [Vitis vinifera]
Length=262

 Score = 80.9 bits (198),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 61/94 (65%), Gaps = 8/94 (9%)
 Frame = +2

Query  98   IYFITKANTSK--PNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTS  253
            ++FI K   +    NLPPGS GWP IGE +  +       P+++I +RM KY   VFKTS
Sbjct  16   LHFIAKILKAGKFSNLPPGSLGWPRIGETLVFLRSGEDGEPQRFIRERMDKYDSGVFKTS  75

Query  254  ILGEKVAVFCGAAGNKffftnentllttWWPQSV  355
            +LGE + VFCG AGNKF F NEN L++ WWP SV
Sbjct  76   LLGEPMMVFCGPAGNKFLFGNENKLVSVWWPSSV  109



>dbj|BAP59949.1| cytochrome P450 monooxygenase CYP716A48 [Olea europaea]
Length=479

 Score = 82.8 bits (203),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 62/94 (66%), Gaps = 8/94 (9%)
 Frame = +2

Query  98   IYFITKANTSK--PNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTS  253
            ++F+   N S     +PPG TGWPVIGE+++ +       PEK+I DR+ KYS  VF+T 
Sbjct  20   LHFLFYKNKSSFSGQIPPGKTGWPVIGESLEFLSNGWKGHPEKFIFDRIAKYSSYVFRTH  79

Query  254  ILGEKVAVFCGAAGNKffftnentllttWWPQSV  355
            + GE  AVFCGA GNKF F+NEN L+  WWP SV
Sbjct  80   LFGEPAAVFCGANGNKFLFSNENKLVQAWWPASV  113



>emb|CAN77161.1| hypothetical protein VITISV_020236 [Vitis vinifera]
Length=462

 Score = 82.8 bits (203),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 59/80 (74%), Gaps = 6/80 (8%)
 Frame = +2

Query  134  NLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSILGEKVAVFCGAAG  295
            NLP G+TG P IGE+I  +       PEK+IS+RM K+S +VFKTS+ GE  AVFCG+AG
Sbjct  37   NLPSGNTGLPYIGESIQFLSNGRKGHPEKFISERMLKFSSKVFKTSLFGETAAVFCGSAG  96

Query  296  NKffftnentllttWWPQSV  355
            NKF F+NEN L+T WWP SV
Sbjct  97   NKFLFSNENKLVTAWWPSSV  116



>ref|XP_010046875.1| PREDICTED: beta-amyrin 28-oxidase-like [Eucalyptus grandis]
 gb|KCW78586.1| hypothetical protein EUGRSUZ_C00059 [Eucalyptus grandis]
Length=482

 Score = 82.8 bits (203),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 54/80 (68%), Gaps = 6/80 (8%)
 Frame = +2

Query  134  NLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSILGEKVAVFCGAAG  295
            NLPPG  G P IGE +  +       PEK+I DRM  YSP VFKTSIL E  AVFCGA G
Sbjct  37   NLPPGRFGLPFIGETLHFLRSGWNGHPEKFIFDRMSAYSPRVFKTSILAEPTAVFCGAPG  96

Query  296  NKffftnentllttWWPQSV  355
            NKF F+NEN L+T WWP SV
Sbjct  97   NKFLFSNENKLVTAWWPDSV  116



>emb|CAN71865.1| hypothetical protein VITISV_033123 [Vitis vinifera]
Length=448

 Score = 82.4 bits (202),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 57/89 (64%), Gaps = 2/89 (2%)
 Frame = +2

Query  95   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV--PEKYISDRMKKYSPEVFKTSILGEK  268
            I  F  K+      LPPGS GWP++GE ++ +   PE ++ DRMKKYSP++FKT ILGEK
Sbjct  21   IFAFTRKSGDDDKKLPPGSLGWPIMGETLEFLFGKPENFVFDRMKKYSPDIFKTKILGEK  80

Query  269  VAVFCGAAGNKffftnentllttWWPQSV  355
              V CG  G+KF F+NE    T + P S+
Sbjct  81   TVVICGPEGHKFLFSNEAKYFTAFRPHSM  109



>emb|CAN75788.1| hypothetical protein VITISV_041016 [Vitis vinifera]
Length=393

 Score = 81.6 bits (200),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 45/80 (56%), Positives = 55/80 (69%), Gaps = 6/80 (8%)
 Frame = +2

Query  134  NLPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSPEVFKTSILGEKVAVFCGAAG  295
            NLPPGS GWP IGE +  +       P+++I +RM KY   VFKTS+LGE + VFCG AG
Sbjct  30   NLPPGSLGWPRIGETLVFLRSGEDGEPQRFIRERMDKYDSGVFKTSLLGEPMMVFCGPAG  89

Query  296  NKffftnentllttWWPQSV  355
            NKF F NEN L++ WWP SV
Sbjct  90   NKFLFGNENKLVSVWWPSSV  109



>ref|XP_011017588.1| PREDICTED: beta-amyrin 28-oxidase-like [Populus euphratica]
Length=481

 Score = 82.4 bits (202),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 62/93 (67%), Gaps = 6/93 (6%)
 Frame = +2

Query  95   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  256
            +I++  ++  S P LPPG  G P++GE+ + +       PEK+I DR+ +YS  VFKT+I
Sbjct  23   LIFYNHRSQNSHPKLPPGKLGLPLVGESFEFLATGWKGHPEKFIFDRIARYSSHVFKTNI  82

Query  257  LGEKVAVFCGAAGNKffftnentllttWWPQSV  355
            LG+   VFCG A NKF F+NEN L+ +WWP SV
Sbjct  83   LGQPAVVFCGVACNKFLFSNENKLVVSWWPDSV  115



>ref|XP_008225708.1| PREDICTED: beta-amyrin 28-oxidase-like isoform X1 [Prunus mume]
Length=482

 Score = 82.4 bits (202),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 61/89 (69%), Gaps = 3/89 (3%)
 Frame = +2

Query  95   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV--PEKYISDRMKKYSPEVFKTSILGEK  268
            I  F  K++  K NLPPGS GWP++GE ++ +   PE ++S RM++YSPE+FKT ILGEK
Sbjct  19   IFAFKGKSDDGK-NLPPGSMGWPIVGETLEFLFGKPEIFVSKRMRRYSPEIFKTKILGEK  77

Query  269  VAVFCGAAGNKffftnentllttWWPQSV  355
             AV CG  G+KF F+NE    T + P S+
Sbjct  78   TAVICGPKGHKFLFSNEQKYFTAFRPHSM  106



>ref|XP_006353745.1| PREDICTED: cytochrome P450 716B2-like [Solanum tuberosum]
Length=481

 Score = 82.4 bits (202),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 57/79 (72%), Gaps = 6/79 (8%)
 Frame = +2

Query  137  LPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSILGEKVAVFCGAAGN  298
            LPPG +GWPVIGE+++ +       PEK+I DR+ KYS  +FKT +LGEK  VFCGA+ N
Sbjct  36   LPPGKSGWPVIGESLEFLSTGWKGHPEKFIFDRIFKYSSNIFKTHLLGEKAIVFCGASSN  95

Query  299  KffftnentllttWWPQSV  355
            KF F+NEN L+  WWP SV
Sbjct  96   KFLFSNENKLVQAWWPSSV  114



>ref|XP_008358589.1| PREDICTED: beta-amyrin 28-oxidase-like isoform X1 [Malus domestica]
Length=480

 Score = 82.4 bits (202),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 62/89 (70%), Gaps = 3/89 (3%)
 Frame = +2

Query  95   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV--PEKYISDRMKKYSPEVFKTSILGEK  268
            I  F  K++  K NLPPGS GWP++GE+I+ +   PE ++  RM++YSPE+FKT ILGEK
Sbjct  19   IFAFKGKSDDGK-NLPPGSMGWPIVGESIEFLFGKPENFVFKRMRRYSPEIFKTYILGEK  77

Query  269  VAVFCGAAGNKffftnentllttWWPQSV  355
             AV CG +G+KF F+NE    T + P S+
Sbjct  78   TAVICGPSGHKFLFSNEQKYFTAFRPHSM  106



>ref|XP_010098502.1| Cytochrome P450 [Morus notabilis]
 gb|EXB75162.1| Cytochrome P450 [Morus notabilis]
Length=479

 Score = 82.4 bits (202),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 63/89 (71%), Gaps = 2/89 (2%)
 Frame = +2

Query  95   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV--PEKYISDRMKKYSPEVFKTSILGEK  268
            +I+  TK++ +   LPPGS GWP+IGE I+ +   PE ++  RM KYSP++FKT+ILGEK
Sbjct  20   LIFKSTKSSENSKTLPPGSMGWPIIGETIEFLFGKPENFVFKRMNKYSPDIFKTNILGEK  79

Query  269  VAVFCGAAGNKffftnentllttWWPQSV  355
             AV CG  G+KF F+NE   LT + P+S+
Sbjct  80   TAVICGPNGHKFLFSNEQKYLTAFRPRSM  108



>emb|CBI20810.3| unnamed protein product [Vitis vinifera]
Length=420

 Score = 82.0 bits (201),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 59/80 (74%), Gaps = 6/80 (8%)
 Frame = +2

Query  134  NLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSILGEKVAVFCGAAG  295
            NLP G+TG P IGE+I  +       PEK+IS+RM K+S +VFKTS+ GE  AVFCG+AG
Sbjct  37   NLPSGNTGLPYIGESIQFLSNGRKGHPEKFISERMLKFSSKVFKTSLFGETAAVFCGSAG  96

Query  296  NKffftnentllttWWPQSV  355
            NKF F+NEN L+T WWP SV
Sbjct  97   NKFLFSNENKLVTAWWPSSV  116



>ref|XP_008358591.1| PREDICTED: beta-amyrin 28-oxidase-like isoform X2 [Malus domestica]
Length=477

 Score = 82.4 bits (202),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 62/89 (70%), Gaps = 3/89 (3%)
 Frame = +2

Query  95   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV--PEKYISDRMKKYSPEVFKTSILGEK  268
            I  F  K++  K NLPPGS GWP++GE+I+ +   PE ++  RM++YSPE+FKT ILGEK
Sbjct  19   IFAFKGKSDDGK-NLPPGSMGWPIVGESIEFLFGKPENFVFKRMRRYSPEIFKTYILGEK  77

Query  269  VAVFCGAAGNKffftnentllttWWPQSV  355
             AV CG +G+KF F+NE    T + P S+
Sbjct  78   TAVICGPSGHKFLFSNEQKYFTAFRPHSM  106



>ref|XP_002280969.1| PREDICTED: beta-amyrin 28-oxidase [Vitis vinifera]
Length=482

 Score = 82.4 bits (202),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 59/80 (74%), Gaps = 6/80 (8%)
 Frame = +2

Query  134  NLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSILGEKVAVFCGAAG  295
            NLP G+TG P IGE+I  +       PEK+IS+RM K+S +VFKTS+ GE  AVFCG+AG
Sbjct  37   NLPSGNTGLPYIGESIQFLSNGRKGHPEKFISERMLKFSSKVFKTSLFGETAAVFCGSAG  96

Query  296  NKffftnentllttWWPQSV  355
            NKF F+NEN L+T WWP SV
Sbjct  97   NKFLFSNENKLVTAWWPSSV  116



>ref|XP_004243906.1| PREDICTED: beta-amyrin 28-oxidase-like [Solanum lycopersicum]
Length=482

 Score = 82.4 bits (202),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 57/79 (72%), Gaps = 6/79 (8%)
 Frame = +2

Query  137  LPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSILGEKVAVFCGAAGN  298
            LPPG++GWPVIGE ++ +       PEK+I DR+ KY   +FKT +LGEK  VFCGA+ N
Sbjct  37   LPPGNSGWPVIGETLEFLSTGWKGHPEKFIFDRISKYKSSIFKTHLLGEKAVVFCGASSN  96

Query  299  KffftnentllttWWPQSV  355
            KF F+NEN L+ TWWP SV
Sbjct  97   KFLFSNENKLVQTWWPSSV  115



>ref|XP_007213963.1| hypothetical protein PRUPE_ppa004999mg [Prunus persica]
 gb|EMJ15162.1| hypothetical protein PRUPE_ppa004999mg [Prunus persica]
Length=482

 Score = 82.4 bits (202),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 61/89 (69%), Gaps = 3/89 (3%)
 Frame = +2

Query  95   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV--PEKYISDRMKKYSPEVFKTSILGEK  268
            I  F  K++  K NLPPGS GWP++GE ++ +   PE ++S RM++YSPE+FKT ILGEK
Sbjct  19   IFAFKGKSDDGK-NLPPGSMGWPIVGETLEFLFGKPEIFVSKRMRRYSPEIFKTKILGEK  77

Query  269  VAVFCGAAGNKffftnentllttWWPQSV  355
             AV CG  G+KF F+NE    T + P S+
Sbjct  78   TAVICGPNGHKFLFSNEQKYFTAFRPHSM  106



>ref|XP_008225705.1| PREDICTED: beta-amyrin 28-oxidase-like isoform X1 [Prunus mume]
Length=478

 Score = 82.4 bits (202),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 61/89 (69%), Gaps = 3/89 (3%)
 Frame = +2

Query  95   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV--PEKYISDRMKKYSPEVFKTSILGEK  268
            I  F  K++  K NLPPGS GWP++GE ++ +   PE ++S RM++YSPE+FKT ILGEK
Sbjct  19   IFAFKGKSDDGK-NLPPGSMGWPIVGETLEFLFGKPEIFVSKRMRRYSPEIFKTKILGEK  77

Query  269  VAVFCGAAGNKffftnentllttWWPQSV  355
             AV CG  G+KF F+NE    T + P S+
Sbjct  78   TAVICGPNGHKFLFSNEQKYFTAFRPHSM  106



>dbj|BAP59952.1| cytochrome P450 monooxygenase CYP716A51 [Lotus japonicus]
Length=481

 Score = 82.4 bits (202),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/83 (57%), Positives = 58/83 (70%), Gaps = 6/83 (7%)
 Frame = +2

Query  125  SKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSILGEKVAVFCG  286
            + PNLPPG  G+PVIGE+++ +       PEK+I DRM KY   +FKTSI+GE   VFCG
Sbjct  33   TAPNLPPGRMGFPVIGESLEFLSTGWNGHPEKFIFDRMTKYCSHIFKTSIVGEPAVVFCG  92

Query  287  AAGNKffftnentllttWWPQSV  355
             A NKF F+NEN L+T WWP SV
Sbjct  93   PACNKFLFSNENKLVTAWWPNSV  115



>ref|XP_008225706.1| PREDICTED: beta-amyrin 28-oxidase-like isoform X2 [Prunus mume]
 ref|XP_008225707.1| PREDICTED: beta-amyrin 28-oxidase-like isoform X3 [Prunus mume]
Length=478

 Score = 82.0 bits (201),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 61/89 (69%), Gaps = 3/89 (3%)
 Frame = +2

Query  95   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV--PEKYISDRMKKYSPEVFKTSILGEK  268
            I  F  K++  K NLPPGS GWP++GE ++ +   PE ++S RM++YSPE+FKT ILGEK
Sbjct  19   IFAFKGKSDDGK-NLPPGSMGWPIVGETLEFLFGKPEIFVSKRMRRYSPEIFKTKILGEK  77

Query  269  VAVFCGAAGNKffftnentllttWWPQSV  355
             AV CG  G+KF F+NE    T + P S+
Sbjct  78   TAVICGPNGHKFLFSNEQKYFTAFRPHSM  106



>ref|XP_003633047.1| PREDICTED: beta-amyrin 28-oxidase-like [Vitis vinifera]
Length=475

 Score = 82.0 bits (201),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 57/89 (64%), Gaps = 2/89 (2%)
 Frame = +2

Query  95   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV--PEKYISDRMKKYSPEVFKTSILGEK  268
            I  F  K+      LPPGS GWP++GE ++ +   PE ++ DRMKKYSP++FKT ILGEK
Sbjct  21   IFAFTRKSGDDDKKLPPGSLGWPIMGETLEFLFGKPENFVFDRMKKYSPDIFKTKILGEK  80

Query  269  VAVFCGAAGNKffftnentllttWWPQSV  355
              V CG  G+KF F+NE    T + P S+
Sbjct  81   TVVICGPEGHKFLFSNEAKYFTAFRPHSM  109



>ref|XP_009617512.1| PREDICTED: beta-amyrin 28-oxidase-like [Nicotiana tomentosiformis]
Length=484

 Score = 82.0 bits (201),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/92 (46%), Positives = 59/92 (64%), Gaps = 6/92 (7%)
 Frame = +2

Query  98   IYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSIL  259
            I F  +      N PPGS+GWP++GE +D +       PEK++ DR++KY  ++FKTSI+
Sbjct  26   ISFFLRRKKKTLNFPPGSSGWPIVGETLDFLRANREGKPEKFVEDRIEKYKSKIFKTSIM  85

Query  260  GEKVAVFCGAAGNKffftnentllttWWPQSV  355
            GE V V  GA GNKF F+NEN  +  WWP ++
Sbjct  86   GENVVVIGGAGGNKFLFSNENKKVNVWWPVTI  117



>emb|CDO98601.1| unnamed protein product [Coffea canephora]
Length=480

 Score = 82.0 bits (201),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 45/58 (78%), Gaps = 2/58 (3%)
 Frame = +2

Query  134  NLPPGSTGWPVIGENIDLMV--PEKYISDRMKKYSPEVFKTSILGEKVAVFCGAAGNK  301
             LPPGS GWP+IGE ++ +   PEK++ DRMKKYSP++FKT ILGEK AV CG  G+K
Sbjct  14   KLPPGSFGWPIIGETMEFLFGKPEKFVGDRMKKYSPDIFKTKILGEKTAVICGPNGHK  71



>ref|XP_004504209.1| PREDICTED: cytochrome P450 716B1-like [Cicer arietinum]
Length=479

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 58/93 (62%), Gaps = 7/93 (8%)
 Frame = +2

Query  98   IYFITK-ANTSKPNLPPGSTGWPVIGENIDLMVPE------KYISDRMKKYSPEVFKTSI  256
             +FIT+     K NLP GS GWP+IGE  + +         ++I +RMKKY   VFKTS+
Sbjct  20   FHFITRIVKLKKLNLPLGSLGWPIIGETFEFVKASVEGKQIRFIEERMKKYDKRVFKTSM  79

Query  257  LGEKVAVFCGAAGNKffftnentllttWWPQSV  355
             GE +AVFCG  GNKF F+NEN  +  WWP SV
Sbjct  80   FGEHIAVFCGPLGNKFLFSNENKNVQVWWPSSV  112



>gb|AFK44313.1| unknown [Lotus japonicus]
Length=276

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 53/80 (66%), Gaps = 6/80 (8%)
 Frame = +2

Query  134  NLPPGSTGWPVIGENIDLMVPE------KYISDRMKKYSPEVFKTSILGEKVAVFCGAAG  295
            +LPPG+TGWP++GE  +           ++I DRM KY   VFKTS++G  +AVFCG AG
Sbjct  32   HLPPGTTGWPIVGETFEFRRRSIEGSISRFIQDRMLKYDSRVFKTSLIGNLIAVFCGPAG  91

Query  296  NKffftnentllttWWPQSV  355
            NKF F+NEN  +  WWP SV
Sbjct  92   NKFLFSNENKNVQVWWPSSV  111



>ref|XP_009353896.1| PREDICTED: beta-amyrin 28-oxidase-like [Pyrus x bretschneideri]
Length=480

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/88 (48%), Positives = 61/88 (69%), Gaps = 2/88 (2%)
 Frame = +2

Query  98   IYFITKANTSKPNLPPGSTGWPVIGENIDLMV--PEKYISDRMKKYSPEVFKTSILGEKV  271
            I+ +   +    NLPPGS GWP++GE+I+ +   PE ++ +RM+KYSP++FKT ILGEK 
Sbjct  19   IFALKGKSDGAKNLPPGSMGWPIVGESIEFLFGKPENFVFNRMRKYSPDIFKTYILGEKT  78

Query  272  AVFCGAAGNKffftnentllttWWPQSV  355
            AV CG +G+KF F+NE    T + P S+
Sbjct  79   AVICGPSGHKFLFSNEQKYFTAFRPHSM  106



>ref|XP_004296583.1| PREDICTED: beta-amyrin 28-oxidase-like [Fragaria vesca subsp. 
vesca]
Length=485

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 63/93 (68%), Gaps = 6/93 (6%)
 Frame = +2

Query  95   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  256
             +++  ++  +  NLPPG  G+PVIGE+ + +       PEK+I DRM K+S +VFKTS+
Sbjct  23   FLFYKHRSQFTGNNLPPGKVGYPVIGESYEFLSSGWKGHPEKFIFDRMNKFSSQVFKTSL  82

Query  257  LGEKVAVFCGAAGNKffftnentllttWWPQSV  355
             GEK  +F GAA NKF F+NEN L+T WWP SV
Sbjct  83   FGEKACIFTGAACNKFLFSNENKLVTAWWPSSV  115



>gb|EPS59491.1| hypothetical protein M569_15315, partial [Genlisea aurea]
Length=471

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 44/87 (51%), Positives = 59/87 (68%), Gaps = 6/87 (7%)
 Frame = +2

Query  113  KANTSKPNLPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSPEVFKTSILGEKVA  274
            K+   K NLPPG  GWP+IGE++D         P+K+   R++KY   +FKTS+LGEK+A
Sbjct  21   KSTDGKRNLPPGGYGWPIIGESLDFFRDARNGEPQKFALSRVEKYKSPIFKTSLLGEKMA  80

Query  275  VFCGAAGNKffftnentllttWWPQSV  355
               GA+GNKF F+NEN L++ WWP SV
Sbjct  81   FLSGASGNKFLFSNENKLVSLWWPASV  107



>ref|XP_002299097.1| hypothetical protein POPTR_0001s04010g [Populus trichocarpa]
 gb|EEE83902.1| hypothetical protein POPTR_0001s04010g [Populus trichocarpa]
Length=483

 Score = 81.3 bits (199),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/95 (51%), Positives = 62/95 (65%), Gaps = 8/95 (8%)
 Frame = +2

Query  95   IIYFITKANTSK----PNLPPGSTGWPVIGENIDLMV----PEKYISDRMKKYSPEVFKT  250
            ++YF  K    +    P+LPPGS GWP++GE +  +     PE +++ RMKKY   VFKT
Sbjct  21   LLYFAIKTLKERLFPNPHLPPGSLGWPLVGETLQFLPINLPPEIFVNYRMKKYDSPVFKT  80

Query  251  SILGEKVAVFCGAAGNKffftnentllttWWPQSV  355
            S+ GE VAVF G AGNKF F+NEN L+  WWP SV
Sbjct  81   SLFGETVAVFVGPAGNKFLFSNENKLVNVWWPTSV  115



>ref|XP_004308426.1| PREDICTED: beta-amyrin 28-oxidase-like [Fragaria vesca subsp. 
vesca]
Length=210

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 59/80 (74%), Gaps = 9/80 (11%)
 Frame = +2

Query  134  NLPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSP---EVFKTSILGEKVAVFCG  286
             LPPGSTGWP+IGE ++ +      VPEK ++DR +KYS    +VFKTS+LGE +A+ C 
Sbjct  36   QLPPGSTGWPIIGETLEYLRTARNGVPEKSVADRRRKYSDGSCKVFKTSLLGEPMAMLCT  95

Query  287  AAGNKffftnentllttWWP  346
            AAGNKF F+NEN L+ TWWP
Sbjct  96   AAGNKFLFSNENKLVKTWWP  115



>ref|XP_008388261.1| PREDICTED: beta-amyrin 28-oxidase-like [Malus domestica]
Length=480

 Score = 81.3 bits (199),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 62/89 (70%), Gaps = 3/89 (3%)
 Frame = +2

Query  95   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV--PEKYISDRMKKYSPEVFKTSILGEK  268
            I  F  K++  K NLPPGS GWP++GE+I+ +   PE ++  RM++YSP++FKT ILGEK
Sbjct  19   IFAFKGKSDDGK-NLPPGSMGWPIVGESIEFLFGKPENFVFKRMRRYSPDIFKTYILGEK  77

Query  269  VAVFCGAAGNKffftnentllttWWPQSV  355
             AV CG +G+KF F+NE    T + P S+
Sbjct  78   TAVICGPSGHKFLFSNEQKYFTAFRPHSM  106



>ref|XP_008350555.1| PREDICTED: beta-amyrin 28-oxidase-like [Malus domestica]
 ref|XP_008350556.1| PREDICTED: beta-amyrin 28-oxidase-like [Malus domestica]
Length=480

 Score = 81.3 bits (199),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 62/89 (70%), Gaps = 3/89 (3%)
 Frame = +2

Query  95   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV--PEKYISDRMKKYSPEVFKTSILGEK  268
            I  F  K++  K NLPPGS GWP++GE+I+ +   PE ++  RM++YSP++FKT ILGEK
Sbjct  19   IFAFKGKSDDGK-NLPPGSMGWPIVGESIEFLFGKPENFVFKRMRRYSPDIFKTYILGEK  77

Query  269  VAVFCGAAGNKffftnentllttWWPQSV  355
             AV CG +G+KF F+NE    T + P S+
Sbjct  78   TAVICGPSGHKFLFSNEQKYFTAFRPHSM  106



>ref|XP_007022977.1| Cytochrome P450 716B1 [Theobroma cacao]
 gb|EOY25599.1| Cytochrome P450 716B1 [Theobroma cacao]
Length=557

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 56/76 (74%), Gaps = 2/76 (3%)
 Frame = +2

Query  134  NLPPGSTGWPVIGENIDLMV--PEKYISDRMKKYSPEVFKTSILGEKVAVFCGAAGNKff  307
            +LPPGS GWPV+GE ++ +   PEK++ DRMKKYSP +FKT ILGE+ AV CG  G+KF 
Sbjct  39   DLPPGSLGWPVMGETLEFLFGKPEKFVFDRMKKYSPHIFKTKILGEETAVICGPEGHKFL  98

Query  308  ftnentllttWWPQSV  355
            F+NE  L T + P S+
Sbjct  99   FSNEQKLFTAFRPHSM  114



>ref|XP_007213882.1| hypothetical protein PRUPE_ppa005225mg [Prunus persica]
 gb|EMJ15081.1| hypothetical protein PRUPE_ppa005225mg [Prunus persica]
Length=471

 Score = 81.3 bits (199),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 42/88 (48%), Positives = 59/88 (67%), Gaps = 2/88 (2%)
 Frame = +2

Query  98   IYFITKANTSKPNLPPGSTGWPVIGENIDLMV--PEKYISDRMKKYSPEVFKTSILGEKV  271
            I+ +   +    NLPPGS GWP++GE ++ +   PE ++S RM++YSPE+FKT ILGEK 
Sbjct  19   IFAVKGKSDDGKNLPPGSMGWPIVGETLEFLFGKPEIFVSKRMRRYSPEIFKTKILGEKT  78

Query  272  AVFCGAAGNKffftnentllttWWPQSV  355
            AV CG  G+KF F+NE    T + P S+
Sbjct  79   AVICGPNGHKFLFSNEQKYCTAFRPHSM  106



>ref|XP_004300936.1| PREDICTED: beta-amyrin 28-oxidase-like [Fragaria vesca subsp. 
vesca]
Length=328

 Score = 79.7 bits (195),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 42/92 (46%), Positives = 62/92 (67%), Gaps = 5/92 (5%)
 Frame = +2

Query  95   IIYFITKANTS--KPN-LPPGSTGWPVIGENIDLM--VPEKYISDRMKKYSPEVFKTSIL  259
            +++F+ K +TS  KPN LPPGS GWP+IGE    +    ++++ DRMK++S ++FKT+I 
Sbjct  23   LLFFVFKYSTSNSKPNNLPPGSFGWPIIGETFAFINETQQRFVGDRMKRHSSKLFKTNIF  82

Query  260  GEKVAVFCGAAGNKffftnentllttWWPQSV  355
            GE   VFCG +G+KF  +NE  L   W P S+
Sbjct  83   GEPTVVFCGISGHKFIASNEEKLFLAWRPHSM  114



>ref|XP_009760011.1| PREDICTED: beta-amyrin 28-oxidase-like [Nicotiana sylvestris]
Length=364

 Score = 80.1 bits (196),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 58/90 (64%), Gaps = 6/90 (7%)
 Frame = +2

Query  104  FITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSILGE  265
            F  +      N PPGS+GWP++GE +D +       PEK++ +R++KY  ++FKTSI+GE
Sbjct  22   FFLRRKKKTLNFPPGSSGWPIVGETLDFLRANKEGKPEKFVKERIEKYKSKIFKTSIMGE  81

Query  266  KVAVFCGAAGNKffftnentllttWWPQSV  355
             V V  GA GNKF F+NEN  +  WWP ++
Sbjct  82   NVVVIGGAGGNKFLFSNENKKVNVWWPVTI  111



>ref|XP_008349137.1| PREDICTED: beta-amyrin 28-oxidase-like [Malus domestica]
Length=480

 Score = 80.9 bits (198),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 56/76 (74%), Gaps = 2/76 (3%)
 Frame = +2

Query  134  NLPPGSTGWPVIGENIDLMV--PEKYISDRMKKYSPEVFKTSILGEKVAVFCGAAGNKff  307
            NLPPGS GWP++GE+I+ +   PE ++  RM+KYSP++FKT ILGEK AV CG +G+KF 
Sbjct  31   NLPPGSMGWPIVGESIEFLFGKPENFVFKRMRKYSPDIFKTYILGEKTAVICGPSGHKFL  90

Query  308  ftnentllttWWPQSV  355
            F+NE    T + P S+
Sbjct  91   FSNEQKYFTAFRPHSM  106



>ref|XP_008340177.1| PREDICTED: beta-amyrin 28-oxidase-like [Malus domestica]
Length=485

 Score = 80.9 bits (198),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 63/93 (68%), Gaps = 6/93 (6%)
 Frame = +2

Query  95   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  256
            ++ +  ++  +  NLPPG+ G+PVIGE+   +       PEK+  DR+ K+S +VFKTS+
Sbjct  26   VLLYRHRSQFTSENLPPGNVGYPVIGESFKFLASGWKGQPEKFFFDRITKFSSQVFKTSL  85

Query  257  LGEKVAVFCGAAGNKffftnentllttWWPQSV  355
             GE+ A+FCGAA NKF F+NEN L+  W+P S+
Sbjct  86   FGEQAAIFCGAACNKFLFSNENKLVAVWYPSSI  118



>ref|XP_010247736.1| PREDICTED: beta-amyrin 28-oxidase-like [Nelumbo nucifera]
Length=443

 Score = 80.1 bits (196),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 52/74 (70%), Gaps = 2/74 (3%)
 Frame = +2

Query  134  NLPPGSTGWPVIGENIDLMV--PEKYISDRMKKYSPEVFKTSILGEKVAVFCGAAGNKff  307
             LPPGS GWP+IGE ++ +   PEK++ DRMKKYS ++FKT I GE  AV CG AGNKF 
Sbjct  34   KLPPGSLGWPIIGETLEFVFGKPEKFVGDRMKKYSSDIFKTKIFGEPTAVICGPAGNKFL  93

Query  308  ftnentllttWWPQ  349
            F+NE  L+  W P 
Sbjct  94   FSNEQKLVVAWRPH  107



>ref|XP_006488697.1| PREDICTED: cytochrome P450 716B2-like [Citrus sinensis]
Length=534

 Score = 80.5 bits (197),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 46/79 (58%), Positives = 54/79 (68%), Gaps = 6/79 (8%)
 Frame = +2

Query  137  LPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSPEVFKTSILGEKVAVFCGAAGN  298
            LPPG  G P IGE+++ +       PEK+I DRM KYS +VFKTSILGE   V CGAA N
Sbjct  84   LPPGKMGLPYIGESLEFLNSGRKGFPEKFIYDRMAKYSSQVFKTSILGEPTVVVCGAAAN  143

Query  299  KffftnentllttWWPQSV  355
            KF F+NEN L+  WWP SV
Sbjct  144  KFLFSNENKLVQAWWPDSV  162



>gb|EYU43204.1| hypothetical protein MIMGU_mgv1a005450mg [Erythranthe guttata]
Length=483

 Score = 80.5 bits (197),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 44/58 (76%), Gaps = 2/58 (3%)
 Frame = +2

Query  134  NLPPGSTGWPVIGENIDLMV--PEKYISDRMKKYSPEVFKTSILGEKVAVFCGAAGNK  301
            NLPPGS GWP++GE I+ +   PE ++ DRM KYSP++FKT ILGEK AV CG  G+K
Sbjct  31   NLPPGSYGWPIMGETIEFLFGKPENFVGDRMNKYSPDIFKTKILGEKTAVICGPNGHK  88



>ref|XP_008243439.1| PREDICTED: beta-amyrin 28-oxidase-like [Prunus mume]
Length=114

 Score = 75.9 bits (185),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 52/78 (67%), Gaps = 2/78 (3%)
 Frame = +2

Query  128  KPNLPPGSTGWPVIGENIDLM--VPEKYISDRMKKYSPEVFKTSILGEKVAVFCGAAGNK  301
            K NLPPGS GWP+IGE    +    EK++ D MKK+  ++FKT+ILGE   VFCG AG K
Sbjct  5    KANLPPGSFGWPIIGETFAFLNQTQEKFVGDTMKKHPSKLFKTNILGEPTVVFCGNAGQK  64

Query  302  ffftnentllttWWPQSV  355
            F  +N+  L  +W PQS+
Sbjct  65   FISSNKEKLFLSWKPQSM  82



>gb|AEY75213.1| cytochrome P450 CYP716A47 [Panax ginseng]
Length=482

 Score = 80.1 bits (196),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 58/87 (67%), Gaps = 6/87 (7%)
 Frame = +2

Query  113  KANTSKPNLPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSPEVFKTSILGEKVA  274
            K N SK  LPPG TGWP+IGE ++ +      V E ++  R +KYSP+VF+TS+LGE +A
Sbjct  30   KENDSKAPLPPGQTGWPLIGETLNYLSCVKSGVSENFVKYRKEKYSPKVFRTSLLGEPMA  89

Query  275  VFCGAAGNKffftnentllttWWPQSV  355
            + CG  GNKF ++ E  L+  W+P SV
Sbjct  90   ILCGPEGNKFLYSTEKKLVQVWFPSSV  116



>gb|KDO67048.1| hypothetical protein CISIN_1g037867mg [Citrus sinensis]
Length=495

 Score = 80.1 bits (196),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 54/79 (68%), Gaps = 6/79 (8%)
 Frame = +2

Query  137  LPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSPEVFKTSILGEKVAVFCGAAGN  298
            LPPG  G P IGE+++ +       PEK+I DRM KYS +VFKTSILGE   V CGAA N
Sbjct  45   LPPGKMGLPYIGESLEFLNSGRKGFPEKFIYDRMAKYSSQVFKTSILGEPTVVVCGAAAN  104

Query  299  KffftnentllttWWPQSV  355
            KF F+NEN L+  WWP SV
Sbjct  105  KFLFSNENKLVQAWWPDSV  123



>sp|H2DH16.2|C7A47_PANGI RecName: Full=Dammarenediol 12-hydroxylase; AltName: Full=Cytochrome 
P450 CYP716A47; AltName: Full=Protopanaxadiol synthase; 
Short=PgDDS [Panax ginseng]
 gb|AEY75212.1| cytochrome P450 CYP716A47 [Panax ginseng]
Length=486

 Score = 80.1 bits (196),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 58/87 (67%), Gaps = 6/87 (7%)
 Frame = +2

Query  113  KANTSKPNLPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSPEVFKTSILGEKVA  274
            K N SK  LPPG TGWP+IGE ++ +      V E ++  R +KYSP+VF+TS+LGE +A
Sbjct  34   KENDSKAPLPPGQTGWPLIGETLNYLSCVKSGVSENFVKYRKEKYSPKVFRTSLLGEPMA  93

Query  275  VFCGAAGNKffftnentllttWWPQSV  355
            + CG  GNKF ++ E  L+  W+P SV
Sbjct  94   ILCGPEGNKFLYSTEKKLVQVWFPSSV  120



>gb|AFU93031.1| cytochrome P450 [Panax quinquefolius]
Length=482

 Score = 80.1 bits (196),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 58/87 (67%), Gaps = 6/87 (7%)
 Frame = +2

Query  113  KANTSKPNLPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSPEVFKTSILGEKVA  274
            K N SK  LPPG TGWP+IGE ++ +      V E ++  R +KYSP+VF+TS+LGE +A
Sbjct  30   KENDSKAPLPPGQTGWPLIGETLNYLSCVKSGVSENFVKYRKEKYSPKVFRTSLLGEPMA  89

Query  275  VFCGAAGNKffftnentllttWWPQSV  355
            + CG  GNKF ++ E  L+  W+P SV
Sbjct  90   ILCGPEGNKFLYSTEKKLVQVWFPSSV  116



>ref|XP_010052577.1| PREDICTED: beta-amyrin 28-oxidase-like [Eucalyptus grandis]
 gb|KCW76647.1| hypothetical protein EUGRSUZ_D01027 [Eucalyptus grandis]
Length=471

 Score = 79.7 bits (195),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 45/58 (78%), Gaps = 2/58 (3%)
 Frame = +2

Query  134  NLPPGSTGWPVIGENIDLMV--PEKYISDRMKKYSPEVFKTSILGEKVAVFCGAAGNK  301
            NLPPGS GWP+IGE ++ +   P+K++ DRM KYSP++FKT ILGE  AV CG +G+K
Sbjct  33   NLPPGSFGWPIIGETVEFLFGKPDKFVFDRMAKYSPDIFKTRILGEDTAVICGPSGHK  90



>ref|XP_010252179.1| PREDICTED: beta-amyrin 28-oxidase-like [Nelumbo nucifera]
Length=485

 Score = 79.7 bits (195),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 60/93 (65%), Gaps = 8/93 (9%)
 Frame = +2

Query  101  YFITKANTSKP--NLPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSPEVFKTSI  256
            Y + K  +  P   LPPG  G P +GE+I+        +PEK+  DRM K+S E+FKTS+
Sbjct  27   YLVYKHTSHAPGKKLPPGRMGLPFVGESIEFFSLGRKGIPEKFFFDRMAKFSKEIFKTSL  86

Query  257  LGEKVAVFCGAAGNKffftnentllttWWPQSV  355
            LGE  AV CG  GNKF F+NEN L+T WWP+SV
Sbjct  87   LGENTAVVCGPNGNKFLFSNENKLVTAWWPRSV  119



>ref|XP_007159554.1| hypothetical protein PHAVU_002G247300g [Phaseolus vulgaris]
 gb|ESW31548.1| hypothetical protein PHAVU_002G247300g [Phaseolus vulgaris]
Length=478

 Score = 79.7 bits (195),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 43/93 (46%), Positives = 59/93 (63%), Gaps = 7/93 (8%)
 Frame = +2

Query  98   IYFITK-ANTSKPNLPPGSTGWPVIGENIDLMVPE------KYISDRMKKYSPEVFKTSI  256
            ++FIT+       NLPPG  GWP++GE  + M         +++ +R++KY   VFKTS+
Sbjct  20   LHFITRRVRLRNLNLPPGRLGWPIVGETFEFMHAMLEGNVLRFLKERVEKYDSRVFKTSM  79

Query  257  LGEKVAVFCGAAGNKffftnentllttWWPQSV  355
             G+ VAVFCG AGNKF F+NEN  +  WWP SV
Sbjct  80   FGDPVAVFCGPAGNKFLFSNENKNVQVWWPSSV  112



>ref|XP_002527982.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF34394.1| cytochrome P450, putative [Ricinus communis]
Length=480

 Score = 79.7 bits (195),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 59/78 (76%), Gaps = 6/78 (8%)
 Frame = +2

Query  140  PPGSTGWPVIGENIDLM------VPEKYISDRMKKYSPEVFKTSILGEKVAVFCGAAGNK  301
            PPG+TGWP+IGE ++ +      +PEK+I+DR K+YS ++FKTS+LG+   + C A GNK
Sbjct  40   PPGTTGWPLIGETLEYLSTTKAGIPEKFINDRRKRYSSKLFKTSLLGQPTVLLCNADGNK  99

Query  302  ffftnentllttWWPQSV  355
            F F+NEN L+T+WWP SV
Sbjct  100  FIFSNENKLVTSWWPSSV  117



>ref|XP_002522937.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF39448.1| cytochrome P450, putative [Ricinus communis]
Length=480

 Score = 79.7 bits (195),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 60/87 (69%), Gaps = 6/87 (7%)
 Frame = +2

Query  113  KANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSILGEKVA  274
            K+  + P+LPPG  G P +GE+++ +       PEK++ DR  KYS E+FKT++LG+  A
Sbjct  28   KSQYNYPSLPPGKPGLPFVGESLEFLSSGWKGHPEKFVFDRTSKYSSEIFKTNLLGQPAA  87

Query  275  VFCGAAGNKffftnentllttWWPQSV  355
            VFCGA+ NKF F+NEN L+  WWP SV
Sbjct  88   VFCGASANKFLFSNENKLVQAWWPDSV  114



>ref|XP_004228960.1| PREDICTED: beta-amyrin 28-oxidase-like [Solanum lycopersicum]
Length=321

 Score = 77.8 bits (190),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 41/92 (45%), Positives = 58/92 (63%), Gaps = 6/92 (7%)
 Frame = +2

Query  98   IYFITKANTSKPNLPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSPEVFKTSIL  259
            I  +      + N PPGS GWP +GE +D +       PEK++ +R++KY  ++FKTS++
Sbjct  16   IIIVIVMRRKRLNYPPGSCGWPYLGETLDFLNANKEGKPEKFVKERIEKYKSKIFKTSLM  75

Query  260  GEKVAVFCGAAGNKffftnentllttWWPQSV  355
            GE V V  GA+GNKF F+NEN  +  WWP SV
Sbjct  76   GETVVVLGGASGNKFLFSNENKQVVIWWPASV  107



>ref|XP_004291627.1| PREDICTED: beta-amyrin 28-oxidase-like [Fragaria vesca subsp. 
vesca]
Length=486

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 55/84 (65%), Gaps = 2/84 (2%)
 Frame = +2

Query  110  TKANTSKPNLPPGSTGWPVIGENIDLMVP--EKYISDRMKKYSPEVFKTSILGEKVAVFC  283
            +K++    NLPPGS GWP+IGE    +    EK++ +RMKKYS ++FKT ILGE   V C
Sbjct  31   SKSDEKSTNLPPGSFGWPIIGETFAFLYDDHEKFVGERMKKYSSKIFKTKILGEPTVVLC  90

Query  284  GAAGNKffftnentllttWWPQSV  355
            G AG+KF  +NE+ L   W P S+
Sbjct  91   GTAGHKFVASNEDKLFAAWRPHSM  114



>ref|XP_008389235.1| PREDICTED: beta-amyrin 28-oxidase-like [Malus domestica]
Length=474

 Score = 79.3 bits (194),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 56/80 (70%), Gaps = 2/80 (3%)
 Frame = +2

Query  122  TSKPNLPPGSTGWPVIGENIDLMVPEK--YISDRMKKYSPEVFKTSILGEKVAVFCGAAG  295
            +SK NLPPGS GWP+IGE I  M  ++  ++ +RMKK+S ++FKTSI GE++ V CG AG
Sbjct  23   SSKTNLPPGSFGWPIIGETIAFMKEQQQHFVGERMKKHSTKLFKTSIFGERMVVLCGXAG  82

Query  296  NKffftnentllttWWPQSV  355
            +KF  TNE  L   W P S+
Sbjct  83   HKFIATNEEKLFLAWRPLSM  102



>gb|AFO67229.1| putative cytochrome P450, partial [Aralia elata]
Length=161

 Score = 76.3 bits (186),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 62/96 (65%), Gaps = 10/96 (10%)
 Frame = +2

Query  98   IYFITKANTSKPN----LPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSPEVFK  247
            ++F    + SKP      PPG +GWP++GE++D        + E+++ DR++KYS  VFK
Sbjct  17   LFFHHSLSKSKPKSGAPYPPGRSGWPLLGESLDYFSKLRNGMNERFVMDRLQKYSSRVFK  76

Query  248  TSILGEKVAVFCGAAGNKffftnentllttWWPQSV  355
            +++LGEK+A   GA GNKF F+NEN  +  WWP SV
Sbjct  77   SNVLGEKMAFLPGAEGNKFLFSNENKFVQVWWPSSV  112



>ref|XP_010034533.1| PREDICTED: beta-amyrin 28-oxidase-like [Eucalyptus grandis]
Length=450

 Score = 79.0 bits (193),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 41/81 (51%), Positives = 54/81 (67%), Gaps = 6/81 (7%)
 Frame = +2

Query  131  PNLPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSPEVFKTSILGEKVAVFCGAA  292
            P LPPGS GWP+IGE  + +       PE++I +RM ++   VFKTS+LGE +AVFCG  
Sbjct  33   PRLPPGSLGWPLIGETQEFLRAGWLGEPERFIRERMDRHDARVFKTSLLGEPMAVFCGTE  92

Query  293  GNKffftnentllttWWPQSV  355
            G+KF F NEN  +  WWP +V
Sbjct  93   GHKFLFGNENKAVKVWWPITV  113



>gb|AFK79029.1| cytochrome P450 CYP716A41 [Bupleurum chinense]
Length=482

 Score = 79.3 bits (194),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 60/86 (70%), Gaps = 6/86 (7%)
 Frame = +2

Query  116  ANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSILGEKVAV  277
               S  +LPPG TG+ +IGE+++ +       PEK+I DRM KY+ ++FK+S+ GEK  V
Sbjct  31   TQQSYKSLPPGETGYFLIGESLEFLSTGRKGHPEKFIFDRMTKYASKIFKSSLFGEKTIV  90

Query  278  FCGAAGNKffftnentllttWWPQSV  355
            FCGAA NKF F++EN L+ +WWP SV
Sbjct  91   FCGAANNKFLFSDENKLVQSWWPNSV  116



>ref|XP_002325242.2| hypothetical protein POPTR_0018s13490g [Populus trichocarpa]
 gb|EEF03807.2| hypothetical protein POPTR_0018s13490g [Populus trichocarpa]
Length=461

 Score = 79.0 bits (193),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 59/87 (68%), Gaps = 6/87 (7%)
 Frame = +2

Query  113  KANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSILGEKVA  274
            ++    PNLPPGS+G P IGE ++L+V      P+K+  DR  KY+ EVFKT++  +  A
Sbjct  27   RSKFKHPNLPPGSSGLPYIGETLELLVTGCKGHPQKFFLDRKAKYASEVFKTNLFCQPAA  86

Query  275  VFCGAAGNKffftnentllttWWPQSV  355
            VFCGAAGNKF F+NEN +L  W+P  V
Sbjct  87   VFCGAAGNKFLFSNENKVLKAWYPDFV  113



>ref|XP_011470545.1| PREDICTED: beta-amyrin 28-oxidase-like [Fragaria vesca subsp. 
vesca]
Length=697

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/88 (50%), Positives = 59/88 (67%), Gaps = 10/88 (11%)
 Frame = +2

Query  113  KANTSKPNLPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSPE----VFKTSILG  262
            +   +   LPPGSTGWP+IGE ++ +      VPEK+++DR KKYS      VFKTS+ G
Sbjct  30   RQQVTVHQLPPGSTGWPIIGETLEFLRTARNGVPEKFVADRRKKYSSHGSCKVFKTSLFG  89

Query  263  EKVAVFCGAAGNKffftnentllttWWP  346
            E +A+ C AAGNKF F+ EN ++ TWWP
Sbjct  90   EPMAMLCTAAGNKFVFSKENKVVKTWWP  117



>ref|XP_004293684.1| PREDICTED: beta-amyrin 28-oxidase-like [Fragaria vesca subsp. 
vesca]
Length=474

 Score = 79.0 bits (193),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 54/76 (71%), Gaps = 2/76 (3%)
 Frame = +2

Query  134  NLPPGSTGWPVIGENIDLMV--PEKYISDRMKKYSPEVFKTSILGEKVAVFCGAAGNKff  307
            NLPPGS GWP++GE ++ +   PE ++  RMK+YSP++FKT ILGEK AV CG  G+KF 
Sbjct  29   NLPPGSMGWPIVGETLEFLFGKPENFVFKRMKRYSPDIFKTKILGEKTAVICGPNGHKFL  88

Query  308  ftnentllttWWPQSV  355
            F+NE    T + P S+
Sbjct  89   FSNEQKYFTAFRPHSM  104



>ref|XP_004295460.1| PREDICTED: beta-amyrin 28-oxidase-like [Fragaria vesca subsp. 
vesca]
Length=474

 Score = 79.0 bits (193),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 54/76 (71%), Gaps = 2/76 (3%)
 Frame = +2

Query  134  NLPPGSTGWPVIGENIDLMV--PEKYISDRMKKYSPEVFKTSILGEKVAVFCGAAGNKff  307
            NLPPGS GWP++GE ++ +   PE ++  RMK+YSP++FKT ILGEK AV CG  G+KF 
Sbjct  29   NLPPGSMGWPIVGETLEFLFGKPENFVFKRMKRYSPDIFKTKILGEKTAVICGPNGHKFL  88

Query  308  ftnentllttWWPQSV  355
            F+NE    T + P S+
Sbjct  89   FSNEQKYFTAFRPHSM  104



>gb|KCW52345.1| hypothetical protein EUGRSUZ_J01761 [Eucalyptus grandis]
Length=468

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 41/81 (51%), Positives = 54/81 (67%), Gaps = 6/81 (7%)
 Frame = +2

Query  131  PNLPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSPEVFKTSILGEKVAVFCGAA  292
            P LPPGS GWP+IGE  + +       PE++I +RM ++   VFKTS+LGE +AVFCG  
Sbjct  23   PRLPPGSLGWPLIGETQEFLRAGWLGEPERFIRERMDRHDARVFKTSLLGEPMAVFCGTE  82

Query  293  GNKffftnentllttWWPQSV  355
            G+KF F NEN  +  WWP +V
Sbjct  83   GHKFLFGNENKAVKVWWPITV  103



>gb|ACL10147.1| cytochrome P450 monooxygenase [Stevia rebaudiana]
Length=476

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 45/94 (48%), Positives = 63/94 (67%), Gaps = 7/94 (7%)
 Frame = +2

Query  95   IIYFITKANTSKPNLPPGSTGWPVIGENIDLM------VPEKYISDRMKKY-SPEVFKTS  253
            + + + K   +K NLPPGS GWP +GE + L+       PE+++ +R+KK+ SP VFKTS
Sbjct  16   VFWKVYKHQKTKINLPPGSFGWPFLGETLALLRAGWDSEPERFVRERIKKHGSPLVFKTS  75

Query  254  ILGEKVAVFCGAAGNKffftnentllttWWPQSV  355
            + G++ AV CG AGNKF F NEN L+ +WWP  V
Sbjct  76   LFGDRFAVLCGPAGNKFLFCNENKLVASWWPVPV  109



>gb|ABD60225.1| ent-kaurenoic acid 13-hydroxylase [Stevia rebaudiana]
 gb|ACD93722.1| ent-kaurenoic acid 13-hydroxylase [Stevia rebaudiana]
Length=476

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 45/94 (48%), Positives = 63/94 (67%), Gaps = 7/94 (7%)
 Frame = +2

Query  95   IIYFITKANTSKPNLPPGSTGWPVIGENIDLM------VPEKYISDRMKKY-SPEVFKTS  253
            + + + K   +K NLPPGS GWP +GE + L+       PE+++ +R+KK+ SP VFKTS
Sbjct  16   VFWKVYKHQKTKINLPPGSFGWPFLGETLALLRAGWDSEPERFVRERIKKHGSPLVFKTS  75

Query  254  ILGEKVAVFCGAAGNKffftnentllttWWPQSV  355
            + G++ AV CG AGNKF F NEN L+ +WWP  V
Sbjct  76   LFGDRFAVLCGPAGNKFLFCNENKLVASWWPVPV  109



>ref|XP_007139496.1| hypothetical protein PHAVU_008G034500g [Phaseolus vulgaris]
 gb|ESW11490.1| hypothetical protein PHAVU_008G034500g [Phaseolus vulgaris]
Length=475

 Score = 78.6 bits (192),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 62/93 (67%), Gaps = 6/93 (6%)
 Frame = +2

Query  95   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  256
             +++   A +S PNLPPG+ G+P IGE+I+ +       PEK+I +RM KYS +VFKTS+
Sbjct  22   FLFYSHYAQSSDPNLPPGNMGFPAIGESIEYLSLGWKGHPEKFIYERMAKYSSKVFKTSL  81

Query  257  LGEKVAVFCGAAGNKffftnentllttWWPQSV  355
             GE   + C A  NKF F+NEN L+ +WWP +V
Sbjct  82   FGESTVMLCEAECNKFLFSNENKLVVSWWPDNV  114



>emb|CDP19705.1| unnamed protein product [Coffea canephora]
Length=496

 Score = 78.6 bits (192),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 55/85 (65%), Gaps = 3/85 (4%)
 Frame = +2

Query  101  YFITKANTSKPNLPPGSTGWPVIGENIDLMV---PEKYISDRMKKYSPEVFKTSILGEKV  271
            +   ++++ K  LPPG++G P++GE +       PEK+I  RMKKYS EVF TS++G+ +
Sbjct  22   FLCHRSDSKKCKLPPGTSGLPLVGETLHFFYLSGPEKFIHQRMKKYSDEVFATSLIGQNM  81

Query  272  AVFCGAAGNKffftnentllttWWP  346
            AV CGAAGNKF     N  ++ W P
Sbjct  82   AVICGAAGNKFLLCTANDFVSPWLP  106



>emb|CDP19704.1| unnamed protein product [Coffea canephora]
Length=485

 Score = 78.6 bits (192),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 58/87 (67%), Gaps = 4/87 (5%)
 Frame = +2

Query  101  YFITKANTSKPNLPPGSTGWPVIGENIDLMV--PEKYISDRMKKYSPEVFKTSILGEKVA  274
            YFI ++   K  LPPG++ +P++GE +   +  PEK+I  RMKKYS EVF TS++G+ +A
Sbjct  37   YFIHESKKYK--LPPGASRFPLVGETLHFFLSGPEKFIHHRMKKYSDEVFATSLVGQNMA  94

Query  275  VFCGAAGNKffftnentllttWWPQSV  355
            V CGAAGNKF     N  ++ W P S+
Sbjct  95   VICGAAGNKFLLCTANDFVSPWLPDSL  121



>emb|CDP17152.1| unnamed protein product [Coffea canephora]
Length=450

 Score = 78.6 bits (192),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 55/83 (66%), Gaps = 2/83 (2%)
 Frame = +2

Query  113  KANTSKPNLPPGSTGWPVIGENIDLMV--PEKYISDRMKKYSPEVFKTSILGEKVAVFCG  286
            + N+++  +PPG+ G+P+IGE I  +   PEK+   RM+KYS ++F TS+ GEKVAV CG
Sbjct  27   RYNSNRSKVPPGTFGFPLIGETIQFLASGPEKFFHRRMEKYSGDIFTTSLFGEKVAVVCG  86

Query  287  AAGNKffftnentllttWWPQSV  355
            AAGNKF     N  LT W P + 
Sbjct  87   AAGNKFLLYTANHQLTPWIPSAT  109



>emb|CAN66589.1| hypothetical protein VITISV_017098 [Vitis vinifera]
Length=123

 Score = 74.7 bits (182),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 48/75 (64%), Gaps = 6/75 (8%)
 Frame = +2

Query  95   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  256
            II+ + +  ++   LP G+ GWP+IGE +   +      P ++I +RM KYSP VF+TS+
Sbjct  19   IIFLVIRYKSATARLPLGNQGWPIIGETLAFALGKKSGNPTRFIKERMMKYSPNVFQTSL  78

Query  257  LGEKVAVFCGAAGNK  301
            +GEKV VFCG   NK
Sbjct  79   VGEKVVVFCGPTRNK  93



>gb|AED99867.1| cytochrome P450 [Panax notoginseng]
Length=500

 Score = 78.6 bits (192),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 58/87 (67%), Gaps = 6/87 (7%)
 Frame = +2

Query  113  KANTSKPNLPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSPEVFKTSILGEKVA  274
            K N SK  LPPG TGWP+IGE ++ +        E ++  R +KYSP+VF+TS+LGE +A
Sbjct  48   KENDSKAPLPPGQTGWPLIGETLNYLSCVKSGFSENFVKYRKEKYSPKVFRTSLLGEPMA  107

Query  275  VFCGAAGNKffftnentllttWWPQSV  355
            + CG  GNKF ++ E  L+ TW+P SV
Sbjct  108  ILCGPEGNKFLYSTEKKLVQTWFPSSV  134



>gb|KDP43440.1| hypothetical protein JCGZ_16727 [Jatropha curcas]
Length=462

 Score = 78.2 bits (191),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 58/79 (73%), Gaps = 6/79 (8%)
 Frame = +2

Query  137  LPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSILGEKVAVFCGAAGN  298
            LPPG TG P +GE+++ +       PEK+I +RM KYS ++F+TSILGE+ A+ CG  GN
Sbjct  34   LPPGKTGLPYVGESLEFLSTGRKGHPEKFILERMTKYSCQIFRTSILGEQTAILCGPQGN  93

Query  299  KffftnentllttWWPQSV  355
            KF F+NEN L+T WWP+SV
Sbjct  94   KFLFSNENKLVTAWWPKSV  112



>gb|AIN44011.1| cytochrome P450, partial [Panax notoginseng]
Length=506

 Score = 78.6 bits (192),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 58/87 (67%), Gaps = 6/87 (7%)
 Frame = +2

Query  113  KANTSKPNLPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSPEVFKTSILGEKVA  274
            K N SK  LPPG TGWP+IGE ++ +        E ++  R +KYSP+VF+TS+LGE +A
Sbjct  54   KENDSKAPLPPGQTGWPLIGETLNYLSCVKSGFSENFVKYRKEKYSPKVFRTSLLGEPMA  113

Query  275  VFCGAAGNKffftnentllttWWPQSV  355
            + CG  GNKF ++ E  L+ TW+P SV
Sbjct  114  ILCGPEGNKFLYSTEKKLVQTWFPSSV  140



>ref|XP_002523409.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF38988.1| cytochrome P450, putative [Ricinus communis]
Length=455

 Score = 77.8 bits (190),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 44/81 (54%), Positives = 54/81 (67%), Gaps = 6/81 (7%)
 Frame = +2

Query  131  PNLPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSPEVFKTSILGEKVAVFCGAA  292
            PNLPPG  GWP+IGE            PEK+I +RM+KY   VFKTS+LG+  AV  G A
Sbjct  35   PNLPPGRLGWPLIGETPAFFRAGFEAKPEKFIGERMEKYDSRVFKTSLLGKPFAVISGTA  94

Query  293  GNKffftnentllttWWPQSV  355
            G+KF F+NEN L+  WWP+SV
Sbjct  95   GHKFLFSNENKLVNLWWPESV  115



>ref|XP_011089170.1| PREDICTED: beta-amyrin 28-oxidase-like [Sesamum indicum]
Length=492

 Score = 77.8 bits (190),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 59/88 (67%), Gaps = 6/88 (7%)
 Frame = +2

Query  110  TKANTSKPNLPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSPEVFKTSILGEKV  271
            +K+     NLPPGS GWP++GE +  +       PEK++ +RM KY  +VFKTS+LGE V
Sbjct  38   SKSRNKILNLPPGSYGWPILGETMAFLRGSIDGSPEKFVKERMDKYKTQVFKTSLLGESV  97

Query  272  AVFCGAAGNKffftnentllttWWPQSV  355
            AV  G AG KF F+NEN L+T WWP SV
Sbjct  98   AVLRGPAGYKFLFSNENKLVTVWWPSSV  125



>ref|NP_198463.1| cytochrome P450, family 716, subfamily A, polypeptide 2 [Arabidopsis 
thaliana]
 dbj|BAA96889.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED94048.1| cytochrome P450, family 716, subfamily A, polypeptide 2 [Arabidopsis 
thaliana]
Length=318

 Score = 76.3 bits (186),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 63/95 (66%), Gaps = 8/95 (8%)
 Frame = +2

Query  95   IIYFITK--ANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKT  250
            +++F+ K  +N   PNLPPG  G+P+IGE +  +       PEK+++DR++ +S  +FKT
Sbjct  17   LLFFLGKHLSNFRYPNLPPGKIGFPLIGETLSFLSAGRQGHPEKFVTDRVRHFSSGIFKT  76

Query  251  SILGEKVAVFCGAAGNKffftnentllttWWPQSV  355
             + G   AV  GA+GNKF FTNEN L+ +WWP SV
Sbjct  77   HLFGSPFAVVTGASGNKFLFTNENKLVISWWPDSV  111



>gb|ABC94482.1| putative taxane 13-alpha-hydroxylase cytochrome P450 [Artemisia 
annua]
Length=480

 Score = 77.8 bits (190),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 45/86 (52%), Positives = 59/86 (69%), Gaps = 7/86 (8%)
 Frame = +2

Query  119  NTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKY-SPEVFKTSILGEKVAV  277
            +T+  NLPPGS GWP IGE +  +       PE++  +R++KY S  VFKTS+ GE++AV
Sbjct  27   STTTKNLPPGSFGWPFIGETLAYIRSKRGGDPERFTKERIEKYGSTLVFKTSVAGERMAV  86

Query  278  FCGAAGNKffftnentllttWWPQSV  355
            FCG  GNKF F NEN L+ +WWP SV
Sbjct  87   FCGPEGNKFLFGNENKLVASWWPNSV  112



>ref|XP_008388262.1| PREDICTED: beta-amyrin 28-oxidase-like [Malus domestica]
Length=478

 Score = 77.4 bits (189),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 57/88 (65%), Gaps = 2/88 (2%)
 Frame = +2

Query  98   IYFITKANTSKPNLPPGSTGWPVIGENIDLMV--PEKYISDRMKKYSPEVFKTSILGEKV  271
            ++   + +    NLPPGS GWP+ GE ++ +   PE ++  RM++YSP++FKT ILGEK 
Sbjct  19   VFAFKRNSDDSNNLPPGSMGWPIXGETLEFLFGKPENFVFKRMRRYSPDIFKTKILGEKT  78

Query  272  AVFCGAAGNKffftnentllttWWPQSV  355
            AV CG  G+KF F+NE    T + P S+
Sbjct  79   AVICGPNGHKFLFSNEQKYFTAFRPHSM  106



>ref|XP_004308257.1| PREDICTED: beta-amyrin 28-oxidase-like [Fragaria vesca subsp. 
vesca]
Length=515

 Score = 77.0 bits (188),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 45/81 (56%), Positives = 58/81 (72%), Gaps = 10/81 (12%)
 Frame = +2

Query  134  NLPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSP----EVFKTSILGEKVAVFC  283
             LPPGSTGWP+IGE ++ +      VPEK+I+DR  K+S     +VFKTS+L E +AV C
Sbjct  40   QLPPGSTGWPIIGETLEYLSTAKQGVPEKFIADRRNKHSSSVPCKVFKTSLLQESMAVLC  99

Query  284  GAAGNKffftnentllttWWP  346
             AAGNKF F+NEN L+ +WWP
Sbjct  100  TAAGNKFLFSNENKLVKSWWP  120



>ref|XP_010533078.1| PREDICTED: beta-amyrin 28-oxidase-like [Tarenaya hassleriana]
Length=469

 Score = 77.0 bits (188),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 42/90 (47%), Positives = 62/90 (69%), Gaps = 3/90 (3%)
 Frame = +2

Query  95   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV---PEKYISDRMKKYSPEVFKTSILGE  265
             I++   ++ S PNLPPG+ G+P +GE +  +    PEK++SDR++++S  VFKT I+G 
Sbjct  18   FIFYKHLSHFSYPNLPPGNIGFPFLGETLSFLSSGRPEKFVSDRVRRFSSAVFKTHIVGS  77

Query  266  KVAVFCGAAGNKffftnentllttWWPQSV  355
              AV  G+ GNKF FTNE+ L+ +WWP SV
Sbjct  78   PAAVVSGSLGNKFLFTNEDKLVVSWWPDSV  107



>emb|CBI39947.3| unnamed protein product [Vitis vinifera]
Length=210

 Score = 74.7 bits (182),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 48/75 (64%), Gaps = 6/75 (8%)
 Frame = +2

Query  95   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  256
            II+ + +  ++   LP G+ GWP+IGE +   +      P ++I +RM KYSP VF+TS+
Sbjct  19   IIFLVIRYKSATARLPLGNQGWPIIGETLAFALGKKSGNPTRFIKERMMKYSPNVFQTSL  78

Query  257  LGEKVAVFCGAAGNK  301
            +GEKV VFCG   NK
Sbjct  79   VGEKVVVFCGPTRNK  93



>ref|XP_002325238.1| hypothetical protein POPTR_0018s13420g [Populus trichocarpa]
 gb|EEF03803.1| hypothetical protein POPTR_0018s13420g [Populus trichocarpa]
Length=475

 Score = 77.0 bits (188),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 60/93 (65%), Gaps = 6/93 (6%)
 Frame = +2

Query  95   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  256
            II    ++    PNLPPGS+G P IGE ++L++      P+K+  DR  KY+ EVFKT++
Sbjct  17   IIVHKHRSKFKHPNLPPGSSGLPYIGETLELLLTGCKGHPQKFFLDRKAKYASEVFKTNL  76

Query  257  LGEKVAVFCGAAGNKffftnentllttWWPQSV  355
              +  AV CGAAGNKF F+NEN +L  W+P  V
Sbjct  77   FCQPAAVLCGAAGNKFLFSNENKVLKAWYPDFV  109



>ref|XP_004172744.1| PREDICTED: cytochrome P450 716B1-like [Cucumis sativus]
Length=179

 Score = 74.3 bits (181),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 59/87 (68%), Gaps = 6/87 (7%)
 Frame = +2

Query  113  KANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSILGEKVA  274
            K+  S PN PPG+ G P++GE+++ +       PEK+I DR+ KY  +VFKTSI+G   A
Sbjct  28   KSLFSYPNTPPGAIGLPILGESVEFLSSGWKGHPEKFIFDRLNKYKSDVFKTSIVGVPAA  87

Query  275  VFCGAAGNKffftnentllttWWPQSV  355
            +FCG   NKF F+NEN L+T WWP SV
Sbjct  88   IFCGPICNKFLFSNENKLVTPWWPDSV  114



>ref|XP_006425177.1| hypothetical protein CICLE_v10030148mg [Citrus clementina]
 gb|ESR38417.1| hypothetical protein CICLE_v10030148mg [Citrus clementina]
Length=495

 Score = 77.0 bits (188),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 53/79 (67%), Gaps = 6/79 (8%)
 Frame = +2

Query  137  LPPGSTGWPVIGENIDLM------VPEKYISDRMKKYSPEVFKTSILGEKVAVFCGAAGN  298
            LPPG  G P IGE+++ +       PEK+I DRM KYS +VFKT+ILGE   V CGA  N
Sbjct  45   LPPGKMGLPYIGESLEFLNSGRKGFPEKFIYDRMAKYSSQVFKTAILGEPTVVVCGAIAN  104

Query  299  KffftnentllttWWPQSV  355
            KF F+NEN L+  WWP SV
Sbjct  105  KFLFSNENKLVQAWWPDSV  123



>ref|XP_002325239.2| hypothetical protein POPTR_0018s13420g [Populus trichocarpa]
 gb|EEF03804.2| hypothetical protein POPTR_0018s13420g [Populus trichocarpa]
Length=384

 Score = 75.9 bits (185),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 44/93 (47%), Positives = 60/93 (65%), Gaps = 6/93 (6%)
 Frame = +2

Query  95   IIYFITKANTSKPNLPPGSTGWPVIGENIDLMV------PEKYISDRMKKYSPEVFKTSI  256
            II    ++    PNLPPGS+G P IGE ++L++      P+K+  DR  KY+ EVFKT++
Sbjct  17   IIVHKHRSKFKHPNLPPGSSGLPYIGETLELLLTGCKGHPQKFFLDRKAKYASEVFKTNL  76

Query  257  LGEKVAVFCGAAGNKffftnentllttWWPQSV  355
              +  AV CGAAGNKF F+NEN +L  W+P  V
Sbjct  77   FCQPAAVLCGAAGNKFLFSNENKVLKAWYPDFV  109



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 567748279395