BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002A20

Length=519
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004239847.1|  PREDICTED: protein transport protein SEC23-like    182   2e-50   Solanum lycopersicum
ref|XP_006365462.1|  PREDICTED: protein transport protein SEC23-like    182   2e-50   Solanum tuberosum [potatoes]
ref|XP_009799069.1|  PREDICTED: protein transport protein SEC23-like    178   1e-48   Nicotiana sylvestris
ref|XP_009622558.1|  PREDICTED: protein transport protein SEC23-like    178   1e-48   Nicotiana tomentosiformis
ref|XP_006358773.1|  PREDICTED: protein transport protein SEC23-like    176   3e-48   Solanum tuberosum [potatoes]
ref|XP_004247906.1|  PREDICTED: protein transport protein SEC23-like    174   1e-47   Solanum lycopersicum
gb|KDO52832.1|  hypothetical protein CISIN_1g0042381mg                  162   2e-44   Citrus sinensis [apfelsine]
emb|CDP15130.1|  unnamed protein product                                165   4e-44   Coffea canephora [robusta coffee]
gb|EPS74608.1|  hypothetical protein M569_00146                         158   1e-43   Genlisea aurea
ref|XP_003601725.1|  Protein transport protein Sec23                    163   1e-43   
gb|EYU38948.1|  hypothetical protein MIMGU_mgv1a001629mg                164   1e-43   Erythranthe guttata [common monkey flower]
ref|XP_009378161.1|  PREDICTED: protein transport protein SEC23-like    164   2e-43   Pyrus x bretschneideri [bai li]
ref|XP_004502262.1|  PREDICTED: protein transport protein SEC23-l...    163   2e-43   Cicer arietinum [garbanzo]
ref|XP_003601724.1|  Protein transport protein Sec23                    163   2e-43   Medicago truncatula
ref|XP_009373604.1|  PREDICTED: protein transport protein SEC23-like    163   3e-43   Pyrus x bretschneideri [bai li]
ref|XP_010097955.1|  Protein transport protein SEC23                    162   3e-43   Morus notabilis
ref|XP_011084141.1|  PREDICTED: protein transport protein SEC23-like    162   4e-43   Sesamum indicum [beniseed]
ref|XP_006421049.1|  hypothetical protein CICLE_v10004373mg             162   4e-43   Citrus clementina [clementine]
ref|XP_006492989.1|  PREDICTED: protein transport protein SEC23-like    162   4e-43   Citrus sinensis [apfelsine]
ref|XP_008337484.1|  PREDICTED: protein transport protein SEC23         162   6e-43   
ref|XP_010028115.1|  PREDICTED: protein transport protein SEC23-like    161   1e-42   Eucalyptus grandis [rose gum]
gb|KDP32574.1|  hypothetical protein JCGZ_13124                         160   2e-42   Jatropha curcas
ref|XP_007221956.1|  hypothetical protein PRUPE_ppa001742mg             160   2e-42   Prunus persica
ref|XP_003552491.1|  PREDICTED: protein transport protein SEC23-l...    160   2e-42   Glycine max [soybeans]
ref|XP_008222792.1|  PREDICTED: protein transport protein SEC23         160   2e-42   Prunus mume [ume]
ref|XP_010650390.1|  PREDICTED: protein transport protein SEC23-like    160   2e-42   Vitis vinifera
ref|XP_009349001.1|  PREDICTED: protein transport protein SEC23-like    160   3e-42   Pyrus x bretschneideri [bai li]
ref|XP_007163794.1|  hypothetical protein PHAVU_001G264700g             159   4e-42   Phaseolus vulgaris [French bean]
ref|XP_010270294.1|  PREDICTED: protein transport protein SEC23-like    159   5e-42   Nelumbo nucifera [Indian lotus]
ref|XP_002516399.1|  protein transport protein sec23, putative          159   8e-42   Ricinus communis
ref|XP_007153808.1|  hypothetical protein PHAVU_003G066300g             159   1e-41   Phaseolus vulgaris [French bean]
ref|XP_007034166.1|  Sec23/Sec24 protein transport family protein       159   1e-41   Theobroma cacao [chocolate]
ref|XP_004172995.1|  PREDICTED: LOW QUALITY PROTEIN: protein tran...    153   1e-41   
ref|XP_010683601.1|  PREDICTED: protein transport protein SEC23-like    158   2e-41   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003538532.1|  PREDICTED: protein transport protein SEC23-l...    157   3e-41   Glycine max [soybeans]
ref|XP_004296961.1|  PREDICTED: protein transport protein SEC23-like    157   3e-41   Fragaria vesca subsp. vesca
gb|EPS72601.1|  hypothetical protein M569_02145                         157   5e-41   Genlisea aurea
gb|KJB37899.1|  hypothetical protein B456_006G225300                    155   2e-40   Gossypium raimondii
gb|KJB37898.1|  hypothetical protein B456_006G225300                    155   2e-40   Gossypium raimondii
gb|KJB71965.1|  hypothetical protein B456_011G150700                    154   3e-40   Gossypium raimondii
gb|KHF97532.1|  Protein transport SEC23                                 154   3e-40   Gossypium arboreum [tree cotton]
ref|XP_008439044.1|  PREDICTED: protein transport protein SEC23         154   3e-40   Cucumis melo [Oriental melon]
gb|KGN57237.1|  hypothetical protein Csa_3G172420                       154   3e-40   Cucumis sativus [cucumbers]
ref|XP_010269071.1|  PREDICTED: protein transport protein SEC23-like    154   4e-40   Nelumbo nucifera [Indian lotus]
ref|XP_004147649.1|  PREDICTED: protein transport protein SEC23-like    154   4e-40   
ref|XP_011045698.1|  PREDICTED: protein transport protein SEC23-like    154   4e-40   Populus euphratica
gb|KHG15352.1|  Protein transport SEC23                                 154   4e-40   Gossypium arboreum [tree cotton]
ref|XP_006370915.1|  transport family protein                           154   6e-40   
ref|XP_011046336.1|  PREDICTED: protein transport protein SEC23-like    154   6e-40   Populus euphratica
ref|NP_974544.1|  sec23/sec24-like transport protein                    150   5e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002300208.1|  transport family protein                           151   5e-39   Populus trichocarpa [western balsam poplar]
emb|CDY12738.1|  BnaC04g29030D                                          150   7e-39   Brassica napus [oilseed rape]
ref|XP_010466720.1|  PREDICTED: protein transport protein SEC23-like    150   1e-38   Camelina sativa [gold-of-pleasure]
gb|AAM10394.1|  AT4g14160/dl3120w                                       150   1e-38   Arabidopsis thaliana [mouse-ear cress]
emb|CAB10195.1|  transport protein                                      150   1e-38   Arabidopsis thaliana [mouse-ear cress]
ref|NP_193152.2|  sec23/sec24-like transport protein                    150   1e-38   Arabidopsis thaliana [mouse-ear cress]
ref|NP_849541.2|  sec23/sec24-like transport protein                    150   1e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010532717.1|  PREDICTED: protein transport protein SEC23-l...    149   1e-38   Tarenaya hassleriana [spider flower]
ref|XP_006418018.1|  hypothetical protein EUTSA_v10006857mg             150   1e-38   Eutrema salsugineum [saltwater cress]
gb|KHG16267.1|  Protein transport Sec23A                                150   1e-38   Gossypium arboreum [tree cotton]
ref|XP_010527425.1|  PREDICTED: protein transport protein SEC23-l...    148   2e-38   Tarenaya hassleriana [spider flower]
gb|KJB28028.1|  hypothetical protein B456_005G022700                    147   2e-38   Gossypium raimondii
ref|XP_010532714.1|  PREDICTED: protein transport protein SEC23-l...    149   3e-38   Tarenaya hassleriana [spider flower]
emb|CDX90271.1|  BnaA08g17130D                                          149   3e-38   
gb|KHG04907.1|  Protein transport SEC23                                 149   3e-38   Gossypium arboreum [tree cotton]
gb|KFK39665.1|  hypothetical protein AALP_AA3G273400                    149   3e-38   Arabis alpina [alpine rockcress]
ref|XP_010527422.1|  PREDICTED: protein transport protein SEC23-l...    149   3e-38   Tarenaya hassleriana [spider flower]
ref|XP_010512680.1|  PREDICTED: protein transport protein SEC23-l...    149   4e-38   Camelina sativa [gold-of-pleasure]
ref|XP_002892293.1|  hypothetical protein ARALYDRAFT_470552             148   7e-38   
ref|XP_006283156.1|  hypothetical protein CARUB_v10004186mg             148   8e-38   Capsella rubella
ref|XP_010522277.1|  PREDICTED: protein transport protein SEC23         148   9e-38   Tarenaya hassleriana [spider flower]
emb|CDY12077.1|  BnaC03g59930D                                          147   9e-38   Brassica napus [oilseed rape]
gb|KJB28027.1|  hypothetical protein B456_005G022700                    147   1e-37   Gossypium raimondii
ref|XP_010485034.1|  PREDICTED: protein transport protein SEC23-like    147   1e-37   Camelina sativa [gold-of-pleasure]
gb|KFK42891.1|  hypothetical protein AALP_AA1G052100                    147   1e-37   Arabis alpina [alpine rockcress]
gb|KJB30033.1|  hypothetical protein B456_005G128200                    145   1e-37   Gossypium raimondii
ref|XP_006414783.1|  hypothetical protein EUTSA_v10024465mg             146   3e-37   Eutrema salsugineum [saltwater cress]
gb|KJB30034.1|  hypothetical protein B456_005G128200                    144   4e-37   Gossypium raimondii
gb|AAL08282.1|  At1g05520/T25N20_16                                     145   4e-37   Arabidopsis thaliana [mouse-ear cress]
gb|AAF79733.1|AC005106_14  T25N20.17                                    146   4e-37   Arabidopsis thaliana [mouse-ear cress]
ref|NP_563741.1|  sec23/sec24-like transport protein                    145   5e-37   Arabidopsis thaliana [mouse-ear cress]
gb|KFK22996.1|  hypothetical protein AALP_AAs50735U000600               145   7e-37   Arabis alpina [alpine rockcress]
emb|CDY01197.1|  BnaA04g06220D                                          145   8e-37   
ref|XP_002885585.1|  hypothetical protein ARALYDRAFT_479878             145   8e-37   
gb|KJB30032.1|  hypothetical protein B456_005G128200                    145   8e-37   Gossypium raimondii
ref|XP_009111051.1|  PREDICTED: protein transport protein SEC23         144   1e-36   Brassica rapa
emb|CDX86574.1|  BnaC08g01290D                                          144   1e-36   
ref|XP_008785319.1|  PREDICTED: protein transport protein SEC23-like    144   2e-36   Phoenix dactylifera
ref|XP_010457640.1|  PREDICTED: protein transport protein SEC23-l...    144   2e-36   
ref|XP_009419583.1|  PREDICTED: protein transport protein SEC23-like    144   2e-36   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010475248.1|  PREDICTED: protein transport protein SEC23-like    143   4e-36   Camelina sativa [gold-of-pleasure]
emb|CBI39378.3|  unnamed protein product                                142   4e-36   Vitis vinifera
ref|XP_010934373.1|  PREDICTED: protein transport protein SEC23-l...    140   6e-36   
ref|XP_002870333.1|  hypothetical protein ARALYDRAFT_493493             142   6e-36   
ref|XP_009139544.1|  PREDICTED: protein transport protein SEC23-like    142   6e-36   Brassica rapa
ref|XP_009420223.1|  PREDICTED: protein transport protein SEC23-like    142   8e-36   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006303716.1|  hypothetical protein CARUB_v10011838mg             142   8e-36   Capsella rubella
ref|NP_189008.1|  Sec23/Sec24 protein transport family protein          141   2e-35   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001189956.1|  Sec23/Sec24 protein transport family protein       141   2e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010934372.1|  PREDICTED: protein transport protein SEC23-l...    140   5e-35   Elaeis guineensis
ref|XP_010908064.1|  PREDICTED: protein transport protein SEC23-l...    140   5e-35   Elaeis guineensis
ref|XP_006297004.1|  hypothetical protein CARUB_v10012995mg             140   6e-35   Capsella rubella
ref|XP_010908065.1|  PREDICTED: protein transport protein SEC23-l...    140   6e-35   
ref|XP_006297005.1|  hypothetical protein CARUB_v10012995mg             140   7e-35   
ref|XP_009414536.1|  PREDICTED: protein transport protein SEC23-like    134   6e-33   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010440522.1|  PREDICTED: protein transport protein SEC23-like    133   2e-32   Camelina sativa [gold-of-pleasure]
ref|XP_008791501.1|  PREDICTED: protein transport protein SEC23-like    132   3e-32   Phoenix dactylifera
ref|XP_009417946.1|  PREDICTED: protein transport protein SEC23-like    132   4e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006827919.1|  hypothetical protein AMTR_s00008p00163370          132   4e-32   Amborella trichopoda
ref|XP_010435181.1|  PREDICTED: protein transport protein SEC23-like    127   2e-30   Camelina sativa [gold-of-pleasure]
ref|XP_001762459.1|  predicted protein                                  124   1e-29   
gb|KJB72954.1|  hypothetical protein B456_011G205900                    123   4e-29   Gossypium raimondii
ref|XP_003577593.1|  PREDICTED: protein transport protein SEC23-like    123   4e-29   Brachypodium distachyon [annual false brome]
gb|KJB72955.1|  hypothetical protein B456_011G205900                    123   4e-29   Gossypium raimondii
ref|XP_001774792.1|  predicted protein                                  123   4e-29   
gb|KDP24898.1|  hypothetical protein JCGZ_24276                         124   4e-29   Jatropha curcas
ref|XP_003059046.1|  predicted protein                                  123   4e-29   Micromonas pusilla CCMP1545
gb|KJB72956.1|  hypothetical protein B456_011G205900                    123   5e-29   Gossypium raimondii
gb|KJB72952.1|  hypothetical protein B456_011G205900                    123   5e-29   Gossypium raimondii
ref|XP_010450096.1|  PREDICTED: protein transport protein SEC23-like    123   6e-29   Camelina sativa [gold-of-pleasure]
ref|XP_007011443.1|  Sec23/Sec24 protein transport family protein...    122   7e-29   Theobroma cacao [chocolate]
gb|EAZ07329.1|  hypothetical protein OsI_29578                          119   8e-29   Oryza sativa Indica Group [Indian rice]
ref|XP_010255698.1|  PREDICTED: protein transport protein SEC23-like    122   8e-29   Nelumbo nucifera [Indian lotus]
ref|XP_009387153.1|  PREDICTED: protein transport protein SEC23         122   1e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010939455.1|  PREDICTED: protein transport protein SEC23 i...    121   1e-28   
ref|XP_002526529.1|  protein transport protein sec23, putative          122   1e-28   Ricinus communis
gb|KJB78641.1|  hypothetical protein B456_013G010400                    119   2e-28   Gossypium raimondii
ref|XP_010278786.1|  PREDICTED: protein transport protein SEC23-l...    121   2e-28   
ref|XP_007011442.1|  Sec23/Sec24 protein transport family protein...    122   2e-28   
ref|XP_002508348.1|  predicted protein                                  122   2e-28   Micromonas commoda
ref|XP_008797249.1|  PREDICTED: protein transport protein sec23 i...    121   2e-28   
ref|XP_010278781.1|  PREDICTED: protein transport protein SEC23-l...    121   2e-28   
ref|XP_010939452.1|  PREDICTED: protein transport protein SEC23 i...    121   2e-28   Elaeis guineensis
emb|CAN81541.1|  hypothetical protein VITISV_008772                     119   2e-28   Vitis vinifera
ref|XP_010278785.1|  PREDICTED: protein transport protein SEC23-l...    121   2e-28   Nelumbo nucifera [Indian lotus]
ref|XP_002444510.1|  hypothetical protein SORBIDRAFT_07g023060          121   2e-28   Sorghum bicolor [broomcorn]
ref|XP_010278782.1|  PREDICTED: protein transport protein SEC23-l...    121   2e-28   Nelumbo nucifera [Indian lotus]
ref|XP_010278787.1|  PREDICTED: protein transport protein SEC23-l...    121   2e-28   Nelumbo nucifera [Indian lotus]
ref|XP_008797246.1|  PREDICTED: protein transport protein SEC23 i...    121   2e-28   Phoenix dactylifera
ref|XP_008375693.1|  PREDICTED: protein transport protein SEC23-like    119   3e-28   
gb|EMS65767.1|  Protein transport protein SEC23                         119   5e-28   Triticum urartu
ref|XP_010097714.1|  Protein transport protein SEC23                    120   6e-28   
ref|XP_011024746.1|  PREDICTED: protein transport protein SEC23-l...    120   6e-28   Populus euphratica
ref|XP_011024747.1|  PREDICTED: protein transport protein SEC23-l...    120   7e-28   Populus euphratica
gb|KJB78640.1|  hypothetical protein B456_013G010400                    119   7e-28   Gossypium raimondii
ref|XP_011010741.1|  PREDICTED: protein transport protein SEC23-like    119   8e-28   Populus euphratica
gb|KJB78639.1|  hypothetical protein B456_013G010400                    119   8e-28   Gossypium raimondii
dbj|BAJ93511.1|  predicted protein                                      119   9e-28   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB78634.1|  hypothetical protein B456_013G010400                    119   9e-28   Gossypium raimondii
gb|KJB78638.1|  hypothetical protein B456_013G010400                    119   1e-27   Gossypium raimondii
gb|KJB78636.1|  hypothetical protein B456_013G010400                    119   1e-27   Gossypium raimondii
ref|NP_001062030.1|  Os08g0474700                                       119   1e-27   
ref|XP_008344490.1|  PREDICTED: protein transport protein SEC23-like    115   1e-27   
ref|XP_006375610.1|  hypothetical protein POPTR_0014s17660g             119   1e-27   Populus trichocarpa [western balsam poplar]
ref|XP_003578242.1|  PREDICTED: protein transport protein SEC23-like    119   1e-27   Brachypodium distachyon [annual false brome]
ref|XP_002320574.1|  transport family protein                           119   1e-27   
ref|XP_009361354.1|  PREDICTED: protein transport protein SEC23-like    119   2e-27   Pyrus x bretschneideri [bai li]
ref|XP_002265101.1|  PREDICTED: protein transport protein SEC23         119   2e-27   Vitis vinifera
emb|CBI38071.3|  unnamed protein product                                119   2e-27   Vitis vinifera
ref|XP_007220245.1|  hypothetical protein PRUPE_ppa001813mg             118   2e-27   Prunus persica
gb|AAX96396.1|  At1g05520/T25N20_16                                     118   2e-27   Oryza sativa Japonica Group [Japonica rice]
gb|EMS46122.1|  Protein transport protein SEC23                         118   2e-27   Triticum urartu
ref|XP_008232223.1|  PREDICTED: protein transport protein SEC23         118   2e-27   Prunus mume [ume]
gb|EAY80788.1|  hypothetical protein OsI_35968                          118   2e-27   Oryza sativa Indica Group [Indian rice]
ref|XP_004973675.1|  PREDICTED: protein transport protein SEC23-l...    118   3e-27   Setaria italica
gb|EMT03462.1|  Protein transport protein SEC23                         118   3e-27   
gb|EMT27989.1|  Protein transport protein sec-23                        118   3e-27   
ref|XP_004973674.1|  PREDICTED: protein transport protein SEC23-l...    117   4e-27   Setaria italica
ref|XP_004160683.1|  PREDICTED: protein transport protein SEC23-like    117   4e-27   
ref|XP_004964627.1|  PREDICTED: protein transport protein SEC23-l...    117   4e-27   
ref|XP_004145019.1|  PREDICTED: LOW QUALITY PROTEIN: protein tran...    117   4e-27   
ref|XP_004153079.1|  PREDICTED: protein transport protein SEC23-like    117   4e-27   
ref|XP_008460075.1|  PREDICTED: protein transport protein SEC23         117   4e-27   Cucumis melo [Oriental melon]
ref|XP_004307298.1|  PREDICTED: protein transport protein SEC23         117   6e-27   Fragaria vesca subsp. vesca
ref|XP_002460346.1|  hypothetical protein SORBIDRAFT_02g026780          117   7e-27   Sorghum bicolor [broomcorn]
ref|XP_006659495.1|  PREDICTED: protein transport protein SEC23-like    117   7e-27   Oryza brachyantha
dbj|BAJ85358.1|  predicted protein                                      116   1e-26   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAK01218.1|  predicted protein                                      116   1e-26   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KHG07260.1|  Protein transport SEC23                                 116   1e-26   Gossypium arboreum [tree cotton]
ref|XP_009376310.1|  PREDICTED: protein transport protein SEC23-like    115   2e-26   Pyrus x bretschneideri [bai li]
ref|XP_008344985.1|  PREDICTED: protein transport protein SEC23         115   2e-26   
ref|XP_010052697.1|  PREDICTED: protein transport protein SEC23         115   2e-26   Eucalyptus grandis [rose gum]
gb|EEE67142.1|  hypothetical protein OsJ_24197                          115   3e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003626854.1|  Protein transport protein SEC23                    114   5e-26   Medicago truncatula
gb|KDO85352.1|  hypothetical protein CISIN_1g004199mg                   112   5e-26   Citrus sinensis [apfelsine]
gb|EEC82002.1|  hypothetical protein OsI_25948                          114   7e-26   Oryza sativa Indica Group [Indian rice]
tpg|DAA40251.1|  TPA: hypothetical protein ZEAMMB73_365624              114   8e-26   
ref|XP_008668489.1|  PREDICTED: uncharacterized protein LOC100384...    114   8e-26   
ref|XP_002946892.1|  hypothetical protein VOLCADRAFT_103128             114   9e-26   Volvox carteri f. nagariensis
ref|XP_001702936.1|  COP-II coat subunit                                113   1e-25   Chlamydomonas reinhardtii
ref|XP_005843379.1|  hypothetical protein CHLNCDRAFT_141205             111   1e-25   Chlorella variabilis
gb|KDO85351.1|  hypothetical protein CISIN_1g004199mg                   112   2e-25   Citrus sinensis [apfelsine]
ref|XP_002461253.1|  hypothetical protein SORBIDRAFT_02g043632          107   3e-25   
ref|XP_001774442.1|  predicted protein                                  112   3e-25   
ref|XP_006445524.1|  hypothetical protein CICLE_v10019144mg             112   3e-25   
gb|KDO85350.1|  hypothetical protein CISIN_1g004199mg                   112   3e-25   Citrus sinensis [apfelsine]
ref|XP_006464334.1|  PREDICTED: protein transport protein SEC23-like    112   4e-25   Citrus sinensis [apfelsine]
gb|KDO85349.1|  hypothetical protein CISIN_1g004199mg                   112   4e-25   Citrus sinensis [apfelsine]
ref|XP_010235206.1|  PREDICTED: protein transport protein SEC23-l...    111   6e-25   
ref|XP_003574621.1|  PREDICTED: protein transport protein SEC23-l...    111   6e-25   Brachypodium distachyon [annual false brome]
ref|XP_002966180.1|  hypothetical protein SELMODRAFT_168140             111   6e-25   Selaginella moellendorffii
ref|XP_002982254.1|  hypothetical protein SELMODRAFT_155031             111   7e-25   Selaginella moellendorffii
ref|XP_002102257.1|  GD19805                                            104   9e-25   
ref|XP_010691934.1|  PREDICTED: protein transport protein SEC23         110   1e-24   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004510207.1|  PREDICTED: protein transport protein SEC23-like    110   2e-24   Cicer arietinum [garbanzo]
ref|XP_001765516.1|  predicted protein                                  109   3e-24   
ref|XP_003521007.1|  PREDICTED: protein transport protein SEC23-like    109   3e-24   Glycine max [soybeans]
dbj|BAM19569.1|  protein transport protein sec23                        103   5e-24   Papilio xuthus [Chinese swallowtail]
ref|XP_780042.1|  PREDICTED: protein transport protein Sec23A iso...    108   8e-24   Strongylocentrotus purpuratus [purple urchin]
gb|EPX72404.1|  GTPase activating protein Sec23b                        108   8e-24   Schizosaccharomyces octosporus yFS286
gb|KDP40275.1|  hypothetical protein JCGZ_02273                         107   1e-23   Jatropha curcas
ref|XP_006854134.1|  hypothetical protein AMTR_s00048p00165750          107   2e-23   Amborella trichopoda
ref|XP_011416353.1|  PREDICTED: protein transport protein Sec23A-...    107   2e-23   
ref|XP_011416351.1|  PREDICTED: protein transport protein Sec23A-...    107   2e-23   
ref|XP_002977937.1|  hypothetical protein SELMODRAFT_107900             107   2e-23   
ref|XP_002986965.1|  hypothetical protein SELMODRAFT_124893             107   2e-23   
ref|XP_010495646.1|  PREDICTED: protein transport protein SEC23-like    105   2e-23   Camelina sativa [gold-of-pleasure]
ref|XP_011410444.1|  PREDICTED: protein transport protein Sec23A-...    107   2e-23   Amphimedon queenslandica
ref|XP_009026518.1|  hypothetical protein HELRODRAFT_185982             107   2e-23   Helobdella robusta
gb|EGI70064.1|  Protein transport protein Sec23A                        106   3e-23   Acromyrmex echinatior
ref|XP_004923361.1|  PREDICTED: protein transport protein Sec23A-...    106   3e-23   
ref|XP_004923360.1|  PREDICTED: protein transport protein Sec23A-...    106   3e-23   Bombyx mori [silk moth]
gb|ERL83427.1|  hypothetical protein D910_00401                         106   4e-23   Dendroctonus ponderosae
ref|XP_010531432.1|  PREDICTED: protein transport protein SEC23         106   4e-23   Tarenaya hassleriana [spider flower]
ref|XP_010274198.1|  PREDICTED: protein transport protein Sec23A        106   4e-23   Nelumbo nucifera [Indian lotus]
ref|XP_001751286.1|  predicted protein                                  106   4e-23   
emb|CAB81549.1|  putative Sec23 protein                                 106   5e-23   Drosophila melanogaster
ref|XP_006280033.1|  hypothetical protein CARUB_v10025910mg             106   5e-23   Capsella rubella
gb|KHN32738.1|  Protein transport protein SEC23                         105   6e-23   Glycine soja [wild soybean]
ref|XP_010441998.1|  PREDICTED: protein transport protein SEC23-like    105   6e-23   Camelina sativa [gold-of-pleasure]
gb|AEE62753.1|  unknown                                                 105   6e-23   Dendroctonus ponderosae
gb|ENN77775.1|  hypothetical protein YQE_05747                          105   8e-23   Dendroctonus ponderosae
ref|NP_730978.1|  Sec23 ortholog, isoform A                             105   8e-23   Drosophila melanogaster
ref|XP_002863641.1|  hypothetical protein ARALYDRAFT_494637             105   8e-23   
ref|XP_002431175.1|  protein transport protein Sec23A, putative         105   8e-23   Pediculus humanus corporis [human body lice]
ref|XP_002517022.1|  protein transport protein sec23, putative          105   8e-23   Ricinus communis
gb|AAN71374.1|  RE35250p                                                105   8e-23   Drosophila melanogaster
ref|NP_001246932.1|  Sec23 ortholog, isoform E                          105   9e-23   Drosophila melanogaster
ref|NP_001246933.1|  Sec23 ortholog, isoform F                          105   9e-23   Drosophila melanogaster
dbj|BAB08946.1|  protein transport protein SEC23                        105   9e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001978970.1|  GG12978                                            105   1e-22   Drosophila erecta
ref|XP_002098055.1|  GE10151                                            105   1e-22   Drosophila yakuba
ref|NP_568626.1|  sec23/sec24-like transport protein                    105   1e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010087764.1|  Protein transport protein Sec23A                   105   1e-22   
ref|XP_010481838.1|  PREDICTED: protein transport protein SEC23-like    105   1e-22   Camelina sativa [gold-of-pleasure]
ref|XP_008224182.1|  PREDICTED: protein transport protein SEC23         105   1e-22   Prunus mume [ume]
ref|XP_007225252.1|  hypothetical protein PRUPE_ppa001670mg             105   1e-22   Prunus persica
ref|XP_001998913.1|  GI23366                                            105   1e-22   Drosophila mojavensis
ref|XP_007660591.1|  PREDICTED: protein transport protein Sec23A-...  98.2    1e-22   
ref|XP_010278158.1|  PREDICTED: protein transport protein SEC23-like    105   1e-22   Nelumbo nucifera [Indian lotus]
ref|XP_010024035.1|  PREDICTED: protein transport protein Sec23A        105   1e-22   Eucalyptus grandis [rose gum]
ref|XP_007134267.1|  hypothetical protein PHAVU_010G032700g             105   1e-22   Phaseolus vulgaris [French bean]
ref|XP_009800228.1|  PREDICTED: protein transport protein SEC23         104   1e-22   Nicotiana sylvestris
ref|XP_009629158.1|  PREDICTED: protein transport protein SEC23         104   1e-22   Nicotiana tomentosiformis
gb|EPY54023.1|  GTPase activating protein Sec23b                        104   1e-22   Schizosaccharomyces cryophilus OY26
ref|XP_006403208.1|  hypothetical protein EUTSA_v10003153mg             104   2e-22   Eutrema salsugineum [saltwater cress]
ref|XP_011030584.1|  PREDICTED: protein transport protein sec23-1       104   2e-22   Populus euphratica
gb|EHJ75116.1|  putative protein transport protein sec23                102   2e-22   
ref|XP_011064305.1|  PREDICTED: protein transport protein Sec23A        104   2e-22   Acromyrmex echinatior
ref|XP_003547758.1|  PREDICTED: protein transport protein SEC23-like    104   2e-22   Glycine max [soybeans]
ref|XP_010149983.1|  PREDICTED: protein transport protein Sec23A-...    100   2e-22   Eurypyga helias
ref|XP_002137352.1|  GA26597, isoform A                                 104   2e-22   Drosophila pseudoobscura pseudoobscura
ref|XP_002315735.1|  transport family protein                           104   2e-22   
ref|XP_001990177.1|  GH18375                                            104   2e-22   Drosophila grimshawi
ref|XP_001953052.1|  GF17577                                            104   2e-22   Drosophila ananassae
ref|XP_002070766.1|  GK12234                                            104   2e-22   Drosophila willistoni
ref|XP_002013896.1|  GL24389                                            104   2e-22   
ref|XP_002056184.1|  GJ10360                                            104   2e-22   Drosophila virilis
ref|XP_003736491.1|  GA26597, isoform B                                 104   2e-22   Drosophila pseudoobscura pseudoobscura
gb|KFB45362.1|  hypothetical protein ZHAS_00013314                      104   2e-22   Anopheles sinensis
ref|XP_009101771.1|  PREDICTED: protein transport protein SEC23         103   3e-22   Brassica rapa
ref|XP_005186963.1|  PREDICTED: protein transport protein Sec23A ...    103   3e-22   Musca domestica
ref|XP_005186964.1|  PREDICTED: protein transport protein Sec23A ...    103   3e-22   Musca domestica
gb|ABQ12917.1|  Sec23 (S. cerevisiae) homolog B                       97.8    3e-22   Bos taurus [bovine]
ref|XP_003427585.1|  PREDICTED: protein transport protein Sec23A ...    103   3e-22   Nasonia vitripennis
ref|XP_008549258.1|  PREDICTED: protein transport protein Sec23A ...    103   3e-22   Microplitis demolitor
ref|XP_004229519.1|  PREDICTED: protein transport protein SEC23         103   3e-22   Solanum lycopersicum
ref|XP_008549259.1|  PREDICTED: protein transport protein Sec23A ...    103   3e-22   Microplitis demolitor
ref|XP_008211672.1|  PREDICTED: protein transport protein Sec23A ...    103   3e-22   Nasonia vitripennis
ref|XP_002620173.1|  protein transporter SEC23                          103   3e-22   
ref|XP_002311659.1|  hypothetical protein POPTR_0008s16120g             103   3e-22   
ref|XP_005648317.1|  COP-II coat subunit                                103   3e-22   
gb|EEQ86379.1|  protein transporter sec23                               103   3e-22   
ref|XP_011279270.1|  PREDICTED: protein transport protein Sec23B-...  97.8    4e-22   
ref|XP_002489340.1|  hypothetical protein SORBIDRAFT_0010s021250        103   4e-22   
emb|CDY22339.1|  BnaA06g36610D                                          103   4e-22   
ref|XP_321324.2|  AGAP001759-PA                                         103   4e-22   
gb|EZG08535.1|  protein transporter SEC23                               103   5e-22   
gb|EZF25244.1|  protein transporter SEC23                               103   5e-22   
gb|EGE05200.1|  protein transport protein Sec23                         103   5e-22   
ref|XP_005095979.1|  PREDICTED: protein transport protein Sec23A-...    103   5e-22   
emb|CDX94717.1|  BnaC07g17260D                                          103   5e-22   
gb|EGE00351.1|  protein transporter SEC23                               103   5e-22   
ref|XP_003171482.1|  transporter SEC23                                  103   5e-22   
ref|XP_003233178.1|  protein transporter SEC23                          103   5e-22   
gb|EPX71940.1|  GTPase activating protein Sec23a                        103   5e-22   
ref|XP_003022301.1|  hypothetical protein TRV_03512                     103   5e-22   
ref|XP_002846070.1|  protein transport protein SEC23                    103   5e-22   
ref|XP_005095981.1|  PREDICTED: protein transport protein Sec23A-...    103   5e-22   
ref|XP_007799878.1|  Protein transport protein SEC23                    103   5e-22   
gb|KFK31705.1|  hypothetical protein AALP_AA6G148300                    103   5e-22   
gb|EPY49891.1|  GTPase activating protein Sec23a                        103   5e-22   
ref|XP_006354587.1|  PREDICTED: protein transport protein SEC23-like    103   6e-22   
ref|XP_004979229.1|  PREDICTED: protein transport protein SEC23-like    103   6e-22   
ref|XP_011214742.1|  PREDICTED: protein transport protein Sec23A ...    103   6e-22   
ref|XP_006356052.1|  PREDICTED: protein transport protein SEC23-like    103   6e-22   
ref|XP_011214740.1|  PREDICTED: protein transport protein Sec23A ...    103   6e-22   
ref|XP_004234029.1|  PREDICTED: protein transport protein SEC23         102   6e-22   
emb|CAN67335.1|  hypothetical protein VITISV_024487                     102   6e-22   
gb|EKC40209.1|  transport protein Sec23A                                102   6e-22   
ref|XP_011177751.1|  PREDICTED: protein transport protein Sec23A ...    102   7e-22   
ref|XP_011177750.1|  PREDICTED: protein transport protein Sec23A ...    102   7e-22   
ref|XP_011416350.1|  PREDICTED: protein transport protein Sec23A-...    102   7e-22   
ref|XP_004531028.1|  PREDICTED: protein transport protein Sec23A-...    102   7e-22   
ref|XP_002284161.1|  PREDICTED: protein transport protein SEC23         102   7e-22   
gb|KDD75245.1|  hypothetical protein H632_c788p0                      97.1    7e-22   
ref|XP_004531027.1|  PREDICTED: protein transport protein Sec23A-...    102   7e-22   
ref|XP_003746313.1|  PREDICTED: protein transport protein Sec23A        102   7e-22   
emb|CCO26910.1|  Protein transport protein SEC23                      97.1    8e-22   
gb|EKG21478.1|  Zinc finger Sec23/Sec24-type protein                    102   9e-22   
ref|XP_006616915.1|  PREDICTED: protein transport protein Sec23A-...    102   9e-22   
ref|XP_006567440.1|  PREDICTED: protein transport protein Sec23A-...    102   9e-22   
ref|XP_392515.2|  PREDICTED: protein transport protein Sec23A-lik...    102   9e-22   
gb|ETN64439.1|  protein transport protein sec23                         102   9e-22   
ref|XP_006616914.1|  PREDICTED: protein transport protein Sec23A-...    102   9e-22   
gb|AEZ67826.1|  AGAP001759-PA                                           102   1e-21   
ref|XP_001652783.1|  AAEL007484-PB                                      102   1e-21   
ref|XP_011306630.1|  PREDICTED: protein transport protein Sec23A ...    102   1e-21   
ref|XP_001846775.1|  transport protein sec23                            102   1e-21   
ref|XP_011306629.1|  PREDICTED: protein transport protein Sec23A ...    102   1e-21   
ref|XP_008482918.1|  PREDICTED: LOW QUALITY PROTEIN: protein tran...    101   1e-21   
ref|XP_001652784.1|  AAEL007484-PA                                      102   1e-21   
emb|CBY41352.1|  unnamed protein product                                102   1e-21   
ref|XP_011029889.1|  PREDICTED: protein transport protein sec23-1...    102   1e-21   
ref|XP_003707642.1|  PREDICTED: protein transport protein Sec23A ...    102   1e-21   
ref|XP_003707641.1|  PREDICTED: protein transport protein Sec23A ...    102   1e-21   
ref|XP_011416352.1|  PREDICTED: protein transport protein Sec23A-...    102   1e-21   
dbj|BAN20484.1|  protein transport protein sec23                        102   1e-21   
ref|XP_971475.1|  PREDICTED: protein transport protein Sec23A iso...    102   1e-21   
dbj|BAE33090.1|  unnamed protein product                              99.0    1e-21   
ref|XP_003484429.1|  PREDICTED: protein transport protein Sec23A-...    102   1e-21   
ref|XP_008195413.1|  PREDICTED: protein transport protein Sec23A ...    102   2e-21   
ref|XP_008312513.1|  PREDICTED: protein transport protein Sec23A        101   2e-21   
ref|XP_007515183.1|  predicted protein                                  101   2e-21   
gb|EZA56457.1|  Protein transport protein Sec23A                        101   2e-21   
ref|XP_011335785.1|  PREDICTED: protein transport protein Sec23A        101   2e-21   
ref|XP_001211721.1|  hypothetical protein ATEG_02543                    101   2e-21   
ref|XP_010081860.1|  PREDICTED: protein transport protein Sec23A      99.8    2e-21   
gb|KDR24163.1|  Protein transport protein Sec23A                        101   2e-21   
ref|XP_008477629.1|  PREDICTED: protein transport protein Sec23A-...    101   2e-21   
gb|KFV01574.1|  Protein transport protein Sec23A                      99.8    2e-21   
gb|ADN34158.1|  transport protein sec23                                 101   2e-21   
ref|XP_004376602.1|  PREDICTED: protein transport protein Sec23A      99.0    2e-21   
gb|EDL95155.1|  SEC23B (S. cerevisiae) (predicted), isoform CRA_b     99.4    3e-21   
ref|XP_008589236.1|  PREDICTED: protein transport protein Sec23A      99.4    3e-21   
gb|EHB18824.1|  Protein transport protein Sec23B                        101   3e-21   
ref|XP_004840935.1|  PREDICTED: protein transport protein Sec23B ...    101   3e-21   
ref|XP_004909922.1|  PREDICTED: protein transport protein Sec23B        101   3e-21   
gb|KDE07582.1|  protein transporter SEC23                               101   3e-21   
ref|XP_008465182.1|  PREDICTED: protein transport protein SEC23         100   3e-21   
ref|XP_009373957.1|  PREDICTED: protein transport protein SEC23-l...    100   3e-21   
ref|XP_009373956.1|  PREDICTED: protein transport protein SEC23-l...    100   3e-21   
ref|XP_003203805.1|  PREDICTED: protein transport protein Sec23B        100   3e-21   
ref|NP_001006179.1|  protein transport protein Sec23A                   100   3e-21   
ref|XP_008042194.1|  copii coat protein                                 100   3e-21   
ref|XP_004150433.1|  PREDICTED: protein transport protein SEC23-like    100   4e-21   
ref|XP_004164421.1|  PREDICTED: LOW QUALITY PROTEIN: protein tran...    100   4e-21   
ref|XP_011254641.1|  PREDICTED: protein transport protein Sec23A        100   4e-21   
gb|EDL28470.1|  SEC23B (S. cerevisiae), isoform CRA_b                 99.4    4e-21   
ref|XP_003476542.1|  PREDICTED: protein transport protein Sec23B ...    100   4e-21   
ref|XP_010632467.1|  PREDICTED: protein transport protein Sec23B        100   4e-21   
gb|EFN69453.1|  Protein transport protein Sec23A                        100   4e-21   
ref|XP_005380990.1|  PREDICTED: protein transport protein Sec23B        100   4e-21   
ref|XP_008831120.1|  PREDICTED: protein transport protein Sec23A        100   4e-21   
ref|XP_005695308.1|  PREDICTED: protein transport protein Sec23A ...    100   4e-21   
gb|KGQ01205.1|  protein transporter SEC23                               100   4e-21   
ref|XP_004017955.1|  PREDICTED: protein transport protein Sec23A        100   4e-21   
gb|EME44468.1|  hypothetical protein DOTSEDRAFT_152349                  100   5e-21   
ref|XP_005985813.1|  PREDICTED: LOW QUALITY PROTEIN: Sec23 homolo...    100   5e-21   
ref|XP_008538699.1|  PREDICTED: protein transport protein Sec23B        100   5e-21   
emb|CCA74741.1|  probable SEC23-component of COPII coat of ER-gol...    100   5e-21   
ref|XP_003363993.1|  PREDICTED: protein transport protein Sec23B        100   5e-21   
gb|KIJ06392.1|  hypothetical protein PAXINDRAFT_103385                94.4    5e-21   
ref|XP_001245371.1|  hypothetical protein CIMG_04812                    100   5e-21   
ref|NP_001072659.1|  protein transport protein Sec23A                   100   5e-21   
ref|XP_002792304.1|  transport protein SEC23                            100   5e-21   
ref|XP_008678116.1|  PREDICTED: protein transport protein SEC23-like    100   5e-21   
ref|XP_005072663.1|  PREDICTED: protein transport protein Sec23B        100   5e-21   
ref|XP_010763047.1|  protein transporter SEC23                          100   6e-21   
ref|XP_003962841.1|  PREDICTED: protein transport protein Sec23A-...    100   6e-21   
gb|KEQ62401.1|  hypothetical protein M437DRAFT_49639                    100   6e-21   
ref|XP_010012826.1|  PREDICTED: protein transport protein Sec23A      99.8    6e-21   
gb|KER00109.1|  hypothetical protein AUEXF2481DRAFT_61372               100   7e-21   
ref|XP_008583587.1|  PREDICTED: protein transport protein Sec23B ...    100   7e-21   
ref|XP_008923315.1|  PREDICTED: protein transport protein Sec23A      99.8    7e-21   
ref|XP_009335644.1|  PREDICTED: protein transport protein SEC23-like    100   7e-21   
ref|XP_003933212.1|  PREDICTED: protein transport protein Sec23B        100   7e-21   
ref|XP_009876332.1|  PREDICTED: protein transport protein Sec23A      99.8    7e-21   
ref|XP_007004395.1|  hypothetical protein TREMEDRAFT_71580            99.8    8e-21   
gb|EFX88498.1|  hypothetical protein DAPPUDRAFT_190968                99.8    8e-21   
ref|XP_006015425.1|  PREDICTED: protein transport protein Sec23A      99.8    8e-21   
ref|XP_010287250.1|  PREDICTED: protein transport protein Sec23A      99.8    8e-21   
ref|XP_007891559.1|  PREDICTED: protein transport protein Sec23A      99.8    8e-21   
ref|XP_005479880.1|  PREDICTED: protein transport protein Sec23A      99.8    8e-21   
ref|XP_005021459.1|  PREDICTED: protein transport protein Sec23A ...  99.8    8e-21   
ref|XP_009904914.1|  PREDICTED: protein transport protein Sec23A      99.8    8e-21   
ref|XP_009992172.1|  PREDICTED: protein transport protein Sec23A      99.8    8e-21   
ref|XP_421250.1|  PREDICTED: protein transport protein Sec23A iso...  99.8    8e-21   
ref|XP_006163699.1|  PREDICTED: protein transport protein Sec23B ...  99.8    8e-21   
ref|XP_006163701.1|  PREDICTED: protein transport protein Sec23B ...  99.8    8e-21   
ref|XP_003792045.1|  PREDICTED: protein transport protein Sec23A      99.4    8e-21   
ref|XP_009561911.1|  PREDICTED: protein transport protein Sec23A      99.8    8e-21   
ref|XP_009472738.1|  PREDICTED: protein transport protein Sec23A      99.8    8e-21   
ref|XP_008503441.1|  PREDICTED: protein transport protein Sec23A      99.8    8e-21   
ref|XP_005148968.1|  PREDICTED: protein transport protein Sec23A      99.8    8e-21   
ref|XP_007896517.1|  PREDICTED: protein transport protein Sec23B      99.8    8e-21   
ref|XP_005320491.1|  PREDICTED: protein transport protein Sec23B ...  99.8    8e-21   
ref|XP_009577232.1|  PREDICTED: protein transport protein Sec23A      99.8    8e-21   
ref|XP_009937402.1|  PREDICTED: protein transport protein Sec23A      99.8    8e-21   
ref|XP_002200559.1|  PREDICTED: protein transport protein Sec23A      99.8    8e-21   
ref|XP_005243914.1|  PREDICTED: protein transport protein Sec23A      99.8    8e-21   
ref|XP_009100152.1|  PREDICTED: protein transport protein Sec23A      99.8    8e-21   
ref|XP_009669204.1|  PREDICTED: protein transport protein Sec23A      99.8    8e-21   
ref|XP_010142368.1|  PREDICTED: protein transport protein Sec23A      99.8    8e-21   
ref|XP_009278965.1|  PREDICTED: protein transport protein Sec23A      99.8    8e-21   
ref|XP_008355768.1|  PREDICTED: protein transport protein SEC23-like  99.8    8e-21   
ref|XP_010354943.1|  PREDICTED: protein transport protein Sec23A      99.8    8e-21   
ref|XP_002710997.1|  PREDICTED: protein transport protein Sec23B      99.8    9e-21   
ref|XP_009954309.1|  PREDICTED: protein transport protein Sec23A      99.8    9e-21   
ref|XP_005989219.1|  PREDICTED: protein transport protein Sec23A      99.8    9e-21   
ref|XP_008388605.1|  PREDICTED: protein transport protein SEC23-like  99.8    9e-21   
ref|XP_010305177.1|  PREDICTED: protein transport protein Sec23A      99.8    9e-21   
ref|XP_005047371.1|  PREDICTED: protein transport protein Sec23A      99.8    9e-21   
ref|XP_005992973.1|  PREDICTED: protein transport protein Sec23A-...  99.8    9e-21   
gb|KFP31076.1|  Protein transport protein Sec23A                      99.8    9e-21   
ref|XP_010754153.1|  PREDICTED: protein transport protein Sec23A      99.8    9e-21   
ref|XP_010589816.1|  PREDICTED: protein transport protein Sec23B ...  99.4    9e-21   
ref|XP_005320492.1|  PREDICTED: protein transport protein Sec23B ...  99.8    9e-21   
ref|XP_010198659.1|  PREDICTED: protein transport protein Sec23A      99.8    9e-21   
gb|KFO13060.1|  Protein transport protein Sec23A                      99.8    9e-21   
gb|KEQ75339.1|  hypothetical protein M436DRAFT_41639                  99.8    9e-21   
ref|XP_001374135.1|  PREDICTED: protein transport protein Sec23B ...  99.8    9e-21   
ref|XP_004941831.1|  PREDICTED: protein transport protein Sec23A ...  99.8    9e-21   
dbj|BAG61217.1|  unnamed protein product                              99.8    9e-21   
pdb|3EG9|A  Chain A, Crystal Structure Of The Mammalian Copii-coa...  99.8    9e-21   
ref|XP_006030511.1|  PREDICTED: protein transport protein Sec23A-...  99.8    1e-20   
pdb|3EFO|A  Chain A, Crystal Structure Of The Mammalian Copii-coa...  99.8    1e-20   
ref|NP_006355.2|  protein transport protein Sec23A                    99.8    1e-20   
gb|AAH95404.1|  Sec23 homolog B (S. cerevisiae)                       99.8    1e-20   
ref|XP_006489507.1|  PREDICTED: protein transport protein SEC23-l...  99.8    1e-20   
ref|NP_001248292.1|  protein transport protein Sec23A                 99.8    1e-20   
ref|XP_006259608.1|  PREDICTED: protein transport protein Sec23A-...  99.8    1e-20   
ref|XP_006420097.1|  hypothetical protein CICLE_v10004380mg           99.8    1e-20   
gb|AAH36649.1|  Sec23 homolog A (S. cerevisiae)                       99.8    1e-20   
ref|NP_001126773.1|  protein transport protein Sec23B                 99.8    1e-20   
ref|XP_005152100.1|  PREDICTED: protein transport protein Sec23A-...  99.4    1e-20   
dbj|BAG58980.1|  unnamed protein product                              99.4    1e-20   
pdb|2NUP|A  Chain A, Crystal Structure Of The Human Sec23a24A HET...  99.8    1e-20   
ref|XP_005267319.1|  PREDICTED: protein transport protein Sec23A ...  99.8    1e-20   
ref|XP_008955398.1|  PREDICTED: protein transport protein Sec23A      99.4    1e-20   
ref|XP_009396065.1|  PREDICTED: protein transport protein sec23-1     99.8    1e-20   
ref|XP_002808009.1|  PREDICTED: LOW QUALITY PROTEIN: protein tran...  99.4    1e-20   
ref|NP_001274570.1|  Sec23 homolog B                                  99.4    1e-20   
gb|KDO53915.1|  hypothetical protein CISIN_1g004188mg                 99.4    1e-20   
ref|NP_001126678.1|  protein transport protein Sec23A                 99.4    1e-20   
gb|AAH05404.1|  SEC23B protein                                        99.4    1e-20   
ref|NP_001166217.1|  protein transport protein Sec23B isoform 2       99.4    1e-20   
ref|NP_116780.1|  protein transport protein Sec23B isoform 1          99.4    1e-20   
ref|XP_001269814.1|  protein transport protein Sec23, putative        99.4    1e-20   
ref|XP_009214879.1|  PREDICTED: protein transport protein Sec23B      99.4    1e-20   
ref|XP_009004211.1|  PREDICTED: protein transport protein Sec23A      99.4    1e-20   
ref|XP_009435084.1|  PREDICTED: protein transport protein Sec23B ...  99.4    1e-20   
ref|XP_010368152.1|  PREDICTED: protein transport protein Sec23B      99.4    1e-20   
ref|NP_001267323.1|  protein transport protein Sec23B                 99.4    1e-20   
ref|XP_007984737.1|  PREDICTED: protein transport protein Sec23A ...  99.4    1e-20   
ref|XP_007959355.1|  PREDICTED: protein transport protein Sec23B      99.4    1e-20   
ref|XP_002747524.1|  PREDICTED: protein transport protein Sec23B      99.4    1e-20   
ref|XP_005568308.1|  PREDICTED: protein transport protein Sec23B ...  99.4    1e-20   
ref|XP_010337754.1|  PREDICTED: protein transport protein Sec23A      99.4    1e-20   
dbj|BAC25779.1|  unnamed protein product                              99.4    1e-20   
ref|XP_004584839.1|  PREDICTED: protein transport protein Sec23A ...  99.4    1e-20   
emb|CAA65775.1|  Sec23 protein                                        99.4    1e-20   
gb|EDL28469.1|  SEC23B (S. cerevisiae), isoform CRA_a                 99.4    1e-20   
ref|XP_001943407.1|  PREDICTED: protein transport protein Sec23A      99.4    1e-20   
ref|XP_008838451.1|  PREDICTED: LOW QUALITY PROTEIN: protein tran...  99.4    1e-20   
ref|XP_004646407.1|  PREDICTED: protein transport protein Sec23A      99.8    1e-20   
ref|XP_010589815.1|  PREDICTED: protein transport protein Sec23B ...  99.4    1e-20   
ref|XP_006838861.1|  hypothetical protein AMTR_s00002p00266230        99.4    1e-20   
ref|XP_003268276.2|  PREDICTED: LOW QUALITY PROTEIN: protein tran...  99.4    1e-20   
ref|XP_004404205.1|  PREDICTED: protein transport protein Sec23B ...  99.4    1e-20   
ref|XP_004862804.1|  PREDICTED: protein transport protein Sec23A ...  99.4    1e-20   
ref|XP_006989005.1|  PREDICTED: protein transport protein Sec23A-...  99.4    1e-20   
ref|XP_007465859.1|  PREDICTED: protein transport protein Sec23A ...  99.4    1e-20   
ref|XP_004649663.1|  PREDICTED: protein transport protein Sec23A      99.4    1e-20   
ref|XP_004436439.1|  PREDICTED: protein transport protein Sec23A ...  99.4    1e-20   
ref|XP_003471955.1|  PREDICTED: protein transport protein Sec23A      99.4    1e-20   
ref|XP_006835391.1|  PREDICTED: protein transport protein Sec23A ...  99.4    1e-20   
ref|XP_004270036.1|  PREDICTED: protein transport protein Sec23A ...  99.4    1e-20   
ref|XP_005902353.1|  PREDICTED: protein transport protein Sec23A      99.4    1e-20   
ref|XP_005376946.1|  PREDICTED: protein transport protein Sec23A ...  99.4    1e-20   



>ref|XP_004239847.1| PREDICTED: protein transport protein SEC23-like [Solanum lycopersicum]
Length=784

 Score =   182 bits (463),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 79/99 (80%), Positives = 89/99 (90%), Gaps = 0/99 (0%)
 Frame = +3

Query  222  SSEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCK  401
            ++E++Q D EGIDGVRMTWNAWPRTKVE+SKCVIPIA+SIHLIRP  +L T+PY PLRCK
Sbjct  2    ATEMAQPDAEGIDGVRMTWNAWPRTKVEASKCVIPIASSIHLIRPHTDLPTLPYVPLRCK  61

Query  402  TCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            TCTAVLNPFARVD+QALIWICPFCFQRN FP  YS +SE
Sbjct  62   TCTAVLNPFARVDFQALIWICPFCFQRNHFPQHYSGISE  100



>ref|XP_006365462.1| PREDICTED: protein transport protein SEC23-like [Solanum tuberosum]
Length=784

 Score =   182 bits (463),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 79/99 (80%), Positives = 89/99 (90%), Gaps = 0/99 (0%)
 Frame = +3

Query  222  SSEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCK  401
            ++E++Q D EGIDGVRMTWNAWPRTKVE+SKCVIPIA+SIHLIRP  +L T+PY PLRCK
Sbjct  2    ATEMAQPDAEGIDGVRMTWNAWPRTKVEASKCVIPIASSIHLIRPHTDLPTLPYVPLRCK  61

Query  402  TCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            TCTAVLNPFARVD+QALIWICPFCFQRN FP  YS +SE
Sbjct  62   TCTAVLNPFARVDFQALIWICPFCFQRNHFPQHYSGISE  100



>ref|XP_009799069.1| PREDICTED: protein transport protein SEC23-like [Nicotiana sylvestris]
Length=770

 Score =   178 bits (451),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 76/99 (77%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = +3

Query  222  SSEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCK  401
            ++E++Q D EGIDGVRMTWNAWPRTKVESSKCVIPIA SIHLIRP  +L T+ Y PL+CK
Sbjct  2    ATEMAQPDAEGIDGVRMTWNAWPRTKVESSKCVIPIATSIHLIRPHTDLPTLSYPPLKCK  61

Query  402  TCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            TC++VLNPFARVD+QALIWICPFCFQRN FPH YS ++E
Sbjct  62   TCSSVLNPFARVDFQALIWICPFCFQRNHFPHHYSGINE  100



>ref|XP_009622558.1| PREDICTED: protein transport protein SEC23-like [Nicotiana tomentosiformis]
Length=774

 Score =   178 bits (451),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 76/99 (77%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = +3

Query  222  SSEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCK  401
            ++E++Q D EGIDGVRMTWNAWPRTKVESSKCVIPIA SIHLIRP  +L T+ Y PL+CK
Sbjct  2    ATEMAQPDAEGIDGVRMTWNAWPRTKVESSKCVIPIATSIHLIRPHTDLPTLSYPPLKCK  61

Query  402  TCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            TC++VLNPFARVD+QALIWICPFCFQRN FPH YS ++E
Sbjct  62   TCSSVLNPFARVDFQALIWICPFCFQRNHFPHHYSGINE  100



>ref|XP_006358773.1| PREDICTED: protein transport protein SEC23-like [Solanum tuberosum]
Length=764

 Score =   176 bits (447),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 90/99 (91%), Gaps = 0/99 (0%)
 Frame = +3

Query  222  SSEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCK  401
            ++E++QTD EGIDGVRMTWN+WPRTKVE+SKC+IPIA+SI L+RP P+L T+PYAPLRCK
Sbjct  2    ATEMAQTDPEGIDGVRMTWNSWPRTKVEASKCIIPIASSIQLLRPFPDLPTLPYAPLRCK  61

Query  402  TCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            TC+++LNPF RVD+QALIWICPFCFQRN FP  YS +SE
Sbjct  62   TCSSILNPFCRVDFQALIWICPFCFQRNHFPQHYSGISE  100



>ref|XP_004247906.1| PREDICTED: protein transport protein SEC23-like [Solanum lycopersicum]
Length=766

 Score =   174 bits (442),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 90/99 (91%), Gaps = 0/99 (0%)
 Frame = +3

Query  222  SSEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCK  401
            ++E++QT+ EGIDGVRMTWN+WPRTKVE+SKC+IPIA+SI L+RP P+L T+PYAPLRCK
Sbjct  2    ATEMAQTEPEGIDGVRMTWNSWPRTKVEASKCIIPIASSIQLLRPFPDLPTLPYAPLRCK  61

Query  402  TCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            TC+++LNPF RVD+QALIWICPFCFQRN FP  YS +SE
Sbjct  62   TCSSILNPFCRVDFQALIWICPFCFQRNHFPQHYSGISE  100



>gb|KDO52832.1| hypothetical protein CISIN_1g0042381mg, partial [Citrus sinensis]
Length=412

 Score =   162 bits (410),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 83/98 (85%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  404
            SE++ TD EGIDGVRMTWN WPRTKVE+SKCVIP+AASI  IR  P++ T+PYAPLRCKT
Sbjct  2    SEMASTDPEGIDGVRMTWNVWPRTKVEASKCVIPLAASISPIRSHPDIPTLPYAPLRCKT  61

Query  405  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            CTA LN FARVD+ A IWICPFC+QRN FP  Y+A+SE
Sbjct  62   CTAALNAFARVDFTAKIWICPFCYQRNHFPPHYAAISE  99



>emb|CDP15130.1| unnamed protein product [Coffea canephora]
Length=784

 Score =   165 bits (418),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = +3

Query  222  SSEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCK  401
            ++E++Q D EGIDGVRMTWN WPRTKVE SKCVIP+AASI  IR  P+++T+PY PL+CK
Sbjct  2    ATEMAQMDPEGIDGVRMTWNVWPRTKVELSKCVIPLAASISPIRSHPDVLTLPYPPLKCK  61

Query  402  TCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            TCTAVLNPF RVD+Q L+WICPFCF RN FP  Y+A+SE
Sbjct  62   TCTAVLNPFCRVDFQGLVWICPFCFSRNHFPQHYNAISE  100



>gb|EPS74608.1| hypothetical protein M569_00146, partial [Genlisea aurea]
Length=323

 Score =   158 bits (400),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 72/103 (70%), Positives = 84/103 (82%), Gaps = 0/103 (0%)
 Frame = +3

Query  210  SLMASSEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAP  389
            S MA+ E++QT+ EGIDGVRMTW  WPRTKVE+SKCVIPIAASI  IRP  +L  +PY P
Sbjct  1    SSMAAPELAQTEPEGIDGVRMTWFNWPRTKVEASKCVIPIAASIQPIRPHVDLKILPYPP  60

Query  390  LRCKTCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            LRCK C+AVLNPF RVD+ A IWICPFCFQRN FP  YS++S+
Sbjct  61   LRCKACSAVLNPFCRVDFTACIWICPFCFQRNHFPQHYSSMSQ  103



>ref|XP_003601725.1| Protein transport protein Sec23 [Medicago truncatula]
 gb|AES71976.1| protein transporter Sec23-like protein [Medicago truncatula]
Length=702

 Score =   163 bits (413),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  404
            SE++ TD EGIDGVRMTWN WPR+KVESSKCVIP+AA+I LIR  P++ ++PYAPLRCKT
Sbjct  2    SEMANTDPEGIDGVRMTWNVWPRSKVESSKCVIPLAATISLIRSHPDIPSLPYAPLRCKT  61

Query  405  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            CT++LNP++RVD+ A IWICPFC+QRN FP  Y+A+SE
Sbjct  62   CTSILNPYSRVDFTAKIWICPFCYQRNHFPPHYNAISE  99



>gb|EYU38948.1| hypothetical protein MIMGU_mgv1a001629mg [Erythranthe guttata]
Length=782

 Score =   164 bits (414),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 72/101 (71%), Positives = 86/101 (85%), Gaps = 0/101 (0%)
 Frame = +3

Query  216  MASSEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLR  395
            MA+ E++QTD EGI+GVRMTW  WPR+KVE+SKCVIPIAASI  IRP  +L  +PYAPLR
Sbjct  1    MAAPELAQTDPEGIEGVRMTWLNWPRSKVEASKCVIPIAASIQPIRPHVDLQILPYAPLR  60

Query  396  CKTCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            CKTC++VLNPF RVD+ ALIWICPFCFQRN FP  YS++S+
Sbjct  61   CKTCSSVLNPFCRVDFTALIWICPFCFQRNHFPQHYSSISQ  101



>ref|XP_009378161.1| PREDICTED: protein transport protein SEC23-like [Pyrus x bretschneideri]
Length=773

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  404
            SE++ TD EGIDGVRMTWN WPRTKVE+SKCVIP+AA I  IR  P++ T+PYAPLRCKT
Sbjct  2    SEMANTDPEGIDGVRMTWNVWPRTKVEASKCVIPLAACISPIRSHPDIPTLPYAPLRCKT  61

Query  405  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            C+AVLNPFARVD+ A IWICPFC+QRN FP  Y+A+SE
Sbjct  62   CSAVLNPFARVDFTAKIWICPFCYQRNHFPPHYAAISE  99



>ref|XP_004502262.1| PREDICTED: protein transport protein SEC23-like isoform X1 [Cicer 
arietinum]
 ref|XP_004502263.1| PREDICTED: protein transport protein SEC23-like isoform X2 [Cicer 
arietinum]
Length=762

 Score =   163 bits (413),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  404
            SEI+ TD EG+DGVRMTWN WPR+KVE+SKCVIP+A ++++IRP P++  +PYAPLRCKT
Sbjct  2    SEIASTDPEGVDGVRMTWNVWPRSKVEASKCVIPLAVTLYVIRPHPDIPRLPYAPLRCKT  61

Query  405  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            C+A LNPFARVD+ A IWICPFC+QRN FP  Y+A+SE
Sbjct  62   CSAALNPFARVDFTAKIWICPFCYQRNHFPPHYNAISE  99



>ref|XP_003601724.1| Protein transport protein Sec23 [Medicago truncatula]
 gb|AES71975.1| protein transporter Sec23-like protein [Medicago truncatula]
Length=771

 Score =   163 bits (413),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  404
            SE++ TD EGIDGVRMTWN WPR+KVESSKCVIP+AA+I LIR  P++ ++PYAPLRCKT
Sbjct  2    SEMANTDPEGIDGVRMTWNVWPRSKVESSKCVIPLAATISLIRSHPDIPSLPYAPLRCKT  61

Query  405  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            CT++LNP++RVD+ A IWICPFC+QRN FP  Y+A+SE
Sbjct  62   CTSILNPYSRVDFTAKIWICPFCYQRNHFPPHYNAISE  99



>ref|XP_009373604.1| PREDICTED: protein transport protein SEC23-like [Pyrus x bretschneideri]
Length=773

 Score =   163 bits (412),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 71/98 (72%), Positives = 83/98 (85%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  404
            SE++ TD EGIDGVRMTWN WPRTKVE+SKCVIP+AA I  IR  P++ T+PYAPLRCKT
Sbjct  2    SEMANTDAEGIDGVRMTWNVWPRTKVEASKCVIPLAACISPIRSHPDIPTLPYAPLRCKT  61

Query  405  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            C+A LNPFARVD+ A IWICPFC+QRN FP  Y+A+SE
Sbjct  62   CSAALNPFARVDFTAKIWICPFCYQRNHFPPHYAAISE  99



>ref|XP_010097955.1| Protein transport protein SEC23 [Morus notabilis]
 gb|EXB73685.1| Protein transport protein SEC23 [Morus notabilis]
Length=775

 Score =   162 bits (411),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  404
            +E++ TD +GIDGVRMTWNAWPRTKVE+SKCVIP+AA I  IRP PE+ T+ Y PLRCKT
Sbjct  2    TEMASTDIDGIDGVRMTWNAWPRTKVEASKCVIPLAAVISPIRPHPEIATLDYYPLRCKT  61

Query  405  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            C A+LNPF RVD+ A+IWICPFCFQRN FP QY  +S+
Sbjct  62   CAAILNPFCRVDFTAMIWICPFCFQRNHFPPQYVGISD  99



>ref|XP_011084141.1| PREDICTED: protein transport protein SEC23-like [Sesamum indicum]
Length=782

 Score =   162 bits (411),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 72/101 (71%), Positives = 85/101 (84%), Gaps = 0/101 (0%)
 Frame = +3

Query  216  MASSEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLR  395
            MA+ E++QTD EGI+GVRMTW  WPR+KVE+SKCVIPIAASI  IRP  +L  +PY PLR
Sbjct  1    MAAPELAQTDPEGIEGVRMTWLNWPRSKVEASKCVIPIAASIQPIRPHVDLQILPYPPLR  60

Query  396  CKTCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            CKTC+AVLNPF RVD+ ALIWICPFCFQRN FP  YS++S+
Sbjct  61   CKTCSAVLNPFCRVDFTALIWICPFCFQRNHFPQHYSSISQ  101



>ref|XP_006421049.1| hypothetical protein CICLE_v10004373mg [Citrus clementina]
 gb|ESR34289.1| hypothetical protein CICLE_v10004373mg [Citrus clementina]
Length=774

 Score =   162 bits (410),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 83/98 (85%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  404
            SE++ TD EGIDGVRMTWN WPRTKVE+SKCVIP+AASI  IR  P++ T+PYAPLRCKT
Sbjct  2    SEMASTDPEGIDGVRMTWNVWPRTKVEASKCVIPLAASISPIRSHPDIPTLPYAPLRCKT  61

Query  405  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            CTA LN FARVD+ A IWICPFC+QRN FP  Y+A+SE
Sbjct  62   CTAALNAFARVDFTAKIWICPFCYQRNHFPPHYAAISE  99



>ref|XP_006492989.1| PREDICTED: protein transport protein SEC23-like [Citrus sinensis]
Length=774

 Score =   162 bits (410),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 83/98 (85%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  404
            SE++ TD EGIDGVRMTWN WPRTKVE+SKCVIP+AASI  IR  P++ T+PYAPLRCKT
Sbjct  2    SEMASTDPEGIDGVRMTWNVWPRTKVEASKCVIPLAASISPIRSHPDIPTLPYAPLRCKT  61

Query  405  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            CTA LN FARVD+ A IWICPFC+QRN FP  Y+A+SE
Sbjct  62   CTAALNAFARVDFTAKIWICPFCYQRNHFPPHYAAISE  99



>ref|XP_008337484.1| PREDICTED: protein transport protein SEC23 [Malus domestica]
Length=773

 Score =   162 bits (410),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 71/98 (72%), Positives = 83/98 (85%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  404
            SE++ TD EGIDGVRMTWN WPRTKVE+SKCVIP+AA I  IR  P++ T+PYAPLRCKT
Sbjct  2    SEMANTDPEGIDGVRMTWNVWPRTKVEASKCVIPLAACISPIRSHPDIPTLPYAPLRCKT  61

Query  405  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            C+A LNPFARVD+ A IWICPFC+QRN FP  Y+A+SE
Sbjct  62   CSAALNPFARVDFTAKIWICPFCYQRNHFPPHYAAISE  99



>ref|XP_010028115.1| PREDICTED: protein transport protein SEC23-like [Eucalyptus grandis]
 gb|KCW54774.1| hypothetical protein EUGRSUZ_I00719 [Eucalyptus grandis]
Length=777

 Score =   161 bits (407),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = +3

Query  222  SSEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCK  401
            SSE+S  D EG+DGVRM+WN WPRTKVE+SKCVIP+AA I  +RP P++ T+PYAPLRCK
Sbjct  2    SSEMSSVDPEGMDGVRMSWNVWPRTKVEASKCVIPLAACIAPLRPHPDIPTLPYAPLRCK  61

Query  402  TCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            TC+AVLNP+ARVD+ A IWICPFC+QRN FP  Y+A+S+
Sbjct  62   TCSAVLNPYARVDFTAKIWICPFCYQRNHFPPHYAAISD  100



>gb|KDP32574.1| hypothetical protein JCGZ_13124 [Jatropha curcas]
Length=778

 Score =   160 bits (406),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 71/98 (72%), Positives = 83/98 (85%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  404
            SE++ TD EGIDGVRMTWN WPRTKVE+SKCVIP+AASI  IR  P++ T+PY+PLRCKT
Sbjct  2    SEMANTDPEGIDGVRMTWNVWPRTKVEASKCVIPLAASISPIRHHPDIPTLPYSPLRCKT  61

Query  405  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            C+AVLN FARVD+ A IWICPFCFQRN FP  Y+ +SE
Sbjct  62   CSAVLNSFARVDFTAKIWICPFCFQRNHFPPHYAMISE  99



>ref|XP_007221956.1| hypothetical protein PRUPE_ppa001742mg [Prunus persica]
 ref|XP_007221957.1| hypothetical protein PRUPE_ppa001742mg [Prunus persica]
 gb|EMJ23155.1| hypothetical protein PRUPE_ppa001742mg [Prunus persica]
 gb|EMJ23156.1| hypothetical protein PRUPE_ppa001742mg [Prunus persica]
Length=772

 Score =   160 bits (406),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 83/98 (85%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  404
            SE++ TD EGIDGVRMTWN WPRTKVE+SKCVIP+AA I  IR  P++ T+PYAPLRCKT
Sbjct  2    SEMANTDPEGIDGVRMTWNVWPRTKVEASKCVIPLAACISPIRAHPDIPTLPYAPLRCKT  61

Query  405  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            C+A LNPF+RVD+ A IWICPFC+QRN FP  Y+A+SE
Sbjct  62   CSAALNPFSRVDFTAKIWICPFCYQRNHFPPHYAAISE  99



>ref|XP_003552491.1| PREDICTED: protein transport protein SEC23-like isoform 1 [Glycine 
max]
Length=766

 Score =   160 bits (406),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 83/98 (85%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  404
            SE++  D EG+DGVRMTWN WPRTKVESSKCVIP+AA++ LIRP P++  +PYAPLRCKT
Sbjct  2    SEMASPDPEGLDGVRMTWNVWPRTKVESSKCVIPLAATVALIRPHPDIPRLPYAPLRCKT  61

Query  405  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            C++ LNPF+RVD+ A IWICPFC+QRN FP  Y A+SE
Sbjct  62   CSSALNPFSRVDFTAKIWICPFCYQRNHFPPHYHAISE  99



>ref|XP_008222792.1| PREDICTED: protein transport protein SEC23 [Prunus mume]
 ref|XP_008222793.1| PREDICTED: protein transport protein SEC23 [Prunus mume]
Length=772

 Score =   160 bits (406),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 83/98 (85%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  404
            SE++ TD EGIDGVRMTWN WPRTKVE+SKCVIP+AA I  IR  P++ T+PYAPLRCKT
Sbjct  2    SEMANTDPEGIDGVRMTWNVWPRTKVEASKCVIPLAACISPIRAHPDIPTLPYAPLRCKT  61

Query  405  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            C+A LNPF+RVD+ A IWICPFC+QRN FP  Y+A+SE
Sbjct  62   CSAALNPFSRVDFTAKIWICPFCYQRNHFPPHYAAISE  99



>ref|XP_010650390.1| PREDICTED: protein transport protein SEC23-like [Vitis vinifera]
Length=771

 Score =   160 bits (405),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 69/92 (75%), Positives = 78/92 (85%), Gaps = 0/92 (0%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  422
            D EGIDGVRMTWN WPRTKVE+SKCVIPIAAS+  IR  P++ T+PYAPLRCKTC ++LN
Sbjct  7    DQEGIDGVRMTWNVWPRTKVEASKCVIPIAASVSPIRSHPDIPTLPYAPLRCKTCISLLN  66

Query  423  PFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            PF RVD+ A IWICPFCFQRN FPH YS +SE
Sbjct  67   PFCRVDFAAKIWICPFCFQRNHFPHHYSMISE  98



>ref|XP_009349001.1| PREDICTED: protein transport protein SEC23-like [Pyrus x bretschneideri]
Length=770

 Score =   160 bits (404),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 70/96 (73%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = +3

Query  231  ISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCT  410
            ++ TD EGIDGVRMTWN WPRTKVE+SKCVIP+AA I  IR  P++ T+PYAPLRCKTC+
Sbjct  1    MANTDPEGIDGVRMTWNVWPRTKVEASKCVIPLAACISPIRSHPDIPTLPYAPLRCKTCS  60

Query  411  AVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            AVLNPFARVD+ A IWICPFC+QRN FP  Y+A+SE
Sbjct  61   AVLNPFARVDFTAKIWICPFCYQRNHFPPHYAAISE  96



>ref|XP_007163794.1| hypothetical protein PHAVU_001G264700g [Phaseolus vulgaris]
 gb|ESW35788.1| hypothetical protein PHAVU_001G264700g [Phaseolus vulgaris]
Length=768

 Score =   159 bits (403),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 83/98 (85%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  404
            SE++  D EG+DGVRMTWN WPRTKVESSKCVIP+AA++ LIRP P++  + YAPLRCKT
Sbjct  2    SEMASPDPEGVDGVRMTWNVWPRTKVESSKCVIPLAATVALIRPHPDIPRLQYAPLRCKT  61

Query  405  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            C++ LNPFARVD+ A IWICPFC+QRN FP  Y+A+SE
Sbjct  62   CSSALNPFARVDFTAKIWICPFCYQRNHFPPHYNAISE  99



>ref|XP_010270294.1| PREDICTED: protein transport protein SEC23-like [Nelumbo nucifera]
Length=769

 Score =   159 bits (403),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  404
            SE++ +D EGIDGVRMTWNAWPRTKVE+SKCVIP+AA+I  IRP P++ T+PY PLRCKT
Sbjct  2    SEMAASDPEGIDGVRMTWNAWPRTKVEASKCVIPLAAAISPIRPHPDIPTLPYLPLRCKT  61

Query  405  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            C  VLNP+ RVD+ A IWICPFCFQRN FP  YS +SE
Sbjct  62   CACVLNPYCRVDFTAKIWICPFCFQRNHFPPHYSMISE  99



>ref|XP_002516399.1| protein transport protein sec23, putative [Ricinus communis]
 gb|EEF46016.1| protein transport protein sec23, putative [Ricinus communis]
Length=782

 Score =   159 bits (401),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 83/98 (85%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  404
            SEI+ TD EGIDGVRM+WN WPRTKVE+SKCVIP+AASI  IR  P++ T+PY+PLRCKT
Sbjct  2    SEIANTDPEGIDGVRMSWNVWPRTKVEASKCVIPLAASISPIRHHPDIPTLPYSPLRCKT  61

Query  405  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            C+++LN FARVD+ A IWICPFCFQRN FP  YS +SE
Sbjct  62   CSSILNCFARVDFTAKIWICPFCFQRNHFPPHYSMISE  99



>ref|XP_007153808.1| hypothetical protein PHAVU_003G066300g [Phaseolus vulgaris]
 gb|ESW25802.1| hypothetical protein PHAVU_003G066300g [Phaseolus vulgaris]
Length=767

 Score =   159 bits (401),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 85/99 (86%), Gaps = 1/99 (1%)
 Frame = +3

Query  225  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELV-TVPYAPLRCK  401
            SE++QTD EG+DGVRMTWN WPRTKVE+SKCVIP+AA+I L+RP P +  T+PYAPLRCK
Sbjct  2    SEMAQTDPEGVDGVRMTWNLWPRTKVEASKCVIPLAATIALLRPHPGIPPTLPYAPLRCK  61

Query  402  TCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            TC+++LNPF+RVD+ A IWICPFC+ RN FP  Y+ +SE
Sbjct  62   TCSSILNPFSRVDFAAKIWICPFCYNRNHFPPHYAQISE  100



>ref|XP_007034166.1| Sec23/Sec24 protein transport family protein [Theobroma cacao]
 gb|EOY05092.1| Sec23/Sec24 protein transport family protein [Theobroma cacao]
Length=772

 Score =   159 bits (401),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  404
            SE++ TD EG+D VRMTWN WPRTKVE+SKCVIP+AASI  IRP P++ T+PYAPLRCKT
Sbjct  2    SEMANTDPEGVDAVRMTWNVWPRTKVEASKCVIPLAASIAPIRPNPDIPTLPYAPLRCKT  61

Query  405  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            C+A LN FARVD+ A IWICPFC+QRN FP  Y+ +SE
Sbjct  62   CSAALNAFARVDFTAKIWICPFCYQRNHFPPHYAMISE  99



>ref|XP_004172995.1| PREDICTED: LOW QUALITY PROTEIN: protein transport protein SEC23-like 
[Cucumis sativus]
Length=332

 Score =   153 bits (387),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  404
            SE++  D EGIDGVRM+WN WPRTKVE+SKCV+P+AASI  IR  PE+ T+PYAPLRCK+
Sbjct  2    SEMANADPEGIDGVRMSWNVWPRTKVEASKCVVPLAASIAPIRHHPEIPTLPYAPLRCKS  61

Query  405  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            C+AVLNPF+RVD+ A IWICPFC+QR  FP  Y+ +SE
Sbjct  62   CSAVLNPFSRVDFTAKIWICPFCYQRCHFPPHYAMISE  99



>ref|XP_010683601.1| PREDICTED: protein transport protein SEC23-like [Beta vulgaris 
subsp. vulgaris]
Length=791

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/92 (76%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  422
            D EGIDGVRMTWNAWPRTKVE+SKCVIPIAA+I  IR  PE+ T+PYAPLRCKTC A LN
Sbjct  16   DPEGIDGVRMTWNAWPRTKVEASKCVIPIAATISPIRANPEIPTLPYAPLRCKTCVAALN  75

Query  423  PFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            P+ RVD+ A IWICPFCFQRN FP  YS +SE
Sbjct  76   PYCRVDFTAKIWICPFCFQRNHFPPHYSGISE  107



>ref|XP_003538532.1| PREDICTED: protein transport protein SEC23-like isoform 1 [Glycine 
max]
Length=767

 Score =   157 bits (397),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  404
            SE++  D EG+DGVRMTWN WPRTKVESSKCVIP+AA++ LIRP P++  + YAPLRCKT
Sbjct  2    SEMASPDPEGLDGVRMTWNVWPRTKVESSKCVIPLAATVALIRPHPDIPRLQYAPLRCKT  61

Query  405  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            C++ LNPF+RVD+ A IWICPFC+QRN FP  Y A+SE
Sbjct  62   CSSALNPFSRVDFTAKIWICPFCYQRNHFPPHYHAISE  99



>ref|XP_004296961.1| PREDICTED: protein transport protein SEC23-like [Fragaria vesca 
subsp. vesca]
Length=770

 Score =   157 bits (397),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  404
            SE++ TD EGIDGVRMTWN WPRTKVE+SKCVIP+AA I  IR   ++ T+PYAPLRCKT
Sbjct  2    SEMANTDPEGIDGVRMTWNVWPRTKVEASKCVIPLAACIAPIRFHTDIPTLPYAPLRCKT  61

Query  405  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            C+AVLNPF+RVD+ A IWICPFC+QRN FP  YS +SE
Sbjct  62   CSAVLNPFSRVDFTAKIWICPFCYQRNHFPPHYSLISE  99



>gb|EPS72601.1| hypothetical protein M569_02145 [Genlisea aurea]
Length=773

 Score =   157 bits (396),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 68/101 (67%), Positives = 84/101 (83%), Gaps = 0/101 (0%)
 Frame = +3

Query  216  MASSEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLR  395
            MA+ E++Q++ EGI+GVRMTW  WPRTKVE+SKCVIPIAASI  IR   +L  +PY PLR
Sbjct  1    MAAPELAQSEQEGIEGVRMTWYNWPRTKVEASKCVIPIAASIQPIRSHVDLQILPYPPLR  60

Query  396  CKTCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            CKTC+AVLNPF RVD+ AL+WICPFC+QRN FP  YS++S+
Sbjct  61   CKTCSAVLNPFCRVDFTALVWICPFCYQRNHFPQHYSSISQ  101



>gb|KJB37899.1| hypothetical protein B456_006G225300 [Gossypium raimondii]
Length=727

 Score =   155 bits (391),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 81/98 (83%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  404
            SE++ TD EGID VRMTWN WPRTKVE+SKCVIP+AA+I  IRP P++ T+PYAPLRC+T
Sbjct  2    SEMANTDPEGIDAVRMTWNVWPRTKVEASKCVIPLAATIAPIRPHPDIPTLPYAPLRCRT  61

Query  405  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            C+A LN FARVD  A IWICPFC+QRN FP  Y+ +SE
Sbjct  62   CSAALNAFARVDLVAKIWICPFCYQRNHFPPHYAMISE  99



>gb|KJB37898.1| hypothetical protein B456_006G225300 [Gossypium raimondii]
Length=770

 Score =   155 bits (391),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 81/98 (83%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  404
            SE++ TD EGID VRMTWN WPRTKVE+SKCVIP+AA+I  IRP P++ T+PYAPLRC+T
Sbjct  2    SEMANTDPEGIDAVRMTWNVWPRTKVEASKCVIPLAATIAPIRPHPDIPTLPYAPLRCRT  61

Query  405  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            C+A LN FARVD  A IWICPFC+QRN FP  Y+ +SE
Sbjct  62   CSAALNAFARVDLVAKIWICPFCYQRNHFPPHYAMISE  99



>gb|KJB71965.1| hypothetical protein B456_011G150700 [Gossypium raimondii]
Length=771

 Score =   154 bits (390),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 80/98 (82%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  404
            SE++  D EGID VRMTWN WPRTKVE+SKCVIP+AASI  IRP  ++  +PYAPLRCKT
Sbjct  2    SEMANMDPEGIDAVRMTWNVWPRTKVEASKCVIPLAASIAPIRPHTDIPMLPYAPLRCKT  61

Query  405  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            C+AVLN FARVD+ A IWICPFC+QRN FP  Y+ +SE
Sbjct  62   CSAVLNAFARVDFMAKIWICPFCYQRNHFPPHYAMISE  99



>gb|KHF97532.1| Protein transport SEC23 [Gossypium arboreum]
Length=759

 Score =   154 bits (390),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 81/98 (83%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  404
            SE++ TD EGID VRMTWN WPRTKVE+SKCVIP+AA+I  IRP P++ T+PYAPLRC+ 
Sbjct  2    SEMANTDPEGIDAVRMTWNVWPRTKVEASKCVIPLAATIAPIRPHPDIPTLPYAPLRCRM  61

Query  405  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            C+A LN FARVD+ A IWICPFC+QRN FP  Y+ +SE
Sbjct  62   CSAALNAFARVDFVAKIWICPFCYQRNHFPPHYAMISE  99



>ref|XP_008439044.1| PREDICTED: protein transport protein SEC23 [Cucumis melo]
Length=775

 Score =   154 bits (390),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  404
            SE++  D EGIDGVRM+WN WPRTKVE+SKCV+P+AASI  IR  PE+ T+PYAPLRCK+
Sbjct  2    SEMANADPEGIDGVRMSWNVWPRTKVEASKCVVPLAASIAPIRHHPEIPTLPYAPLRCKS  61

Query  405  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            C+AVLNPF+RVD+ A IWICPFC+QR  FP  Y+ +SE
Sbjct  62   CSAVLNPFSRVDFTAKIWICPFCYQRCHFPPHYAMISE  99



>gb|KGN57237.1| hypothetical protein Csa_3G172420 [Cucumis sativus]
Length=775

 Score =   154 bits (390),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  404
            SE++  D EGIDGVRM+WN WPRTKVE+SKCV+P+AASI  IR  PE+ T+PYAPLRCK+
Sbjct  2    SEMANADPEGIDGVRMSWNVWPRTKVEASKCVVPLAASIAPIRHHPEIPTLPYAPLRCKS  61

Query  405  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            C+AVLNPF+RVD+ A IWICPFC+QR  FP  Y+ +SE
Sbjct  62   CSAVLNPFSRVDFTAKIWICPFCYQRCHFPPHYAMISE  99



>ref|XP_010269071.1| PREDICTED: protein transport protein SEC23-like [Nelumbo nucifera]
Length=770

 Score =   154 bits (389),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 79/98 (81%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  404
            SE++ +D EGIDGVRMTWN WPRTKVE+SKCVIPIAA+I  IR  P++  +PY PLRCKT
Sbjct  2    SEMAASDPEGIDGVRMTWNVWPRTKVEASKCVIPIAAAITPIRSHPDIPPLPYLPLRCKT  61

Query  405  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            C  VLNP+ RVD+ A IWICPFCFQRN FP  YS +SE
Sbjct  62   CAGVLNPYCRVDFNAKIWICPFCFQRNHFPPHYSMISE  99



>ref|XP_004147649.1| PREDICTED: protein transport protein SEC23-like [Cucumis sativus]
Length=776

 Score =   154 bits (389),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  404
            SE++  D EGIDGVRM+WN WPRTKVE+SKCV+P+AASI  IR  PE+ T+PYAPLRCK+
Sbjct  2    SEMANADPEGIDGVRMSWNVWPRTKVEASKCVVPLAASIAPIRHHPEIPTLPYAPLRCKS  61

Query  405  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            C+AVLNPF+RVD+ A IWICPFC+QR  FP  Y+ +SE
Sbjct  62   CSAVLNPFSRVDFTAKIWICPFCYQRCHFPPHYAMISE  99



>ref|XP_011045698.1| PREDICTED: protein transport protein SEC23-like [Populus euphratica]
Length=775

 Score =   154 bits (389),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 80/98 (82%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  404
            SEI  TD EGID VRMTWN WPRTKVE+SKCVIP+AASI  IRP  E+ T+PY PLRCKT
Sbjct  2    SEIPNTDPEGIDSVRMTWNNWPRTKVEASKCVIPLAASISPIRPHSEIPTLPYPPLRCKT  61

Query  405  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            CT+++N F+RVD+ A IWICPFC+QRN FP  YS +SE
Sbjct  62   CTSIMNCFSRVDFTAKIWICPFCYQRNHFPPHYSMISE  99



>gb|KHG15352.1| Protein transport SEC23 [Gossypium arboreum]
Length=771

 Score =   154 bits (389),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 80/98 (82%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  404
            SE++  D EGID +RMTWN WPRTKVE+SKCVIP+AASI  IRP  ++  +PYAPLRCKT
Sbjct  2    SEMANMDPEGIDAIRMTWNVWPRTKVEASKCVIPLAASIAPIRPHTDIPMLPYAPLRCKT  61

Query  405  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            C+AVLN FARVD+ A IWICPFC+QRN FP  Y+ +SE
Sbjct  62   CSAVLNAFARVDFMAKIWICPFCYQRNHFPPHYAMISE  99



>ref|XP_006370915.1| transport family protein [Populus trichocarpa]
 gb|ERP48712.1| transport family protein [Populus trichocarpa]
Length=777

 Score =   154 bits (388),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 79/98 (81%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  404
            SEI   D EGID VRMTWN WPRTKVE+SKCVIP+AASI  IR  PE+ T+PY PLRCKT
Sbjct  2    SEIPNADPEGIDSVRMTWNNWPRTKVEASKCVIPLAASISPIRSNPEIPTLPYLPLRCKT  61

Query  405  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            CT+++N F+RVD+ A IWICPFCFQRN FP  YS +SE
Sbjct  62   CTSIMNCFSRVDFTAKIWICPFCFQRNHFPPHYSMISE  99



>ref|XP_011046336.1| PREDICTED: protein transport protein SEC23-like [Populus euphratica]
Length=777

 Score =   154 bits (388),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 79/98 (81%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  404
            SEI   D EGID VRMTWN WPRTKVE+SKCVIP+AASI  IR  PE+ T+PY PLRCKT
Sbjct  2    SEIPNADPEGIDSVRMTWNNWPRTKVEASKCVIPLAASISPIRSNPEIPTLPYLPLRCKT  61

Query  405  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            CT+++N F+RVD+ A IWICPFCFQRN FP  YS +SE
Sbjct  62   CTSIMNCFSRVDFTAKIWICPFCFQRNHFPPNYSMISE  99



>ref|NP_974544.1| sec23/sec24-like transport protein [Arabidopsis thaliana]
 gb|AEE83386.1| sec23/sec24-like transport protein [Arabidopsis thaliana]
Length=620

 Score =   150 bits (378),  Expect = 5e-39, Method: Composition-based stats.
 Identities = 62/104 (60%), Positives = 80/104 (77%), Gaps = 0/104 (0%)
 Frame = +3

Query  207  SSLMASSEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYA  386
            + +   +++ + D EGIDGVRMTWN WPRTKVE+SKCVIP+AASI  IR  P ++ +PYA
Sbjct  2    AEMADKAKVEEMDWEGIDGVRMTWNLWPRTKVEASKCVIPLAASISPIRRHPLILDLPYA  61

Query  387  PLRCKTCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            PL CKTC A+LN FARVD+ A+ W+CPFC+ RN FP  Y ++SE
Sbjct  62   PLDCKTCKALLNAFARVDFAAMNWVCPFCYHRNHFPSHYHSISE  105



>ref|XP_002300208.1| transport family protein [Populus trichocarpa]
 gb|EEE85013.1| transport family protein [Populus trichocarpa]
Length=775

 Score =   151 bits (381),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 79/98 (81%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  404
            SEI  TD EGID VRMTWN WPRTKVE+SKCVIP+AASI  IRP  E+ T+ Y PLRCKT
Sbjct  2    SEIPNTDPEGIDSVRMTWNNWPRTKVEASKCVIPLAASISPIRPHSEIPTLTYPPLRCKT  61

Query  405  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            CT+++N F+RVD+ A IWICPFC+QRN FP  YS +SE
Sbjct  62   CTSIMNCFSRVDFTAKIWICPFCYQRNHFPPHYSMISE  99



>emb|CDY12738.1| BnaC04g29030D [Brassica napus]
Length=736

 Score =   150 bits (380),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 66/98 (67%), Positives = 79/98 (81%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  404
            +E++  D EG+DGVRMTWN WPRTKVE+SKCVIP+AASI  IR   E+ ++PYAPL+C+T
Sbjct  2    AEMANMDPEGMDGVRMTWNVWPRTKVEASKCVIPLAASISPIRRHSEIPSLPYAPLKCRT  61

Query  405  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            C AVLN FARVD+ A IWICPFCFQRN FP  Y  +SE
Sbjct  62   CVAVLNAFARVDFAAKIWICPFCFQRNPFPPHYHMISE  99



>ref|XP_010466720.1| PREDICTED: protein transport protein SEC23-like [Camelina sativa]
Length=770

 Score =   150 bits (379),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 64/98 (65%), Positives = 79/98 (81%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  404
            +E + TD EGIDGVRMTWN WPR+K E+SKCVIP+AASI  IR  P++ T+PYAPLRC+T
Sbjct  2    AETANTDLEGIDGVRMTWNVWPRSKAEASKCVIPLAASISPIRRHPDIPTLPYAPLRCRT  61

Query  405  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            C+A LN +A+VD+ A +WICPFCFQRN FP  Y  +SE
Sbjct  62   CSAALNAYAQVDFTAKLWICPFCFQRNHFPPHYHVISE  99



>gb|AAM10394.1| AT4g14160/dl3120w [Arabidopsis thaliana]
Length=772

 Score =   150 bits (379),  Expect = 1e-38, Method: Composition-based stats.
 Identities = 62/104 (60%), Positives = 80/104 (77%), Gaps = 0/104 (0%)
 Frame = +3

Query  207  SSLMASSEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYA  386
            + +   +++ + D EGIDGVRMTWN WPRTKVE+SKCVIP+AASI  IR  P ++ +PYA
Sbjct  2    AEMADKAKVEEMDWEGIDGVRMTWNLWPRTKVEASKCVIPLAASISPIRRHPLILDLPYA  61

Query  387  PLRCKTCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            PL CKTC A+LN FARVD+ A+ W+CPFC+ RN FP  Y ++SE
Sbjct  62   PLDCKTCKALLNAFARVDFAAMNWVCPFCYHRNHFPSHYHSISE  105



>emb|CAB10195.1| transport protein [Arabidopsis thaliana]
 emb|CAB78458.1| transport protein [Arabidopsis thaliana]
Length=769

 Score =   150 bits (379),  Expect = 1e-38, Method: Composition-based stats.
 Identities = 62/98 (63%), Positives = 78/98 (80%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  404
            +++ + D EGIDGVRMTWN WPRTKVE+SKCVIP+AASI  IR  P ++ +PYAPL CKT
Sbjct  5    AKVEEMDWEGIDGVRMTWNLWPRTKVEASKCVIPLAASISPIRRHPLILDLPYAPLDCKT  64

Query  405  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            C A+LN FARVD+ A+ W+CPFC+ RN FP  Y ++SE
Sbjct  65   CKALLNAFARVDFAAMNWVCPFCYHRNHFPSHYHSISE  102



>ref|NP_193152.2| sec23/sec24-like transport protein [Arabidopsis thaliana]
 gb|AAL67087.1| putative transport protein [Arabidopsis thaliana]
 gb|AAM67461.1| putative transport protein [Arabidopsis thaliana]
 gb|AEE83387.1| sec23/sec24-like transport protein [Arabidopsis thaliana]
Length=772

 Score =   150 bits (379),  Expect = 1e-38, Method: Composition-based stats.
 Identities = 62/104 (60%), Positives = 80/104 (77%), Gaps = 0/104 (0%)
 Frame = +3

Query  207  SSLMASSEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYA  386
            + +   +++ + D EGIDGVRMTWN WPRTKVE+SKCVIP+AASI  IR  P ++ +PYA
Sbjct  2    AEMADKAKVEEMDWEGIDGVRMTWNLWPRTKVEASKCVIPLAASISPIRRHPLILDLPYA  61

Query  387  PLRCKTCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            PL CKTC A+LN FARVD+ A+ W+CPFC+ RN FP  Y ++SE
Sbjct  62   PLDCKTCKALLNAFARVDFAAMNWVCPFCYHRNHFPSHYHSISE  105



>ref|NP_849541.2| sec23/sec24-like transport protein [Arabidopsis thaliana]
 gb|AEE83385.1| sec23/sec24-like transport protein [Arabidopsis thaliana]
Length=773

 Score =   150 bits (379),  Expect = 1e-38, Method: Composition-based stats.
 Identities = 62/104 (60%), Positives = 80/104 (77%), Gaps = 0/104 (0%)
 Frame = +3

Query  207  SSLMASSEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYA  386
            + +   +++ + D EGIDGVRMTWN WPRTKVE+SKCVIP+AASI  IR  P ++ +PYA
Sbjct  2    AEMADKAKVEEMDWEGIDGVRMTWNLWPRTKVEASKCVIPLAASISPIRRHPLILDLPYA  61

Query  387  PLRCKTCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            PL CKTC A+LN FARVD+ A+ W+CPFC+ RN FP  Y ++SE
Sbjct  62   PLDCKTCKALLNAFARVDFAAMNWVCPFCYHRNHFPSHYHSISE  105



>ref|XP_010532717.1| PREDICTED: protein transport protein SEC23-like isoform X4 [Tarenaya 
hassleriana]
Length=613

 Score =   149 bits (375),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 64/98 (65%), Positives = 79/98 (81%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  404
            +E++  D +GIDGVRMTWN WPRTKVE+SKCVIP+AA I  IR  P++ ++PYAPLRC+T
Sbjct  2    AEMANPDLDGIDGVRMTWNVWPRTKVEASKCVIPLAACISPIRRHPDIPSLPYAPLRCRT  61

Query  405  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            C+A LN FARVD+ A IWICPFC+QRN FP  Y  +SE
Sbjct  62   CSAALNAFARVDFTAKIWICPFCYQRNHFPPHYHMISE  99



>ref|XP_006418018.1| hypothetical protein EUTSA_v10006857mg [Eutrema salsugineum]
 gb|ESQ36371.1| hypothetical protein EUTSA_v10006857mg [Eutrema salsugineum]
Length=780

 Score =   150 bits (378),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 66/98 (67%), Positives = 77/98 (79%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  404
            SE++  D EGIDGVRMTWN WPR KVE+SKCVIP+AA I  IR   ++ +VPYAPLRC+T
Sbjct  2    SEMASMDPEGIDGVRMTWNVWPRNKVEASKCVIPVAACISPIRYHRDIQSVPYAPLRCRT  61

Query  405  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            C+A LNPFARVD+ A IWICP CFQRN FP  Y  +SE
Sbjct  62   CSAALNPFARVDFTAKIWICPICFQRNHFPPHYHGISE  99



>gb|KHG16267.1| Protein transport Sec23A [Gossypium arboreum]
Length=772

 Score =   150 bits (378),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 65/98 (66%), Positives = 79/98 (81%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  404
            SE++ TD EGID VRMTWN WPRTKVE+S CVIP+A SI  IR  P++ T+PYAPLRCK+
Sbjct  2    SEMANTDPEGIDAVRMTWNVWPRTKVEASACVIPLAVSIAPIRSHPDIPTLPYAPLRCKS  61

Query  405  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            C++ LN FARVD+ A IWICPFC+QRN FP  Y+ +SE
Sbjct  62   CSSALNAFARVDFTAKIWICPFCYQRNHFPPHYAMISE  99



>ref|XP_010527425.1| PREDICTED: protein transport protein SEC23-like isoform X2 [Tarenaya 
hassleriana]
Length=624

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 64/98 (65%), Positives = 79/98 (81%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  404
            +E++  D EGIDGVRMTWN WPRTKVE+SKCVIP+AA I  IR  P++ ++PYAPLRC+T
Sbjct  2    AEMANPDLEGIDGVRMTWNVWPRTKVEASKCVIPLAACISPIRRHPDIPSLPYAPLRCRT  61

Query  405  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            C+A LN FARVD+ A IWICPFC+QRN FP  Y  +S+
Sbjct  62   CSAALNAFARVDFTAKIWICPFCYQRNHFPPHYHMISD  99



>gb|KJB28028.1| hypothetical protein B456_005G022700 [Gossypium raimondii]
Length=549

 Score =   147 bits (372),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 63/98 (64%), Positives = 79/98 (81%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  404
            SE++ TD EGID VRMTWN WPRTKVE+S CVIP+A SI  IR  P++ T+PY+PLRCK+
Sbjct  2    SEMANTDPEGIDAVRMTWNVWPRTKVEASACVIPLAVSIAPIRSHPDIPTLPYSPLRCKS  61

Query  405  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            C++ LN FARVD+ A IWICPFC+QRN FP  Y+ +S+
Sbjct  62   CSSALNAFARVDFTAKIWICPFCYQRNHFPPHYAMISD  99



>ref|XP_010532714.1| PREDICTED: protein transport protein SEC23-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010532715.1| PREDICTED: protein transport protein SEC23-like isoform X2 [Tarenaya 
hassleriana]
 ref|XP_010532716.1| PREDICTED: protein transport protein SEC23-like isoform X3 [Tarenaya 
hassleriana]
Length=778

 Score =   149 bits (376),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 64/98 (65%), Positives = 79/98 (81%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  404
            +E++  D +GIDGVRMTWN WPRTKVE+SKCVIP+AA I  IR  P++ ++PYAPLRC+T
Sbjct  2    AEMANPDLDGIDGVRMTWNVWPRTKVEASKCVIPLAACISPIRRHPDIPSLPYAPLRCRT  61

Query  405  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            C+A LN FARVD+ A IWICPFC+QRN FP  Y  +SE
Sbjct  62   CSAALNAFARVDFTAKIWICPFCYQRNHFPPHYHMISE  99



>emb|CDX90271.1| BnaA08g17130D [Brassica napus]
Length=738

 Score =   149 bits (375),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 64/98 (65%), Positives = 79/98 (81%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  404
            +E++  D EG+DGVRMTWN WPRTKVE+SKCV+P+AASI  IR   ++ ++PYAPL+C+T
Sbjct  2    AEMANMDPEGMDGVRMTWNVWPRTKVEASKCVVPLAASISPIRRHSDIPSLPYAPLKCRT  61

Query  405  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            C AVLN FARVD+ A IWICPFCFQRN FP  Y  +SE
Sbjct  62   CVAVLNAFARVDFAAKIWICPFCFQRNPFPPHYHMISE  99



>gb|KHG04907.1| Protein transport SEC23 [Gossypium arboreum]
Length=842

 Score =   149 bits (377),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 63/96 (66%), Positives = 81/96 (84%), Gaps = 0/96 (0%)
 Frame = +3

Query  231  ISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCT  410
            ++ +D EG+DGVRMTWN WPRTK+E+SKCVIP+AASI  IRP  ++ T+PYAPLRC+TC+
Sbjct  1    MANSDPEGVDGVRMTWNVWPRTKLEASKCVIPLAASIAPIRPHSDIPTLPYAPLRCRTCS  60

Query  411  AVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            AVLN ++RVD+ A IWICPFC+QRN FP  Y+ +SE
Sbjct  61   AVLNVYSRVDFLAKIWICPFCYQRNQFPPHYAMISE  96



>gb|KFK39665.1| hypothetical protein AALP_AA3G273400 [Arabis alpina]
Length=773

 Score =   149 bits (376),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 63/98 (64%), Positives = 78/98 (80%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  404
            +E + TD EGIDGVRMTWN WPR+K+E+SKCVIP+AA I  IR   ++ T+PYAPL+C+T
Sbjct  2    AETANTDQEGIDGVRMTWNVWPRSKIEASKCVIPLAACISPIRRHSDIPTLPYAPLKCRT  61

Query  405  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            CTA LNP+A+VD+   IWICPFCFQRN FP  Y  +SE
Sbjct  62   CTAALNPYAQVDFNVKIWICPFCFQRNQFPPHYHVISE  99



>ref|XP_010527422.1| PREDICTED: protein transport protein SEC23-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010527423.1| PREDICTED: protein transport protein SEC23-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010527424.1| PREDICTED: protein transport protein SEC23-like isoform X1 [Tarenaya 
hassleriana]
Length=776

 Score =   149 bits (376),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 64/98 (65%), Positives = 79/98 (81%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  404
            +E++  D EGIDGVRMTWN WPRTKVE+SKCVIP+AA I  IR  P++ ++PYAPLRC+T
Sbjct  2    AEMANPDLEGIDGVRMTWNVWPRTKVEASKCVIPLAACISPIRRHPDIPSLPYAPLRCRT  61

Query  405  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            C+A LN FARVD+ A IWICPFC+QRN FP  Y  +S+
Sbjct  62   CSAALNAFARVDFTAKIWICPFCYQRNHFPPHYHMISD  99



>ref|XP_010512680.1| PREDICTED: protein transport protein SEC23-like isoform X1 [Camelina 
sativa]
 ref|XP_010512688.1| PREDICTED: protein transport protein SEC23-like isoform X2 [Camelina 
sativa]
Length=769

 Score =   149 bits (375),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 64/98 (65%), Positives = 79/98 (81%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  404
            +E + TD EGIDGVRMTWN WPR+KVE+SKCVIP+AASI  IR   ++ T+PYAPLRC+T
Sbjct  2    AETANTDLEGIDGVRMTWNVWPRSKVEASKCVIPLAASISPIRRHSDIPTLPYAPLRCRT  61

Query  405  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            C+A LN +A+VD+ A +WICPFCFQRN FP  Y  +SE
Sbjct  62   CSAALNAYAQVDFTAKLWICPFCFQRNHFPPHYHVISE  99



>ref|XP_002892293.1| hypothetical protein ARALYDRAFT_470552 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68552.1| hypothetical protein ARALYDRAFT_470552 [Arabidopsis lyrata subsp. 
lyrata]
Length=780

 Score =   148 bits (373),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 65/96 (68%), Positives = 76/96 (79%), Gaps = 0/96 (0%)
 Frame = +3

Query  231  ISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCT  410
            ++  D EGIDGVRMTWN WPRTKVE+SKCVIP+AA I  IR   ++ +V YAPLRC+TC+
Sbjct  1    MASMDPEGIDGVRMTWNVWPRTKVEASKCVIPVAACISPIRYHRDIPSVDYAPLRCRTCS  60

Query  411  AVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            A LNPFARVD  A IWICP CFQRN FPH Y A+S+
Sbjct  61   AALNPFARVDTHAKIWICPICFQRNHFPHHYHAISD  96



>ref|XP_006283156.1| hypothetical protein CARUB_v10004186mg [Capsella rubella]
 gb|EOA16054.1| hypothetical protein CARUB_v10004186mg [Capsella rubella]
Length=781

 Score =   148 bits (373),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 63/98 (64%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  404
            ++++  D EG+DGVRMTWN WPRTKVE+SKCVIP+AASI  IR  P+++ + YAPL+C+T
Sbjct  2    ADMAYVDPEGMDGVRMTWNFWPRTKVEASKCVIPLAASISPIRRHPDILNLDYAPLQCRT  61

Query  405  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            C+AVLN FARVD+ A IWICPFC+QRN+FP  Y ++SE
Sbjct  62   CSAVLNCFARVDFIAKIWICPFCYQRNTFPTHYHSISE  99



>ref|XP_010522277.1| PREDICTED: protein transport protein SEC23 [Tarenaya hassleriana]
 ref|XP_010522278.1| PREDICTED: protein transport protein SEC23 [Tarenaya hassleriana]
 ref|XP_010522279.1| PREDICTED: protein transport protein SEC23 [Tarenaya hassleriana]
 ref|XP_010522280.1| PREDICTED: protein transport protein SEC23 [Tarenaya hassleriana]
 ref|XP_010522281.1| PREDICTED: protein transport protein SEC23 [Tarenaya hassleriana]
 ref|XP_010522282.1| PREDICTED: protein transport protein SEC23 [Tarenaya hassleriana]
Length=780

 Score =   148 bits (373),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 76/98 (78%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  404
            SE++  D EGIDGVRMTWN WPRTKVE+SKCV+PIAA I  IR   E+ TVPYAPLRC+T
Sbjct  2    SEMATMDPEGIDGVRMTWNFWPRTKVEASKCVVPIAACISPIRYHREIPTVPYAPLRCRT  61

Query  405  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            C+A LN F RVD+   IWICPFCFQRN FP  Y  +SE
Sbjct  62   CSAALNAFCRVDFTVKIWICPFCFQRNHFPPHYHMISE  99



>emb|CDY12077.1| BnaC03g59930D [Brassica napus]
Length=737

 Score =   147 bits (372),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 63/98 (64%), Positives = 79/98 (81%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  404
            +E++  D EG+DGVRMTWN WPRTKVE+SKCV+P+AASI  IR   ++ ++PYAPL+C+T
Sbjct  2    AEMANMDPEGMDGVRMTWNVWPRTKVEASKCVVPLAASISPIRRHSDIPSLPYAPLKCRT  61

Query  405  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            C AVLN FARVD+ A IWICPFCFQRN FP  Y  +S+
Sbjct  62   CVAVLNAFARVDFAAKIWICPFCFQRNPFPPHYHMISD  99



>gb|KJB28027.1| hypothetical protein B456_005G022700 [Gossypium raimondii]
Length=772

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 63/98 (64%), Positives = 79/98 (81%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  404
            SE++ TD EGID VRMTWN WPRTKVE+S CVIP+A SI  IR  P++ T+PY+PLRCK+
Sbjct  2    SEMANTDPEGIDAVRMTWNVWPRTKVEASACVIPLAVSIAPIRSHPDIPTLPYSPLRCKS  61

Query  405  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            C++ LN FARVD+ A IWICPFC+QRN FP  Y+ +S+
Sbjct  62   CSSALNAFARVDFTAKIWICPFCYQRNHFPPHYAMISD  99



>ref|XP_010485034.1| PREDICTED: protein transport protein SEC23-like [Camelina sativa]
Length=780

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/98 (67%), Positives = 77/98 (79%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  404
            SE++  D EGIDGVRMTWN WPRTKVE+SKCVIP+AA I  IR   ++ +V YAPLRC++
Sbjct  2    SEMATMDPEGIDGVRMTWNVWPRTKVEASKCVIPVAACISPIRYHRDIQSVGYAPLRCRS  61

Query  405  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            CTA LNPFARVD+ A IWICP CFQRN FP  Y  +SE
Sbjct  62   CTAALNPFARVDFSAKIWICPICFQRNHFPPHYHVMSE  99



>gb|KFK42891.1| hypothetical protein AALP_AA1G052100 [Arabis alpina]
Length=777

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 64/98 (65%), Positives = 77/98 (79%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  404
            SE++  D EGIDGVRMTWN WPR KVE+SKCVIP+AA I  IR   ++ +VPYAPLRC+T
Sbjct  2    SEMATMDPEGIDGVRMTWNVWPRNKVEASKCVIPVAACISPIRYHRDIQSVPYAPLRCRT  61

Query  405  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            CTA LNPF+RVD+ A +WICP C+QRN FP  Y  +SE
Sbjct  62   CTAALNPFSRVDFSAKLWICPICYQRNHFPPHYHVISE  99



>gb|KJB30033.1| hypothetical protein B456_005G128200 [Gossypium raimondii]
Length=494

 Score =   145 bits (365),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 79/96 (82%), Gaps = 0/96 (0%)
 Frame = +3

Query  231  ISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCT  410
            ++ +D EG+DGVRMTWN WPRTK+E+SKCVIP+AASI  I P  ++ T+PYAPLRC+TC+
Sbjct  1    MANSDPEGVDGVRMTWNVWPRTKLEASKCVIPLAASIAPIPPHSDIPTLPYAPLRCRTCS  60

Query  411  AVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            A LN ++RVD+ A IWICPFC+QRN FP  Y+ +SE
Sbjct  61   AALNAYSRVDFLAKIWICPFCYQRNQFPPHYAMISE  96



>ref|XP_006414783.1| hypothetical protein EUTSA_v10024465mg [Eutrema salsugineum]
 gb|ESQ56236.1| hypothetical protein EUTSA_v10024465mg [Eutrema salsugineum]
Length=780

 Score =   146 bits (369),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 63/98 (64%), Positives = 78/98 (80%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  404
            +E++  D EG+DGVRMTWN WPRTKVE+SKCVIP+AASI  IR   ++ ++PYAPL+C+T
Sbjct  2    AEMATMDPEGMDGVRMTWNVWPRTKVEASKCVIPLAASISPIRRHSDIPSLPYAPLKCRT  61

Query  405  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            C A LN FARVD+ A IWICPFC+QRN FP  Y  +SE
Sbjct  62   CEAALNAFARVDFTAKIWICPFCYQRNHFPPHYHMISE  99



>gb|KJB30034.1| hypothetical protein B456_005G128200 [Gossypium raimondii]
Length=644

 Score =   144 bits (364),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 79/96 (82%), Gaps = 0/96 (0%)
 Frame = +3

Query  231  ISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCT  410
            ++ +D EG+DGVRMTWN WPRTK+E+SKCVIP+AASI  I P  ++ T+PYAPLRC+TC+
Sbjct  1    MANSDPEGVDGVRMTWNVWPRTKLEASKCVIPLAASIAPIPPHSDIPTLPYAPLRCRTCS  60

Query  411  AVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            A LN ++RVD+ A IWICPFC+QRN FP  Y+ +SE
Sbjct  61   AALNAYSRVDFLAKIWICPFCYQRNQFPPHYAMISE  96



>gb|AAL08282.1| At1g05520/T25N20_16 [Arabidopsis thaliana]
Length=783

 Score =   145 bits (367),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 66/98 (67%), Positives = 76/98 (78%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  404
            SE++  D EGIDGVRMTWN WPRTKVE+SKCVIP+AA I  IR   ++ +V YAPLRC+ 
Sbjct  2    SEMASMDPEGIDGVRMTWNVWPRTKVEASKCVIPVAACISPIRYHRDIPSVEYAPLRCRI  61

Query  405  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            CTA LNPFARVD+ A IWICP CFQRN FP  Y  +SE
Sbjct  62   CTAALNPFARVDFLAKIWICPICFQRNHFPPHYHVMSE  99



>gb|AAF79733.1|AC005106_14 T25N20.17 [Arabidopsis thaliana]
Length=811

 Score =   146 bits (368),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 66/98 (67%), Positives = 76/98 (78%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  404
            SE++  D EGIDGVRMTWN WPRTKVE+SKCVIP+AA I  IR   ++ +V YAPLRC+ 
Sbjct  2    SEMASMDPEGIDGVRMTWNVWPRTKVEASKCVIPVAACISPIRYHRDIPSVEYAPLRCRI  61

Query  405  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            CTA LNPFARVD+ A IWICP CFQRN FP  Y  +SE
Sbjct  62   CTAALNPFARVDFLAKIWICPICFQRNHFPPHYHVMSE  99



>ref|NP_563741.1| sec23/sec24-like transport protein [Arabidopsis thaliana]
 gb|AAN72246.1| At1g05520/T25N20_16 [Arabidopsis thaliana]
 gb|AEE27848.1| sec23/sec24-like transport protein [Arabidopsis thaliana]
Length=783

 Score =   145 bits (367),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 66/98 (67%), Positives = 76/98 (78%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  404
            SE++  D EGIDGVRMTWN WPRTKVE+SKCVIP+AA I  IR   ++ +V YAPLRC+ 
Sbjct  2    SEMASMDPEGIDGVRMTWNVWPRTKVEASKCVIPVAACISPIRYHRDIPSVEYAPLRCRI  61

Query  405  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            CTA LNPFARVD+ A IWICP CFQRN FP  Y  +SE
Sbjct  62   CTAALNPFARVDFLAKIWICPICFQRNHFPPHYHVMSE  99



>gb|KFK22996.1| hypothetical protein AALP_AAs50735U000600 [Arabis alpina]
Length=775

 Score =   145 bits (366),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 63/98 (64%), Positives = 78/98 (80%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  404
            +E+  TD EGIDGVRMTWN WPRTKVE+SKCVIP+A SI  IR   ++ ++PYAPL C+T
Sbjct  2    AEMVNTDPEGIDGVRMTWNVWPRTKVEASKCVIPLAVSISPIRRHSDIPSLPYAPLLCRT  61

Query  405  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            C A LN FARVD+Q+ IWICPFC+QR++FP  Y  +SE
Sbjct  62   CNAALNSFARVDFQSKIWICPFCYQRSNFPPHYHMISE  99



>emb|CDY01197.1| BnaA04g06220D [Brassica napus]
Length=762

 Score =   145 bits (365),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 78/96 (81%), Gaps = 0/96 (0%)
 Frame = +3

Query  231  ISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCT  410
            +++ D EG+DGVRMTWN WPRTKVE+SKCVIP+AASI  IR   ++ ++PYAPL+C+TC 
Sbjct  1    MAEMDPEGMDGVRMTWNVWPRTKVEASKCVIPLAASISPIRRHSDIPSLPYAPLKCRTCV  60

Query  411  AVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            +VLN FARVD+ A IWICPFCFQRN FP  Y  +S+
Sbjct  61   SVLNAFARVDFAAKIWICPFCFQRNPFPPHYHMISD  96



>ref|XP_002885585.1| hypothetical protein ARALYDRAFT_479878 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61844.1| hypothetical protein ARALYDRAFT_479878 [Arabidopsis lyrata subsp. 
lyrata]
Length=769

 Score =   145 bits (365),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 62/98 (63%), Positives = 78/98 (80%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  404
            +E + TD EGIDGVRMTWN WPR+KVE+SKCVIP+AA I  IR   ++ T+PYAPLRC+T
Sbjct  2    AETANTDLEGIDGVRMTWNVWPRSKVEASKCVIPLAACISPIRRHSDIPTLPYAPLRCRT  61

Query  405  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            C+A LN +A+VD+ A +WICPFC+QRN FP  Y  +SE
Sbjct  62   CSAALNAYAQVDFTAKLWICPFCYQRNHFPPHYHVISE  99



>gb|KJB30032.1| hypothetical protein B456_005G128200 [Gossypium raimondii]
Length=769

 Score =   145 bits (365),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 79/96 (82%), Gaps = 0/96 (0%)
 Frame = +3

Query  231  ISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCT  410
            ++ +D EG+DGVRMTWN WPRTK+E+SKCVIP+AASI  I P  ++ T+PYAPLRC+TC+
Sbjct  1    MANSDPEGVDGVRMTWNVWPRTKLEASKCVIPLAASIAPIPPHSDIPTLPYAPLRCRTCS  60

Query  411  AVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            A LN ++RVD+ A IWICPFC+QRN FP  Y+ +SE
Sbjct  61   AALNAYSRVDFLAKIWICPFCYQRNQFPPHYAMISE  96



>ref|XP_009111051.1| PREDICTED: protein transport protein SEC23 [Brassica rapa]
 emb|CDY15544.1| BnaA08g28280D [Brassica napus]
Length=767

 Score =   144 bits (364),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 63/98 (64%), Positives = 75/98 (77%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  404
            +E+   D EGID VRMTWN WPR KVE+SKCV+P+AA I  IR   ++ +VPYAPLRC+T
Sbjct  2    AEMESLDPEGIDSVRMTWNVWPRNKVEASKCVVPVAACISPIRYHRDIQSVPYAPLRCRT  61

Query  405  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            C+A LNPFARVD+ A IWICP CFQRN FP  Y  +SE
Sbjct  62   CSAALNPFARVDFSAKIWICPICFQRNHFPPHYHVISE  99



>emb|CDX86574.1| BnaC08g01290D [Brassica napus]
Length=767

 Score =   144 bits (364),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 63/98 (64%), Positives = 75/98 (77%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  404
            +E+   D EGID VRMTWN WPR KVE+SKCV+P+AA I  IR   ++ +VPYAPLRC+T
Sbjct  2    AEMESLDPEGIDSVRMTWNVWPRNKVEASKCVVPVAACISPIRYHRDIQSVPYAPLRCRT  61

Query  405  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            C+A LNPFARVD+ A IWICP CFQRN FP  Y  +SE
Sbjct  62   CSAALNPFARVDFSAKIWICPICFQRNHFPPHYHVISE  99



>ref|XP_008785319.1| PREDICTED: protein transport protein SEC23-like [Phoenix dactylifera]
 ref|XP_008785320.1| PREDICTED: protein transport protein SEC23-like [Phoenix dactylifera]
 ref|XP_008785321.1| PREDICTED: protein transport protein SEC23-like [Phoenix dactylifera]
Length=785

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/93 (71%), Positives = 75/93 (81%), Gaps = 1/93 (1%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCK-TCTAVL  419
            D +G DGVRMTWNAWPR+KVE+SKCVIP+AASI  IR  P L+ +PYAPLRCK  C AVL
Sbjct  17   DPDGPDGVRMTWNAWPRSKVEASKCVIPVAASIAPIRASPSLLVLPYAPLRCKPPCAAVL  76

Query  420  NPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            NPFARVD+ A IWICP CF RN FP  Y+A+SE
Sbjct  77   NPFARVDFAAKIWICPLCFSRNHFPPHYAAISE  109



>ref|XP_010457640.1| PREDICTED: protein transport protein SEC23-like isoform X1 [Camelina 
sativa]
 ref|XP_010457641.1| PREDICTED: protein transport protein SEC23-like isoform X2 [Camelina 
sativa]
Length=780

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/98 (66%), Positives = 76/98 (78%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  404
            SE++  D EGIDGVRM WN WPRTKVE+SKCVIP+AA I  IR   ++ +V YAPLRC++
Sbjct  2    SEMATMDPEGIDGVRMPWNFWPRTKVEASKCVIPVAACISPIRYHRDIQSVGYAPLRCRS  61

Query  405  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            CTA LNPFARVD+ A IWICP CFQRN FP  Y  +SE
Sbjct  62   CTAALNPFARVDFSAKIWICPICFQRNHFPPHYHVMSE  99



>ref|XP_009419583.1| PREDICTED: protein transport protein SEC23-like [Musa acuminata 
subsp. malaccensis]
Length=783

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 64/96 (67%), Positives = 76/96 (79%), Gaps = 1/96 (1%)
 Frame = +3

Query  234  SQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCK-TCT  410
            S TD +G DGVRMTWN+WPR+KVE+SKC++P+AAS+  IR  P LV +PYAPLRCK  C 
Sbjct  13   SSTDPDGPDGVRMTWNSWPRSKVEASKCIVPVAASVTPIRASPSLVVLPYAPLRCKPPCA  72

Query  411  AVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            AVLNPFARVD+ A IWICP CF RN FP  Y+ +SE
Sbjct  73   AVLNPFARVDFAAKIWICPLCFSRNHFPPHYAGISE  108



>ref|XP_010475248.1| PREDICTED: protein transport protein SEC23-like [Camelina sativa]
Length=780

 Score =   143 bits (361),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 64/98 (65%), Positives = 75/98 (77%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  404
            SE++  D EGIDGVRM WN WPR KVE+SKCVIP+AA I  IR   ++ +V YAPLRC++
Sbjct  2    SEMATMDPEGIDGVRMPWNVWPRNKVEASKCVIPVAACISPIRYHRDIQSVGYAPLRCRS  61

Query  405  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            CTA LNPFARVD+ A IWICP CFQRN FP  Y  +SE
Sbjct  62   CTAALNPFARVDFSAKIWICPICFQRNHFPPHYHVMSE  99



>emb|CBI39378.3| unnamed protein product [Vitis vinifera]
Length=707

 Score =   142 bits (359),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = +3

Query  270  MTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLNPFARVDYQA  449
            MTWN WPRTKVE+SKCVIPIAAS+  IR  P++ T+PYAPLRCKTC ++LNPF RVD+ A
Sbjct  1    MTWNVWPRTKVEASKCVIPIAASVSPIRSHPDIPTLPYAPLRCKTCISLLNPFCRVDFAA  60

Query  450  LIWICPFCFQRNSFPHQYSAVSE  518
             IWICPFCFQRN FPH YS +SE
Sbjct  61   KIWICPFCFQRNHFPHHYSMISE  83



>ref|XP_010934373.1| PREDICTED: protein transport protein SEC23-like isoform X2 [Elaeis 
guineensis]
Length=540

 Score =   140 bits (354),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 64/88 (73%), Positives = 72/88 (82%), Gaps = 1/88 (1%)
 Frame = +3

Query  258  DGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCK-TCTAVLNPFAR  434
            DGVRMTWNAWPR+KVE+SKCVIP+AASI  IR  P L+ +PYAPLRCK  C AVLNPFAR
Sbjct  19   DGVRMTWNAWPRSKVEASKCVIPVAASIAPIRASPSLLVLPYAPLRCKPPCAAVLNPFAR  78

Query  435  VDYQALIWICPFCFQRNSFPHQYSAVSE  518
            VD+ A IWICP CF RN FP  Y+A+SE
Sbjct  79   VDFAAKIWICPLCFSRNQFPPHYAAMSE  106



>ref|XP_002870333.1| hypothetical protein ARALYDRAFT_493493 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46592.1| hypothetical protein ARALYDRAFT_493493 [Arabidopsis lyrata subsp. 
lyrata]
Length=763

 Score =   142 bits (359),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 62/90 (69%), Positives = 73/90 (81%), Gaps = 0/90 (0%)
 Frame = +3

Query  249  EGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLNPF  428
            EG+DGVRMTWN WPRTKVE+SKCVIP+AASI  IR   ++  +PYAPL+C+TC AVLN F
Sbjct  6    EGMDGVRMTWNLWPRTKVEASKCVIPLAASISPIRRHSDIPDLPYAPLKCRTCVAVLNAF  65

Query  429  ARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            ARVD+ A IWICPFC QRN FP  Y ++SE
Sbjct  66   ARVDFNAKIWICPFCHQRNHFPVHYHSISE  95



>ref|XP_009139544.1| PREDICTED: protein transport protein SEC23-like [Brassica rapa]
Length=772

 Score =   142 bits (359),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 77/96 (80%), Gaps = 0/96 (0%)
 Frame = +3

Query  231  ISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCT  410
            +++ D EG+DGVRMTWN WPRTKVE+SKCVIP+AASI  IR   ++ ++PYAPL+C+TC 
Sbjct  1    MAEMDPEGMDGVRMTWNVWPRTKVEASKCVIPLAASISPIRRHSDIPSLPYAPLKCRTCV  60

Query  411  AVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            +VL  FARVD+ A IWICPFCFQRN FP  Y  +S+
Sbjct  61   SVLTAFARVDFAAKIWICPFCFQRNPFPPHYHMISD  96



>ref|XP_009420223.1| PREDICTED: protein transport protein SEC23-like [Musa acuminata 
subsp. malaccensis]
Length=783

 Score =   142 bits (358),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 75/93 (81%), Gaps = 1/93 (1%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCK-TCTAVL  419
            D +G DGVRMTWN+WPR+KVE+SKCV+P+AAS+  IR  P LV +PY+PLRCK  C AVL
Sbjct  17   DPDGPDGVRMTWNSWPRSKVEASKCVVPVAASVAPIRSSPSLVVLPYSPLRCKPPCAAVL  76

Query  420  NPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            NPFARVD+ A IWICPFCF RN FP  Y+ +SE
Sbjct  77   NPFARVDFAAKIWICPFCFSRNHFPPHYAGISE  109



>ref|XP_006303716.1| hypothetical protein CARUB_v10011838mg [Capsella rubella]
 gb|EOA36614.1| hypothetical protein CARUB_v10011838mg [Capsella rubella]
Length=780

 Score =   142 bits (358),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 64/98 (65%), Positives = 74/98 (76%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  404
            SE++  D EGIDGVRMTWN WPRTKVE+SKCVIP+AA I  IR   ++    YAPLRC+T
Sbjct  2    SEVASIDPEGIDGVRMTWNVWPRTKVEASKCVIPVAACISPIRYHRDIQFNNYAPLRCRT  61

Query  405  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            CTA LNP+ RVD+ A IWICP CFQRN FP  Y  +SE
Sbjct  62   CTAALNPYVRVDFSAKIWICPICFQRNHFPPHYHVMSE  99



>ref|NP_189008.1| Sec23/Sec24 protein transport family protein [Arabidopsis thaliana]
 dbj|BAB02785.1| protein transport protein Sec23 [Arabidopsis thaliana]
 gb|AAO22730.1| putative transport protein [Arabidopsis thaliana]
 gb|AAO50656.1| putative transport protein [Arabidopsis thaliana]
 gb|AEE76796.1| Sec23/Sec24 protein transport family protein [Arabidopsis thaliana]
Length=765

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 76/98 (78%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  404
            +E + TD EGIDGVRMTWN WP +K E+SKCVIP+AA I  IR   ++ T+PYAPLRC+T
Sbjct  2    AETANTDLEGIDGVRMTWNVWPHSKAEASKCVIPLAACISPIRRHADIPTLPYAPLRCRT  61

Query  405  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            C+A LN +A+VD+ A +WICPFC+QRN FP  Y  +SE
Sbjct  62   CSAALNAYAQVDFTAKLWICPFCYQRNHFPPHYHVISE  99



>ref|NP_001189956.1| Sec23/Sec24 protein transport family protein [Arabidopsis thaliana]
 gb|AEE76797.1| Sec23/Sec24 protein transport family protein [Arabidopsis thaliana]
Length=791

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 76/98 (78%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  404
            +E + TD EGIDGVRMTWN WP +K E+SKCVIP+AA I  IR   ++ T+PYAPLRC+T
Sbjct  2    AETANTDLEGIDGVRMTWNVWPHSKAEASKCVIPLAACISPIRRHADIPTLPYAPLRCRT  61

Query  405  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            C+A LN +A+VD+ A +WICPFC+QRN FP  Y  +SE
Sbjct  62   CSAALNAYAQVDFTAKLWICPFCYQRNHFPPHYHVISE  99



>ref|XP_010934372.1| PREDICTED: protein transport protein SEC23-like isoform X1 [Elaeis 
guineensis]
Length=782

 Score =   140 bits (352),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 64/88 (73%), Positives = 72/88 (82%), Gaps = 1/88 (1%)
 Frame = +3

Query  258  DGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCK-TCTAVLNPFAR  434
            DGVRMTWNAWPR+KVE+SKCVIP+AASI  IR  P L+ +PYAPLRCK  C AVLNPFAR
Sbjct  19   DGVRMTWNAWPRSKVEASKCVIPVAASIAPIRASPSLLVLPYAPLRCKPPCAAVLNPFAR  78

Query  435  VDYQALIWICPFCFQRNSFPHQYSAVSE  518
            VD+ A IWICP CF RN FP  Y+A+SE
Sbjct  79   VDFAAKIWICPLCFSRNQFPPHYAAMSE  106



>ref|XP_010908064.1| PREDICTED: protein transport protein SEC23-like isoform X1 [Elaeis 
guineensis]
Length=790

 Score =   140 bits (352),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 74/93 (80%), Gaps = 1/93 (1%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCK-TCTAVL  419
            D +G DGVRMTWNAWPR+KVE+SKCVIP+AA I  IR  P L+ +PYAPLRCK  C AVL
Sbjct  17   DPDGPDGVRMTWNAWPRSKVEASKCVIPVAACIAPIRASPSLLVLPYAPLRCKPPCAAVL  76

Query  420  NPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            NPF+RVD+ A IWICP CF RN FP  Y+A+SE
Sbjct  77   NPFSRVDFAAKIWICPICFSRNHFPPHYAAISE  109



>ref|XP_006297004.1| hypothetical protein CARUB_v10012995mg [Capsella rubella]
 gb|EOA29902.1| hypothetical protein CARUB_v10012995mg [Capsella rubella]
Length=782

 Score =   140 bits (352),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 62/98 (63%), Positives = 76/98 (78%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  404
            +E + TD EGIDGVRMTWN WP +KVESSK VIP+AA I  IR   ++ T+PYAPLRC+T
Sbjct  2    AETAITDLEGIDGVRMTWNVWPHSKVESSKLVIPLAACISPIRRHSDIPTLPYAPLRCRT  61

Query  405  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            C+A LN +A+VD+ A +WICPFCFQRN FP  Y  +SE
Sbjct  62   CSAALNAYAQVDFTAKLWICPFCFQRNHFPPHYHVMSE  99



>ref|XP_010908065.1| PREDICTED: protein transport protein SEC23-like isoform X2 [Elaeis 
guineensis]
Length=754

 Score =   140 bits (352),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 74/93 (80%), Gaps = 1/93 (1%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCK-TCTAVL  419
            D +G DGVRMTWNAWPR+KVE+SKCVIP+AA I  IR  P L+ +PYAPLRCK  C AVL
Sbjct  17   DPDGPDGVRMTWNAWPRSKVEASKCVIPVAACIAPIRASPSLLVLPYAPLRCKPPCAAVL  76

Query  420  NPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            NPF+RVD+ A IWICP CF RN FP  Y+A+SE
Sbjct  77   NPFSRVDFAAKIWICPICFSRNHFPPHYAAISE  109



>ref|XP_006297005.1| hypothetical protein CARUB_v10012995mg [Capsella rubella]
 gb|EOA29903.1| hypothetical protein CARUB_v10012995mg [Capsella rubella]
Length=812

 Score =   140 bits (352),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 62/98 (63%), Positives = 76/98 (78%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  404
            +E + TD EGIDGVRMTWN WP +KVESSK VIP+AA I  IR   ++ T+PYAPLRC+T
Sbjct  2    AETAITDLEGIDGVRMTWNVWPHSKVESSKLVIPLAACISPIRRHSDIPTLPYAPLRCRT  61

Query  405  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            C+A LN +A+VD+ A +WICPFCFQRN FP  Y  +SE
Sbjct  62   CSAALNAYAQVDFTAKLWICPFCFQRNHFPPHYHVMSE  99



>ref|XP_009414536.1| PREDICTED: protein transport protein SEC23-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009414537.1| PREDICTED: protein transport protein SEC23-like [Musa acuminata 
subsp. malaccensis]
Length=785

 Score =   134 bits (338),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 74/94 (79%), Gaps = 1/94 (1%)
 Frame = +3

Query  240  TDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCK-TCTAV  416
            +D +G DGVRM+WN WPR+K+E+SKCVIP+AASI  IR  P ++ +PY PLRCK  C+AV
Sbjct  13   SDPDGPDGVRMSWNNWPRSKIEASKCVIPVAASITPIRASPSVLVLPYQPLRCKPPCSAV  72

Query  417  LNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            L+PFARVD+ A IWICP CF RN FP  Y+ +SE
Sbjct  73   LSPFARVDFAAKIWICPLCFSRNHFPPHYAGISE  106



>ref|XP_010440522.1| PREDICTED: protein transport protein SEC23-like [Camelina sativa]
Length=779

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 76/98 (78%), Gaps = 1/98 (1%)
 Frame = +3

Query  225  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  404
            ++++  D EG+DGVRMTWN WPRTKVE+SKCVIP+AASI  IR  P+++ + YAPL C+ 
Sbjct  2    ADMASMDPEGMDGVRMTWNVWPRTKVEASKCVIPLAASISPIRRHPDILNLDYAPLHCR-  60

Query  405  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            C+AVLN FA VDY+A IW CPFC   N+FP  Y ++++
Sbjct  61   CSAVLNAFASVDYRARIWKCPFCLHTNTFPTHYHSITQ  98



>ref|XP_008791501.1| PREDICTED: protein transport protein SEC23-like [Phoenix dactylifera]
Length=791

 Score =   132 bits (332),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 69/86 (80%), Gaps = 1/86 (1%)
 Frame = +3

Query  264  VRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCK-TCTAVLNPFARVD  440
            VRMTWNAWPR+KVE+SKCVIP+AA I  IR  P L+ +PYAPLRCK  C AVLNPFARVD
Sbjct  24   VRMTWNAWPRSKVEASKCVIPVAACIAPIRASPSLLVLPYAPLRCKPPCAAVLNPFARVD  83

Query  441  YQALIWICPFCFQRNSFPHQYSAVSE  518
            + A IWICP CF RN FP  Y+A+SE
Sbjct  84   FAARIWICPICFSRNHFPPHYAAISE  109



>ref|XP_009417946.1| PREDICTED: protein transport protein SEC23-like [Musa acuminata 
subsp. malaccensis]
Length=786

 Score =   132 bits (331),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 70/86 (81%), Gaps = 1/86 (1%)
 Frame = +3

Query  264  VRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCK-TCTAVLNPFARVD  440
            VRMTWN WPR+K+E+SKCV+P+AASI  IR  P L+ +PY PLRCK  C+AVLNPFARVD
Sbjct  22   VRMTWNNWPRSKLEASKCVVPVAASIAPIRASPSLLVLPYNPLRCKPPCSAVLNPFARVD  81

Query  441  YQALIWICPFCFQRNSFPHQYSAVSE  518
            + A IWICPFCF RN FP  Y+A+SE
Sbjct  82   FAAKIWICPFCFSRNHFPPHYAAISE  107



>ref|XP_006827919.1| hypothetical protein AMTR_s00008p00163370 [Amborella trichopoda]
 gb|ERM95335.1| hypothetical protein AMTR_s00008p00163370 [Amborella trichopoda]
Length=762

 Score =   132 bits (331),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 55/92 (60%), Positives = 69/92 (75%), Gaps = 0/92 (0%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  422
            + E ++GVRM+WN WPRTKV++SKCV+P+A  +  IR  PEL  +PY PLRCK+C+ VLN
Sbjct  6    EMEAVEGVRMSWNVWPRTKVDASKCVVPLATVVSPIRSLPELPVLPYPPLRCKSCSCVLN  65

Query  423  PFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            P  RVDY A IW+CPFCFQR  FP  Y  +SE
Sbjct  66   PHCRVDYAARIWVCPFCFQRTHFPIHYEGISE  97



>ref|XP_010435181.1| PREDICTED: protein transport protein SEC23-like [Camelina sativa]
Length=776

 Score =   127 bits (319),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 56/95 (59%), Positives = 70/95 (74%), Gaps = 1/95 (1%)
 Frame = +3

Query  231  ISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCT  410
            ++  D EG+DGVRMTWN WPRTKVE+SKCVIP+AASI  IR   +++ + YAPLRC+ C+
Sbjct  1    MASMDPEGMDGVRMTWNVWPRTKVEASKCVIPLAASISPIRRHHDILNLDYAPLRCR-CS  59

Query  411  AVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVS  515
            AVLN FA VDY A IW C FC   N FP  Y +++
Sbjct  60   AVLNAFATVDYDARIWKCHFCLHTNHFPTHYRSIT  94



>ref|XP_001762459.1| predicted protein [Physcomitrella patens]
 gb|EDQ72582.1| predicted protein [Physcomitrella patens]
Length=774

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 69/96 (72%), Gaps = 4/96 (4%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAA---SIHLIRPQPELVTV-PYAPLRCKTCT  410
            D E ++G+RM+WN WP TK+++SKC IP+AA    +H   P    V V  YAPLRC+ C 
Sbjct  6    DAEAMNGIRMSWNVWPSTKLDASKCHIPLAALYTPLHGAGPHSNPVAVLNYAPLRCRACR  65

Query  411  AVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
             VLNPF  VDYQA IWICPFC QRNSFPH YS++S+
Sbjct  66   GVLNPFCAVDYQAKIWICPFCHQRNSFPHHYSSISD  101



>gb|KJB72954.1| hypothetical protein B456_011G205900 [Gossypium raimondii]
Length=692

 Score =   123 bits (308),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 52/92 (57%), Positives = 68/92 (74%), Gaps = 0/92 (0%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  422
            + EG DGVRM WN  P TK E+S CV+P++A    I+P P +  +PYAPLRC+ C +VLN
Sbjct  6    ELEGQDGVRMAWNVIPGTKQEASNCVVPVSAVYTPIKPFPNMPVLPYAPLRCRNCRSVLN  65

Query  423  PFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            PF+ VD+ A IWICPFCFQRN FP  Y+++S+
Sbjct  66   PFSIVDFAAKIWICPFCFQRNHFPPHYASISD  97



>ref|XP_003577593.1| PREDICTED: protein transport protein SEC23-like [Brachypodium 
distachyon]
Length=787

 Score =   123 bits (309),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 57/92 (62%), Positives = 71/92 (77%), Gaps = 3/92 (3%)
 Frame = +3

Query  252  GIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVT--VPYAPLRCKT-CTAVLN  422
            G D VR+TWNAWPR+KVE+S+CV+P+AA+I  +R    L +  +PYAPLRCK  C+A+LN
Sbjct  16   GPDAVRLTWNAWPRSKVEASRCVVPLAAAISPVRCPESLASPPLPYAPLRCKPPCSALLN  75

Query  423  PFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            PFARVDY A IWICP CF RN FP  Y+ +SE
Sbjct  76   PFARVDYAAKIWICPLCFSRNHFPPHYAGISE  107



>gb|KJB72955.1| hypothetical protein B456_011G205900 [Gossypium raimondii]
Length=681

 Score =   123 bits (308),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 52/92 (57%), Positives = 68/92 (74%), Gaps = 0/92 (0%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  422
            + EG DGVRM WN  P TK E+S CV+P++A    I+P P +  +PYAPLRC+ C +VLN
Sbjct  6    ELEGQDGVRMAWNVIPGTKQEASNCVVPVSAVYTPIKPFPNMPVLPYAPLRCRNCRSVLN  65

Query  423  PFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            PF+ VD+ A IWICPFCFQRN FP  Y+++S+
Sbjct  66   PFSIVDFAAKIWICPFCFQRNHFPPHYASISD  97



>ref|XP_001774792.1| predicted protein [Physcomitrella patens]
 gb|EDQ60463.1| predicted protein [Physcomitrella patens]
Length=772

 Score =   123 bits (309),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 71/96 (74%), Gaps = 4/96 (4%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAA---SIHLIRPQPELVT-VPYAPLRCKTCT  410
            + E ++G+RM+WN WP TK+++SKC IP+AA    +H   P    VT + YAPLRC+ C 
Sbjct  6    EAEAMNGIRMSWNVWPSTKLDASKCHIPLAALYTPLHGAGPHSNPVTKLNYAPLRCRACR  65

Query  411  AVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            +VLNPF  VDYQA IWICPFC QRNSFPH Y+++SE
Sbjct  66   SVLNPFCSVDYQAKIWICPFCHQRNSFPHHYASISE  101



>gb|KDP24898.1| hypothetical protein JCGZ_24276 [Jatropha curcas]
Length=1052

 Score =   124 bits (310),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 53/92 (58%), Positives = 68/92 (74%), Gaps = 0/92 (0%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  422
            D E  DGVRM WN  P TK E+S CV+P++A    I+P P +  +PYAPLRC+TC +VLN
Sbjct  6    DLEAQDGVRMPWNVLPGTKQEASNCVVPVSAMYTPIKPFPNMPILPYAPLRCRTCRSVLN  65

Query  423  PFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            PF+ VD+ A IWICPFCFQRN FP  Y+++S+
Sbjct  66   PFSIVDFAAKIWICPFCFQRNHFPPHYASISD  97



>ref|XP_003059046.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH57501.1| predicted protein [Micromonas pusilla CCMP1545]
Length=809

 Score =   123 bits (309),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 67/90 (74%), Gaps = 0/90 (0%)
 Frame = +3

Query  249  EGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLNPF  428
            E +DGVR++WN WP +K E++KCV+P+ A +   +P P++  VPY P+RCK C A LNP+
Sbjct  10   EAVDGVRLSWNVWPNSKAEAAKCVVPLGAVVTPRKPLPDMPVVPYDPVRCKGCAACLNPY  69

Query  429  ARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            ARVD+   +WICPFC+ RN FP  Y+++SE
Sbjct  70   ARVDFNGKLWICPFCYARNHFPPHYASISE  99



>gb|KJB72956.1| hypothetical protein B456_011G205900 [Gossypium raimondii]
Length=735

 Score =   123 bits (308),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 52/92 (57%), Positives = 68/92 (74%), Gaps = 0/92 (0%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  422
            + EG DGVRM WN  P TK E+S CV+P++A    I+P P +  +PYAPLRC+ C +VLN
Sbjct  6    ELEGQDGVRMAWNVIPGTKQEASNCVVPVSAVYTPIKPFPNMPVLPYAPLRCRNCRSVLN  65

Query  423  PFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            PF+ VD+ A IWICPFCFQRN FP  Y+++S+
Sbjct  66   PFSIVDFAAKIWICPFCFQRNHFPPHYASISD  97



>gb|KJB72952.1| hypothetical protein B456_011G205900 [Gossypium raimondii]
 gb|KJB72953.1| hypothetical protein B456_011G205900 [Gossypium raimondii]
Length=761

 Score =   123 bits (308),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 52/92 (57%), Positives = 68/92 (74%), Gaps = 0/92 (0%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  422
            + EG DGVRM WN  P TK E+S CV+P++A    I+P P +  +PYAPLRC+ C +VLN
Sbjct  6    ELEGQDGVRMAWNVIPGTKQEASNCVVPVSAVYTPIKPFPNMPVLPYAPLRCRNCRSVLN  65

Query  423  PFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            PF+ VD+ A IWICPFCFQRN FP  Y+++S+
Sbjct  66   PFSIVDFAAKIWICPFCFQRNHFPPHYASISD  97



>ref|XP_010450096.1| PREDICTED: protein transport protein SEC23-like [Camelina sativa]
Length=784

 Score =   123 bits (308),  Expect = 6e-29, Method: Composition-based stats.
 Identities = 57/104 (55%), Positives = 72/104 (69%), Gaps = 9/104 (9%)
 Frame = +3

Query  231  ISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCT  410
            ++  D EG+DGVRMTWN WPRTKVE+SKCVIP+AASI  IR  P+++ + YAPL C+ C+
Sbjct  1    MASMDPEGMDGVRMTWNVWPRTKVEASKCVIPLAASISPIRRHPDILNLDYAPLHCR-CS  59

Query  411  AVLNPFARVDYQAL--------IWICPFCFQRNSFPHQYSAVSE  518
            AVLN FA VD+ A         IW CPFC   N FP  Y ++S+
Sbjct  60   AVLNAFATVDFSASHSASASAKIWKCPFCLHPNHFPTHYHSISQ  103



>ref|XP_007011443.1| Sec23/Sec24 protein transport family protein isoform 2 [Theobroma 
cacao]
 gb|EOY20253.1| Sec23/Sec24 protein transport family protein isoform 2 [Theobroma 
cacao]
Length=761

 Score =   122 bits (307),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 52/92 (57%), Positives = 68/92 (74%), Gaps = 0/92 (0%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  422
            + EG DGVRM WN  P TK E+S CV+P++A    I+P P +  +PYAPLRC+ C +VLN
Sbjct  6    ELEGQDGVRMAWNVVPGTKQEASNCVVPVSAIYTPIKPFPNMPVLPYAPLRCRNCRSVLN  65

Query  423  PFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            PF+ VD+ A IWICPFCFQRN FP  Y+++S+
Sbjct  66   PFSIVDFAAKIWICPFCFQRNHFPPHYASISD  97



>gb|EAZ07329.1| hypothetical protein OsI_29578 [Oryza sativa Indica Group]
Length=367

 Score =   119 bits (299),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 49/92 (53%), Positives = 65/92 (71%), Gaps = 0/92 (0%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  422
            D E  DG+RM WN  P TK +++ CV+P++A    +RP P +  +PY PLRC+ C ++LN
Sbjct  6    DLELQDGIRMPWNVIPGTKQDAANCVVPVSAIYTPLRPNPAIPVLPYGPLRCRMCRSILN  65

Query  423  PFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            PF  VDY A IW+CPFCFQRN FP  YS++SE
Sbjct  66   PFCVVDYVAKIWVCPFCFQRNHFPQHYSSISE  97



>ref|XP_010255698.1| PREDICTED: protein transport protein SEC23-like [Nelumbo nucifera]
 ref|XP_010255700.1| PREDICTED: protein transport protein SEC23-like [Nelumbo nucifera]
Length=764

 Score =   122 bits (307),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 68/92 (74%), Gaps = 0/92 (0%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  422
            D E  DG+RM WN +P TK E++ CV+P++A    ++P P    +PY+PLRC+TC +VLN
Sbjct  6    DLEAQDGIRMPWNVFPGTKQEAANCVVPVSAIYTPLKPFPNXPVLPYSPLRCRTCRSVLN  65

Query  423  PFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            PF+ VDY A IWICPFCFQRN FP  Y+++SE
Sbjct  66   PFSIVDYMAKIWICPFCFQRNHFPPHYASISE  97



>ref|XP_009387153.1| PREDICTED: protein transport protein SEC23 [Musa acuminata subsp. 
malaccensis]
Length=763

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 52/92 (57%), Positives = 67/92 (73%), Gaps = 0/92 (0%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  422
            D E  DGVRMTWN  P TK E+  CVIP+AA    ++P P++  +PY+PLRC+ C ++LN
Sbjct  6    DLETQDGVRMTWNMLPGTKQEALGCVIPVAAIYTPLKPIPDMPVLPYSPLRCRICRSILN  65

Query  423  PFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            PF+ VDY A IW+CPFCFQRN FP  Y ++SE
Sbjct  66   PFSIVDYVAKIWVCPFCFQRNHFPQHYLSISE  97



>ref|XP_010939455.1| PREDICTED: protein transport protein SEC23 isoform X2 [Elaeis 
guineensis]
Length=683

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/92 (59%), Positives = 66/92 (72%), Gaps = 0/92 (0%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  422
            D E  DGVRMTWN +P TK ++  CVIP AA    ++P P    +PYAPLRC+ C ++LN
Sbjct  6    DLESQDGVRMTWNIFPGTKQDAVGCVIPTAAMYTPLKPIPNTPVLPYAPLRCRMCRSILN  65

Query  423  PFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            PF+ VDY A IWICPFCFQRN FP  YS++SE
Sbjct  66   PFSIVDYIAKIWICPFCFQRNHFPPHYSSISE  97



>ref|XP_002526529.1| protein transport protein sec23, putative [Ricinus communis]
 gb|EEF35920.1| protein transport protein sec23, putative [Ricinus communis]
Length=761

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 52/92 (57%), Positives = 67/92 (73%), Gaps = 0/92 (0%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  422
            D E  DGVRM WN  P +K E+S CV+P++A    I+P P +  +PYAPLRC+TC +VLN
Sbjct  6    DLEAQDGVRMPWNVLPGSKQEASNCVVPVSAIYTPIKPFPNMPVLPYAPLRCRTCRSVLN  65

Query  423  PFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            PF+ VD+ A IWICPFCFQRN FP  Y ++S+
Sbjct  66   PFSIVDFAAKIWICPFCFQRNHFPPHYGSISD  97



>gb|KJB78641.1| hypothetical protein B456_013G010400 [Gossypium raimondii]
 gb|KJB78642.1| hypothetical protein B456_013G010400 [Gossypium raimondii]
Length=510

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 50/92 (54%), Positives = 67/92 (73%), Gaps = 0/92 (0%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  422
            + E  DGVRMTWN  P TK E+  CV+P++A    I+P P ++ +PYAPLRC+ C++VLN
Sbjct  6    ELEAQDGVRMTWNVVPGTKEEAGNCVVPVSAIYTPIKPFPNMLVLPYAPLRCRNCSSVLN  65

Query  423  PFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            PF  +D+ A IWICPFCF R+ FP  Y++VSE
Sbjct  66   PFCVMDFAAKIWICPFCFHRSHFPAHYASVSE  97



>ref|XP_010278786.1| PREDICTED: protein transport protein SEC23-like isoform X4 [Nelumbo 
nucifera]
Length=742

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 49/92 (53%), Positives = 68/92 (74%), Gaps = 0/92 (0%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  422
            D E  DG+RM WN +P TK E++ CV+P++A    ++P P +  +PY+PLRC+TC +VLN
Sbjct  6    DLEAHDGIRMPWNVFPGTKQEAASCVVPVSAIYTPLKPFPNMPVLPYSPLRCRTCRSVLN  65

Query  423  PFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            PF+ VDY   IWICPFCFQRN FP  Y+++S+
Sbjct  66   PFSTVDYMGQIWICPFCFQRNHFPPHYASISQ  97



>ref|XP_007011442.1| Sec23/Sec24 protein transport family protein isoform 1 [Theobroma 
cacao]
 gb|EOY20252.1| Sec23/Sec24 protein transport family protein isoform 1 [Theobroma 
cacao]
Length=998

 Score =   122 bits (306),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/92 (57%), Positives = 68/92 (74%), Gaps = 0/92 (0%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  422
            + EG DGVRM WN  P TK E+S CV+P++A    I+P P +  +PYAPLRC+ C +VLN
Sbjct  6    ELEGQDGVRMAWNVVPGTKQEASNCVVPVSAIYTPIKPFPNMPVLPYAPLRCRNCRSVLN  65

Query  423  PFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            PF+ VD+ A IWICPFCFQRN FP  Y+++S+
Sbjct  66   PFSIVDFAAKIWICPFCFQRNHFPPHYASISD  97



>ref|XP_002508348.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO69606.1| predicted protein [Micromonas sp. RCC299]
Length=808

 Score =   122 bits (305),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 66/90 (73%), Gaps = 0/90 (0%)
 Frame = +3

Query  249  EGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLNPF  428
            E +DGVR++WN WP +++E+ KCV+P  A +   +  PE+  VPY P+RCK C A LNP+
Sbjct  46   EAVDGVRLSWNVWPNSRMEAQKCVVPFGALVTPRKVLPEMPVVPYDPVRCKGCAACLNPY  105

Query  429  ARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            ARVD+ A +WICPFC+ RN FP  Y+++SE
Sbjct  106  ARVDFNAKLWICPFCYTRNHFPQHYASISE  135



>ref|XP_008797249.1| PREDICTED: protein transport protein sec23 isoform X2 [Phoenix 
dactylifera]
Length=709

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/92 (59%), Positives = 66/92 (72%), Gaps = 0/92 (0%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  422
            D E  DGVRMTWN +P TK ++  CVIP AA    ++P P    +PYAPLRC+ C ++LN
Sbjct  6    DLESQDGVRMTWNIFPGTKQDAVGCVIPTAAIYTPLKPIPNTPVLPYAPLRCRMCRSILN  65

Query  423  PFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            PF+ VDY A IWICPFCFQRN FP  YS++SE
Sbjct  66   PFSIVDYIAKIWICPFCFQRNHFPPHYSSISE  97



>ref|XP_010278781.1| PREDICTED: protein transport protein SEC23-like isoform X1 [Nelumbo 
nucifera]
Length=780

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 49/92 (53%), Positives = 68/92 (74%), Gaps = 0/92 (0%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  422
            D E  DG+RM WN +P TK E++ CV+P++A    ++P P +  +PY+PLRC+TC +VLN
Sbjct  6    DLEAHDGIRMPWNVFPGTKQEAASCVVPVSAIYTPLKPFPNMPVLPYSPLRCRTCRSVLN  65

Query  423  PFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            PF+ VDY   IWICPFCFQRN FP  Y+++S+
Sbjct  66   PFSTVDYMGQIWICPFCFQRNHFPPHYASISQ  97



>ref|XP_010939452.1| PREDICTED: protein transport protein SEC23 isoform X1 [Elaeis 
guineensis]
 ref|XP_010939453.1| PREDICTED: protein transport protein SEC23 isoform X1 [Elaeis 
guineensis]
 ref|XP_010939454.1| PREDICTED: protein transport protein SEC23 isoform X1 [Elaeis 
guineensis]
Length=763

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/92 (59%), Positives = 66/92 (72%), Gaps = 0/92 (0%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  422
            D E  DGVRMTWN +P TK ++  CVIP AA    ++P P    +PYAPLRC+ C ++LN
Sbjct  6    DLESQDGVRMTWNIFPGTKQDAVGCVIPTAAMYTPLKPIPNTPVLPYAPLRCRMCRSILN  65

Query  423  PFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            PF+ VDY A IWICPFCFQRN FP  YS++SE
Sbjct  66   PFSIVDYIAKIWICPFCFQRNHFPPHYSSISE  97



>emb|CAN81541.1| hypothetical protein VITISV_008772 [Vitis vinifera]
Length=372

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 67/92 (73%), Gaps = 0/92 (0%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  422
            + E  DGVRM WN  P TK ES++ +IP+AA    ++P P +  +PY PLRC+TC +VLN
Sbjct  6    ELEAQDGVRMPWNVIPGTKQESAQSIIPVAAIYTPLKPFPSMPVLPYTPLRCRTCRSVLN  65

Query  423  PFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            PFA VD+ A +WICPFCFQRN FP  YS++S+
Sbjct  66   PFAIVDFSAKLWICPFCFQRNHFPAHYSSISD  97



>ref|XP_010278785.1| PREDICTED: protein transport protein SEC23-like isoform X3 [Nelumbo 
nucifera]
Length=746

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 49/92 (53%), Positives = 68/92 (74%), Gaps = 0/92 (0%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  422
            D E  DG+RM WN +P TK E++ CV+P++A    ++P P +  +PY+PLRC+TC +VLN
Sbjct  6    DLEAHDGIRMPWNVFPGTKQEAASCVVPVSAIYTPLKPFPNMPVLPYSPLRCRTCRSVLN  65

Query  423  PFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            PF+ VDY   IWICPFCFQRN FP  Y+++S+
Sbjct  66   PFSTVDYMGQIWICPFCFQRNHFPPHYASISQ  97



>ref|XP_002444510.1| hypothetical protein SORBIDRAFT_07g023060 [Sorghum bicolor]
 gb|EES14005.1| hypothetical protein SORBIDRAFT_07g023060 [Sorghum bicolor]
Length=763

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 68/92 (74%), Gaps = 0/92 (0%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  422
            D E  DG+RMTWN  P TK +++ CV+P++A    ++P P +  +PYAPLRC+ C ++LN
Sbjct  6    DLETQDGIRMTWNVIPGTKQDATNCVVPVSAIYTPLKPNPSIPVLPYAPLRCRMCRSILN  65

Query  423  PFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            PF+ VD+ A IW+CPFCFQRN FP  Y+++SE
Sbjct  66   PFSVVDFVAKIWVCPFCFQRNHFPQHYNSISE  97



>ref|XP_010278782.1| PREDICTED: protein transport protein SEC23-like isoform X2 [Nelumbo 
nucifera]
 ref|XP_010278783.1| PREDICTED: protein transport protein SEC23-like isoform X2 [Nelumbo 
nucifera]
 ref|XP_010278784.1| PREDICTED: protein transport protein SEC23-like isoform X2 [Nelumbo 
nucifera]
Length=766

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 49/92 (53%), Positives = 68/92 (74%), Gaps = 0/92 (0%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  422
            D E  DG+RM WN +P TK E++ CV+P++A    ++P P +  +PY+PLRC+TC +VLN
Sbjct  6    DLEAHDGIRMPWNVFPGTKQEAASCVVPVSAIYTPLKPFPNMPVLPYSPLRCRTCRSVLN  65

Query  423  PFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            PF+ VDY   IWICPFCFQRN FP  Y+++S+
Sbjct  66   PFSTVDYMGQIWICPFCFQRNHFPPHYASISQ  97



>ref|XP_010278787.1| PREDICTED: protein transport protein SEC23-like isoform X5 [Nelumbo 
nucifera]
Length=734

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 49/92 (53%), Positives = 68/92 (74%), Gaps = 0/92 (0%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  422
            D E  DG+RM WN +P TK E++ CV+P++A    ++P P +  +PY+PLRC+TC +VLN
Sbjct  6    DLEAHDGIRMPWNVFPGTKQEAASCVVPVSAIYTPLKPFPNMPVLPYSPLRCRTCRSVLN  65

Query  423  PFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            PF+ VDY   IWICPFCFQRN FP  Y+++S+
Sbjct  66   PFSTVDYMGQIWICPFCFQRNHFPPHYASISQ  97



>ref|XP_008797246.1| PREDICTED: protein transport protein SEC23 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008797247.1| PREDICTED: protein transport protein SEC23 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008797248.1| PREDICTED: protein transport protein SEC23 isoform X1 [Phoenix 
dactylifera]
Length=763

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/92 (59%), Positives = 66/92 (72%), Gaps = 0/92 (0%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  422
            D E  DGVRMTWN +P TK ++  CVIP AA    ++P P    +PYAPLRC+ C ++LN
Sbjct  6    DLESQDGVRMTWNIFPGTKQDAVGCVIPTAAIYTPLKPIPNTPVLPYAPLRCRMCRSILN  65

Query  423  PFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            PF+ VDY A IWICPFCFQRN FP  YS++SE
Sbjct  66   PFSIVDYIAKIWICPFCFQRNHFPPHYSSISE  97



>ref|XP_008375693.1| PREDICTED: protein transport protein SEC23-like [Malus domestica]
Length=521

 Score =   119 bits (298),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 52/92 (57%), Positives = 66/92 (72%), Gaps = 0/92 (0%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  422
            D E  DGVRM WN  P TK ES+  V+P++A    I+P P +  +PYAPLRC+TC +VLN
Sbjct  6    DLESQDGVRMPWNVIPGTKQESTNSVVPVSAIYTPIKPFPSMPVLPYAPLRCRTCRSVLN  65

Query  423  PFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            PF+ VDY A IWICPFCF RN FP  Y+++S+
Sbjct  66   PFSTVDYAAKIWICPFCFTRNHFPPHYASISD  97



>gb|EMS65767.1| Protein transport protein SEC23 [Triticum urartu]
Length=589

 Score =   119 bits (298),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 67/92 (73%), Gaps = 0/92 (0%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  422
            + E +DG+RM WN  P TK ++  CV+P++A    ++  P++  VPYAPLRC+ C ++LN
Sbjct  6    ELEALDGIRMPWNVIPGTKEDAVSCVVPVSAIYTPLKSIPDMPVVPYAPLRCRMCRSILN  65

Query  423  PFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            PF+RVDY A IW+C FCFQRN FP  YS++SE
Sbjct  66   PFSRVDYSAKIWLCTFCFQRNQFPQHYSSISE  97



>ref|XP_010097714.1| Protein transport protein SEC23 [Morus notabilis]
 gb|EXB70669.1| Protein transport protein SEC23 [Morus notabilis]
Length=756

 Score =   120 bits (300),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 66/92 (72%), Gaps = 0/92 (0%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  422
            D E  DGVRM WN  P TK E++ CV+P++A    I+P P +  VPY PLRC+TC ++LN
Sbjct  6    DLEAQDGVRMPWNVLPGTKQEATSCVVPVSAIYTPIKPLPNIPVVPYGPLRCRTCRSILN  65

Query  423  PFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            PF+ VD+ A IWICPFCFQRN FP  Y+ +S+
Sbjct  66   PFSIVDFVAKIWICPFCFQRNHFPPGYATISD  97



>ref|XP_011024746.1| PREDICTED: protein transport protein SEC23-like isoform X1 [Populus 
euphratica]
Length=766

 Score =   120 bits (300),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 66/92 (72%), Gaps = 0/92 (0%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  422
            + E  DGVRM WN  P TK ESS CV+P++A    I+P P +  +PY+PLRC+ C +VLN
Sbjct  6    ELEAQDGVRMPWNVLPGTKQESSNCVVPVSAIYTPIKPFPNMPVLPYSPLRCRNCRSVLN  65

Query  423  PFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            PF  VD+ A +WICPFCFQRN FP  Y+A+S+
Sbjct  66   PFCTVDFSAKLWICPFCFQRNQFPPHYTAISD  97



>ref|XP_011024747.1| PREDICTED: protein transport protein SEC23-like isoform X2 [Populus 
euphratica]
Length=765

 Score =   120 bits (300),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 66/92 (72%), Gaps = 0/92 (0%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  422
            + E  DGVRM WN  P TK ESS CV+P++A    I+P P +  +PY+PLRC+ C +VLN
Sbjct  6    ELEAQDGVRMPWNVLPGTKQESSNCVVPVSAIYTPIKPFPNMPVLPYSPLRCRNCRSVLN  65

Query  423  PFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            PF  VD+ A +WICPFCFQRN FP  Y+A+S+
Sbjct  66   PFCTVDFSAKLWICPFCFQRNQFPPHYTAISD  97



>gb|KJB78640.1| hypothetical protein B456_013G010400 [Gossypium raimondii]
Length=687

 Score =   119 bits (299),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 50/92 (54%), Positives = 67/92 (73%), Gaps = 0/92 (0%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  422
            + E  DGVRMTWN  P TK E+  CV+P++A    I+P P ++ +PYAPLRC+ C++VLN
Sbjct  6    ELEAQDGVRMTWNVVPGTKEEAGNCVVPVSAIYTPIKPFPNMLVLPYAPLRCRNCSSVLN  65

Query  423  PFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            PF  +D+ A IWICPFCF R+ FP  Y++VSE
Sbjct  66   PFCVMDFAAKIWICPFCFHRSHFPAHYASVSE  97



>ref|XP_011010741.1| PREDICTED: protein transport protein SEC23-like [Populus euphratica]
Length=765

 Score =   119 bits (299),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 50/92 (54%), Positives = 67/92 (73%), Gaps = 0/92 (0%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  422
            + E  DGVRM WN  P TK ESS CV+P++A    I+P P +  +PY+PLRC++C ++LN
Sbjct  6    ELEAQDGVRMPWNVLPGTKQESSNCVVPVSAIYTPIKPFPNMPVLPYSPLRCRSCRSILN  65

Query  423  PFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            PF  VD+ A IWICPFCFQRN FP  Y+++S+
Sbjct  66   PFCTVDFSAKIWICPFCFQRNQFPPHYASISD  97



>gb|KJB78639.1| hypothetical protein B456_013G010400 [Gossypium raimondii]
Length=716

 Score =   119 bits (299),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 50/92 (54%), Positives = 67/92 (73%), Gaps = 0/92 (0%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  422
            + E  DGVRMTWN  P TK E+  CV+P++A    I+P P ++ +PYAPLRC+ C++VLN
Sbjct  6    ELEAQDGVRMTWNVVPGTKEEAGNCVVPVSAIYTPIKPFPNMLVLPYAPLRCRNCSSVLN  65

Query  423  PFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            PF  +D+ A IWICPFCF R+ FP  Y++VSE
Sbjct  66   PFCVMDFAAKIWICPFCFHRSHFPAHYASVSE  97



>dbj|BAJ93511.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=614

 Score =   119 bits (297),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 66/92 (72%), Gaps = 0/92 (0%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  422
            + E  DGVRMTWN  P TK +++ CV+P++A    + P P +  +PYAPLRC+ C A+LN
Sbjct  6    ELEARDGVRMTWNVIPGTKQDAASCVVPVSAMYTPLNPNPAIPVLPYAPLRCRICRAILN  65

Query  423  PFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            PF+  D+ + +W+CPFCFQRN FP QYS VS+
Sbjct  66   PFSVADFNSKMWLCPFCFQRNHFPQQYSTVSQ  97



>gb|KJB78634.1| hypothetical protein B456_013G010400 [Gossypium raimondii]
 gb|KJB78635.1| hypothetical protein B456_013G010400 [Gossypium raimondii]
 gb|KJB78637.1| hypothetical protein B456_013G010400 [Gossypium raimondii]
Length=757

 Score =   119 bits (299),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 50/92 (54%), Positives = 67/92 (73%), Gaps = 0/92 (0%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  422
            + E  DGVRMTWN  P TK E+  CV+P++A    I+P P ++ +PYAPLRC+ C++VLN
Sbjct  6    ELEAQDGVRMTWNVVPGTKEEAGNCVVPVSAIYTPIKPFPNMLVLPYAPLRCRNCSSVLN  65

Query  423  PFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            PF  +D+ A IWICPFCF R+ FP  Y++VSE
Sbjct  66   PFCVMDFAAKIWICPFCFHRSHFPAHYASVSE  97



>gb|KJB78638.1| hypothetical protein B456_013G010400 [Gossypium raimondii]
Length=745

 Score =   119 bits (299),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 50/92 (54%), Positives = 67/92 (73%), Gaps = 0/92 (0%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  422
            + E  DGVRMTWN  P TK E+  CV+P++A    I+P P ++ +PYAPLRC+ C++VLN
Sbjct  6    ELEAQDGVRMTWNVVPGTKEEAGNCVVPVSAIYTPIKPFPNMLVLPYAPLRCRNCSSVLN  65

Query  423  PFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            PF  +D+ A IWICPFCF R+ FP  Y++VSE
Sbjct  66   PFCVMDFAAKIWICPFCFHRSHFPAHYASVSE  97



>gb|KJB78636.1| hypothetical protein B456_013G010400 [Gossypium raimondii]
Length=726

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 50/92 (54%), Positives = 67/92 (73%), Gaps = 0/92 (0%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  422
            + E  DGVRMTWN  P TK E+  CV+P++A    I+P P ++ +PYAPLRC+ C++VLN
Sbjct  6    ELEAQDGVRMTWNVVPGTKEEAGNCVVPVSAIYTPIKPFPNMLVLPYAPLRCRNCSSVLN  65

Query  423  PFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            PF  +D+ A IWICPFCF R+ FP  Y++VSE
Sbjct  66   PFCVMDFAAKIWICPFCFHRSHFPAHYASVSE  97



>ref|NP_001062030.1| Os08g0474700 [Oryza sativa Japonica Group]
 dbj|BAD09341.1| putative SEC23 [Oryza sativa Japonica Group]
 dbj|BAF23944.1| Os08g0474700 [Oryza sativa Japonica Group]
Length=763

 Score =   119 bits (299),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 49/92 (53%), Positives = 65/92 (71%), Gaps = 0/92 (0%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  422
            D E  DG+RM WN  P TK +++ CV+P++A    +RP P +  +PY PLRC+ C ++LN
Sbjct  6    DLELQDGIRMPWNVIPGTKQDAANCVVPVSAIYTPLRPNPAIPVLPYGPLRCRMCRSILN  65

Query  423  PFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            PF  VDY A IW+CPFCFQRN FP  YS++SE
Sbjct  66   PFCVVDYVAKIWVCPFCFQRNHFPQHYSSISE  97



>ref|XP_008344490.1| PREDICTED: protein transport protein SEC23-like [Malus domestica]
Length=305

 Score =   115 bits (288),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 65/92 (71%), Gaps = 0/92 (0%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  422
            D E  DGVRM WN  P TK ES+  V+P++A    I+P P +  +PYA LRC+TC +VLN
Sbjct  6    DLESQDGVRMPWNVIPGTKQESTNSVVPVSAIYTPIKPFPSMPVLPYAALRCRTCRSVLN  65

Query  423  PFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            PF+ VDY A IWICPFCF RN FP  Y+++S+
Sbjct  66   PFSTVDYAAKIWICPFCFTRNHFPPHYASISD  97



>ref|XP_006375610.1| hypothetical protein POPTR_0014s17660g [Populus trichocarpa]
 gb|ERP53407.1| hypothetical protein POPTR_0014s17660g [Populus trichocarpa]
Length=765

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 50/92 (54%), Positives = 66/92 (72%), Gaps = 0/92 (0%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  422
            + E  DGVRM WN  P TK ESS CV+P++A    I+P P +  +PY+PLRC+ C ++LN
Sbjct  6    ELEAQDGVRMPWNVLPGTKQESSNCVVPVSAIYTPIKPFPNMPVLPYSPLRCRACRSILN  65

Query  423  PFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            PF  VD+ A IWICPFCFQRN FP  Y+++S+
Sbjct  66   PFCTVDFSAKIWICPFCFQRNQFPPHYASISD  97



>ref|XP_003578242.1| PREDICTED: protein transport protein SEC23-like [Brachypodium 
distachyon]
Length=762

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 67/92 (73%), Gaps = 0/92 (0%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  422
            D E +DG+RM WN  P T+ +++ CV+P++A    ++  P +  VPY+PLRC+ C ++LN
Sbjct  6    DLEALDGIRMPWNVIPGTREDAASCVVPVSAIYTPLKSIPNVPVVPYSPLRCRMCRSILN  65

Query  423  PFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            PF+ VDY A IW+CPFCFQRN FP  YS++SE
Sbjct  66   PFSMVDYDAKIWLCPFCFQRNHFPQHYSSISE  97



>ref|XP_002320574.1| transport family protein [Populus trichocarpa]
 gb|EEE98889.1| transport family protein [Populus trichocarpa]
Length=773

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 50/92 (54%), Positives = 66/92 (72%), Gaps = 0/92 (0%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  422
            + E  DGVRM WN  P TK ESS CV+P++A    I+P P +  +PY+PLRC+ C ++LN
Sbjct  6    ELEAQDGVRMPWNVLPGTKQESSNCVVPVSAIYTPIKPFPNMPVLPYSPLRCRACRSILN  65

Query  423  PFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            PF  VD+ A IWICPFCFQRN FP  Y+++S+
Sbjct  66   PFCTVDFSAKIWICPFCFQRNQFPPHYASISD  97



>ref|XP_009361354.1| PREDICTED: protein transport protein SEC23-like [Pyrus x bretschneideri]
Length=761

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/92 (57%), Positives = 66/92 (72%), Gaps = 0/92 (0%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  422
            D E  DGVRM WN  P TK ES+  V+P++A    I+P P +  +PYAPLRC+TC +VLN
Sbjct  6    DLESQDGVRMPWNVIPGTKQESTNSVVPVSAIYTPIKPFPSMPVLPYAPLRCRTCRSVLN  65

Query  423  PFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            PF+ VDY A IWICPFCF RN FP  Y+++S+
Sbjct  66   PFSTVDYAAKIWICPFCFTRNHFPPHYASISD  97



>ref|XP_002265101.1| PREDICTED: protein transport protein SEC23 [Vitis vinifera]
Length=761

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 67/92 (73%), Gaps = 0/92 (0%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  422
            + E  DGVRM WN  P TK ES++ +IP+AA    ++P P +  +PY PLRC+TC +VLN
Sbjct  6    ELEAQDGVRMPWNVIPGTKQESAQSIIPVAAIYTPLKPFPSMPVLPYTPLRCRTCRSVLN  65

Query  423  PFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            PFA VD+ A +WICPFCFQRN FP  YS++S+
Sbjct  66   PFAIVDFSAKLWICPFCFQRNHFPAHYSSISD  97



>emb|CBI38071.3| unnamed protein product [Vitis vinifera]
Length=800

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 67/92 (73%), Gaps = 0/92 (0%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  422
            + E  DGVRM WN  P TK ES++ +IP+AA    ++P P +  +PY PLRC+TC +VLN
Sbjct  6    ELEAQDGVRMPWNVIPGTKQESAQSIIPVAAIYTPLKPFPSMPVLPYTPLRCRTCRSVLN  65

Query  423  PFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            PFA VD+ A +WICPFCFQRN FP  YS++S+
Sbjct  66   PFAIVDFSAKLWICPFCFQRNHFPAHYSSISD  97



>ref|XP_007220245.1| hypothetical protein PRUPE_ppa001813mg [Prunus persica]
 gb|EMJ21444.1| hypothetical protein PRUPE_ppa001813mg [Prunus persica]
Length=761

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/92 (57%), Positives = 66/92 (72%), Gaps = 0/92 (0%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  422
            D E  DGVRM WN  P TK ES+  V+P++A    I+P P +  +PYAPLRC+TC +VLN
Sbjct  6    DLESQDGVRMPWNVIPGTKQESTNSVVPVSAIYTPIKPFPSMPVLPYAPLRCRTCRSVLN  65

Query  423  PFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            PF+ VDY A IWICPFCF RN FP  Y+++S+
Sbjct  66   PFSTVDYAAKIWICPFCFTRNHFPPHYASISD  97



>gb|AAX96396.1| At1g05520/T25N20_16 [Oryza sativa Japonica Group]
 gb|ABA93126.1| Sec23/Sec24 trunk domain containing protein, expressed [Oryza 
sativa Japonica Group]
 gb|EEE52049.1| hypothetical protein OsJ_33782 [Oryza sativa Japonica Group]
Length=793

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/88 (61%), Positives = 69/88 (78%), Gaps = 3/88 (3%)
 Frame = +3

Query  264  VRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVT--VPYAPLRCKT-CTAVLNPFAR  434
            VR+TWNAWPR+KVE+S+CV+P+AA+I  +R    L +  +PY PLRCK  C+A+LNPFAR
Sbjct  21   VRLTWNAWPRSKVEASRCVVPLAAAISPVRSPESLASPPLPYPPLRCKPPCSALLNPFAR  80

Query  435  VDYQALIWICPFCFQRNSFPHQYSAVSE  518
            VD+ A IWICP CF RN FP  Y+A+SE
Sbjct  81   VDFAAKIWICPLCFSRNHFPPHYAAISE  108



>gb|EMS46122.1| Protein transport protein SEC23 [Triticum urartu]
Length=720

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 67/92 (73%), Gaps = 0/92 (0%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  422
            + E  DGVRMTWN  P TK +++ CV+P++A    + P P +  +PYAPLRC+ C ++LN
Sbjct  6    ELEARDGVRMTWNVIPGTKQDAASCVVPVSAMYTPLNPNPAIPVLPYAPLRCRICRSILN  65

Query  423  PFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            PF+  D+ + +W+CPFCFQRN FP QYSAVS+
Sbjct  66   PFSVADFGSKMWLCPFCFQRNHFPQQYSAVSQ  97



>ref|XP_008232223.1| PREDICTED: protein transport protein SEC23 [Prunus mume]
 ref|XP_008232224.1| PREDICTED: protein transport protein SEC23 [Prunus mume]
Length=761

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/92 (57%), Positives = 66/92 (72%), Gaps = 0/92 (0%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  422
            D E  DGVRM WN  P TK ES+  V+P++A    I+P P +  +PYAPLRC+TC +VLN
Sbjct  6    DLESQDGVRMPWNVIPGTKQESTNSVVPVSAIYTPIKPFPAMPVLPYAPLRCRTCRSVLN  65

Query  423  PFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            PF+ VDY A IWICPFCF RN FP  Y+++S+
Sbjct  66   PFSTVDYAAKIWICPFCFTRNHFPPHYASISD  97



>gb|EAY80788.1| hypothetical protein OsI_35968 [Oryza sativa Indica Group]
Length=793

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/88 (61%), Positives = 69/88 (78%), Gaps = 3/88 (3%)
 Frame = +3

Query  264  VRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVT--VPYAPLRCKT-CTAVLNPFAR  434
            VR+TWNAWPR+KVE+S+CV+P+AA+I  +R    L +  +PY PLRCK  C+A+LNPFAR
Sbjct  21   VRLTWNAWPRSKVEASRCVVPLAAAISPVRSPESLASPPLPYPPLRCKPPCSALLNPFAR  80

Query  435  VDYQALIWICPFCFQRNSFPHQYSAVSE  518
            VD+ A IWICP CF RN FP  Y+A+SE
Sbjct  81   VDFAAKIWICPLCFSRNHFPPHYAAISE  108



>ref|XP_004973675.1| PREDICTED: protein transport protein SEC23-like isoform X2 [Setaria 
italica]
Length=709

 Score =   118 bits (295),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 64/92 (70%), Gaps = 0/92 (0%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  422
            D E  DG+RM WN  P TK ++  CV+P++A    ++P P +  +PYAPLRC+ C ++LN
Sbjct  6    DLEAQDGIRMAWNVIPGTKQDAINCVVPVSAIFTPLKPNPTIPVLPYAPLRCRMCRSILN  65

Query  423  PFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            PF+ VD+ A IW+CPFCFQRN FP  Y  +SE
Sbjct  66   PFSVVDFVAKIWVCPFCFQRNHFPQHYYTISE  97



>gb|EMT03462.1| Protein transport protein SEC23 [Aegilops tauschii]
Length=829

 Score =   118 bits (295),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 67/92 (73%), Gaps = 0/92 (0%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  422
            + E  DGVRMTWN  P TK +++ CV+P++A    + P P +  +PYAPLRC+ C ++LN
Sbjct  6    ELEARDGVRMTWNVIPGTKQDAASCVVPVSAIYTPLNPNPAIPVLPYAPLRCRICRSILN  65

Query  423  PFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            PF+  D+ + +W+CPFCFQRN FP QYSAVS+
Sbjct  66   PFSVADFGSKMWLCPFCFQRNHFPQQYSAVSQ  97



>gb|EMT27989.1| Protein transport protein sec-23 [Aegilops tauschii]
Length=932

 Score =   118 bits (296),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 67/92 (73%), Gaps = 0/92 (0%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  422
            + E +DG+RM WN  P T+ ++  CV+P++A    ++  P++  VPYAPLRC+ C ++LN
Sbjct  162  ELEALDGIRMPWNVIPGTREDAVSCVVPVSAIYTPLKSIPDMPVVPYAPLRCRMCRSILN  221

Query  423  PFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            PF+RVDY A IW+C FCFQRN FP  YS++SE
Sbjct  222  PFSRVDYNAKIWLCTFCFQRNQFPQHYSSISE  253



>ref|XP_004973674.1| PREDICTED: protein transport protein SEC23-like isoform X1 [Setaria 
italica]
Length=763

 Score =   117 bits (294),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 64/92 (70%), Gaps = 0/92 (0%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  422
            D E  DG+RM WN  P TK ++  CV+P++A    ++P P +  +PYAPLRC+ C ++LN
Sbjct  6    DLEAQDGIRMAWNVIPGTKQDAINCVVPVSAIFTPLKPNPTIPVLPYAPLRCRMCRSILN  65

Query  423  PFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            PF+ VD+ A IW+CPFCFQRN FP  Y  +SE
Sbjct  66   PFSVVDFVAKIWVCPFCFQRNHFPQHYYTISE  97



>ref|XP_004160683.1| PREDICTED: protein transport protein SEC23-like [Cucumis sativus]
Length=761

 Score =   117 bits (294),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 49/92 (53%), Positives = 67/92 (73%), Gaps = 0/92 (0%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  422
            D E  DGVRM WN  P TK E+S C++P++A    I+  P +  +PY+PLRC+TC ++LN
Sbjct  6    DLEAQDGVRMPWNVVPGTKQEASNCIVPVSALYTPIKAFPNMPVLPYSPLRCRTCRSILN  65

Query  423  PFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            PF+ VD+ A IWICPFCFQRN FP  Y+++S+
Sbjct  66   PFSIVDFAAKIWICPFCFQRNHFPPHYASISD  97



>ref|XP_004964627.1| PREDICTED: protein transport protein SEC23-like isoform X1 [Setaria 
italica]
 ref|XP_004964628.1| PREDICTED: protein transport protein SEC23-like isoform X2 [Setaria 
italica]
 ref|XP_004964629.1| PREDICTED: protein transport protein SEC23-like isoform X3 [Setaria 
italica]
 ref|XP_004964630.1| PREDICTED: protein transport protein SEC23-like isoform X4 [Setaria 
italica]
 ref|XP_004964631.1| PREDICTED: protein transport protein SEC23-like isoform X5 [Setaria 
italica]
 ref|XP_004964632.1| PREDICTED: protein transport protein SEC23-like isoform X6 [Setaria 
italica]
Length=762

 Score =   117 bits (294),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 50/92 (54%), Positives = 65/92 (71%), Gaps = 0/92 (0%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  422
            D E  DG+RM WN  P TK E+  CVIP++A    ++  P++  +PY+PLRC+ C +VLN
Sbjct  6    DLEAQDGIRMPWNVIPGTKQEALNCVIPVSAIYTPLKSIPDIPVLPYSPLRCRMCRSVLN  65

Query  423  PFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            PF+ VDY A IW+CPFCFQRN FP  YS +SE
Sbjct  66   PFSIVDYVAKIWVCPFCFQRNQFPQHYSLISE  97



>ref|XP_004145019.1| PREDICTED: LOW QUALITY PROTEIN: protein transport protein SEC23-like 
[Cucumis sativus]
Length=769

 Score =   117 bits (294),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 49/92 (53%), Positives = 67/92 (73%), Gaps = 0/92 (0%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  422
            D E  DGVRM WN  P TK E+S C++P++A    I+  P +  +PY+PLRC+TC ++LN
Sbjct  6    DLEAQDGVRMPWNVVPGTKQEASNCIVPVSALYTPIKAFPNMPVLPYSPLRCRTCRSILN  65

Query  423  PFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            PF+ VD+ A IWICPFCFQRN FP  Y+++S+
Sbjct  66   PFSIVDFAAKIWICPFCFQRNHFPPHYASISD  97



>ref|XP_004153079.1| PREDICTED: protein transport protein SEC23-like [Cucumis sativus]
 gb|KGN46272.1| hypothetical protein Csa_6G078680 [Cucumis sativus]
Length=761

 Score =   117 bits (294),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 49/92 (53%), Positives = 67/92 (73%), Gaps = 0/92 (0%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  422
            D E  DGVRM WN  P TK E+S C++P++A    I+  P +  +PY+PLRC+TC ++LN
Sbjct  6    DLEAQDGVRMPWNVVPGTKQEASNCIVPVSALYTPIKAFPNMPVLPYSPLRCRTCRSILN  65

Query  423  PFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            PF+ VD+ A IWICPFCFQRN FP  Y+++S+
Sbjct  66   PFSIVDFAAKIWICPFCFQRNHFPPHYASISD  97



>ref|XP_008460075.1| PREDICTED: protein transport protein SEC23 [Cucumis melo]
Length=761

 Score =   117 bits (294),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 49/92 (53%), Positives = 67/92 (73%), Gaps = 0/92 (0%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  422
            D E  DGVRM WN  P TK E+S C++P++A    I+  P +  +PY+PLRC+TC ++LN
Sbjct  6    DLEAQDGVRMPWNVVPGTKQEASNCIVPVSALYTPIKAFPNMPVLPYSPLRCRTCRSILN  65

Query  423  PFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            PF+ VD+ A IWICPFCFQRN FP  Y+++S+
Sbjct  66   PFSIVDFAAKIWICPFCFQRNHFPPHYASISD  97



>ref|XP_004307298.1| PREDICTED: protein transport protein SEC23 [Fragaria vesca subsp. 
vesca]
Length=761

 Score =   117 bits (293),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 52/92 (57%), Positives = 66/92 (72%), Gaps = 0/92 (0%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  422
            D E  DGVRM WN  P TK ES+  VIP++A    I+P P +  +PY+PLRC+TC AVLN
Sbjct  6    DLETQDGVRMPWNVIPGTKQESTNSVIPVSAIYTPIKPFPTMPLLPYSPLRCRTCRAVLN  65

Query  423  PFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            PF+ VDY A IWICPFCF RN FP  Y+++++
Sbjct  66   PFSTVDYAAKIWICPFCFTRNHFPPHYASITD  97



>ref|XP_002460346.1| hypothetical protein SORBIDRAFT_02g026780 [Sorghum bicolor]
 gb|EER96867.1| hypothetical protein SORBIDRAFT_02g026780 [Sorghum bicolor]
Length=762

 Score =   117 bits (293),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 49/92 (53%), Positives = 66/92 (72%), Gaps = 0/92 (0%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  422
            D E  DG+RM WN  P TK E+  CVIP++A    ++  P++  +PY+PLRC+ C ++LN
Sbjct  6    DLEVQDGIRMPWNVIPGTKQETVNCVIPVSAIYTPLKSIPDIPVLPYSPLRCRMCRSILN  65

Query  423  PFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            PF+ VDY A IW+CPFCFQRN FP  YS++SE
Sbjct  66   PFSIVDYVAKIWVCPFCFQRNQFPQHYSSISE  97



>ref|XP_006659495.1| PREDICTED: protein transport protein SEC23-like [Oryza brachyantha]
Length=763

 Score =   117 bits (292),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 65/92 (71%), Gaps = 0/92 (0%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  422
            + E  DG+RM WN  P TK +++ CV+P++A    ++P P +  +PY PLRC+ C ++LN
Sbjct  6    ELEAQDGIRMPWNVIPGTKQDAANCVVPVSAIYTPLKPNPVIPVLPYGPLRCRMCRSILN  65

Query  423  PFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            PF  VDY A IW+CPFCFQRN FP  YS++SE
Sbjct  66   PFCVVDYVAKIWVCPFCFQRNHFPQHYSSISE  97



>dbj|BAJ85358.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=782

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 67/88 (76%), Gaps = 3/88 (3%)
 Frame = +3

Query  264  VRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVT--VPYAPLRCKT-CTAVLNPFAR  434
            VR TWNAWPR+KVE+S+CV+P+AA+I  +R    L +  +PY PLRCK  C+A+LNPFAR
Sbjct  20   VRFTWNAWPRSKVEASRCVVPLAAAISPVRSPESLASPPLPYPPLRCKPPCSALLNPFAR  79

Query  435  VDYQALIWICPFCFQRNSFPHQYSAVSE  518
            VD+ A IWICP CF RN FP  Y+ +SE
Sbjct  80   VDFAAKIWICPLCFSRNHFPPHYAGISE  107



>dbj|BAK01218.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=782

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 67/88 (76%), Gaps = 3/88 (3%)
 Frame = +3

Query  264  VRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVT--VPYAPLRCKT-CTAVLNPFAR  434
            VR TWNAWPR+KVE+S+CV+P+AA+I  +R    L +  +PY PLRCK  C+A+LNPFAR
Sbjct  20   VRFTWNAWPRSKVEASRCVVPLAAAISPVRSPESLASPPLPYPPLRCKPPCSALLNPFAR  79

Query  435  VDYQALIWICPFCFQRNSFPHQYSAVSE  518
            VD+ A IWICP CF RN FP  Y+ +SE
Sbjct  80   VDFAAKIWICPLCFSRNHFPPHYAGISE  107



>gb|KHG07260.1| Protein transport SEC23 [Gossypium arboreum]
Length=761

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 49/92 (53%), Positives = 66/92 (72%), Gaps = 0/92 (0%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  422
            + E  DGVRMTWN  P TK E+  CV+P++A    I+P P ++ + YAPLRC+ C++VLN
Sbjct  6    ELEAQDGVRMTWNVVPGTKEEAGNCVVPVSAIYTPIKPFPNMLVLTYAPLRCRNCSSVLN  65

Query  423  PFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            PF  +D+ A IWICPFCF R+ FP  Y++VSE
Sbjct  66   PFCVMDFAAKIWICPFCFHRSHFPAHYASVSE  97



>ref|XP_009376310.1| PREDICTED: protein transport protein SEC23-like [Pyrus x bretschneideri]
Length=761

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 65/92 (71%), Gaps = 0/92 (0%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  422
            D E  DGVRM WN  P TK ES+  V+P++A    I+P P +  +PYA LRC+TC +VLN
Sbjct  6    DLESQDGVRMPWNVIPGTKQESTNSVVPVSAIYTPIKPFPSMPVLPYAALRCRTCRSVLN  65

Query  423  PFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            PF+ VDY A IWICPFCF RN FP  Y+++S+
Sbjct  66   PFSTVDYAAKIWICPFCFTRNHFPPHYASISD  97



>ref|XP_008344985.1| PREDICTED: protein transport protein SEC23 [Malus domestica]
Length=761

 Score =   115 bits (288),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 65/92 (71%), Gaps = 0/92 (0%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  422
            D E  DGVRM WN  P TK ES+  V+P++A    I+P P +  +PYA LRC+TC +VLN
Sbjct  6    DLESQDGVRMPWNVIPGTKQESTNSVVPVSAIYTPIKPFPSMPVLPYAALRCRTCRSVLN  65

Query  423  PFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            PF+ VDY A IWICPFCF RN FP  Y+++S+
Sbjct  66   PFSTVDYAAKIWICPFCFTRNHFPPHYASISD  97



>ref|XP_010052697.1| PREDICTED: protein transport protein SEC23 [Eucalyptus grandis]
 gb|KCW76763.1| hypothetical protein EUGRSUZ_D01124 [Eucalyptus grandis]
Length=762

 Score =   115 bits (288),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 66/92 (72%), Gaps = 0/92 (0%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  422
            D E  DGVRM WN  P T+ E++ CV+P++A    +RP P +  +PY+PLRC+ C +VLN
Sbjct  6    DLEAQDGVRMPWNVVPGTRQEAAGCVVPVSAVYTPLRPFPSMPVLPYSPLRCRNCRSVLN  65

Query  423  PFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            PF+ VD+ A IWICP CFQRN FP  Y+++S+
Sbjct  66   PFSIVDFAAKIWICPLCFQRNHFPPHYASISD  97



>gb|EEE67142.1| hypothetical protein OsJ_24197 [Oryza sativa Japonica Group]
Length=768

 Score =   115 bits (288),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 66/92 (72%), Gaps = 0/92 (0%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  422
            D E  DG+RM WN  P T+ ++  CV+PI+A    ++  P++  +PY+PLRC+ C ++LN
Sbjct  6    DLEAQDGIRMPWNVIPGTREDALSCVVPISAIYTPLKQVPDIPVLPYSPLRCRMCRSILN  65

Query  423  PFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            PF+ VDY A IW+CPFCFQRN FP  YS++SE
Sbjct  66   PFSIVDYVAKIWVCPFCFQRNHFPQHYSSISE  97



>ref|XP_003626854.1| Protein transport protein SEC23 [Medicago truncatula]
 gb|AET01330.1| protein transporter Sec23-like protein [Medicago truncatula]
Length=763

 Score =   114 bits (286),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 65/92 (71%), Gaps = 0/92 (0%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  422
            D E  DGVRM WN  P TK ES   V+P+AA    I+  P +  +PY+PLRC+TC ++LN
Sbjct  7    DLETQDGVRMPWNVIPGTKQESVNVVVPVAAIYTPIKHFPTMPILPYSPLRCRTCRSILN  66

Query  423  PFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            PF  VD+ A IWICPFCFQRN FP+ Y+++SE
Sbjct  67   PFCIVDFAAKIWICPFCFQRNHFPNHYASISE  98



>gb|KDO85352.1| hypothetical protein CISIN_1g004199mg [Citrus sinensis]
Length=470

 Score =   112 bits (280),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 67/96 (70%), Gaps = 4/96 (4%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQP----ELVTVPYAPLRCKTCT  410
            D E  DGVRM WN  P TK E+S CV+P++A    I+  P     +  +PYAPLRC+TC 
Sbjct  6    DLEAQDGVRMPWNVIPGTKQEASNCVVPVSAIYTPIKAFPVNNNSMPILPYAPLRCRTCR  65

Query  411  AVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            ++LNPF+ VD+ A IWICPFCFQRN FP  Y+++++
Sbjct  66   SILNPFSIVDFAAKIWICPFCFQRNHFPPHYASITD  101



>gb|EEC82002.1| hypothetical protein OsI_25948 [Oryza sativa Indica Group]
Length=768

 Score =   114 bits (285),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 66/92 (72%), Gaps = 0/92 (0%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  422
            D E  DG+RM WN  P T+ ++  CV+PI+A    ++  P++  +PY+PLRC+ C ++LN
Sbjct  6    DLEAQDGIRMPWNVIPGTREDALSCVVPISAIYTPLKQVPDIPVLPYSPLRCRMCRSILN  65

Query  423  PFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            PF+ VDY A IW+CPFCFQRN FP  YS++SE
Sbjct  66   PFSIVDYVAKIWVCPFCFQRNHFPQLYSSISE  97



>tpg|DAA40251.1| TPA: hypothetical protein ZEAMMB73_365624 [Zea mays]
Length=724

 Score =   114 bits (284),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 65/92 (71%), Gaps = 0/92 (0%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  422
            D E  DG+RM WN  P TK E+  CVIP++A    ++P  ++  +PY+PLRC+ C ++LN
Sbjct  6    DLELQDGIRMPWNVIPGTKQETVNCVIPVSAIYTPLKPISDIPVLPYSPLRCRMCRSILN  65

Query  423  PFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            PF+ VDY A IW+C FCFQRN FP  YS++SE
Sbjct  66   PFSIVDYVAKIWVCSFCFQRNQFPQHYSSISE  97



>ref|XP_008668489.1| PREDICTED: uncharacterized protein LOC100384491 isoform X1 [Zea 
mays]
Length=895

 Score =   114 bits (285),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 78/119 (66%), Gaps = 6/119 (5%)
 Frame = +3

Query  174  FVCI----YLYYIARSSLMASSEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASI  341
            F+C+     L  + +++++  SE    D E  DG+RM WN  P TK E+  CVIP++A  
Sbjct  114  FLCLTCGSLLQLLYKAAVLKMSEF--LDLELQDGIRMPWNVIPGTKQETVNCVIPVSAIY  171

Query  342  HLIRPQPELVTVPYAPLRCKTCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
              ++P  ++  +PY+PLRC+ C ++LNPF+ VDY A IW+C FCFQRN FP  YS++SE
Sbjct  172  TPLKPISDIPVLPYSPLRCRMCRSILNPFSIVDYVAKIWVCSFCFQRNQFPQHYSSISE  230



>ref|XP_002946892.1| hypothetical protein VOLCADRAFT_103128 [Volvox carteri f. nagariensis]
 gb|EFJ52118.1| hypothetical protein VOLCADRAFT_103128 [Volvox carteri f. nagariensis]
Length=764

 Score =   114 bits (284),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 64/90 (71%), Gaps = 0/90 (0%)
 Frame = +3

Query  249  EGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLNPF  428
            E IDGVR+TWN WP +K+E++KCVIP A+     +  P +  +PY P+ CK C+A+LNP+
Sbjct  7    EDIDGVRLTWNIWPNSKLEATKCVIPFASVYTPNKRLPTMPVLPYEPIPCKQCSAILNPY  66

Query  429  ARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            ARVD+ + +WICPFC  RN FP  Y  +S+
Sbjct  67   ARVDFYSKVWICPFCHSRNHFPAHYQGISD  96



>ref|XP_001702936.1| COP-II coat subunit [Chlamydomonas reinhardtii]
 gb|EDO96789.1| COP-II coat subunit [Chlamydomonas reinhardtii]
Length=762

 Score =   113 bits (283),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 63/90 (70%), Gaps = 0/90 (0%)
 Frame = +3

Query  249  EGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLNPF  428
            E IDGVR+TWN WP +K+E++KCVIP A+     +  P +  +PY P+ CK C A+LNP+
Sbjct  7    EDIDGVRLTWNIWPNSKLEATKCVIPFASIYTPNKRLPTMPVLPYEPIPCKQCNAILNPY  66

Query  429  ARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            ARVD+ + +WICPFC  RN FP  Y  +S+
Sbjct  67   ARVDFYSKVWICPFCHSRNHFPAHYQGISD  96



>ref|XP_005843379.1| hypothetical protein CHLNCDRAFT_141205 [Chlorella variabilis]
 gb|EFN51277.1| hypothetical protein CHLNCDRAFT_141205 [Chlorella variabilis]
Length=466

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/102 (49%), Positives = 66/102 (65%), Gaps = 2/102 (2%)
 Frame = +3

Query  213  LMASSEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPL  392
            +M  +E +  + E IDGVRMTWN WP +++E++KCVIP        R   +L  V Y P+
Sbjct  1    MMLQAEFA--ELEEIDGVRMTWNVWPHSRLEAAKCVIPFCTLYSPARQTSQLQVVEYDPV  58

Query  393  RCKTCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
             CKTC +VLNP+A VD+ A IW CPFC  RN FP  Y+ +SE
Sbjct  59   TCKTCGSVLNPYASVDFAAKIWTCPFCHTRNHFPPHYAGISE  100



>gb|KDO85351.1| hypothetical protein CISIN_1g004199mg [Citrus sinensis]
Length=561

 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 67/96 (70%), Gaps = 4/96 (4%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQP----ELVTVPYAPLRCKTCT  410
            D E  DGVRM WN  P TK E+S CV+P++A    I+  P     +  +PYAPLRC+TC 
Sbjct  6    DLEAQDGVRMPWNVIPGTKQEASNCVVPVSAIYTPIKAFPVNNNSMPILPYAPLRCRTCR  65

Query  411  AVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            ++LNPF+ VD+ A IWICPFCFQRN FP  Y+++++
Sbjct  66   SILNPFSIVDFAAKIWICPFCFQRNHFPPHYASITD  101



>ref|XP_002461253.1| hypothetical protein SORBIDRAFT_02g043632 [Sorghum bicolor]
 gb|EER97774.1| hypothetical protein SORBIDRAFT_02g043632 [Sorghum bicolor]
Length=219

 Score =   107 bits (268),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 43/92 (47%), Positives = 63/92 (68%), Gaps = 0/92 (0%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  422
            D E  DG+RMTWN  P TK +++ CV+P++     ++P   +  +PYAPL C+ C ++LN
Sbjct  6    DLETQDGIRMTWNVIPGTKQDATNCVVPVSVIYTPLKPNLSIPVLPYAPLSCRMCRSILN  65

Query  423  PFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            PF+ VD+ A IW+C FCFQRN FP  Y+++ E
Sbjct  66   PFSVVDFVAKIWVCSFCFQRNHFPQHYNSILE  97



>ref|XP_001774442.1| predicted protein [Physcomitrella patens]
 gb|EDQ60805.1| predicted protein [Physcomitrella patens]
Length=779

 Score =   112 bits (281),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 65/98 (66%), Gaps = 7/98 (7%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIR-------PQPELVTVPYAPLRCK  401
            + E   GVRM WNAWP T++E++KC +P AA +  +          P +  +PY PLRCK
Sbjct  7    EVEAATGVRMPWNAWPNTQIEAAKCAVPFAAVVTPLHHGGGADSTAPPVNVLPYPPLRCK  66

Query  402  TCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVS  515
            TC AVLNPF RVD+ A IWICPFC+QR  FP  Y+++S
Sbjct  67   TCRAVLNPFCRVDFDAKIWICPFCYQRCHFPSHYASIS  104



>ref|XP_006445524.1| hypothetical protein CICLE_v10019144mg [Citrus clementina]
 gb|ESR58764.1| hypothetical protein CICLE_v10019144mg [Citrus clementina]
Length=683

 Score =   112 bits (280),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 67/96 (70%), Gaps = 4/96 (4%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQP----ELVTVPYAPLRCKTCT  410
            D E  DGVRM WN  P TK E+S CV+P++A    I+  P     +  +PYAPLRC+TC 
Sbjct  6    DLEAQDGVRMPWNVIPGTKQEASNCVVPVSAIYTPIKAFPVNNNSMPILPYAPLRCRTCR  65

Query  411  AVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            ++LNPF+ VD+ A IWICPFCFQRN FP  Y+++++
Sbjct  66   SILNPFSIVDFAAKIWICPFCFQRNHFPPHYASITD  101



>gb|KDO85350.1| hypothetical protein CISIN_1g004199mg [Citrus sinensis]
Length=701

 Score =   112 bits (279),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 67/96 (70%), Gaps = 4/96 (4%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQP----ELVTVPYAPLRCKTCT  410
            D E  DGVRM WN  P TK E+S CV+P++A    I+  P     +  +PYAPLRC+TC 
Sbjct  6    DLEAQDGVRMPWNVIPGTKQEASNCVVPVSAIYTPIKAFPVNNNSMPILPYAPLRCRTCR  65

Query  411  AVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            ++LNPF+ VD+ A IWICPFCFQRN FP  Y+++++
Sbjct  66   SILNPFSIVDFAAKIWICPFCFQRNHFPPHYASITD  101



>ref|XP_006464334.1| PREDICTED: protein transport protein SEC23-like [Citrus sinensis]
 gb|KDO85348.1| hypothetical protein CISIN_1g004199mg [Citrus sinensis]
Length=769

 Score =   112 bits (279),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 67/96 (70%), Gaps = 4/96 (4%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQP----ELVTVPYAPLRCKTCT  410
            D E  DGVRM WN  P TK E+S CV+P++A    I+  P     +  +PYAPLRC+TC 
Sbjct  6    DLEAQDGVRMPWNVIPGTKQEASNCVVPVSAIYTPIKAFPVNNNSMPILPYAPLRCRTCR  65

Query  411  AVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            ++LNPF+ VD+ A IWICPFCFQRN FP  Y+++++
Sbjct  66   SILNPFSIVDFAAKIWICPFCFQRNHFPPHYASITD  101



>gb|KDO85349.1| hypothetical protein CISIN_1g004199mg [Citrus sinensis]
Length=762

 Score =   112 bits (279),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 67/96 (70%), Gaps = 4/96 (4%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQP----ELVTVPYAPLRCKTCT  410
            D E  DGVRM WN  P TK E+S CV+P++A    I+  P     +  +PYAPLRC+TC 
Sbjct  6    DLEAQDGVRMPWNVIPGTKQEASNCVVPVSAIYTPIKAFPVNNNSMPILPYAPLRCRTCR  65

Query  411  AVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            ++LNPF+ VD+ A IWICPFCFQRN FP  Y+++++
Sbjct  66   SILNPFSIVDFAAKIWICPFCFQRNHFPPHYASITD  101



>ref|XP_010235206.1| PREDICTED: protein transport protein SEC23-like isoform X2 [Brachypodium 
distachyon]
Length=722

 Score =   111 bits (278),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 46/91 (51%), Positives = 63/91 (69%), Gaps = 0/91 (0%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  422
            + E  DG+RMTWN  P TK +++ CV+P++A    + P P +  +PYAPLRC+ C ++LN
Sbjct  6    ELEAQDGIRMTWNVIPGTKQDAASCVVPVSALYTPLYPNPAIPVLPYAPLRCRICRSILN  65

Query  423  PFARVDYQALIWICPFCFQRNSFPHQYSAVS  515
             F+ VD+ + IW CPFCFQRN FP  YS VS
Sbjct  66   SFSVVDFDSKIWQCPFCFQRNHFPQHYSTVS  96



>ref|XP_003574621.1| PREDICTED: protein transport protein SEC23-like isoform X1 [Brachypodium 
distachyon]
Length=763

 Score =   111 bits (278),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 46/91 (51%), Positives = 63/91 (69%), Gaps = 0/91 (0%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  422
            + E  DG+RMTWN  P TK +++ CV+P++A    + P P +  +PYAPLRC+ C ++LN
Sbjct  6    ELEAQDGIRMTWNVIPGTKQDAASCVVPVSALYTPLYPNPAIPVLPYAPLRCRICRSILN  65

Query  423  PFARVDYQALIWICPFCFQRNSFPHQYSAVS  515
             F+ VD+ + IW CPFCFQRN FP  YS VS
Sbjct  66   SFSVVDFDSKIWQCPFCFQRNHFPQHYSTVS  96



>ref|XP_002966180.1| hypothetical protein SELMODRAFT_168140 [Selaginella moellendorffii]
 gb|EFJ32207.1| hypothetical protein SELMODRAFT_168140 [Selaginella moellendorffii]
Length=756

 Score =   111 bits (278),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 66/94 (70%), Gaps = 3/94 (3%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRP--QPELVTVPYAPLRCKTCTAV  416
            + E  DG+RM+WN WP ++VE ++CV+P AA I  ++P  QPE V + Y PLRC+TC A+
Sbjct  6    EIEAADGIRMSWNVWPSSRVEMARCVVPPAAVISPLQPLAQPEAV-LQYPPLRCRTCRAI  64

Query  417  LNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            LNPF  VD+   IW+CPF F RN FP  YS +SE
Sbjct  65   LNPFCSVDFAGKIWVCPFDFSRNQFPPHYSELSE  98



>ref|XP_002982254.1| hypothetical protein SELMODRAFT_155031 [Selaginella moellendorffii]
 gb|EFJ16499.1| hypothetical protein SELMODRAFT_155031 [Selaginella moellendorffii]
Length=756

 Score =   111 bits (278),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 66/94 (70%), Gaps = 3/94 (3%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRP--QPELVTVPYAPLRCKTCTAV  416
            + E  DG+RM+WN WP ++VE ++CV+P AA I  ++P  QPE V + Y PLRC+TC A+
Sbjct  6    EIEAADGIRMSWNVWPSSRVEMARCVVPPAAVISPLQPLAQPEAV-LQYPPLRCRTCRAI  64

Query  417  LNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            LNPF  VD+   IW+CPF F RN FP  YS +SE
Sbjct  65   LNPFCSVDFAGKIWVCPFDFSRNQFPPHYSELSE  98



>ref|XP_002102257.1| GD19805 [Drosophila simulans]
 gb|EDX11760.1| GD19805 [Drosophila simulans]
Length=156

 Score =   104 bits (260),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 68/103 (66%), Gaps = 2/103 (2%)
 Frame = +3

Query  216  MASSEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLR  395
            M + E      E  DGVR+TWN WP +++E+S+ V+P+A     ++ +P+L  + Y P+ 
Sbjct  1    MTTYEEFIQQNEDRDGVRLTWNVWPSSRIEASRLVVPLACLYQPLKERPDLPPIQYEPVL  60

Query  396  C--KTCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            C    C A+LNP  +VDY+A +W+C FCFQRN FP QY+A+SE
Sbjct  61   CTRSNCRAILNPLCQVDYRAKLWVCNFCFQRNPFPPQYAAISE  103



>ref|XP_010691934.1| PREDICTED: protein transport protein SEC23 [Beta vulgaris subsp. 
vulgaris]
Length=769

 Score =   110 bits (276),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 46/92 (50%), Positives = 63/92 (68%), Gaps = 0/92 (0%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  422
            D E  DGVRM WN  P TK ESS  VIP++     I+  P L  +PY+PLRC++C ++LN
Sbjct  6    DLETQDGVRMPWNVIPGTKQESSNSVIPVSLLYTPIKSFPNLPILPYSPLRCRSCRSILN  65

Query  423  PFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            PF+ +D+   +WICPFCF RN FP  Y+++S+
Sbjct  66   PFSVIDFAGKVWICPFCFNRNHFPQHYASISD  97



>ref|XP_004510207.1| PREDICTED: protein transport protein SEC23-like [Cicer arietinum]
Length=762

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/92 (54%), Positives = 63/92 (68%), Gaps = 0/92 (0%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  422
            D E  DGVRM WN  P TK ES   V+P+AA    I+  P +  +PY+PLRC+TC +VLN
Sbjct  6    DLESQDGVRMPWNVIPGTKQESLNVVVPVAAIYTPIKHFPSMPLLPYSPLRCRTCRSVLN  65

Query  423  PFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            PF  VD+ A IWICP CFQRN FP  Y+++S+
Sbjct  66   PFCIVDFAAKIWICPICFQRNHFPPHYASISD  97



>ref|XP_001765516.1| predicted protein [Physcomitrella patens]
 gb|EDQ69566.1| predicted protein [Physcomitrella patens]
Length=752

 Score =   109 bits (273),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 61/93 (66%), Gaps = 0/93 (0%)
 Frame = +3

Query  240  TDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVL  419
            T+ EG++GVR+ WN WP +++E+++ VIP       + P PEL  +PY P+ CK C  VL
Sbjct  4    TELEGVEGVRLVWNEWPSSRIEATRLVIPFGVMCTPLGPIPELPLLPYEPIFCKGCRGVL  63

Query  420  NPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            NP+ R D  A IW+C FCFQRN FP  Y  +S+
Sbjct  64   NPYCRYDTDAKIWVCQFCFQRNHFPASYHQISQ  96



>ref|XP_003521007.1| PREDICTED: protein transport protein SEC23-like [Glycine max]
Length=767

 Score =   109 bits (272),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 49/92 (53%), Positives = 63/92 (68%), Gaps = 0/92 (0%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  422
            D E  DGVRM WN  P TK ++   V+PI+A    I+  P +  + Y+PLRC+TC +VLN
Sbjct  6    DLESQDGVRMPWNVIPGTKQDAQNAVVPISAVYTPIKHFPSMPVLNYSPLRCRTCRSVLN  65

Query  423  PFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            PF  VD+ A IWICPFCFQRN FP  YS++S+
Sbjct  66   PFCIVDFAAKIWICPFCFQRNHFPPHYSSISD  97



>dbj|BAM19569.1| protein transport protein sec23, partial [Papilio xuthus]
Length=190

 Score =   103 bits (257),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 67/103 (65%), Gaps = 2/103 (2%)
 Frame = +3

Query  216  MASSEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLR  395
            MA+ E      E  DG+R TWN WP + +E++  V+P+A     ++ +P+L  + Y P+ 
Sbjct  1    MATYEEFIQQNEDRDGIRFTWNVWPSSXIETTXLVVPLACLYQPLKERPDLPPIQYEPVL  60

Query  396  C--KTCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            C   TC A+LNP  +VDY+A +W+C FCFQRN FP QY+A+SE
Sbjct  61   CTRNTCRAILNPMCQVDYRAKLWVCNFCFQRNPFPPQYAAISE  103



>ref|XP_780042.1| PREDICTED: protein transport protein Sec23A isoform 1 [Strongylocentrotus 
purpuratus]
Length=764

 Score =   108 bits (270),  Expect = 8e-24, Method: Composition-based stats.
 Identities = 47/103 (46%), Positives = 71/103 (69%), Gaps = 3/103 (3%)
 Frame = +3

Query  216  MASSEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLR  395
            MA+ E  + + E  DGVR +WN WP +++E+++ V+P++A    ++ +P+L  + Y P+ 
Sbjct  1    MANYEFIRQNEER-DGVRFSWNVWPSSRLEATRMVVPLSALYTPLKERPDLPPIQYDPVL  59

Query  396  CK--TCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            C   TC AVLNPF +VDY+A +W C FCFQRN FP+QY  +SE
Sbjct  60   CSRSTCRAVLNPFCQVDYRAKLWNCNFCFQRNQFPNQYRGISE  102



>gb|EPX72404.1| GTPase activating protein Sec23b [Schizosaccharomyces octosporus 
yFS286]
Length=765

 Score =   108 bits (270),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 62/90 (69%), Gaps = 1/90 (1%)
 Frame = +3

Query  249  EGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT-CTAVLNP  425
            E  DG+R++WN +P T  E+++ VIPI A    + P+P+LVT PY P+ C+  C AVLNP
Sbjct  7    EDQDGIRLSWNMFPATTAETARAVIPIGAMYTPLHPKPDLVTAPYEPITCRAPCRAVLNP  66

Query  426  FARVDYQALIWICPFCFQRNSFPHQYSAVS  515
            +  VD +A  WICPFCFQRNS P QY  +S
Sbjct  67   YCNVDLRARFWICPFCFQRNSLPPQYHDIS  96



>gb|KDP40275.1| hypothetical protein JCGZ_02273 [Jatropha curcas]
Length=787

 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 61/92 (66%), Gaps = 0/92 (0%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  422
            + E I+G+R +WNAWP TK E +  VIP+      +    EL  +PY PL C  C AVLN
Sbjct  5    ELEAIEGLRWSWNAWPTTKNEVTSLVIPLGIMCTPLMQSLELPILPYEPLTCTRCGAVLN  64

Query  423  PFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            P+ARVDYQ+ IW CPFC+Q+N+FP  YS + E
Sbjct  65   PYARVDYQSRIWSCPFCYQKNTFPISYSGIGE  96



>ref|XP_006854134.1| hypothetical protein AMTR_s00048p00165750 [Amborella trichopoda]
 gb|ERN15601.1| hypothetical protein AMTR_s00048p00165750 [Amborella trichopoda]
Length=762

 Score =   107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/92 (54%), Positives = 66/92 (72%), Gaps = 0/92 (0%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  422
            + E  DG+RM WN WP TK E+S CVIP +A    + P P L  +PY PLRC+TC ++LN
Sbjct  6    ELEAQDGIRMPWNVWPGTKPEASACVIPTSAIYTPLNPNPNLPLLPYQPLRCRTCRSILN  65

Query  423  PFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            PFA VD+QA IW CPFC+QRN FP  Y+++++
Sbjct  66   PFAIVDFQAKIWACPFCYQRNHFPPHYASITD  97



>ref|XP_011416353.1| PREDICTED: protein transport protein Sec23A-like isoform X4 [Crassostrea 
gigas]
Length=779

 Score =   107 bits (267),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 46/107 (43%), Positives = 70/107 (65%), Gaps = 3/107 (3%)
 Frame = +3

Query  204  RSSLMASSEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPY  383
            R S+    E  Q + E  DGVR +WN WP +++E+++ V+P+      ++ +P+L  + Y
Sbjct  10   RYSMATYQEFIQQN-EDRDGVRFSWNVWPSSRIEATRMVVPLGCLFTPLKERPDLPPIQY  68

Query  384  APLRCK--TCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
             P+ C   TC A+LNPF +VDY+A +W C FCFQRN FP QY+A+S+
Sbjct  69   DPVLCTRPTCRAILNPFCQVDYRAKVWACNFCFQRNPFPPQYAAISD  115



>ref|XP_011416351.1| PREDICTED: protein transport protein Sec23A-like isoform X2 [Crassostrea 
gigas]
Length=784

 Score =   107 bits (267),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 46/107 (43%), Positives = 70/107 (65%), Gaps = 3/107 (3%)
 Frame = +3

Query  204  RSSLMASSEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPY  383
            R S+    E  Q + E  DGVR +WN WP +++E+++ V+P+      ++ +P+L  + Y
Sbjct  10   RYSMATYQEFIQQN-EDRDGVRFSWNVWPSSRIEATRMVVPLGCLFTPLKERPDLPPIQY  68

Query  384  APLRCK--TCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
             P+ C   TC A+LNPF +VDY+A +W C FCFQRN FP QY+A+S+
Sbjct  69   DPVLCTRPTCRAILNPFCQVDYRAKVWACNFCFQRNPFPPQYAAISD  115



>ref|XP_002977937.1| hypothetical protein SELMODRAFT_107900 [Selaginella moellendorffii]
 gb|EFJ21275.1| hypothetical protein SELMODRAFT_107900 [Selaginella moellendorffii]
Length=763

 Score =   107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 63/93 (68%), Gaps = 1/93 (1%)
 Frame = +3

Query  240  TDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVL  419
             + E  +G+R  WNAWP +++++++ V+P     +++ P P+L  +PY P+RCK C AVL
Sbjct  4    NEIEATEGLRWVWNAWPTSRIDAARMVVPFGIMANVLMPLPDLPVLPYQPVRCK-CQAVL  62

Query  420  NPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            NP+  VDY A IW CPFC QRN FP  Y+ VSE
Sbjct  63   NPYCNVDYTARIWGCPFCLQRNYFPGNYAGVSE  95



>ref|XP_002986965.1| hypothetical protein SELMODRAFT_124893 [Selaginella moellendorffii]
 gb|EFJ12047.1| hypothetical protein SELMODRAFT_124893 [Selaginella moellendorffii]
Length=763

 Score =   107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 63/93 (68%), Gaps = 1/93 (1%)
 Frame = +3

Query  240  TDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVL  419
             + E  +G+R  WNAWP +++++++ V+P     +++ P P+L  +PY P+RCK C AVL
Sbjct  4    NEIEATEGLRWVWNAWPTSRIDAARMVVPFGIMANVLMPLPDLPVLPYQPVRCK-CQAVL  62

Query  420  NPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            NP+  VDY A IW CPFC QRN FP  Y+ VSE
Sbjct  63   NPYCNVDYTARIWGCPFCLQRNYFPGNYAGVSE  95



>ref|XP_010495646.1| PREDICTED: protein transport protein SEC23-like [Camelina sativa]
Length=489

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 61/92 (66%), Gaps = 0/92 (0%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  422
            + E I+G+R +WN+WP TK +    V+P++     +    EL T+PY PL C  C AVLN
Sbjct  5    ELEAIEGLRWSWNSWPTTKSDCESLVVPLSIMYTPLMHFSELPTIPYDPLICSRCGAVLN  64

Query  423  PFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            P+ARVDYQ+ IW CPFCF +N FP  YS ++E
Sbjct  65   PYARVDYQSRIWSCPFCFHKNHFPRSYSGITE  96



>ref|XP_011410444.1| PREDICTED: protein transport protein Sec23A-like [Amphimedon 
queenslandica]
Length=715

 Score =   107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 65/93 (70%), Gaps = 2/93 (2%)
 Frame = +3

Query  246  TEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCK--TCTAVL  419
             E  DGVR+TWN WP T++E++K V+P+AA I  ++ +PEL    Y P+ C    C AVL
Sbjct  11   NEDRDGVRLTWNVWPSTRIEAAKLVVPMAAMITPLKERPELPPAQYEPVLCGRSQCRAVL  70

Query  420  NPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            NP  +VDY++  WIC FC+QRN+FP  Y+A+SE
Sbjct  71   NPLCQVDYRSKSWICNFCYQRNTFPQHYAAISE  103



>ref|XP_009026518.1| hypothetical protein HELRODRAFT_185982 [Helobdella robusta]
 gb|ESN95356.1| hypothetical protein HELRODRAFT_185982 [Helobdella robusta]
Length=770

 Score =   107 bits (267),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 44/92 (48%), Positives = 64/92 (70%), Gaps = 2/92 (2%)
 Frame = +3

Query  249  EGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCK--TCTAVLN  422
            E  DG+R +WN WP +++E+++ V+P+      ++ +P+L  + Y P+ C    C AVLN
Sbjct  12   EDRDGIRFSWNVWPSSRLEATRLVVPLGCLYTPLKERPDLPPIQYDPVLCTRAICRAVLN  71

Query  423  PFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            PF +VDY+A +W C FCFQRNSFP QYSA+SE
Sbjct  72   PFCQVDYRAKVWTCNFCFQRNSFPPQYSAISE  103



>gb|EGI70064.1| Protein transport protein Sec23A [Acromyrmex echinatior]
Length=774

 Score =   106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 46/107 (43%), Positives = 69/107 (64%), Gaps = 2/107 (2%)
 Frame = +3

Query  204  RSSLMASSEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPY  383
            + S+M + E      E  DGVR TWN WP +++++++ V+P+      I+ +P L  + Y
Sbjct  4    QKSIMTTYEDFIQQNEDRDGVRFTWNVWPSSRIDATRLVVPLGTLYQPIKERPNLPAIQY  63

Query  384  APLRC--KTCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
             P+ C   TC A+LNP  +VDY+A +W+C FCFQRN FP QY+A+SE
Sbjct  64   DPVLCTRSTCRAILNPLCQVDYRAKLWVCNFCFQRNPFPPQYAAISE  110



>ref|XP_004923361.1| PREDICTED: protein transport protein Sec23A-like isoform X2 [Bombyx 
mori]
Length=766

 Score =   106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 69/103 (67%), Gaps = 2/103 (2%)
 Frame = +3

Query  216  MASSEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLR  395
            MA+ E      E  DG+R TWN WP +++E+++ V+P+A     ++ +P+L  + Y P+ 
Sbjct  1    MATYEEFIQQNEDRDGIRFTWNVWPSSRIEATRLVVPLACLYQPLKERPDLPPIQYEPVL  60

Query  396  C--KTCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            C   TC A+LNP  +VDY+A +W+C FCFQRN FP QY+A+SE
Sbjct  61   CTRNTCRAILNPMCQVDYRAKLWVCNFCFQRNPFPPQYAAISE  103



>ref|XP_004923360.1| PREDICTED: protein transport protein Sec23A-like isoform X1 [Bombyx 
mori]
Length=773

 Score =   106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 69/103 (67%), Gaps = 2/103 (2%)
 Frame = +3

Query  216  MASSEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLR  395
            MA+ E      E  DG+R TWN WP +++E+++ V+P+A     ++ +P+L  + Y P+ 
Sbjct  1    MATYEEFIQQNEDRDGIRFTWNVWPSSRIEATRLVVPLACLYQPLKERPDLPPIQYEPVL  60

Query  396  C--KTCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            C   TC A+LNP  +VDY+A +W+C FCFQRN FP QY+A+SE
Sbjct  61   CTRNTCRAILNPMCQVDYRAKLWVCNFCFQRNPFPPQYAAISE  103



>gb|ERL83427.1| hypothetical protein D910_00401 [Dendroctonus ponderosae]
Length=810

 Score =   106 bits (265),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 72/109 (66%), Gaps = 2/109 (2%)
 Frame = +3

Query  198  IARSSLMASSEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTV  377
            I ++  MA+ E      E  DG+R+TWN WP +++E+++ V+P+A     I+ +P+L  +
Sbjct  29   IDQTHGMATYEEYIHQNEERDGIRLTWNVWPSSRIEATRLVVPLACLYQPIKERPDLPPI  88

Query  378  PYAPLRC--KTCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
             Y P+ C    C A+LNP  +VDY+A +W+C FCFQRN FP QY+A+SE
Sbjct  89   QYDPVLCTRSNCRAILNPLCQVDYRAKLWVCNFCFQRNPFPPQYAAISE  137



>ref|XP_010531432.1| PREDICTED: protein transport protein SEC23 [Tarenaya hassleriana]
Length=766

 Score =   106 bits (264),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 48/95 (51%), Positives = 66/95 (69%), Gaps = 5/95 (5%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAA---SIHLIRPQPELVTVPYAPLRCKTCTA  413
            + E  DG+RM WN  P TK E + CVIP++A    + L+R    +  +PY+PLRC++C +
Sbjct  6    ELEAQDGLRMPWNVIPGTKEEETNCVIPVSAIYTPLKLLRSH--VSPLPYSPLRCRSCRS  63

Query  414  VLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            VLNPF+ VD+ A +WICPFCF RN FP  YS++SE
Sbjct  64   VLNPFSVVDFSACVWICPFCFNRNPFPLNYSSISE  98



>ref|XP_010274198.1| PREDICTED: protein transport protein Sec23A [Nelumbo nucifera]
Length=792

 Score =   106 bits (265),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 44/92 (48%), Positives = 63/92 (68%), Gaps = 0/92 (0%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  422
            + E I+G+R +WN+WP +K E+S  VIP++     +    EL  +PY PL C  C AVLN
Sbjct  5    ELEAIEGLRWSWNSWPASKSEASSLVIPLSVMCTPLMEFTELPLLPYDPLVCSRCGAVLN  64

Query  423  PFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            P+ARVDYQ+ +W+CPFC+Q+N FP  Y+ + E
Sbjct  65   PYARVDYQSRLWVCPFCYQKNPFPRSYAGIGE  96



>ref|XP_001751286.1| predicted protein [Physcomitrella patens]
 gb|EDQ83603.1| predicted protein [Physcomitrella patens]
Length=757

 Score =   106 bits (264),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 63/98 (64%), Gaps = 7/98 (7%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIR-------PQPELVTVPYAPLRCK  401
            + E   GVRM WN WP TK+E++KC +P AA +  +          P +  +PY PLRC+
Sbjct  7    EVEAATGVRMPWNVWPNTKIEAAKCTVPFAAVVTPLHHGEGASDAAPPVNLLPYPPLRCR  66

Query  402  TCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVS  515
            TC AVLNPF RVD+ A +WIC FC+QR  FP  Y+++S
Sbjct  67   TCQAVLNPFCRVDFDAKMWICLFCYQRCYFPQHYASIS  104



>emb|CAB81549.1| putative Sec23 protein [Drosophila melanogaster]
Length=769

 Score =   106 bits (264),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 68/103 (66%), Gaps = 2/103 (2%)
 Frame = +3

Query  216  MASSEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLR  395
            M + E      E  DGVR+TWN WP +++E+S+ V+P+A     ++ +P+L  + Y P+ 
Sbjct  1    MTTYEEFIQQNEDRDGVRLTWNVWPSSRIEASRLVVPLACLYQPLKERPDLPPIQYEPVL  60

Query  396  C--KTCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            C    C A+LNP  +VDY+A +W+C FCFQRN FP QY+A+SE
Sbjct  61   CTRSNCRAILNPLCQVDYRAKLWVCNFCFQRNQFPPQYAAISE  103



>ref|XP_006280033.1| hypothetical protein CARUB_v10025910mg [Capsella rubella]
 ref|XP_006280034.1| hypothetical protein CARUB_v10025910mg [Capsella rubella]
 gb|EOA12931.1| hypothetical protein CARUB_v10025910mg [Capsella rubella]
 gb|EOA12932.1| hypothetical protein CARUB_v10025910mg [Capsella rubella]
Length=791

 Score =   106 bits (264),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 61/92 (66%), Gaps = 0/92 (0%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  422
            + E I+G+R +WN+WP TK +    V+P++     +    EL T+PY PL C  C AVLN
Sbjct  5    ELEAIEGLRWSWNSWPTTKSDCESLVVPLSIMYTPLMQFSELPTIPYDPLICSRCGAVLN  64

Query  423  PFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            P+ARVDYQ+ IW CPFCF +N FP  YS ++E
Sbjct  65   PYARVDYQSRIWSCPFCFHKNHFPRSYSGITE  96



>gb|KHN32738.1| Protein transport protein SEC23 [Glycine soja]
Length=765

 Score =   105 bits (263),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 62/92 (67%), Gaps = 0/92 (0%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  422
            D E  DGVRM WN  P TK ++   V+PI+A    I+    +  + Y+PLRC+TC +VLN
Sbjct  6    DLESQDGVRMPWNVIPGTKQDAQNAVVPISAVYTPIKHFTSMPLLNYSPLRCRTCRSVLN  65

Query  423  PFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            PF  VD+ A IWICPFCFQRN FP  YS++S+
Sbjct  66   PFCIVDFAAKIWICPFCFQRNHFPPHYSSISD  97



>ref|XP_010441998.1| PREDICTED: protein transport protein SEC23-like [Camelina sativa]
Length=792

 Score =   105 bits (263),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 61/92 (66%), Gaps = 0/92 (0%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  422
            + E I+G+R +WN+WP TK +    V+P++     +    EL T+PY PL C  C AVLN
Sbjct  5    ELEAIEGLRWSWNSWPTTKSDCESLVVPLSIMYTPLMHFSELPTIPYDPLICSRCGAVLN  64

Query  423  PFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            P+ARVDYQ+ IW CPFCF +N FP  YS ++E
Sbjct  65   PYARVDYQSRIWSCPFCFHKNHFPRSYSGITE  96



>gb|AEE62753.1| unknown [Dendroctonus ponderosae]
 gb|ERL84168.1| hypothetical protein D910_01542 [Dendroctonus ponderosae]
Length=776

 Score =   105 bits (263),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 69/103 (67%), Gaps = 2/103 (2%)
 Frame = +3

Query  216  MASSEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLR  395
            MA+ E      E  DG+R+TWN WP +++E+++ V+P+A     I+ +P+L  + Y P+ 
Sbjct  1    MATYEEYIHQNEERDGIRLTWNVWPSSRIEATRLVVPLACLYQPIKERPDLPPIQYDPVL  60

Query  396  C--KTCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            C    C A+LNP  +VDY+A +W+C FCFQRN FP QY+A+SE
Sbjct  61   CTRSNCRAILNPLCQVDYRAKLWVCNFCFQRNPFPPQYAAISE  103



>gb|ENN77775.1| hypothetical protein YQE_05747, partial [Dendroctonus ponderosae]
Length=810

 Score =   105 bits (263),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 69/103 (67%), Gaps = 2/103 (2%)
 Frame = +3

Query  216  MASSEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLR  395
            MA+ E      E  DG+R+TWN WP +++E+++ V+P+A     I+ +P+L  + Y P+ 
Sbjct  35   MATYEEYIHQNEERDGIRLTWNVWPSSRIEATRLVVPLACLYQPIKERPDLPPIQYDPVL  94

Query  396  C--KTCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            C    C A+LNP  +VDY+A +W+C FCFQRN FP QY+A+SE
Sbjct  95   CTRSNCRAILNPLCQVDYRAKLWVCNFCFQRNPFPPQYAAISE  137



>ref|NP_730978.1| Sec23 ortholog, isoform A [Drosophila melanogaster]
 ref|NP_730979.1| Sec23 ortholog, isoform B [Drosophila melanogaster]
 ref|NP_001262294.1| Sec23 ortholog, isoform G [Drosophila melanogaster]
 ref|NP_001287184.1| Sec23 ortholog, isoform H [Drosophila melanogaster]
 gb|AAF51978.2| Sec23 ortholog, isoform A [Drosophila melanogaster]
 gb|AAF51979.2| Sec23 ortholog, isoform B [Drosophila melanogaster]
 gb|AGB95677.1| Sec23 ortholog, isoform G [Drosophila melanogaster]
 gb|AHN57183.1| Sec23 ortholog, isoform H [Drosophila melanogaster]
Length=773

 Score =   105 bits (262),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 68/103 (66%), Gaps = 2/103 (2%)
 Frame = +3

Query  216  MASSEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLR  395
            M + E      E  DGVR+TWN WP +++E+S+ V+P+A     ++ +P+L  + Y P+ 
Sbjct  1    MTTYEEFIQQNEDRDGVRLTWNVWPSSRIEASRLVVPLACLYQPLKERPDLPPIQYEPVL  60

Query  396  C--KTCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            C    C A+LNP  +VDY+A +W+C FCFQRN FP QY+A+SE
Sbjct  61   CTRSNCRAILNPLCQVDYRAKLWVCNFCFQRNPFPPQYAAISE  103



>ref|XP_002863641.1| hypothetical protein ARALYDRAFT_494637 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39900.1| hypothetical protein ARALYDRAFT_494637 [Arabidopsis lyrata subsp. 
lyrata]
Length=793

 Score =   105 bits (262),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 61/92 (66%), Gaps = 0/92 (0%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  422
            + E I+G+R +WN+WP TK +    V+P++     +    EL T+PY PL C  C AVLN
Sbjct  5    ELEAIEGLRWSWNSWPTTKSDCESLVVPLSIMYTPLMQFSELPTIPYDPLICSRCGAVLN  64

Query  423  PFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            P+ARVDYQ+ IW CPFCF +N FP  YS ++E
Sbjct  65   PYARVDYQSRIWSCPFCFHKNLFPRSYSGITE  96



>ref|XP_002431175.1| protein transport protein Sec23A, putative [Pediculus humanus 
corporis]
 gb|EEB18437.1| protein transport protein Sec23A, putative [Pediculus humanus 
corporis]
Length=768

 Score =   105 bits (262),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 67/103 (65%), Gaps = 2/103 (2%)
 Frame = +3

Query  216  MASSEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLR  395
            MA+ E      E  DG+R TWN WP ++VE++K V+P+      ++ +P+L  + Y P+ 
Sbjct  1    MATYEEFIQQNEDRDGIRFTWNVWPSSRVEATKLVVPLGCLYQPLKERPDLPPIQYDPVL  60

Query  396  C--KTCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            C   TC A+LNP  +VD+ A +W+C FCFQRN FP QY+A+SE
Sbjct  61   CTRNTCRAILNPLCQVDFHAKLWVCNFCFQRNPFPPQYAAISE  103



>ref|XP_002517022.1| protein transport protein sec23, putative [Ricinus communis]
 gb|EEF45185.1| protein transport protein sec23, putative [Ricinus communis]
Length=782

 Score =   105 bits (262),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 44/92 (48%), Positives = 62/92 (67%), Gaps = 0/92 (0%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  422
            + E I+G+R +WN+WP  K E+S   IP++     +    EL  +PY PL C  C A+LN
Sbjct  5    ELESIEGLRWSWNSWPTRKNEASSLTIPLSIMCTPLMQSSELPILPYEPLTCTRCFAILN  64

Query  423  PFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            P+ARVDYQ+ IW+CPFC+Q+N+FP  YS + E
Sbjct  65   PYARVDYQSRIWVCPFCYQKNTFPISYSGIGE  96



>gb|AAN71374.1| RE35250p [Drosophila melanogaster]
Length=773

 Score =   105 bits (262),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 68/103 (66%), Gaps = 2/103 (2%)
 Frame = +3

Query  216  MASSEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLR  395
            M + E      E  DGVR+TWN WP +++E+S+ V+P+A     ++ +P+L  + Y P+ 
Sbjct  1    MTTYEEFIQQNEDRDGVRLTWNVWPSSRIEASRLVVPLACLYQPLKERPDLPPIQYEPVL  60

Query  396  C--KTCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            C    C A+LNP  +VDY+A +W+C FCFQRN FP QY+A+SE
Sbjct  61   CTRSNCRAILNPLCQVDYRAKLWVCNFCFQRNPFPPQYAAISE  103



>ref|NP_001246932.1| Sec23 ortholog, isoform E [Drosophila melanogaster]
 gb|AFH06251.1| Sec23 ortholog, isoform E [Drosophila melanogaster]
Length=781

 Score =   105 bits (262),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 68/103 (66%), Gaps = 2/103 (2%)
 Frame = +3

Query  216  MASSEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLR  395
            M + E      E  DGVR+TWN WP +++E+S+ V+P+A     ++ +P+L  + Y P+ 
Sbjct  1    MTTYEEFIQQNEDRDGVRLTWNVWPSSRIEASRLVVPLACLYQPLKERPDLPPIQYEPVL  60

Query  396  C--KTCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            C    C A+LNP  +VDY+A +W+C FCFQRN FP QY+A+SE
Sbjct  61   CTRSNCRAILNPLCQVDYRAKLWVCNFCFQRNPFPPQYAAISE  103



>ref|NP_001246933.1| Sec23 ortholog, isoform F [Drosophila melanogaster]
 ref|NP_001246934.1| Sec23 ortholog, isoform D [Drosophila melanogaster]
 gb|AFH06252.1| Sec23 ortholog, isoform F [Drosophila melanogaster]
 gb|AFH06253.1| Sec23 ortholog, isoform D [Drosophila melanogaster]
Length=780

 Score =   105 bits (262),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 68/103 (66%), Gaps = 2/103 (2%)
 Frame = +3

Query  216  MASSEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLR  395
            M + E      E  DGVR+TWN WP +++E+S+ V+P+A     ++ +P+L  + Y P+ 
Sbjct  1    MTTYEEFIQQNEDRDGVRLTWNVWPSSRIEASRLVVPLACLYQPLKERPDLPPIQYEPVL  60

Query  396  C--KTCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            C    C A+LNP  +VDY+A +W+C FCFQRN FP QY+A+SE
Sbjct  61   CTRSNCRAILNPLCQVDYRAKLWVCNFCFQRNPFPPQYAAISE  103



>dbj|BAB08946.1| protein transport protein SEC23 [Arabidopsis thaliana]
Length=736

 Score =   105 bits (262),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 61/92 (66%), Gaps = 0/92 (0%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  422
            + E I+G+R +WN+WP TK +    V+P++     +    EL T+PY PL C  C AVLN
Sbjct  5    ELEAIEGLRWSWNSWPTTKSDCESLVVPLSIMYTPLMHFSELPTIPYDPLICSRCGAVLN  64

Query  423  PFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            P+ARVDYQ+ IW CPFCF +N FP  YS ++E
Sbjct  65   PYARVDYQSRIWSCPFCFHKNLFPRSYSGITE  96



>ref|XP_001978970.1| GG12978 [Drosophila erecta]
 gb|EDV47928.1| GG12978 [Drosophila erecta]
Length=773

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 68/103 (66%), Gaps = 2/103 (2%)
 Frame = +3

Query  216  MASSEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLR  395
            M + E      E  DGVR+TWN WP +++E+S+ V+P+A     ++ +P+L  + Y P+ 
Sbjct  1    MTTYEEFIQQNEDRDGVRLTWNVWPSSRIEASRLVVPLACLYQPLKERPDLPPIQYEPVL  60

Query  396  C--KTCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            C    C A+LNP  +VDY+A +W+C FCFQRN FP QY+A+SE
Sbjct  61   CTRSNCRAILNPLCQVDYRAKLWVCNFCFQRNPFPPQYAAISE  103



>ref|XP_002098055.1| GE10151 [Drosophila yakuba]
 gb|EDW97767.1| GE10151 [Drosophila yakuba]
Length=773

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 68/103 (66%), Gaps = 2/103 (2%)
 Frame = +3

Query  216  MASSEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLR  395
            M + E      E  DGVR+TWN WP +++E+S+ V+P+A     ++ +P+L  + Y P+ 
Sbjct  1    MTTYEEFIQQNEDRDGVRLTWNVWPSSRIEASRLVVPLACLYQPLKERPDLPPIQYEPVL  60

Query  396  C--KTCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            C    C A+LNP  +VDY+A +W+C FCFQRN FP QY+A+SE
Sbjct  61   CTRSNCRAILNPLCQVDYRAKLWVCNFCFQRNPFPPQYAAISE  103



>ref|NP_568626.1| sec23/sec24-like transport protein [Arabidopsis thaliana]
 gb|AAO29951.1| Unknown protein [Arabidopsis thaliana]
 gb|AAQ56793.1| At5g43670 [Arabidopsis thaliana]
 gb|AED94993.1| sec23/sec24-like transport protein [Arabidopsis thaliana]
Length=794

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 61/92 (66%), Gaps = 0/92 (0%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  422
            + E I+G+R +WN+WP TK +    V+P++     +    EL T+PY PL C  C AVLN
Sbjct  5    ELEAIEGLRWSWNSWPTTKSDCESLVVPLSIMYTPLMHFSELPTIPYDPLICSRCGAVLN  64

Query  423  PFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            P+ARVDYQ+ IW CPFCF +N FP  YS ++E
Sbjct  65   PYARVDYQSRIWSCPFCFHKNLFPRSYSGITE  96



>ref|XP_010087764.1| Protein transport protein Sec23A [Morus notabilis]
 gb|EXB29845.1| Protein transport protein Sec23A [Morus notabilis]
Length=719

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 43/92 (47%), Positives = 64/92 (70%), Gaps = 0/92 (0%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  422
            + E I+G+R +WN+WP +K++S+  +IP++     + PQPEL  +PY PL C  C AVLN
Sbjct  5    ELEAIEGLRWSWNSWPPSKLDSAALIIPLSVICTPLMPQPELPILPYEPLLCSQCGAVLN  64

Query  423  PFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            P+ARV Y + +W CPFC  +NSFP  Y+ ++E
Sbjct  65   PYARVQYPSRLWFCPFCHGKNSFPPSYAGIAE  96



>ref|XP_010481838.1| PREDICTED: protein transport protein SEC23-like [Camelina sativa]
Length=788

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 61/92 (66%), Gaps = 0/92 (0%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  422
            + E I+G+R +WN+WP TK +    V+P++     +    EL T+PY PL C  C AVLN
Sbjct  5    ELEAIEGLRWSWNSWPTTKSDCEFLVVPLSIMYTPLMQFSELPTIPYDPLICSRCGAVLN  64

Query  423  PFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            P+ARVDYQ+ IW CPFCF +N FP  YS ++E
Sbjct  65   PYARVDYQSRIWSCPFCFHKNHFPRSYSGITE  96



>ref|XP_008224182.1| PREDICTED: protein transport protein SEC23 [Prunus mume]
Length=782

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 44/92 (48%), Positives = 61/92 (66%), Gaps = 0/92 (0%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  422
            + E I+G+R  WN+WP +K ES+  VIP++     +  Q EL  +PY P+ C+ C AVLN
Sbjct  5    ELEAIEGLRWCWNSWPASKTESTDLVIPLSIMCTPLMQQAELPVLPYDPVTCRQCGAVLN  64

Query  423  PFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            P+ARV+Y + IW C FC  +NSFPH YS + E
Sbjct  65   PYARVEYTSRIWFCSFCLHKNSFPHSYSNIGE  96



>ref|XP_007225252.1| hypothetical protein PRUPE_ppa001670mg [Prunus persica]
 gb|EMJ26451.1| hypothetical protein PRUPE_ppa001670mg [Prunus persica]
Length=782

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 44/92 (48%), Positives = 61/92 (66%), Gaps = 0/92 (0%)
 Frame = +3

Query  243  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  422
            + E I+G+R  WN+WP +K ES+  VIP++     +  Q EL  +PY P+ C+ C AVLN
Sbjct  5    ELEAIEGLRWCWNSWPASKTESTDLVIPLSIMCTPLMQQAELPVLPYDPVTCRQCGAVLN  64

Query  423  PFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            P+ARV+Y + IW C FC  +NSFPH YS + E
Sbjct  65   PYARVEYTSRIWFCSFCLHKNSFPHSYSNIGE  96



>ref|XP_001998913.1| GI23366 [Drosophila mojavensis]
 gb|EDW14374.1| GI23366 [Drosophila mojavensis]
Length=783

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 68/103 (66%), Gaps = 2/103 (2%)
 Frame = +3

Query  216  MASSEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLR  395
            M + E      E  DGVR+TWN WP +++++S+ V+P+A     I+ +P+L  + Y P+ 
Sbjct  1    MTTYEEFIQQNEDRDGVRLTWNVWPSSRIDASRLVVPLACLYQPIKERPDLPPIQYEPVL  60

Query  396  C--KTCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            C    C A+LNP  +VDY+A +W+C FCFQRN FP QY+A+SE
Sbjct  61   CTRSNCRAILNPLCQVDYRAKLWVCNFCFQRNPFPPQYAAISE  103



>ref|XP_007660591.1| PREDICTED: protein transport protein Sec23A-like, partial [Ornithorhynchus 
anatinus]
Length=126

 Score = 98.2 bits (243),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/105 (43%), Positives = 67/105 (64%), Gaps = 2/105 (2%)
 Frame = +3

Query  210  SLMASSEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAP  389
             +MA+        E  DGVR +WN WP +++E+++ V+P+A  +  ++ +P+L  V Y P
Sbjct  3    KIMATYLEFIQQNEERDGVRFSWNVWPSSRLEATRLVVPLACLLTPLKERPDLPPVQYEP  62

Query  390  LRCK--TCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
            + C   TC AVLNP  +VDY+A +W C FCFQRN FP  Y+ +SE
Sbjct  63   VLCSRPTCKAVLNPLCQVDYRAKLWACNFCFQRNQFPPAYAGISE  107



>ref|XP_010278158.1| PREDICTED: protein transport protein SEC23-like [Nelumbo nucifera]
Length=799

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/102 (44%), Positives = 65/102 (64%), Gaps = 0/102 (0%)
 Frame = +3

Query  213  LMASSEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPL  392
            L+ S+ +     E I+G+R +WN+WP +K E+S  VIP++     +    EL  +PY PL
Sbjct  2    LIDSASMDFVQLEAIEGLRWSWNSWPASKSEASAMVIPLSVMYTPLMEFSELPLLPYDPL  61

Query  393  RCKTCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSE  518
             C  C AVLNP+ARVDYQ+ +W+CPFC++ N FP  Y  + E
Sbjct  62   MCSCCGAVLNPYARVDYQSRLWVCPFCYRNNPFPRSYVGIGE  103



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 566636427000