BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002A18

Length=514
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009783127.1|  PREDICTED: uncharacterized protein LOC104231...    204   9e-60   Nicotiana sylvestris
ref|XP_009783126.1|  PREDICTED: uncharacterized protein LOC104231...    204   1e-59   Nicotiana sylvestris
ref|XP_009593372.1|  PREDICTED: uncharacterized protein LOC104090039    193   3e-59   Nicotiana tomentosiformis
ref|XP_004230386.1|  PREDICTED: uncharacterized protein LOC101247758    184   5e-52   Solanum lycopersicum
gb|EYU33314.1|  hypothetical protein MIMGU_mgv1a019757mg                177   6e-51   Erythranthe guttata [common monkey flower]
ref|XP_006358484.1|  PREDICTED: uncharacterized protein LOC102593...    181   8e-51   Solanum tuberosum [potatoes]
ref|XP_010252239.1|  PREDICTED: uncharacterized protein LOC104593879    166   2e-45   Nelumbo nucifera [Indian lotus]
ref|XP_011092235.1|  PREDICTED: uncharacterized protein LOC105172486    164   2e-44   Sesamum indicum [beniseed]
ref|XP_010926998.1|  PREDICTED: uncharacterized protein LOC105049133    159   8e-43   Elaeis guineensis
ref|XP_002304112.2|  hypothetical protein POPTR_0003s03710g             157   3e-42   Populus trichocarpa [western balsam poplar]
ref|XP_011009425.1|  PREDICTED: uncharacterized protein LOC105114...    154   6e-41   Populus euphratica
ref|XP_011009424.1|  PREDICTED: uncharacterized protein LOC105114...    154   8e-41   Populus euphratica
ref|XP_011009421.1|  PREDICTED: uncharacterized protein LOC105114...    154   8e-41   Populus euphratica
emb|CDP17763.1|  unnamed protein product                                148   6e-39   Coffea canephora [robusta coffee]
ref|XP_009387466.1|  PREDICTED: uncharacterized protein LOC103974377    146   4e-38   
ref|XP_010065201.1|  PREDICTED: uncharacterized protein LOC104452431    145   7e-38   Eucalyptus grandis [rose gum]
ref|XP_010247913.1|  PREDICTED: uncharacterized protein LOC104590857    143   8e-38   Nelumbo nucifera [Indian lotus]
ref|XP_007023219.1|  Uncharacterized protein isoform 4                  143   2e-37   
ref|XP_007023218.1|  Uncharacterized protein isoform 3                  143   2e-37   
ref|XP_007023217.1|  Uncharacterized protein isoform 2                  143   3e-37   
ref|XP_007023216.1|  Uncharacterized protein isoform 1                  143   4e-37   
gb|KDP32457.1|  hypothetical protein JCGZ_13382                         142   1e-36   Jatropha curcas
ref|XP_007022707.1|  Uncharacterized protein TCM_033523                 140   3e-36   
ref|XP_010104208.1|  hypothetical protein L484_002408                   140   5e-36   Morus notabilis
gb|EEE67737.1|  hypothetical protein OsJ_25428                          140   6e-36   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001060514.2|  Os07g0657600                                       140   7e-36   
dbj|BAC15471.1|  hypothetical protein                                   140   7e-36   Oryza sativa Japonica Group [Japonica rice]
gb|EEC82605.1|  hypothetical protein OsI_27177                          140   7e-36   Oryza sativa Indica Group [Indian rice]
ref|XP_007146019.1|  hypothetical protein PHAVU_006G006000g             134   8e-35   Phaseolus vulgaris [French bean]
gb|KHN34477.1|  hypothetical protein glysoja_038896                     135   9e-35   Glycine soja [wild soybean]
ref|XP_004959865.1|  PREDICTED: uncharacterized protein LOC101766322    135   2e-34   Setaria italica
ref|XP_008227745.1|  PREDICTED: uncharacterized protein LOC103327233    134   3e-34   Prunus mume [ume]
ref|XP_002514394.1|  conserved hypothetical protein                     133   2e-33   
ref|XP_006853038.1|  hypothetical protein AMTR_s00038p00020700          132   4e-33   Amborella trichopoda
ref|XP_006470788.1|  PREDICTED: uncharacterized protein LOC102629...    130   2e-32   
ref|XP_006470787.1|  PREDICTED: uncharacterized protein LOC102629...    130   2e-32   
ref|XP_006470786.1|  PREDICTED: uncharacterized protein LOC102629...    130   2e-32   Citrus sinensis [apfelsine]
ref|XP_006431360.1|  hypothetical protein CICLE_v10001110mg             130   2e-32   Citrus clementina [clementine]
ref|XP_010533318.1|  PREDICTED: uncharacterized protein LOC104809120    126   4e-32   
gb|KJB56628.1|  hypothetical protein B456_009G128100                    129   5e-32   Gossypium raimondii
gb|KJB56629.1|  hypothetical protein B456_009G128100                    129   6e-32   Gossypium raimondii
gb|KHG17286.1|  DNA-3-methyladenine glycosylase 1                       127   2e-31   Gossypium arboreum [tree cotton]
emb|CDP17259.1|  unnamed protein product                                124   6e-31   Coffea canephora [robusta coffee]
ref|XP_010682181.1|  PREDICTED: uncharacterized protein LOC104897...    125   1e-30   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010490265.1|  PREDICTED: uncharacterized protein LOC104768014    123   1e-30   Camelina sativa [gold-of-pleasure]
ref|XP_006299074.1|  hypothetical protein CARUB_v10015214mg             124   1e-30   Capsella rubella
ref|XP_009626386.1|  PREDICTED: uncharacterized protein LOC104117102    119   2e-30   
emb|CDX82716.1|  BnaC07g01500D                                          124   2e-30   
ref|XP_010682180.1|  PREDICTED: uncharacterized protein LOC104897...    125   2e-30   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009124647.1|  PREDICTED: uncharacterized protein LOC103849671    119   3e-30   
ref|XP_006350375.1|  PREDICTED: uncharacterized protein LOC102593362    122   5e-30   Solanum tuberosum [potatoes]
ref|XP_010468777.1|  PREDICTED: uncharacterized protein LOC104748896    122   6e-30   Camelina sativa [gold-of-pleasure]
ref|XP_006405889.1|  hypothetical protein EUTSA_v10028065mg             117   1e-29   
ref|XP_006405890.1|  hypothetical protein EUTSA_v10028036mg             121   1e-29   Eutrema salsugineum [saltwater cress]
ref|XP_002519384.1|  conserved hypothetical protein                     122   2e-29   Ricinus communis
gb|KHN40743.1|  hypothetical protein glysoja_015110                     121   2e-29   Glycine soja [wild soybean]
ref|XP_010315535.1|  PREDICTED: uncharacterized protein LOC101254250    119   1e-28   
ref|XP_003534756.2|  PREDICTED: uncharacterized protein LOC100781827    119   1e-28   Glycine max [soybeans]
ref|XP_009804252.1|  PREDICTED: uncharacterized protein LOC104249510    117   3e-28   Nicotiana sylvestris
emb|CDY11690.1|  BnaC06g12980D                                          111   1e-26   Brassica napus [oilseed rape]
ref|XP_007147543.1|  hypothetical protein PHAVU_006G133500g             111   2e-25   Phaseolus vulgaris [French bean]
ref|XP_009102171.1|  PREDICTED: uncharacterized protein LOC103828315    104   1e-24   Brassica rapa
ref|XP_007213368.1|  hypothetical protein PRUPE_ppa026718mg             106   4e-24   
ref|XP_008385650.1|  PREDICTED: uncharacterized protein LOC103448172    104   1e-23   
ref|XP_006593886.1|  PREDICTED: uncharacterized protein LOC102669626    100   4e-22   
emb|CBI35315.3|  unnamed protein product                              98.6    1e-21   Vitis vinifera
gb|KDP47044.1|  hypothetical protein JCGZ_10771                       95.5    2e-21   Jatropha curcas
gb|KDO53850.1|  hypothetical protein CISIN_1g014334mg                 98.2    3e-21   Citrus sinensis [apfelsine]
gb|KDO53849.1|  hypothetical protein CISIN_1g014334mg                 98.2    6e-21   Citrus sinensis [apfelsine]
ref|XP_006423927.1|  hypothetical protein CICLE_v10030405mg           96.3    1e-20   
ref|XP_010256879.1|  PREDICTED: uncharacterized protein LOC104597156  89.0    3e-19   Nelumbo nucifera [Indian lotus]
ref|XP_005646705.1|  DNA glycosylase                                  87.8    3e-17   Coccomyxa subellipsoidea C-169
ref|WP_014437765.1|  hypothetical protein                             85.1    1e-16   Phycisphaera mikurensis
gb|KCW84783.1|  hypothetical protein EUGRSUZ_B01586                   82.8    5e-16   Eucalyptus grandis [rose gum]
emb|CBN77855.1|  conserved unknown protein                            75.9    4e-13   Ectocarpus siliculosus
gb|KJB11530.1|  hypothetical protein B456_001G263800                  61.6    1e-08   Gossypium raimondii
gb|KFG61636.1|  hypothetical protein TGRUB_270750                     55.1    7e-06   Toxoplasma gondii RUB
gb|ESS36255.1|  hypothetical protein TGVEG_270750                     55.1    7e-06   Toxoplasma gondii VEG
gb|EPR64782.1|  hypothetical protein TGGT1_270750                     55.1    7e-06   Toxoplasma gondii GT1
gb|KFG54358.1|  hypothetical protein TGFOU_270750                     55.1    7e-06   Toxoplasma gondii FOU
gb|KFG52135.1|  hypothetical protein TGP89_270750                     55.1    7e-06   Toxoplasma gondii p89
gb|KFH16636.1|  hypothetical protein TGMAS_270750                     55.1    8e-06   Toxoplasma gondii MAS
ref|XP_002365741.1|  hypothetical protein TGME49_070750               55.1    8e-06   Toxoplasma gondii ME49
ref|XP_005842500.1|  hypothetical protein GUITHDRAFT_160483           54.3    8e-06   Guillardia theta CCMP2712
gb|KFH05928.1|  hypothetical protein TGVAND_270750                    54.7    9e-06   Toxoplasma gondii VAND
gb|KJB33231.1|  hypothetical protein B456_006G003300                  53.5    1e-05   Gossypium raimondii
gb|KIY98719.1|  hypothetical protein MNEG_9241                        52.0    6e-05   Monoraphidium neglectum
ref|XP_008882441.1|  hypothetical protein HHA_270750                  51.6    1e-04   
gb|KFK33320.1|  hypothetical protein AALP_AA6G359700                  51.2    1e-04   Arabis alpina [alpine rockcress]
ref|XP_003883854.1|  conserved hypothetical protein                   50.8    2e-04   Neospora caninum Liverpool



>ref|XP_009783127.1| PREDICTED: uncharacterized protein LOC104231771 isoform X2 [Nicotiana 
sylvestris]
Length=480

 Score =   204 bits (519),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 108/163 (66%), Positives = 122/163 (75%), Gaps = 6/163 (4%)
 Frame = +2

Query  26   FIPTVLSPKMQHTGETTISGDARRGMVVVELPLGDASSTFNLEKAVCSHGLFMMAPNHWD  205
             IPT ++ KMQ+  E       RR  VVVELPLGD + T +LEKAVCSHGLFMMAPNHWD
Sbjct  14   LIPTAITSKMQYRQEID-----RRHSVVVELPLGDGA-TCDLEKAVCSHGLFMMAPNHWD  67

Query  206  PLTKTLERPLRLSDDHHCADHEISVTVRVSHPSDSPQSLRLHVFGTDCLSAQQHQSLMAQ  385
             L+KTLERPLRLS + +  DHE S  VR+S P DSP SL L VFGTD LS    +SL+ Q
Sbjct  68   YLSKTLERPLRLSGNINDDDHEKSHLVRISQPPDSPHSLHLRVFGTDSLSPLHQRSLLGQ  127

Query  386  VRRMLRLSEEEEKMVREFQEMYGEAKERGFGRVFRSPILFEDM  514
            VRRMLRLS EE + VR+FQE+ GEAKERGFGRVFRSP LFEDM
Sbjct  128  VRRMLRLSVEENERVRKFQEICGEAKERGFGRVFRSPTLFEDM  170



>ref|XP_009783126.1| PREDICTED: uncharacterized protein LOC104231771 isoform X1 [Nicotiana 
sylvestris]
Length=502

 Score =   204 bits (519),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 108/163 (66%), Positives = 122/163 (75%), Gaps = 6/163 (4%)
 Frame = +2

Query  26   FIPTVLSPKMQHTGETTISGDARRGMVVVELPLGDASSTFNLEKAVCSHGLFMMAPNHWD  205
             IPT ++ KMQ+  E       RR  VVVELPLGD + T +LEKAVCSHGLFMMAPNHWD
Sbjct  14   LIPTAITSKMQYRQEID-----RRHSVVVELPLGDGA-TCDLEKAVCSHGLFMMAPNHWD  67

Query  206  PLTKTLERPLRLSDDHHCADHEISVTVRVSHPSDSPQSLRLHVFGTDCLSAQQHQSLMAQ  385
             L+KTLERPLRLS + +  DHE S  VR+S P DSP SL L VFGTD LS    +SL+ Q
Sbjct  68   YLSKTLERPLRLSGNINDDDHEKSHLVRISQPPDSPHSLHLRVFGTDSLSPLHQRSLLGQ  127

Query  386  VRRMLRLSEEEEKMVREFQEMYGEAKERGFGRVFRSPILFEDM  514
            VRRMLRLS EE + VR+FQE+ GEAKERGFGRVFRSP LFEDM
Sbjct  128  VRRMLRLSVEENERVRKFQEICGEAKERGFGRVFRSPTLFEDM  170



>ref|XP_009593372.1| PREDICTED: uncharacterized protein LOC104090039 [Nicotiana tomentosiformis]
Length=158

 Score =   193 bits (491),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 101/141 (72%), Positives = 113/141 (80%), Gaps = 1/141 (1%)
 Frame = +2

Query  92   RRGMVVVELPLGDASSTFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSDDHHCADHE  271
            RR  VVVELPLGD + T +LEKAVCSHGLFMMAPNHWD L+KTLERPLRLS++ +  DHE
Sbjct  9    RRHSVVVELPLGDGA-TCDLEKAVCSHGLFMMAPNHWDSLSKTLERPLRLSENINDDDHE  67

Query  272  ISVTVRVSHPSDSPQSLRLHVFGTDCLSAQQHQSLMAQVRRMLRLSEEEEKMVREFQEMY  451
             S  VR+S PSDSP SL L VFGTD LS    +SL+ QVRRMLRLS EE + VR+FQE+ 
Sbjct  68   KSHLVRISQPSDSPHSLHLRVFGTDSLSPLHQRSLLGQVRRMLRLSVEENERVRKFQEIC  127

Query  452  GEAKERGFGRVFRSPILFEDM  514
             EAKERGFGRVFRSP LFEDM
Sbjct  128  EEAKERGFGRVFRSPTLFEDM  148



>ref|XP_004230386.1| PREDICTED: uncharacterized protein LOC101247758 [Solanum lycopersicum]
Length=483

 Score =   184 bits (466),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 98/157 (62%), Positives = 114/157 (73%), Gaps = 8/157 (5%)
 Frame = +2

Query  53   MQHTGETTISGDARRGMVVVELPLGDAS---STFNLEKAVCSHGLFMMAPNHWDPLTKTL  223
            MQH  E       R   VVVELPL D +   ++F+LEKAVCSHGLFMMAPN WD L+KTL
Sbjct  1    MQHRQEID-----RHRSVVVELPLEDGNGYCASFDLEKAVCSHGLFMMAPNRWDTLSKTL  55

Query  224  ERPLRLSDDHHCADHEISVTVRVSHPSDSPQSLRLHVFGTDCLSAQQHQSLMAQVRRMLR  403
            ERPLRLS++ +  DHE SV V+++ PSD P SL L V  TD LS    +SL+ QVRRM+R
Sbjct  56   ERPLRLSENINDDDHEQSVLVQITQPSDYPHSLLLRVLDTDSLSTIHQRSLLGQVRRMVR  115

Query  404  LSEEEEKMVREFQEMYGEAKERGFGRVFRSPILFEDM  514
            LS EE K V+ FQE+ GEAKERGFGRVFRSP LFEDM
Sbjct  116  LSVEENKRVKLFQEICGEAKERGFGRVFRSPTLFEDM  152



>gb|EYU33314.1| hypothetical protein MIMGU_mgv1a019757mg, partial [Erythranthe 
guttata]
Length=338

 Score =   177 bits (450),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 90/142 (63%), Positives = 107/142 (75%), Gaps = 3/142 (2%)
 Frame = +2

Query  89   ARRGMVVVELPLGDASSTFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSDDHHCADH  268
            A  G V+VELPLGDA+  FNLEKAVCSHGLFMMAPN WDP +KTL+RPLRL+        
Sbjct  9    AAHGGVLVELPLGDAAPDFNLEKAVCSHGLFMMAPNQWDPHSKTLKRPLRLN---LAGGE  65

Query  269  EISVTVRVSHPSDSPQSLRLHVFGTDCLSAQQHQSLMAQVRRMLRLSEEEEKMVREFQEM  448
              S+ V VSHP+ S  +L L VFGT  LS QQ QSL+ QVRRMLRLS++E + V +FQ++
Sbjct  66   TFSLMVHVSHPTHSSHALHLRVFGTRALSPQQQQSLLNQVRRMLRLSDQENRRVVDFQKV  125

Query  449  YGEAKERGFGRVFRSPILFEDM  514
            + +AKE GFGRVFRSP LFEDM
Sbjct  126  HEKAKETGFGRVFRSPTLFEDM  147



>ref|XP_006358484.1| PREDICTED: uncharacterized protein LOC102593287 isoform X1 [Solanum 
tuberosum]
 ref|XP_006358485.1| PREDICTED: uncharacterized protein LOC102593287 isoform X2 [Solanum 
tuberosum]
Length=485

 Score =   181 bits (458),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 99/159 (62%), Positives = 115/159 (72%), Gaps = 10/159 (6%)
 Frame = +2

Query  53   MQHTGETTISGDARRGMVVVELPLGDA-----SSTFNLEKAVCSHGLFMMAPNHWDPLTK  217
            MQH  E       R   VVVELPLGD       +TF+LEKAVCSHGLFMMAPN WD L+K
Sbjct  1    MQHRQEID-----RHRSVVVELPLGDGDGDGGCATFDLEKAVCSHGLFMMAPNRWDSLSK  55

Query  218  TLERPLRLSDDHHCADHEISVTVRVSHPSDSPQSLRLHVFGTDCLSAQQHQSLMAQVRRM  397
            TLERPL LS++ +  DHE SV V+++ PSDSP SL L VFGT  LS    +SL+ QVRRM
Sbjct  56   TLERPLHLSENINDDDHEQSVLVQINQPSDSPHSLLLRVFGTASLSTIHQRSLLGQVRRM  115

Query  398  LRLSEEEEKMVREFQEMYGEAKERGFGRVFRSPILFEDM  514
            +RLS EE K V++FQE+ GEAK+RG GRVFRSP LFEDM
Sbjct  116  VRLSVEENKRVKQFQEICGEAKDRGLGRVFRSPTLFEDM  154



>ref|XP_010252239.1| PREDICTED: uncharacterized protein LOC104593879 [Nelumbo nucifera]
Length=493

 Score =   166 bits (421),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 83/137 (61%), Positives = 103/137 (75%), Gaps = 7/137 (5%)
 Frame = +2

Query  104  VVVELPLGDASSTFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSDDHHCADHEISVT  283
             ++ LPLG++ STF+LE AVCSHGLFMMAPN WDP TKT +RPLRLSD+        S+ 
Sbjct  28   CLLTLPLGESVSTFSLENAVCSHGLFMMAPNQWDPSTKTFQRPLRLSDE------TTSIL  81

Query  284  VRVSHPSDSPQSLRLHVFGTDCLSAQQHQSLMAQVRRMLRLSEEEEKMVREFQEMYGEAK  463
            VR+SHP +SP SL + V GT  LS    + L+AQV RMLRLS+ +E+ +REF +++ EAK
Sbjct  82   VRISHPPNSP-SLHVRVLGTAFLSPDDQRVLLAQVTRMLRLSDSDERNIREFHKIHHEAK  140

Query  464  ERGFGRVFRSPILFEDM  514
            ERGFGRVFRSP LFEDM
Sbjct  141  ERGFGRVFRSPTLFEDM  157



>ref|XP_011092235.1| PREDICTED: uncharacterized protein LOC105172486 [Sesamum indicum]
Length=503

 Score =   164 bits (415),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 91/137 (66%), Positives = 106/137 (77%), Gaps = 4/137 (3%)
 Frame = +2

Query  104  VVVELPLGDASSTFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSDDHHCADHEISVT  283
            V+VELPLGDA+S F+LEKAVCSHGLFMMAPN WDP +KTL RPLRL+ D      E S+ 
Sbjct  12   VLVELPLGDAASNFSLEKAVCSHGLFMMAPNRWDPHSKTLRRPLRLNPD----GDETSLM  67

Query  284  VRVSHPSDSPQSLRLHVFGTDCLSAQQHQSLMAQVRRMLRLSEEEEKMVREFQEMYGEAK  463
            V +SHP+ S  +L L VFGT  LS QQ QSL++QVRRMLRLSE E + + EF E++ EAK
Sbjct  68   VHISHPTHSADALHLRVFGTHALSPQQQQSLLSQVRRMLRLSEAENRRMNEFHELHKEAK  127

Query  464  ERGFGRVFRSPILFEDM  514
             RGFGRVFRSP LFEDM
Sbjct  128  GRGFGRVFRSPTLFEDM  144



>ref|XP_010926998.1| PREDICTED: uncharacterized protein LOC105049133 [Elaeis guineensis]
Length=459

 Score =   159 bits (401),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 80/144 (56%), Positives = 101/144 (70%), Gaps = 8/144 (6%)
 Frame = +2

Query  83   GDARRGMVVVELPLGDASSTFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSDDHHCA  262
             D   G+V ++LPL D    FNLE AVCSHGLFMMAPN WDP +K+L RPLRL       
Sbjct  11   ADRSTGVVHLQLPLNDPG--FNLETAVCSHGLFMMAPNRWDPASKSLHRPLRLPTSSS--  66

Query  263  DHEISVTVRVSHPSDSPQSLRLHVFGTDCLSAQQHQSLMAQVRRMLRLSEEEEKMVREFQ  442
                S+ VR+SHPS S   L + VFG   LS+Q   +++AQVRRMLR+S+E ++++REF 
Sbjct  67   ----SLPVRISHPSPSHPLLLVSVFGASSLSSQDQHAILAQVRRMLRISDENDRVIREFH  122

Query  443  EMYGEAKERGFGRVFRSPILFEDM  514
            +++  AKERGFGRVFRSP LFEDM
Sbjct  123  KLHAGAKERGFGRVFRSPTLFEDM  146



>ref|XP_002304112.2| hypothetical protein POPTR_0003s03710g [Populus trichocarpa]
 gb|EEE79091.2| hypothetical protein POPTR_0003s03710g [Populus trichocarpa]
Length=489

 Score =   157 bits (398),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 83/148 (56%), Positives = 102/148 (69%), Gaps = 11/148 (7%)
 Frame = +2

Query  104  VVVELPLGDASSTFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLS---DDHHCADHEI  274
            VV E+PLGDA+ TFNLEKAVCSHGLFMM+PNHWDPL+ T  RPLRLS    D   +    
Sbjct  17   VVFEIPLGDAAETFNLEKAVCSHGLFMMSPNHWDPLSLTFSRPLRLSLSDSDPQVSTPTT  76

Query  275  SVTVRVSHPSDSPQSLRLHVFGTDCLSAQQHQSLMAQVRRMLRLSEEEEKMVREFQEM--  448
            S+ V +SHP   P+SL + V+GT CLS +  +SL+AQV RMLRLSE +E+  REF+++  
Sbjct  77   SLFVSISHPPHLPRSLSVRVYGTRCLSPKHQESLVAQVVRMLRLSETDERNAREFRKIAE  136

Query  449  -----YGEAKERGF-GRVFRSPILFEDM  514
                    +   GF GRVFRSP LFEDM
Sbjct  137  AAAAEENNSWLTGFGGRVFRSPTLFEDM  164



>ref|XP_011009425.1| PREDICTED: uncharacterized protein LOC105114550 isoform X3 [Populus 
euphratica]
 ref|XP_011009426.1| PREDICTED: uncharacterized protein LOC105114550 isoform X3 [Populus 
euphratica]
Length=470

 Score =   154 bits (389),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 84/145 (58%), Positives = 103/145 (71%), Gaps = 9/145 (6%)
 Frame = +2

Query  104  VVVELPLGDASSTFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLS---DDHHCADHEI  274
            VV+E+PLGDA+ TFNLEKAVCSHGLFMM+PN WDPL+ T  RPLRLS    D   +    
Sbjct  15   VVLEIPLGDAADTFNLEKAVCSHGLFMMSPNLWDPLSLTFSRPLRLSLSDSDPQVSTPTT  74

Query  275  SVTVRVSHPSDSPQSLRLHVFGTDCLSAQQHQSLMAQVRRMLRLSEEEEKMVREFQEMYG  454
            S+ V +SHP   P+SL + V+GT  LS +  +SL+AQV RMLRLSE +E+  REF++M  
Sbjct  75   SLFVSISHPPHLPRSLSVRVYGTRFLSPKHQESLVAQVVRMLRLSETDERNAREFRKM-A  133

Query  455  EAKER----GF-GRVFRSPILFEDM  514
            EA+      GF GRVFRSP LFEDM
Sbjct  134  EAENNSWLTGFGGRVFRSPTLFEDM  158



>ref|XP_011009424.1| PREDICTED: uncharacterized protein LOC105114550 isoform X2 [Populus 
euphratica]
Length=483

 Score =   154 bits (388),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 84/145 (58%), Positives = 103/145 (71%), Gaps = 9/145 (6%)
 Frame = +2

Query  104  VVVELPLGDASSTFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLS---DDHHCADHEI  274
            VV+E+PLGDA+ TFNLEKAVCSHGLFMM+PN WDPL+ T  RPLRLS    D   +    
Sbjct  15   VVLEIPLGDAADTFNLEKAVCSHGLFMMSPNLWDPLSLTFSRPLRLSLSDSDPQVSTPTT  74

Query  275  SVTVRVSHPSDSPQSLRLHVFGTDCLSAQQHQSLMAQVRRMLRLSEEEEKMVREFQEMYG  454
            S+ V +SHP   P+SL + V+GT  LS +  +SL+AQV RMLRLSE +E+  REF++M  
Sbjct  75   SLFVSISHPPHLPRSLSVRVYGTRFLSPKHQESLVAQVVRMLRLSETDERNAREFRKM-A  133

Query  455  EAKER----GF-GRVFRSPILFEDM  514
            EA+      GF GRVFRSP LFEDM
Sbjct  134  EAENNSWLTGFGGRVFRSPTLFEDM  158



>ref|XP_011009421.1| PREDICTED: uncharacterized protein LOC105114550 isoform X1 [Populus 
euphratica]
 ref|XP_011009422.1| PREDICTED: uncharacterized protein LOC105114550 isoform X1 [Populus 
euphratica]
Length=487

 Score =   154 bits (388),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 84/145 (58%), Positives = 103/145 (71%), Gaps = 9/145 (6%)
 Frame = +2

Query  104  VVVELPLGDASSTFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLS---DDHHCADHEI  274
            VV+E+PLGDA+ TFNLEKAVCSHGLFMM+PN WDPL+ T  RPLRLS    D   +    
Sbjct  15   VVLEIPLGDAADTFNLEKAVCSHGLFMMSPNLWDPLSLTFSRPLRLSLSDSDPQVSTPTT  74

Query  275  SVTVRVSHPSDSPQSLRLHVFGTDCLSAQQHQSLMAQVRRMLRLSEEEEKMVREFQEMYG  454
            S+ V +SHP   P+SL + V+GT  LS +  +SL+AQV RMLRLSE +E+  REF++M  
Sbjct  75   SLFVSISHPPHLPRSLSVRVYGTRFLSPKHQESLVAQVVRMLRLSETDERNAREFRKM-A  133

Query  455  EAKER----GF-GRVFRSPILFEDM  514
            EA+      GF GRVFRSP LFEDM
Sbjct  134  EAENNSWLTGFGGRVFRSPTLFEDM  158



>emb|CDP17763.1| unnamed protein product [Coffea canephora]
Length=430

 Score =   148 bits (373),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 72/111 (65%), Positives = 87/111 (78%), Gaps = 0/111 (0%)
 Frame = +2

Query  182  MMAPNHWDPLTKTLERPLRLSDDHHCADHEISVTVRVSHPSDSPQSLRLHVFGTDCLSAQ  361
            MMAPN WDP +KTL+RPLRLS   +  DH+ SVTV++S      QSL+L VFGTD LS+Q
Sbjct  1    MMAPNFWDPKSKTLQRPLRLSLSLNDPDHQKSVTVKISQSCPPSQSLKLQVFGTDSLSSQ  60

Query  362  QHQSLMAQVRRMLRLSEEEEKMVREFQEMYGEAKERGFGRVFRSPILFEDM  514
            Q  SL+ QVRRMLRLSEE+ + VR+FQE++ EAKER FGR+FRSP LFEDM
Sbjct  61   QQHSLLNQVRRMLRLSEEDNRTVRDFQEIHTEAKEREFGRIFRSPTLFEDM  111



>ref|XP_009387466.1| PREDICTED: uncharacterized protein LOC103974377 [Musa acuminata 
subsp. malaccensis]
Length=457

 Score =   146 bits (368),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 75/144 (52%), Positives = 99/144 (69%), Gaps = 8/144 (6%)
 Frame = +2

Query  83   GDARRGMVVVELPLGDASSTFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSDDHHCA  262
            GD   G+VV++LP+ D   TF+L  AVC+HGLFMMAPN WDP T +L RPL L      +
Sbjct  2    GDGEEGVVVLQLPVKDP--TFDLANAVCNHGLFMMAPNGWDPDTASLRRPLHL------S  53

Query  263  DHEISVTVRVSHPSDSPQSLRLHVFGTDCLSAQQHQSLMAQVRRMLRLSEEEEKMVREFQ  442
                S+ VRVS PS  P  L + V+ T  LS+Q   ++++QVRRMLR+S E ++M++EF 
Sbjct  54   SSSASLCVRVSQPSPHPDHLLVSVYCTTFLSSQDQDAILSQVRRMLRMSNENDRMIKEFH  113

Query  443  EMYGEAKERGFGRVFRSPILFEDM  514
             ++  AKERGFGR+FRSP LFEDM
Sbjct  114  TIHAAAKERGFGRIFRSPTLFEDM  137



>ref|XP_010065201.1| PREDICTED: uncharacterized protein LOC104452431 [Eucalyptus grandis]
Length=499

 Score =   145 bits (367),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 85/144 (59%), Positives = 100/144 (69%), Gaps = 10/144 (7%)
 Frame = +2

Query  110  VELPLGDASS-TFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRL-SDDHHCADHEISVT  283
            VE+ LG+A++ TF LEKAVCSHGLFMM+PN WDPL+ +L RPLRL SDD       + V 
Sbjct  9    VEVGLGEAAAATFRLEKAVCSHGLFMMSPNRWDPLSLSLSRPLRLPSDDGDDDAAPVPVA  68

Query  284  VRVSHPSDSPQSLRLHVFGTDCLSAQQHQSLMAQVRRMLRLSEEEEKMVREFQEMYGEAK  463
            VR+SHP  S  SLRL V G   LS  QH+SL+ QVRRMLRLSEE+E+  REF+ + G   
Sbjct  69   VRISHPPRSA-SLRLLVRGVSALSPSQHRSLLRQVRRMLRLSEEDERNAREFERVCGAVG  127

Query  464  E------RGF-GRVFRSPILFEDM  514
            E      R F GRVFRSP LFEDM
Sbjct  128  EDVPDCVREFGGRVFRSPTLFEDM  151



>ref|XP_010247913.1| PREDICTED: uncharacterized protein LOC104590857 [Nelumbo nucifera]
Length=350

 Score =   143 bits (361),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 93/127 (73%), Gaps = 7/127 (6%)
 Frame = +2

Query  134  SSTFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSDDHHCADHEISVTVRVSHPSDSP  313
            +S+FNLEKAVC+HG FMMAPN W P TKTL+RPLRL      AD   SVTVR+SHP    
Sbjct  2    ASSFNLEKAVCNHGFFMMAPNLWIPSTKTLQRPLRL------ADSITSVTVRISHPPKH-  54

Query  314  QSLRLHVFGTDCLSAQQHQSLMAQVRRMLRLSEEEEKMVREFQEMYGEAKERGFGRVFRS  493
             S+ + V  T  LS+   Q+L+ QV RMLR+SEE+E+ + EF +++ +AK+RGFGR+FRS
Sbjct  55   HSIHVLVLDTKALSSPDQQALLRQVARMLRISEEDERKISEFHKIHSKAKKRGFGRLFRS  114

Query  494  PILFEDM  514
            P LFED+
Sbjct  115  PSLFEDI  121



>ref|XP_007023219.1| Uncharacterized protein isoform 4 [Theobroma cacao]
 gb|EOY25841.1| Uncharacterized protein isoform 4 [Theobroma cacao]
Length=406

 Score =   143 bits (361),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 84/152 (55%), Positives = 106/152 (70%), Gaps = 20/152 (13%)
 Frame = +2

Query  104  VVVELPLGDASST-----FNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSDDHHCADH  268
            V++ELP+G+A++      FNLEKAVCSHGLFMMAPN WDP++++L RPLRL D H     
Sbjct  32   VLIELPVGEAAAAEGAGPFNLEKAVCSHGLFMMAPNQWDPISRSLSRPLRLLDHH---SP  88

Query  269  EISVTVRVSHPSDSPQSLRLHVFGTDCLSAQQHQSLMAQVRRMLRLSEEEEKMVREFQE-  445
             ++V VR+S P+ S  +L L V+GT CLS Q   SL+ QV RMLRLSEEEE  VREF++ 
Sbjct  89   PLTVQVRISQPTAS--TLHLRVYGTRCLSPQHRHSLLNQVSRMLRLSEEEESKVREFRKI  146

Query  446  ---MYGEAKE-----RGF-GRVFRSPILFEDM  514
               ++GE +      R F GRVFRSP LFEDM
Sbjct  147  VEALHGEEEAAAECLRSFSGRVFRSPTLFEDM  178



>ref|XP_007023218.1| Uncharacterized protein isoform 3 [Theobroma cacao]
 gb|EOY25840.1| Uncharacterized protein isoform 3 [Theobroma cacao]
Length=421

 Score =   143 bits (361),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 84/152 (55%), Positives = 106/152 (70%), Gaps = 20/152 (13%)
 Frame = +2

Query  104  VVVELPLGDASST-----FNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSDDHHCADH  268
            V++ELP+G+A++      FNLEKAVCSHGLFMMAPN WDP++++L RPLRL D H     
Sbjct  47   VLIELPVGEAAAAEGAGPFNLEKAVCSHGLFMMAPNQWDPISRSLSRPLRLLDHH---SP  103

Query  269  EISVTVRVSHPSDSPQSLRLHVFGTDCLSAQQHQSLMAQVRRMLRLSEEEEKMVREFQE-  445
             ++V VR+S P+ S  +L L V+GT CLS Q   SL+ QV RMLRLSEEEE  VREF++ 
Sbjct  104  PLTVQVRISQPTAS--TLHLRVYGTRCLSPQHRHSLLNQVSRMLRLSEEEESKVREFRKI  161

Query  446  ---MYGEAKE-----RGF-GRVFRSPILFEDM  514
               ++GE +      R F GRVFRSP LFEDM
Sbjct  162  VEALHGEEEAAAECLRSFSGRVFRSPTLFEDM  193



>ref|XP_007023217.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOY25839.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=426

 Score =   143 bits (361),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 84/152 (55%), Positives = 106/152 (70%), Gaps = 20/152 (13%)
 Frame = +2

Query  104  VVVELPLGDASST-----FNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSDDHHCADH  268
            V++ELP+G+A++      FNLEKAVCSHGLFMMAPN WDP++++L RPLRL D H     
Sbjct  32   VLIELPVGEAAAAEGAGPFNLEKAVCSHGLFMMAPNQWDPISRSLSRPLRLLDHH---SP  88

Query  269  EISVTVRVSHPSDSPQSLRLHVFGTDCLSAQQHQSLMAQVRRMLRLSEEEEKMVREFQE-  445
             ++V VR+S P+ S  +L L V+GT CLS Q   SL+ QV RMLRLSEEEE  VREF++ 
Sbjct  89   PLTVQVRISQPTAS--TLHLRVYGTRCLSPQHRHSLLNQVSRMLRLSEEEESKVREFRKI  146

Query  446  ---MYGEAKE-----RGF-GRVFRSPILFEDM  514
               ++GE +      R F GRVFRSP LFEDM
Sbjct  147  VEALHGEEEAAAECLRSFSGRVFRSPTLFEDM  178



>ref|XP_007023216.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY25838.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=467

 Score =   143 bits (361),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 84/152 (55%), Positives = 106/152 (70%), Gaps = 20/152 (13%)
 Frame = +2

Query  104  VVVELPLGDASST-----FNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSDDHHCADH  268
            V++ELP+G+A++      FNLEKAVCSHGLFMMAPN WDP++++L RPLRL D H     
Sbjct  47   VLIELPVGEAAAAEGAGPFNLEKAVCSHGLFMMAPNQWDPISRSLSRPLRLLDHH---SP  103

Query  269  EISVTVRVSHPSDSPQSLRLHVFGTDCLSAQQHQSLMAQVRRMLRLSEEEEKMVREFQE-  445
             ++V VR+S P+ S  +L L V+GT CLS Q   SL+ QV RMLRLSEEEE  VREF++ 
Sbjct  104  PLTVQVRISQPTAS--TLHLRVYGTRCLSPQHRHSLLNQVSRMLRLSEEEESKVREFRKI  161

Query  446  ---MYGEAKE-----RGF-GRVFRSPILFEDM  514
               ++GE +      R F GRVFRSP LFEDM
Sbjct  162  VEALHGEEEAAAECLRSFSGRVFRSPTLFEDM  193



>gb|KDP32457.1| hypothetical protein JCGZ_13382 [Jatropha curcas]
Length=481

 Score =   142 bits (358),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 79/147 (54%), Positives = 102/147 (69%), Gaps = 13/147 (9%)
 Frame = +2

Query  104  VVVELPLGDASSTFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSDDHHCADHE---I  274
            V++E+PLG A+ TF+ +K VCSHGLF M+PN WDPL+ T  RPLRL   HH +D E    
Sbjct  24   VILEIPLGIAAETFDFKKTVCSHGLFAMSPNQWDPLSYTFSRPLRLR--HH-SDSESDFT  80

Query  275  SVTVRVSHPSDSPQSLRLHVFGTDCLSAQQHQSLMAQVRRMLRLSEEEEKMVREFQEMY-  451
            SV V +SHPS+ P SL + V GT  L+ Q  +SL+ QV RMLRLS+ +E  +REF+++  
Sbjct  81   SVMVSISHPSNLPHSLLVRVHGTRSLTPQNRESLVTQVLRMLRLSDADEMNIREFRKIIA  140

Query  452  -GEAKE----RGF-GRVFRSPILFEDM  514
             GE +E    +GF GRVFRSP LFEDM
Sbjct  141  MGEGEEFDWMKGFSGRVFRSPTLFEDM  167



>ref|XP_007022707.1| Uncharacterized protein TCM_033523 [Theobroma cacao]
 gb|EOY14232.1| Uncharacterized protein TCM_033523 [Theobroma cacao]
Length=374

 Score =   140 bits (352),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 70/138 (51%), Positives = 97/138 (70%), Gaps = 7/138 (5%)
 Frame = +2

Query  101  MVVVELPLGDASSTFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSDDHHCADHEISV  280
            ++ +++ LG+ SS+FN+EKAVC+HGLFMM+PN W P TK+L RPLRL      AD   SV
Sbjct  4    LIELQVALGECSSSFNMEKAVCNHGLFMMSPNVWIPSTKSLRRPLRL------ADSSGSV  57

Query  281  TVRVSHPSDSPQSLRLHVFG-TDCLSAQQHQSLMAQVRRMLRLSEEEEKMVREFQEMYGE  457
             V +SHP+ +   L + V G  + +S+     +M QV RMLR+S ++E+ VREFQ ++G 
Sbjct  58   YVTISHPAPNHPFLVIQVNGLQNSISSADKAVIMEQVARMLRISSKDERDVREFQTLHGS  117

Query  458  AKERGFGRVFRSPILFED  511
            AK+RGFGR+FRSP  FED
Sbjct  118  AKDRGFGRIFRSPSFFED  135



>ref|XP_010104208.1| hypothetical protein L484_002408 [Morus notabilis]
 gb|EXC47697.1| hypothetical protein L484_002408 [Morus notabilis]
Length=472

 Score =   140 bits (353),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 83/142 (58%), Positives = 100/142 (70%), Gaps = 7/142 (5%)
 Frame = +2

Query  104  VVVELPLGDASSTFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSDDHHCAD----HE  271
            V +ELPLGDA++TF LE AVCSHGLFMMAPN WDPL+KTL RPLRL+  HH  +     +
Sbjct  3    VSLELPLGDAAATFRLETAVCSHGLFMMAPNQWDPLSKTLLRPLRLTLHHHHWNPQQQQD  62

Query  272  ISVTVRVSHPSDSPQSLRLHVF-GTDCLSAQQHQSLMAQVRRMLRLSEEEEKMVREFQEM  448
             SV  R+S P D    LR+ V  GT  L++   Q+L+AQV RMLRLS+ EE++ REF E+
Sbjct  63   DSVMARISQPHDRLHCLRVLVHAGTRSLTSDNKQALLAQVSRMLRLSQTEERICREFSEV  122

Query  449  YGEAKERGFGRVFRSPILFEDM  514
            YG     G GRVFRSP LFEDM
Sbjct  123  YGCGS--GLGRVFRSPTLFEDM  142



>gb|EEE67737.1| hypothetical protein OsJ_25428 [Oryza sativa Japonica Group]
Length=442

 Score =   140 bits (352),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 77/144 (53%), Positives = 95/144 (66%), Gaps = 14/144 (10%)
 Frame = +2

Query  110  VELPLGDA-----SSTFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSDDHHCADHEI  274
            +ELPLG A     ++ F+LE AVCSHGLFMMAPN WDP ++ L RPLRL+     +D   
Sbjct  21   LELPLGGAPPYPGAAPFDLEAAVCSHGLFMMAPNRWDPASRALVRPLRLA-----SDRAA  75

Query  275  SVTVRVS-HPSDSPQSLRLHVFGT---DCLSAQQHQSLMAQVRRMLRLSEEEEKMVREFQ  442
            SV VRVS HP+    +L + V G    D LS     S++ QVRRMLRL EE+ + V EFQ
Sbjct  76   SVAVRVSRHPARPSDALLVSVLGAPDDDALSPLDQTSILEQVRRMLRLDEEDGRAVAEFQ  135

Query  443  EMYGEAKERGFGRVFRSPILFEDM  514
             M+  A+E GFGR+FRSP LFEDM
Sbjct  136  AMHAVAREVGFGRIFRSPTLFEDM  159



>ref|NP_001060514.2| Os07g0657600 [Oryza sativa Japonica Group]
 dbj|BAF22428.2| Os07g0657600, partial [Oryza sativa Japonica Group]
Length=465

 Score =   140 bits (352),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 77/144 (53%), Positives = 95/144 (66%), Gaps = 14/144 (10%)
 Frame = +2

Query  110  VELPLGDA-----SSTFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSDDHHCADHEI  274
            +ELPLG A     ++ F+LE AVCSHGLFMMAPN WDP ++ L RPLRL+     +D   
Sbjct  6    LELPLGGAPPYPGAAPFDLEAAVCSHGLFMMAPNRWDPASRALVRPLRLA-----SDRAA  60

Query  275  SVTVRVS-HPSDSPQSLRLHVFGT---DCLSAQQHQSLMAQVRRMLRLSEEEEKMVREFQ  442
            SV VRVS HP+    +L + V G    D LS     S++ QVRRMLRL EE+ + V EFQ
Sbjct  61   SVAVRVSRHPARPSDALLVSVLGAPDDDALSPLDQTSILEQVRRMLRLDEEDGRAVAEFQ  120

Query  443  EMYGEAKERGFGRVFRSPILFEDM  514
             M+  A+E GFGR+FRSP LFEDM
Sbjct  121  AMHAVAREVGFGRIFRSPTLFEDM  144



>dbj|BAC15471.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAD31099.1| hypothetical protein [Oryza sativa Japonica Group]
Length=501

 Score =   140 bits (353),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 77/144 (53%), Positives = 95/144 (66%), Gaps = 14/144 (10%)
 Frame = +2

Query  110  VELPLGDA-----SSTFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSDDHHCADHEI  274
            +ELPLG A     ++ F+LE AVCSHGLFMMAPN WDP ++ L RPLRL+     +D   
Sbjct  21   LELPLGGAPPYPGAAPFDLEAAVCSHGLFMMAPNRWDPASRALVRPLRLA-----SDRAA  75

Query  275  SVTVRVS-HPSDSPQSLRLHVFGT---DCLSAQQHQSLMAQVRRMLRLSEEEEKMVREFQ  442
            SV VRVS HP+    +L + V G    D LS     S++ QVRRMLRL EE+ + V EFQ
Sbjct  76   SVAVRVSRHPARPSDALLVSVLGAPDDDALSPLDQTSILEQVRRMLRLDEEDGRAVAEFQ  135

Query  443  EMYGEAKERGFGRVFRSPILFEDM  514
             M+  A+E GFGR+FRSP LFEDM
Sbjct  136  AMHAVAREVGFGRIFRSPTLFEDM  159



>gb|EEC82605.1| hypothetical protein OsI_27177 [Oryza sativa Indica Group]
Length=463

 Score =   140 bits (352),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 76/143 (53%), Positives = 94/143 (66%), Gaps = 13/143 (9%)
 Frame = +2

Query  110  VELPLGDA-----SSTFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSDDHHCADHEI  274
            +ELPLG A     ++ F+LE AVCSHGLFMMAPN WDP ++ L RPLRL+     +D   
Sbjct  21   LELPLGGAPPYPGAAPFDLEAAVCSHGLFMMAPNRWDPASRALVRPLRLA-----SDRAA  75

Query  275  SVTVRVS-HPSDSPQSLRLHVFGT--DCLSAQQHQSLMAQVRRMLRLSEEEEKMVREFQE  445
            SV VRVS HP+    +L + V G   D LS     S++ QVRRMLRL EE+ +   EFQ 
Sbjct  76   SVAVRVSRHPARPSDALLVSVLGAPGDALSPPDQTSILEQVRRMLRLDEEDGRAAAEFQA  135

Query  446  MYGEAKERGFGRVFRSPILFEDM  514
            M+  A+E GFGR+FRSP LFEDM
Sbjct  136  MHAVAREAGFGRIFRSPTLFEDM  158



>ref|XP_007146019.1| hypothetical protein PHAVU_006G006000g, partial [Phaseolus vulgaris]
 gb|ESW18013.1| hypothetical protein PHAVU_006G006000g, partial [Phaseolus vulgaris]
Length=276

 Score =   134 bits (337),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 93/133 (70%), Gaps = 10/133 (8%)
 Frame = +2

Query  116  LPLGDASSTFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSDDHHCADHEISVTVRVS  295
            L +    STFNLEKAVC+HG FMMAPN W+P TK+L+RPLRL D   C     SV V +S
Sbjct  10   LSVEKYKSTFNLEKAVCNHGFFMMAPNKWNPSTKSLQRPLRLMD--QCC----SVMVTIS  63

Query  296  H-PSDSPQSLRLHVFGTDCLSAQQHQSLMAQVRRMLRLSEEEEKMVREFQEMYGEAKERG  472
            H P ++  +L +HV     LS +  Q+++A + RMLR+S+E+E  V EFQ++Y EAKE G
Sbjct  64   HLPGEN--NLHVHVHDVQLLSLEDQQAILA-LSRMLRISDEDENTVIEFQKLYPEAKEEG  120

Query  473  FGRVFRSPILFED  511
            FGR+FRSP +FED
Sbjct  121  FGRIFRSPSIFED  133



>gb|KHN34477.1| hypothetical protein glysoja_038896 [Glycine soja]
Length=365

 Score =   135 bits (341),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 67/140 (48%), Positives = 98/140 (70%), Gaps = 7/140 (5%)
 Frame = +2

Query  95   RGMVVVELPLGDASSTFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSDDHHCADHEI  274
            +   ++ LPLG   S+FNLEK VC+HG FMMAPN W   TK+L+RPLRL+D   C+    
Sbjct  7    KSKCLLYLPLGSCKSSFNLEKTVCNHGFFMMAPNKWISSTKSLQRPLRLAD--QCS----  60

Query  275  SVTVRVSHPSDSPQSLRLHVFGTDCLSAQQHQSLMAQVRRMLRLSEEEEKMVREFQEMYG  454
            SV V +SH  +S  +++++V   + +S +  Q+++ QV RMLR+S+++EK V EFQ +Y 
Sbjct  61   SVIVTISHLPESA-NIQIYVHDMEGVSLKSEQAILKQVARMLRISDKDEKAVNEFQGLYP  119

Query  455  EAKERGFGRVFRSPILFEDM  514
            +AK+  FGR+FRSP LFED+
Sbjct  120  QAKQDEFGRIFRSPSLFEDV  139



>ref|XP_004959865.1| PREDICTED: uncharacterized protein LOC101766322 [Setaria italica]
Length=461

 Score =   135 bits (341),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 73/139 (53%), Positives = 91/139 (65%), Gaps = 7/139 (5%)
 Frame = +2

Query  104  VVVELPLG-DASSTFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSDDHHCADHEISV  280
            V +ELPL    ++ F+L  AVCSHGLFMMAPN WDP  + L RPLRL+     +D   S+
Sbjct  22   VELELPLPPGGAAPFDLAAAVCSHGLFMMAPNRWDPAARALVRPLRLA-----SDRSASL  76

Query  281  TVRVS-HPSDSPQSLRLHVFGTDCLSAQQHQSLMAQVRRMLRLSEEEEKMVREFQEMYGE  457
              RVS HP+    +L + V G D LS+     ++ QVRRMLRLSEE+   V EFQ M+  
Sbjct  77   LARVSAHPARPGTALLVAVEGADALSSLDRDYILEQVRRMLRLSEEDGAAVAEFQAMHAA  136

Query  458  AKERGFGRVFRSPILFEDM  514
            A+E GFGR+FRSP LFEDM
Sbjct  137  AREEGFGRIFRSPTLFEDM  155



>ref|XP_008227745.1| PREDICTED: uncharacterized protein LOC103327233 [Prunus mume]
Length=369

 Score =   134 bits (338),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 94/133 (71%), Gaps = 8/133 (6%)
 Frame = +2

Query  116  LPLGDASSTFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSDDHHCADHEISVTVRVS  295
            LPLG ++S+FNLEKAVC+HG FMMAPN W P +KTL+RPLRL+D   C      VTV + 
Sbjct  8    LPLG-SNSSFNLEKAVCNHGFFMMAPNRWIPSSKTLQRPLRLADSTTC------VTVSIL  60

Query  296  HPSDSPQSLRLHVFGTDCLSAQQHQSLMAQVRRMLRLSEEEEKMVREFQEMYGEAKERGF  475
            HP +   SL + V     +S    ++++ QV RMLR+SE +E  + E+Q+++ EAKE+GF
Sbjct  61   HPPNRT-SLLVRVRDIQNISYTDQRAILNQVARMLRISERDEMDMGEYQKVHPEAKEKGF  119

Query  476  GRVFRSPILFEDM  514
            GRVFRSP LFED+
Sbjct  120  GRVFRSPSLFEDL  132



>ref|XP_002514394.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF47990.1| conserved hypothetical protein [Ricinus communis]
Length=457

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/126 (52%), Positives = 90/126 (71%), Gaps = 8/126 (6%)
 Frame = +2

Query  134  SSTFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSDDHHCADHEISVTVRVSHPSDSP  313
            S +F+LEK VC+HG FMMAPN W P TKTL+RPLR+ +D        SV + +S P +  
Sbjct  15   SESFDLEKVVCNHGFFMMAPNRWLPETKTLQRPLRIREDTK------SVLISISQPLN--  66

Query  314  QSLRLHVFGTDCLSAQQHQSLMAQVRRMLRLSEEEEKMVREFQEMYGEAKERGFGRVFRS  493
              LR+       L+++  Q+++ QVRRMLR+SE++E+ V+EFQEM+ EAK++GFGR+FRS
Sbjct  67   HHLRIVAHDIQNLTSEDRQTMLNQVRRMLRISEKDEREVKEFQEMHAEAKKKGFGRLFRS  126

Query  494  PILFED  511
            P LFED
Sbjct  127  PSLFED  132



>ref|XP_006853038.1| hypothetical protein AMTR_s00038p00020700 [Amborella trichopoda]
 gb|ERN14505.1| hypothetical protein AMTR_s00038p00020700 [Amborella trichopoda]
Length=458

 Score =   132 bits (332),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 74/138 (54%), Positives = 91/138 (66%), Gaps = 11/138 (8%)
 Frame = +2

Query  104  VVVELPLGDASSTFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSDDHHCADHEISVT  283
             V+ LP+ +   +F LEKAVCSHG FMMAPN W   ++TL+RPLRL+D         SV 
Sbjct  8    TVLTLPVNE---SFELEKAVCSHGFFMMAPNLWFSSSQTLQRPLRLTDRS-------SVP  57

Query  284  VRVSHPSDSPQ-SLRLHVFGTDCLSAQQHQSLMAQVRRMLRLSEEEEKMVREFQEMYGEA  460
            VR++  S S Q SL++ V G   L     Q L+AQV RMLR+SEE++  V +F EMY  A
Sbjct  58   VRITQLSLSSQKSLQILVLGASKLYQHDQQYLLAQVARMLRISEEDDLKVNKFHEMYPVA  117

Query  461  KERGFGRVFRSPILFEDM  514
            KE GFGRVFRSP LFEDM
Sbjct  118  KETGFGRVFRSPTLFEDM  135



>ref|XP_006470788.1| PREDICTED: uncharacterized protein LOC102629917 isoform X3 [Citrus 
sinensis]
Length=382

 Score =   130 bits (326),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 74/152 (49%), Positives = 97/152 (64%), Gaps = 19/152 (13%)
 Frame = +2

Query  107  VVELPLGDASSTFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSDDHHCAD-HEISVT  283
            +++LPL +   TFNLE AVCSHGLFMM+PN WDPL+++L RPL LS+     D   +SV 
Sbjct  7    LLKLPLAE---TFNLETAVCSHGLFMMSPNRWDPLSRSLSRPLHLSNSLDNTDIPSVSVD  63

Query  284  VRVSHPSDSPQSLRLHVFGTD-----CLSAQQHQSLMAQVRRMLRLSEEEEKMVREFQEM  448
            V +  P   P SLR+ V  +       LS +Q  +L+AQV+RMLRLSE +E+ VREF+ +
Sbjct  64   VTICQPQQDPHSLRIEVRNSASGSAPSLSQEQQDALLAQVKRMLRLSEADERNVREFKRI  123

Query  449  YGE-AKERG---------FGRVFRSPILFEDM  514
              + A+E G          GRVFRSP LFEDM
Sbjct  124  VRQVAQEEGEETQYMEDFSGRVFRSPTLFEDM  155



>ref|XP_006470787.1| PREDICTED: uncharacterized protein LOC102629917 isoform X2 [Citrus 
sinensis]
Length=409

 Score =   130 bits (326),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 74/152 (49%), Positives = 97/152 (64%), Gaps = 19/152 (13%)
 Frame = +2

Query  107  VVELPLGDASSTFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSDDHHCAD-HEISVT  283
            +++LPL +   TFNLE AVCSHGLFMM+PN WDPL+++L RPL LS+     D   +SV 
Sbjct  7    LLKLPLAE---TFNLETAVCSHGLFMMSPNRWDPLSRSLSRPLHLSNSLDNTDIPSVSVD  63

Query  284  VRVSHPSDSPQSLRLHVFGTD-----CLSAQQHQSLMAQVRRMLRLSEEEEKMVREFQEM  448
            V +  P   P SLR+ V  +       LS +Q  +L+AQV+RMLRLSE +E+ VREF+ +
Sbjct  64   VTICQPQQDPHSLRIEVRNSASGSAPSLSQEQQDALLAQVKRMLRLSEADERNVREFKRI  123

Query  449  YGE-AKERG---------FGRVFRSPILFEDM  514
              + A+E G          GRVFRSP LFEDM
Sbjct  124  VRQVAQEEGEETQYMEDFSGRVFRSPTLFEDM  155



>ref|XP_006470786.1| PREDICTED: uncharacterized protein LOC102629917 isoform X1 [Citrus 
sinensis]
Length=454

 Score =   130 bits (326),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 74/152 (49%), Positives = 97/152 (64%), Gaps = 19/152 (13%)
 Frame = +2

Query  107  VVELPLGDASSTFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSDDHHCAD-HEISVT  283
            +++LPL +   TFNLE AVCSHGLFMM+PN WDPL+++L RPL LS+     D   +SV 
Sbjct  7    LLKLPLAE---TFNLETAVCSHGLFMMSPNRWDPLSRSLSRPLHLSNSLDNTDIPSVSVD  63

Query  284  VRVSHPSDSPQSLRLHVFGTD-----CLSAQQHQSLMAQVRRMLRLSEEEEKMVREFQEM  448
            V +  P   P SLR+ V  +       LS +Q  +L+AQV+RMLRLSE +E+ VREF+ +
Sbjct  64   VTICQPQQDPHSLRIEVRNSASGSAPSLSQEQQDALLAQVKRMLRLSEADERNVREFKRI  123

Query  449  YGE-AKERG---------FGRVFRSPILFEDM  514
              + A+E G          GRVFRSP LFEDM
Sbjct  124  VRQVAQEEGEETQYMEDFSGRVFRSPTLFEDM  155



>ref|XP_006431360.1| hypothetical protein CICLE_v10001110mg [Citrus clementina]
 gb|ESR44600.1| hypothetical protein CICLE_v10001110mg [Citrus clementina]
Length=454

 Score =   130 bits (326),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 74/152 (49%), Positives = 97/152 (64%), Gaps = 19/152 (13%)
 Frame = +2

Query  107  VVELPLGDASSTFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSDDHHCAD-HEISVT  283
            V++LPL +   TFNLE AVCSHGLFMM+PN WDPL+++L RPL LS+     D   +SV 
Sbjct  7    VLKLPLAE---TFNLEAAVCSHGLFMMSPNRWDPLSRSLSRPLHLSNSLDNTDIPSVSVD  63

Query  284  VRVSHPSDSPQSLRLHVFGTD-----CLSAQQHQSLMAQVRRMLRLSEEEEKMVREFQEM  448
            V +  P   P SLR+ V  +       LS +Q  +L+AQV+RMLRLSE +E+ VR+F+ +
Sbjct  64   VTICQPQQDPHSLRIEVRNSASGSAPSLSQEQQDALLAQVKRMLRLSEADERNVRDFKRI  123

Query  449  YGE-AKERG---------FGRVFRSPILFEDM  514
              + A+E G          GRVFRSP LFEDM
Sbjct  124  VRQVAQEEGEESQYMTDFSGRVFRSPTLFEDM  155



>ref|XP_010533318.1| PREDICTED: uncharacterized protein LOC104809120 [Tarenaya hassleriana]
Length=248

 Score =   126 bits (316),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 77/160 (48%), Positives = 95/160 (59%), Gaps = 15/160 (9%)
 Frame = +2

Query  77   ISGDARRGMVVVELPLGDASSTFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRL-----  241
            I GD  +    VELPLG+A+  F+LEKAVCSHG FMM+PN WDPL+++L RPLR      
Sbjct  2    IDGDDLKISCSVELPLGEAAEAFDLEKAVCSHGFFMMSPNRWDPLSRSLFRPLRFPPLDF  61

Query  242  ---SDDHHCADHEI-SVTVRVSHPSDSPQSLRLHVFGTDCLSAQQHQSLMAQVRRMLRLS  409
                D   C +    S  VR+S   + P  L + V G   LS  Q ++++AQV RMLRLS
Sbjct  62   DGDFDGSDCGEAPYPSAVVRISQHPELP-CLSVRVCGVSSLSESQRRAIVAQVSRMLRLS  120

Query  410  EEEEKMVREFQEMYGEAKE----RGF-GRVFRSPILFEDM  514
              EE   +EF +M  E  E    R F GRVFRSP LFEDM
Sbjct  121  PAEEIKAKEFVKMMTENGEEELLRSFGGRVFRSPPLFEDM  160



>gb|KJB56628.1| hypothetical protein B456_009G128100 [Gossypium raimondii]
Length=428

 Score =   129 bits (323),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 75/147 (51%), Positives = 97/147 (66%), Gaps = 16/147 (11%)
 Frame = +2

Query  104  VVVELPLGDASSTFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSDDHHCADHEISVT  283
            ++VELPL +A+  F LEKA+CSHGLFM+APNHWDP++++  RPLRL+         ++VT
Sbjct  15   LLVELPLREAAEGFELEKAICSHGLFMLAPNHWDPISRSFSRPLRLTSP------PLTVT  68

Query  284  VRV-SHPSDSPQSLRLHVFGTDCLSAQQHQSLMAQVRRMLRLSEEEEKMVREF----QEM  448
            VR+   P+ S  +L L V+G   LS     SL+ QV RMLRLSE EE  VREF    + +
Sbjct  69   VRISQPPTSSSSTLYLRVYGASSLSPPHRHSLLNQVSRMLRLSESEENKVREFRSIVEAL  128

Query  449  YGEAKE----RGF-GRVFRSPILFEDM  514
            +GE +     R F GRVFRSP LFEDM
Sbjct  129  HGEEEATEYLRSFSGRVFRSPTLFEDM  155



>gb|KJB56629.1| hypothetical protein B456_009G128100 [Gossypium raimondii]
Length=435

 Score =   129 bits (323),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 75/147 (51%), Positives = 97/147 (66%), Gaps = 16/147 (11%)
 Frame = +2

Query  104  VVVELPLGDASSTFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSDDHHCADHEISVT  283
            ++VELPL +A+  F LEKA+CSHGLFM+APNHWDP++++  RPLRL+         ++VT
Sbjct  15   LLVELPLREAAEGFELEKAICSHGLFMLAPNHWDPISRSFSRPLRLTSP------PLTVT  68

Query  284  VRV-SHPSDSPQSLRLHVFGTDCLSAQQHQSLMAQVRRMLRLSEEEEKMVREF----QEM  448
            VR+   P+ S  +L L V+G   LS     SL+ QV RMLRLSE EE  VREF    + +
Sbjct  69   VRISQPPTSSSSTLYLRVYGASSLSPPHRHSLLNQVSRMLRLSESEENKVREFRSIVEAL  128

Query  449  YGEAKE----RGF-GRVFRSPILFEDM  514
            +GE +     R F GRVFRSP LFEDM
Sbjct  129  HGEEEATEYLRSFSGRVFRSPTLFEDM  155



>gb|KHG17286.1| DNA-3-methyladenine glycosylase 1 [Gossypium arboreum]
Length=451

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 73/147 (50%), Positives = 96/147 (65%), Gaps = 16/147 (11%)
 Frame = +2

Query  104  VVVELPLGDASSTFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSDDHHCADHEISVT  283
            +++ELPLG+A+  F LEKA+CSHGLFM+APNHWDP++++  RP RL+         ++VT
Sbjct  38   LLIELPLGEAAEGFELEKAICSHGLFMLAPNHWDPISRSFSRPFRLTSP------PLTVT  91

Query  284  VRV-SHPSDSPQSLRLHVFGTDCLSAQQHQSLMAQVRRMLRLSEEEEKMVREF----QEM  448
            V +   P+ S  +L L V+G   LS     SL+ QV RMLRLSE EE  VREF    + +
Sbjct  92   VGISQPPTSSSSTLYLRVYGASSLSPLHRHSLLNQVSRMLRLSESEENKVREFRSIVEAL  151

Query  449  YGEAKE----RGF-GRVFRSPILFEDM  514
            +GE +     R F GRVFRSP LFEDM
Sbjct  152  HGEEEATEYLRSFSGRVFRSPTLFEDM  178



>emb|CDP17259.1| unnamed protein product [Coffea canephora]
Length=292

 Score =   124 bits (311),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 69/151 (46%), Positives = 93/151 (62%), Gaps = 15/151 (10%)
 Frame = +2

Query  62   TGETTISGDARRGMVVVELPLGDASSTFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRL  241
            T +TTI          + +PL D   TFNLEKAVC+HG FMMAPN WDP TK   RPLRL
Sbjct  2    TKKTTICSK-------LYMPLKDYP-TFNLEKAVCNHGFFMMAPNVWDPSTKQFTRPLRL  53

Query  242  SDDHHCADHEISVTVRVSHPSDSPQSLRLHVFGTDCLSAQQHQSLMAQVRRMLRLSEEEE  421
            +D  +      SV V +S P D    L + V   +C+S    +++ AQV RM+RLS ++E
Sbjct  54   ADSVN------SVKVTISQPHDC-SLLLIEVHDMECISDLDKEAIRAQVARMMRLSPKDE  106

Query  422  KMVREFQEMYGEAKERGFGRVFRSPILFEDM  514
            K ++EFQ ++ + K  GFGR+FR+P  FED+
Sbjct  107  KDLQEFQNIHPKFKNMGFGRIFRAPSFFEDV  137



>ref|XP_010682181.1| PREDICTED: uncharacterized protein LOC104897071 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=481

 Score =   125 bits (314),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 94/133 (71%), Gaps = 5/133 (4%)
 Frame = +2

Query  116  LPLGDASSTFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSDDHHCADHEISVTVRVS  295
            +PL + +STFN E A+CSHGLF+MAPN WDP TK+L RPLRLS     A     V +   
Sbjct  28   IPLQNPTSTFNFETAICSHGLFLMAPNEWDPHTKSLLRPLRLSLSSSAASTSALVRI---  84

Query  296  HPSDSPQSLRLHVFGTDCLSAQQHQSLMAQVRRMLRLSEEEEKMVREFQEMYGEAKERGF  475
              S + +++ + V+G   L+A++  +++ QV+RMLRLSE EEK VREFQE++ +AKE  F
Sbjct  85   --SAAQRAVLVRVYGVRHLAAEEEDAVVRQVKRMLRLSEREEKKVREFQELHSQAKEMKF  142

Query  476  GRVFRSPILFEDM  514
            GRVFRSP LFEDM
Sbjct  143  GRVFRSPSLFEDM  155



>ref|XP_010490265.1| PREDICTED: uncharacterized protein LOC104768014 [Camelina sativa]
Length=282

 Score =   123 bits (308),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 88/135 (65%), Gaps = 8/135 (6%)
 Frame = +2

Query  110  VELPLGDASSTFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSDDHHCADHEISVTVR  289
            + L LG+   TF++EKAVC+HG FMMAPN W+P +K+L RPL LSD         S  V 
Sbjct  3    LRLHLGEMKETFDMEKAVCNHGFFMMAPNVWNPSSKSLHRPLTLSDSS-------STDVT  55

Query  290  VSHPSDSPQSLRLHVFGTDCLSAQQHQSLMAQVRRMLRLSEEEEKMVREFQEMYGEAKER  469
            +SHPS     L + V G + +S      ++ QV RMLRLS+++E+ + EFQ+ +  A++ 
Sbjct  56   ISHPS-GLSILVIQVHGINNVSRVDESLILQQVGRMLRLSDKDERDIVEFQQAHEAARKS  114

Query  470  GFGRVFRSPILFEDM  514
            GFGR+FRSP LFEDM
Sbjct  115  GFGRIFRSPSLFEDM  129



>ref|XP_006299074.1| hypothetical protein CARUB_v10015214mg [Capsella rubella]
 gb|EOA31972.1| hypothetical protein CARUB_v10015214mg [Capsella rubella]
Length=350

 Score =   124 bits (311),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 65/135 (48%), Positives = 89/135 (66%), Gaps = 8/135 (6%)
 Frame = +2

Query  110  VELPLGDASSTFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSDDHHCADHEISVTVR  289
            + L LG+   TF++EKAVC+HG FMMAPN W+P TK+L RPL LSD         S  V 
Sbjct  3    LRLHLGEKKGTFDMEKAVCNHGFFMMAPNVWNPSTKSLHRPLTLSDSS-------STDVT  55

Query  290  VSHPSDSPQSLRLHVFGTDCLSAQQHQSLMAQVRRMLRLSEEEEKMVREFQEMYGEAKER  469
            +SHPS     L + V   + +S    + ++ QV RMLRLS+++E+ + EFQ+++  A+E 
Sbjct  56   ISHPS-GLSFLVIQVHAINNVSRVDEELILKQVERMLRLSDKDERDMFEFQQVHEAARES  114

Query  470  GFGRVFRSPILFEDM  514
            GFGR+FRSP LFEDM
Sbjct  115  GFGRIFRSPSLFEDM  129



>ref|XP_009626386.1| PREDICTED: uncharacterized protein LOC104117102 [Nicotiana tomentosiformis]
Length=144

 Score =   119 bits (298),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/125 (47%), Positives = 84/125 (67%), Gaps = 8/125 (6%)
 Frame = +2

Query  140  TFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSDDHHCADHEISVTVRVSHPSDSPQS  319
            TF +EKAVC+HG FMMAPN W+P  K+  RPLRL+D         SV   +S P      
Sbjct  18   TFIIEKAVCNHGFFMMAPNCWEPSFKSFSRPLRLAD-------STSVMTSISQPPGK-DH  69

Query  320  LRLHVFGTDCLSAQQHQSLMAQVRRMLRLSEEEEKMVREFQEMYGEAKERGFGRVFRSPI  499
            L + V+G   LS +   ++ +QV+RMLRLS+++E+ VR+F +++ EA+ +GFGR+FRSP 
Sbjct  70   LAVKVYGASILSLKDELAIQSQVKRMLRLSDKDEEDVRDFHKLHPEAEAKGFGRLFRSPT  129

Query  500  LFEDM  514
            LFED+
Sbjct  130  LFEDI  134



>emb|CDX82716.1| BnaC07g01500D [Brassica napus]
Length=347

 Score =   124 bits (310),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 63/135 (47%), Positives = 90/135 (67%), Gaps = 8/135 (6%)
 Frame = +2

Query  110  VELPLGDASSTFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSDDHHCADHEISVTVR  289
            + L L +    F++EKAVC+HG FMMAPN WDP +K+L RPL LS+         SV+V 
Sbjct  3    LRLYLKEFERKFDMEKAVCNHGFFMMAPNVWDPKSKSLTRPLTLSNSS-------SVSVT  55

Query  290  VSHPSDSPQSLRLHVFGTDCLSAQQHQSLMAQVRRMLRLSEEEEKMVREFQEMYGEAKER  469
            +SHP  +   L + V G + +S    + ++ QV RMLR+S E+++ V EFQ+++ +AK+ 
Sbjct  56   ISHPR-TLSFLVIQVHGINNVSRVDEELILQQVGRMLRISAEDDRDVTEFQQLHEDAKKY  114

Query  470  GFGRVFRSPILFEDM  514
            GFGR+FRSP LFEDM
Sbjct  115  GFGRIFRSPFLFEDM  129



>ref|XP_010682180.1| PREDICTED: uncharacterized protein LOC104897071 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=523

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 94/133 (71%), Gaps = 5/133 (4%)
 Frame = +2

Query  116  LPLGDASSTFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSDDHHCADHEISVTVRVS  295
            +PL + +STFN E A+CSHGLF+MAPN WDP TK+L RPLRLS     A     V +   
Sbjct  28   IPLQNPTSTFNFETAICSHGLFLMAPNEWDPHTKSLLRPLRLSLSSSAASTSALVRI---  84

Query  296  HPSDSPQSLRLHVFGTDCLSAQQHQSLMAQVRRMLRLSEEEEKMVREFQEMYGEAKERGF  475
              S + +++ + V+G   L+A++  +++ QV+RMLRLSE EEK VREFQE++ +AKE  F
Sbjct  85   --SAAQRAVLVRVYGVRHLAAEEEDAVVRQVKRMLRLSEREEKKVREFQELHSQAKEMKF  142

Query  476  GRVFRSPILFEDM  514
            GRVFRSP LFEDM
Sbjct  143  GRVFRSPSLFEDM  155



>ref|XP_009124647.1| PREDICTED: uncharacterized protein LOC103849671 [Brassica rapa]
Length=162

 Score =   119 bits (297),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 84/122 (69%), Gaps = 8/122 (7%)
 Frame = +2

Query  149  LEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSDDHHCADHEISVTVRVSHPSDSPQSLRL  328
            +EKAVC+HG FMMAPN WDP +K+L RPL LS+         SV+V +SHP  +   L +
Sbjct  1    MEKAVCNHGFFMMAPNVWDPKSKSLTRPLTLSNSS-------SVSVTISHPR-TLSFLVI  52

Query  329  HVFGTDCLSAQQHQSLMAQVRRMLRLSEEEEKMVREFQEMYGEAKERGFGRVFRSPILFE  508
             V G + +S    + ++ QV RMLR+S E+++ V EFQ+++ +AK+ GFGR+FRSP LFE
Sbjct  53   QVHGINNVSRVDEELILQQVGRMLRISAEDDRDVTEFQQLHEDAKKYGFGRIFRSPFLFE  112

Query  509  DM  514
            DM
Sbjct  113  DM  114



>ref|XP_006350375.1| PREDICTED: uncharacterized protein LOC102593362 [Solanum tuberosum]
Length=336

 Score =   122 bits (307),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 62/129 (48%), Positives = 83/129 (64%), Gaps = 7/129 (5%)
 Frame = +2

Query  128  DASSTFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSDDHHCADHEISVTVRVSHPSD  307
            D    FNLEKAVC+HG FMMAPNHWDP TKT  RPLRL D         S    +S P  
Sbjct  16   DKFPRFNLEKAVCNHGFFMMAPNHWDPSTKTFSRPLRLDDSIR------SALTFISQPPG  69

Query  308  SPQSLRLHVFGTDCLSAQQHQSLMAQVRRMLRLSEEEEKMVREFQEMYGEAKERGFGRVF  487
                L + V+G   LS++   ++ +QV+RMLRLS+++E+ V  F +++  A+ +GFGR+F
Sbjct  70   EDH-LVITVYGATILSSKDEGAIQSQVKRMLRLSDKDEQDVTYFHKLHPHAEAKGFGRLF  128

Query  488  RSPILFEDM  514
            RSP LFED+
Sbjct  129  RSPTLFEDV  137



>ref|XP_010468777.1| PREDICTED: uncharacterized protein LOC104748896 [Camelina sativa]
Length=348

 Score =   122 bits (306),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 89/135 (66%), Gaps = 8/135 (6%)
 Frame = +2

Query  110  VELPLGDASSTFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSDDHHCADHEISVTVR  289
            + L LG+   TF++EKAVC+HG FMMAPN W+P +K+L RPL LSD         S  V 
Sbjct  3    LRLHLGEMKETFDMEKAVCNHGFFMMAPNVWNPSSKSLHRPLTLSDSS-------STDVT  55

Query  290  VSHPSDSPQSLRLHVFGTDCLSAQQHQSLMAQVRRMLRLSEEEEKMVREFQEMYGEAKER  469
            +SHPS     L + V G + +S      ++ QV RMLRLS+++E+ + EFQ+++  A++ 
Sbjct  56   ISHPS-GLSFLVIQVHGINNVSRVDEALILQQVARMLRLSDKDERDMVEFQQVHEAARKS  114

Query  470  GFGRVFRSPILFEDM  514
            GFGR+FRSP LFEDM
Sbjct  115  GFGRIFRSPSLFEDM  129



>ref|XP_006405889.1| hypothetical protein EUTSA_v10028065mg [Eutrema salsugineum]
 gb|ESQ47342.1| hypothetical protein EUTSA_v10028065mg [Eutrema salsugineum]
Length=158

 Score =   117 bits (293),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/135 (45%), Positives = 87/135 (64%), Gaps = 8/135 (6%)
 Frame = +2

Query  110  VELPLGDASSTFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSDDHHCADHEISVTVR  289
            + L L +   +F++EKAVC+HG FMMAPN W+P T++L +PL +S+         SV V 
Sbjct  3    LRLYLKEFEESFDMEKAVCNHGFFMMAPNIWNPKTRSLSQPLTVSNSS-------SVNVT  55

Query  290  VSHPSDSPQSLRLHVFGTDCLSAQQHQSLMAQVRRMLRLSEEEEKMVREFQEMYGEAKER  469
            +SHP  +   L + V G + +S    + ++ QV RMLR+S E ++ V +FQE+Y  AK  
Sbjct  56   ISHP-RTLSFLVIQVHGINNVSRVGEELILQQVARMLRISPEGQRDVTKFQEVYEAAKTS  114

Query  470  GFGRVFRSPILFEDM  514
            GFGR+FRSP LFEDM
Sbjct  115  GFGRIFRSPSLFEDM  129



>ref|XP_006405890.1| hypothetical protein EUTSA_v10028036mg [Eutrema salsugineum]
 gb|ESQ47343.1| hypothetical protein EUTSA_v10028036mg [Eutrema salsugineum]
Length=355

 Score =   121 bits (304),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 63/135 (47%), Positives = 88/135 (65%), Gaps = 8/135 (6%)
 Frame = +2

Query  110  VELPLGDASSTFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSDDHHCADHEISVTVR  289
            + L L +   +F++EKAVC+HG FMMAPN W+P TK+L RPL +S+         SV V 
Sbjct  3    LRLYLREFEKSFDMEKAVCNHGFFMMAPNIWNPKTKSLSRPLTVSNSS-------SVNVT  55

Query  290  VSHPSDSPQSLRLHVFGTDCLSAQQHQSLMAQVRRMLRLSEEEEKMVREFQEMYGEAKER  469
            +SHP  +   L + V G + +S    + ++ QV RMLR+S E+++ V +FQE+Y  AK  
Sbjct  56   ISHPR-TLSFLVIQVHGINNVSRVDEELILQQVARMLRISPEDQRDVTKFQEVYEAAKTS  114

Query  470  GFGRVFRSPILFEDM  514
            GFGR+FRSP LFEDM
Sbjct  115  GFGRIFRSPSLFEDM  129



>ref|XP_002519384.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF43001.1| conserved hypothetical protein [Ricinus communis]
Length=458

 Score =   122 bits (305),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 70/149 (47%), Positives = 98/149 (66%), Gaps = 15/149 (10%)
 Frame = +2

Query  92   RRGMVVVELPLG-DASSTFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSDDHHCADH  268
            R G+V  E+ +G +A+ TF+LEK VCSHGLFM++PNHWDPL++T  RPLRL+DD    D+
Sbjct  4    REGVVEFEVAVGGEAADTFDLEKTVCSHGLFMLSPNHWDPLSRTFSRPLRLNDD---TDN  60

Query  269  EISVTVRVSHPSDSPQSLRLHVFGTDCLSAQQHQSLMAQVRRMLRLSEEEEKMVREFQEM  448
             + V++   H S   +SL + V+G   LS +  +SL+ Q+ RMLRLS+ +E   REF+++
Sbjct  61   SLMVSIS-QHLS---KSLLVRVYGNRSLSPKHQESLLVQIVRMLRLSDMDEFNAREFRKI  116

Query  449  YG--EAKERGF-----GRVFRSPILFEDM  514
                E +E        GRV RSP LFEDM
Sbjct  117  VSAFEGEECPLIGDFGGRVLRSPTLFEDM  145



>gb|KHN40743.1| hypothetical protein glysoja_015110 [Glycine soja]
Length=443

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 76/137 (55%), Positives = 86/137 (63%), Gaps = 18/137 (13%)
 Frame = +2

Query  110  VELPLGDASSTFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSDDHHCADHEISVTVR  289
            +ELP     S F LE+AVCSHGLFMM PNHWDPL+KTL RPLR S          S  V 
Sbjct  18   MELP-----SPFQLEQAVCSHGLFMMPPNHWDPLSKTLIRPLRSSPS--------SFLVS  64

Query  290  VSHPSDSPQSLRLHVFGTDCLSAQQHQSLMAQVRRMLRLSEEEEKMVREFQEMY-GEAKE  466
            +S  S   QSL + V  T  LS QQ   +MAQV RMLR SE EEK VREF+ ++  +   
Sbjct  65   LSQHS---QSLAVRVHATHALSPQQQNHIMAQVSRMLRFSEAEEKAVREFRSLHVVDHPN  121

Query  467  RGF-GRVFRSPILFEDM  514
            R F GRVFRSP LFEDM
Sbjct  122  RSFSGRVFRSPTLFEDM  138



>ref|XP_010315535.1| PREDICTED: uncharacterized protein LOC101254250 [Solanum lycopersicum]
Length=335

 Score =   119 bits (297),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/129 (46%), Positives = 82/129 (64%), Gaps = 7/129 (5%)
 Frame = +2

Query  128  DASSTFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSDDHHCADHEISVTVRVSHPSD  307
            D    FNLEKAVC+HG FMMAPN WDP TK   RPLRL       D+ I  T+       
Sbjct  16   DKFPRFNLEKAVCNHGFFMMAPNQWDPSTKIFSRPLRL-------DNSIRSTLTFISQPP  68

Query  308  SPQSLRLHVFGTDCLSAQQHQSLMAQVRRMLRLSEEEEKMVREFQEMYGEAKERGFGRVF  487
                L + V+G   LS++   ++ +QV+RMLRLS+++E+ V +F +++  A+ +GFGR+F
Sbjct  69   GEDHLVITVYGAIILSSKDEGAIQSQVKRMLRLSDKDEQDVTDFHKLHPHAEAKGFGRLF  128

Query  488  RSPILFEDM  514
            RSP LFED+
Sbjct  129  RSPTLFEDV  137



>ref|XP_003534756.2| PREDICTED: uncharacterized protein LOC100781827 [Glycine max]
Length=443

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 75/137 (55%), Positives = 85/137 (62%), Gaps = 18/137 (13%)
 Frame = +2

Query  110  VELPLGDASSTFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSDDHHCADHEISVTVR  289
            +ELP     S F LE+AVCSHGLFMM PNHWDPL+KTL RPLR S          S  V 
Sbjct  18   MELP-----SPFQLEQAVCSHGLFMMPPNHWDPLSKTLIRPLRSSPS--------SFLVS  64

Query  290  VSHPSDSPQSLRLHVFGTDCLSAQQHQSLMAQVRRMLRLSEEEEKMVREFQEMY-GEAKE  466
            +S  S   QSL + V  T  LS QQ   + AQV RMLR SE EEK VREF+ ++  +   
Sbjct  65   LSQHS---QSLAVRVHATHALSPQQQNHITAQVSRMLRFSEAEEKAVREFRSLHVVDHPN  121

Query  467  RGF-GRVFRSPILFEDM  514
            R F GRVFRSP LFEDM
Sbjct  122  RSFSGRVFRSPTLFEDM  138



>ref|XP_009804252.1| PREDICTED: uncharacterized protein LOC104249510 [Nicotiana sylvestris]
Length=346

 Score =   117 bits (294),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 58/125 (46%), Positives = 83/125 (66%), Gaps = 8/125 (6%)
 Frame = +2

Query  140  TFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSDDHHCADHEISVTVRVSHPSDSPQS  319
            TF +EKA+C+HG FMMAPN W+P TK+  RPLRL+D         SV   +S P      
Sbjct  18   TFTIEKAMCNHGFFMMAPNCWEPSTKSFSRPLRLADS-------TSVMTFISQPPGKDH-  69

Query  320  LRLHVFGTDCLSAQQHQSLMAQVRRMLRLSEEEEKMVREFQEMYGEAKERGFGRVFRSPI  499
            L + V+G   L  +   ++ +QV+RMLRLS+ +E+ VR+F +++ EA+ +GFGR+FRSP 
Sbjct  70   LVIKVYGASILWLKDELAIQSQVKRMLRLSDMDEQDVRDFHKLHPEAEAKGFGRLFRSPT  129

Query  500  LFEDM  514
            LFED+
Sbjct  130  LFEDV  134



>emb|CDY11690.1| BnaC06g12980D [Brassica napus]
Length=212

 Score =   111 bits (277),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/122 (46%), Positives = 81/122 (66%), Gaps = 8/122 (7%)
 Frame = +2

Query  149  LEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSDDHHCADHEISVTVRVSHPSDSPQSLRL  328
            + KAVC+HG FMMAPN WDP +K+L RPL LS+         SV+V +SHP  +   L +
Sbjct  1    MAKAVCNHGFFMMAPNVWDPKSKSLTRPLTLSNSS-------SVSVTISHPR-TLSFLVI  52

Query  329  HVFGTDCLSAQQHQSLMAQVRRMLRLSEEEEKMVREFQEMYGEAKERGFGRVFRSPILFE  508
             V G + +S    + ++ QV RMLR+S ++++ V EFQ+++  AK+ GFGR+F S +LFE
Sbjct  53   QVHGINNVSRVDEELILQQVGRMLRISAQDDRDVTEFQQLHENAKKNGFGRIFGSLLLFE  112

Query  509  DM  514
            DM
Sbjct  113  DM  114



>ref|XP_007147543.1| hypothetical protein PHAVU_006G133500g [Phaseolus vulgaris]
 gb|ESW19537.1| hypothetical protein PHAVU_006G133500g [Phaseolus vulgaris]
Length=474

 Score =   111 bits (277),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 69/137 (50%), Positives = 85/137 (62%), Gaps = 9/137 (7%)
 Frame = +2

Query  110  VELPLGDASSTFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSDDHHCADHEISVTVR  289
            +ELP    +  F L++AVCSHG FMMAPNHWDPL+KTL RPL L           S +  
Sbjct  37   MELP--SETEPFQLDQAVCSHGFFMMAPNHWDPLSKTLTRPLLLH-----NPSSSSSSSL  89

Query  290  VSHPSDSPQSLRLHVFGTDCLSAQQHQSLMAQVRRMLRLSEEEEKMVREFQEMY-GEAKE  466
            +   S  PQSL + V     +S QQ + + AQ+ RMLRLSE EEK VREF+ ++  +   
Sbjct  90   LVSLSQRPQSLAVRVHSVHFISPQQQRHIKAQITRMLRLSEAEEKAVREFRSVHAADHPN  149

Query  467  RGF-GRVFRSPILFEDM  514
            R F GRVFRSP LFEDM
Sbjct  150  RSFGGRVFRSPTLFEDM  166



>ref|XP_009102171.1| PREDICTED: uncharacterized protein LOC103828315 [Brassica rapa]
Length=162

 Score =   104 bits (259),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 56/122 (46%), Positives = 81/122 (66%), Gaps = 8/122 (7%)
 Frame = +2

Query  149  LEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSDDHHCADHEISVTVRVSHPSDSPQSLRL  328
            +EKA C+HG FMMAPN WDP +K+L RP+          +  SV+V +SHP  +   L +
Sbjct  1    MEKAACNHGFFMMAPNGWDPKSKSLTRPM-------TVSNSSSVSVTISHPR-TLSFLVI  52

Query  329  HVFGTDCLSAQQHQSLMAQVRRMLRLSEEEEKMVREFQEMYGEAKERGFGRVFRSPILFE  508
             V G + +S    + ++ QV RMLR+S+E+ + V EFQ+++ +AK+ GFGR+FRSP LFE
Sbjct  53   QVHGINNVSRVDEELILQQVGRMLRISDEDGRDVTEFQQLHEDAKKYGFGRIFRSPFLFE  112

Query  509  DM  514
            DM
Sbjct  113  DM  114



>ref|XP_007213368.1| hypothetical protein PRUPE_ppa026718mg [Prunus persica]
 gb|EMJ14567.1| hypothetical protein PRUPE_ppa026718mg [Prunus persica]
Length=311

 Score =   106 bits (264),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 75/111 (68%), Gaps = 7/111 (6%)
 Frame = +2

Query  182  MMAPNHWDPLTKTLERPLRLSDDHHCADHEISVTVRVSHPSDSPQSLRLHVFGTDCLSAQ  361
            MMAPN W P +KTL+RPLRL+D   C      VTV + HP +   SL + V     +S  
Sbjct  1    MMAPNRWIPSSKTLQRPLRLADSTTC------VTVSILHPPNRT-SLLVRVHDVQNISYA  53

Query  362  QHQSLMAQVRRMLRLSEEEEKMVREFQEMYGEAKERGFGRVFRSPILFEDM  514
              ++++ QV RMLR+SE +E  +RE+Q+++ EAKE+GFGRVFRSP LFED+
Sbjct  54   DQRAILNQVARMLRISERDEMDMREYQKVHPEAKEKGFGRVFRSPTLFEDL  104



>ref|XP_008385650.1| PREDICTED: uncharacterized protein LOC103448172 [Malus domestica]
Length=263

 Score =   104 bits (259),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 75/111 (68%), Gaps = 8/111 (7%)
 Frame = +2

Query  185  MAPNHWDPLTKTLERPLRLSDDHHCADHEISVTVRVSHPSDSPQSLRLHVFG-TDCLSAQ  361
            MAPN W P +KTLERPLRL+D   C      VTV + HP +   SL + V+     LS  
Sbjct  1    MAPNRWVPSSKTLERPLRLADSTTC------VTVSIQHPPNHT-SLLIQVYDHIHNLSFA  53

Query  362  QHQSLMAQVRRMLRLSEEEEKMVREFQEMYGEAKERGFGRVFRSPILFEDM  514
               +++ QVRRMLR+S+++E+ +RE+ E++ EAKE+G GRVFRSP LFED+
Sbjct  54   DKDAILQQVRRMLRISKKDERAIREYHEVHPEAKEKGCGRVFRSPTLFEDL  104



>ref|XP_006593886.1| PREDICTED: uncharacterized protein LOC102669626 [Glycine max]
Length=343

 Score =   100 bits (250),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 78/111 (70%), Gaps = 7/111 (6%)
 Frame = +2

Query  182  MMAPNHWDPLTKTLERPLRLSDDHHCADHEISVTVRVSHPSDSPQSLRLHVFGTDCLSAQ  361
            MMAPN W   TK+L+RPLRL+D   C+    SV V +SH  +S  +++++V   + +S +
Sbjct  1    MMAPNKWISSTKSLQRPLRLAD--QCS----SVIVTISHLPESA-NIQIYVHDMEGVSLK  53

Query  362  QHQSLMAQVRRMLRLSEEEEKMVREFQEMYGEAKERGFGRVFRSPILFEDM  514
              Q+++ QV RMLR+S+++EK V EFQ +Y +AK+  FGR+FRSP LFED+
Sbjct  54   SEQAILKQVARMLRISDKDEKAVNEFQGLYPQAKQDEFGRIFRSPSLFEDV  104



>emb|CBI35315.3| unnamed protein product [Vitis vinifera]
Length=257

 Score = 98.6 bits (244),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 74/111 (67%), Gaps = 7/111 (6%)
 Frame = +2

Query  182  MMAPNHWDPLTKTLERPLRLSDDHHCADHEISVTVRVSHPSDSPQSLRLHVFGTDCLSAQ  361
            MMAPN W P TKTL+RPLRL+D +       S+   +SHP D+  ++ + +  T+ +S  
Sbjct  1    MMAPNVWIPSTKTLQRPLRLADPY------TSILTSISHP-DNENAIHVRLHDTEYISPN  53

Query  362  QHQSLMAQVRRMLRLSEEEEKMVREFQEMYGEAKERGFGRVFRSPILFEDM  514
              + ++ QV RMLR+S+ +E+ V++F ++  EAK + FGR+FRSP +FEDM
Sbjct  54   DQRVILEQVARMLRISDRDERDVKQFHQIQPEAKNKCFGRIFRSPSIFEDM  104



>gb|KDP47044.1| hypothetical protein JCGZ_10771 [Jatropha curcas]
Length=140

 Score = 95.5 bits (236),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 54/130 (42%), Positives = 77/130 (59%), Gaps = 11/130 (8%)
 Frame = +2

Query  122  LGDASSTFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSDDHHCADHEISVTVRVSHP  301
            LG +   F+LE  +C+HG FMMAPN W   TKTL+RPLRL      A+   S+ V +SH 
Sbjct  11   LGHSQFGFDLETTICNHGFFMMAPNKWISETKTLQRPLRL------ANGIDSLVVSISHT  64

Query  302  SDSPQSLRLHVFGTDCLSAQQHQSLMAQVRRMLRLSEEEEKMVREFQEMYGEAKERGFGR  481
             ++P  + +HV   + L+    +++  QV RMLR+ E      + F E + EAKE+ F +
Sbjct  65   PENPH-VDVHVHDVEILTEDDEEAIQKQVYRMLRVDE----FSKLFHEKHEEAKEKRFCK  119

Query  482  VFRSPILFED  511
            +FRS  LFED
Sbjct  120  LFRSASLFED  129



>gb|KDO53850.1| hypothetical protein CISIN_1g014334mg [Citrus sinensis]
Length=381

 Score = 98.2 bits (243),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 57/127 (45%), Positives = 77/127 (61%), Gaps = 16/127 (13%)
 Frame = +2

Query  182  MMAPNHWDPLTKTLERPLRLSDDHHCAD-HEISVTVRVSHPSDSPQSLRLHVFGTDC---  349
            MM+PN WDPL+++L RPL LS+     D   +SV V +  P   P SLR+ V  +     
Sbjct  1    MMSPNRWDPLSRSLSRPLHLSNSLDNTDIPSVSVDVTICQPQQDPHSLRIEVRNSASGSA  60

Query  350  --LSAQQHQSLMAQVRRMLRLSEEEEKMVREFQEMYGE-AKERG---------FGRVFRS  493
              LS +Q  +L+AQV+RMLRLSE +E+ VR+F+ +  + A+E G          GRVFRS
Sbjct  61   PSLSQEQQDALLAQVKRMLRLSEADERNVRDFKRIVRQVAQEEGEESQYMTDFSGRVFRS  120

Query  494  PILFEDM  514
            P LFEDM
Sbjct  121  PTLFEDM  127



>gb|KDO53849.1| hypothetical protein CISIN_1g014334mg [Citrus sinensis]
Length=426

 Score = 98.2 bits (243),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 57/127 (45%), Positives = 77/127 (61%), Gaps = 16/127 (13%)
 Frame = +2

Query  182  MMAPNHWDPLTKTLERPLRLSDDHHCAD-HEISVTVRVSHPSDSPQSLRLHVFGTDC---  349
            MM+PN WDPL+++L RPL LS+     D   +SV V +  P   P SLR+ V  +     
Sbjct  1    MMSPNRWDPLSRSLSRPLHLSNSLDNTDIPSVSVDVTICQPQQDPHSLRIEVRNSASGSA  60

Query  350  --LSAQQHQSLMAQVRRMLRLSEEEEKMVREFQEMYGE-AKERG---------FGRVFRS  493
              LS +Q  +L+AQV+RMLRLSE +E+ VR+F+ +  + A+E G          GRVFRS
Sbjct  61   PSLSQEQQDALLAQVKRMLRLSEADERNVRDFKRIVRQVAQEEGEESQYMTDFSGRVFRS  120

Query  494  PILFEDM  514
            P LFEDM
Sbjct  121  PTLFEDM  127



>ref|XP_006423927.1| hypothetical protein CICLE_v10030405mg, partial [Citrus clementina]
 gb|ESR37167.1| hypothetical protein CICLE_v10030405mg, partial [Citrus clementina]
Length=332

 Score = 96.3 bits (238),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 51/117 (44%), Positives = 70/117 (60%), Gaps = 14/117 (12%)
 Frame = +2

Query  182  MMAPNHWDPLTKTLERPLRLSDDHHCADHEISVTVRVSHPSDSPQSLRLHVFGTDC----  349
            MM+PN+W P TK+L+RPLRLSD     +  IS+        D    L       D     
Sbjct  1    MMSPNNWIPSTKSLQRPLRLSDSTKSINVSISI--------DEQNCLIARALDDDVNEVV  52

Query  350  --LSAQQHQSLMAQVRRMLRLSEEEEKMVREFQEMYGEAKERGFGRVFRSPILFEDM  514
              L+A   Q +  Q+ RMLRL+E +EK VR+FQ ++ +AK++GFGR+FRSP LFED+
Sbjct  53   SKLTAAGRQVIRKQITRMLRLTERDEKDVRDFQNIHQQAKQKGFGRLFRSPSLFEDI  109



>ref|XP_010256879.1| PREDICTED: uncharacterized protein LOC104597156 [Nelumbo nucifera]
Length=122

 Score = 89.0 bits (219),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 51/65 (78%), Gaps = 6/65 (9%)
 Frame = +2

Query  107  VVELPLGDASSTFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSDDHHCADHEISVTV  286
            ++ LPLG++ STF+LEKAVCSHGLFMMAPN WDP TKT +RPLRLSD+        ++ V
Sbjct  29   LLTLPLGESVSTFSLEKAVCSHGLFMMAPNQWDPSTKTFQRPLRLSDE------TTAILV  82

Query  287  RVSHP  301
            R+SHP
Sbjct  83   RISHP  87



>ref|XP_005646705.1| DNA glycosylase [Coccomyxa subellipsoidea C-169]
 gb|EIE22161.1| DNA glycosylase [Coccomyxa subellipsoidea C-169]
Length=406

 Score = 87.8 bits (216),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 55/144 (38%), Positives = 78/144 (54%), Gaps = 18/144 (13%)
 Frame = +2

Query  107  VVELPLGDASSTFNLEKAVCSHGLFMMAPNHWDPLTKTL-------ERPLRLSDDHHCAD  265
            +V++P   A + F+L  AV S+G FM+APN W     ++       ERPLR +DD     
Sbjct  13   IVKVP---APTGFDLATAVSSYGFFMLAPNRWVKAVSSVPGSQPAFERPLRTADD-----  64

Query  266  HEISVTVRVSHPS-DSPQSLRLHVFGTDCLSAQQHQSLMAQVRRMLRLSEEEEKMVREFQ  442
               +V VR++    +    L + V  TD LS    Q L +QV RML L+  + ++V   Q
Sbjct  65   --TAVPVRITQSILEDGSELSVAVETTDPLSTSDEQHLQSQVVRMLSLAPADVEVVAALQ  122

Query  443  EMYGEAKERGFGRVFRSPILFEDM  514
             M+ EAK   FG +FRSP L+EDM
Sbjct  123  RMHAEAKAASFGHMFRSPTLWEDM  146



>ref|WP_014437765.1| hypothetical protein [Phycisphaera mikurensis]
 dbj|BAM04552.1| hypothetical protein PSMK_23930 [Phycisphaera mikurensis NBRC 
102666]
Length=327

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 66/124 (53%), Gaps = 9/124 (7%)
 Frame = +2

Query  143  FNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSDDHHCADHEISVTVRVSHPSDSPQSL  322
            F+L + VCS+G F++APN WDP   TL RPLRL D          V V +S  + + + L
Sbjct  12   FDLARTVCSYGYFLLAPNFWDPAAATLSRPLRLPDGS-------PVDVVISQATSADRRL  64

Query  323  RLHVFGTDCLSAQQHQSLMAQVRRMLRLSEEEEKMVREFQEMYGEAKERGFGRVFRSPIL  502
            ++ +  T  +       ++ QV RMLRL E++    R  + +         GR+FRSP L
Sbjct  65   KVALEAT--VRGSARALVLGQVARMLRLDEDDRPWRRTIRRVDPALARVAIGRMFRSPTL  122

Query  503  FEDM  514
            FED+
Sbjct  123  FEDL  126



>gb|KCW84783.1| hypothetical protein EUGRSUZ_B01586 [Eucalyptus grandis]
Length=268

 Score = 82.8 bits (203),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 57/137 (42%), Positives = 68/137 (50%), Gaps = 32/137 (23%)
 Frame = +2

Query  185  MAPNHWDPLTKTLERPLRLSDDHHCADHEISVTVRVSHPSDSPQSLRLHVFGTDCLSAQQ  364
            MAPN W P TKTL RPLRL+D          V      P  S   L L V     LS+Q 
Sbjct  1    MAPNSWIPSTKTLRRPLRLADFSS-----SVVVSISQPPGPSSTVLLLRVHRVPRLSSQD  55

Query  365  HQS---------------------------LMAQVRRMLRLSEEEEKMVREFQEMYGEAK  463
             Q+                           L  QV RMLRLSE +E+ V+EF +++ EAK
Sbjct  56   QQAIFVLSLSHSVCAQSKYKLVTEKHGNILLQEQVIRMLRLSERDERNVKEFHKVHPEAK  115

Query  464  ERGFGRVFRSPILFEDM  514
            +RGFGRVFRSP LFED+
Sbjct  116  DRGFGRVFRSPSLFEDV  132



>emb|CBN77855.1| conserved unknown protein [Ectocarpus siliculosus]
Length=366

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 49/156 (31%), Positives = 77/156 (49%), Gaps = 27/156 (17%)
 Frame = +2

Query  101  MVVVELPLGDASSTFNLEKAVCSHGLFMMAPNHWDPL--------TKTLERPLR----LS  244
            +V+VE+P G     F+  +A CS+G F++ PN W           + T  RPLR    L 
Sbjct  38   VVMVEVPQG-----FSFTQAACSYGYFVVPPNLWQRCESGPGLSDSGTFNRPLRFGERLV  92

Query  245  DDHHCADHEISVTVRVSHPSDS------PQSLRLHVFGTDCLSAQQHQSLMAQVRRMLRL  406
            +   C    +    +VS+P           +LR+ V   + L+    + + AQV RM + 
Sbjct  93   NTARCTISLVPACGQVSNPKQGSGGDQQAMALRVDVVSAEALTESDQEDIRAQVVRMFQT  152

Query  407  SEEEEKMVREFQEMYGEAKERGFGRVFRSPILFEDM  514
            + +     R    ++ EAK+RG+GR+FRSP +FEDM
Sbjct  153  TIDLAPWFR----LHPEAKKRGYGRLFRSPTVFEDM  184



>gb|KJB11530.1| hypothetical protein B456_001G263800, partial [Gossypium raimondii]
Length=262

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 64/134 (48%), Gaps = 32/134 (24%)
 Frame = +2

Query  110  VELPLGDASSTFNLEKAVCSHGLFMMAPNHWDPLTKTLERPLRLSDDHHCADHEISVTVR  289
            ++L L + S  F++EKAVC+H                              D   SV V 
Sbjct  3    LKLALWEWSGRFDMEKAVCNH------------------------------DSSRSVPVT  32

Query  290  VSHPSDSPQSLRLHVFGTDCLSAQQHQSLMAQVRRMLRLSEEEEKMVREFQEMYGEAKER  469
            +SHP + P  L + V  +  +S+     ++ Q+ R LR+S ++E+ V EFQ  +  A+E 
Sbjct  33   ISHPLNHP-FLLIQVHHSS-ISSADEAVILEQIGRTLRISNKDERDVMEFQGRHSSAREN  90

Query  470  GFGRVFRSPILFED  511
            G GR+FRSP  F D
Sbjct  91   GLGRIFRSPSFFGD  104



>gb|KFG61636.1| hypothetical protein TGRUB_270750 [Toxoplasma gondii RUB]
Length=1011

 Score = 55.1 bits (131),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 50/102 (49%), Gaps = 7/102 (7%)
 Frame = +2

Query  209  LTKTLERPLRLSDDHHCADHEISVTVRVSHPSDSPQSLRLHVFGTDCLSAQQHQSLMAQV  388
            L  +  RPLR        +    V++R+         LRL +     L  +    ++ QV
Sbjct  501  LAGSFSRPLRFGP---LMEKSCEVSLRMQEAGK----LRLEIAAGALLGPEDEAEILHQV  553

Query  389  RRMLRLSEEEEKMVREFQEMYGEAKERGFGRVFRSPILFEDM  514
            RRM RL  E+   V+ F +M+  A  RGFG +FRSP L+ED+
Sbjct  554  RRMCRLQVEDWAHVQAFWKMHERAASRGFGLLFRSPTLWEDI  595



>gb|ESS36255.1| hypothetical protein TGVEG_270750 [Toxoplasma gondii VEG]
Length=1011

 Score = 55.1 bits (131),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 50/102 (49%), Gaps = 7/102 (7%)
 Frame = +2

Query  209  LTKTLERPLRLSDDHHCADHEISVTVRVSHPSDSPQSLRLHVFGTDCLSAQQHQSLMAQV  388
            L  +  RPLR        +    V++R+         LRL +     L  +    ++ QV
Sbjct  501  LAGSFSRPLRFGP---LMEKSCEVSLRMQEAGK----LRLEIAAGALLGPEDEAEILHQV  553

Query  389  RRMLRLSEEEEKMVREFQEMYGEAKERGFGRVFRSPILFEDM  514
            RRM RL  E+   V+ F +M+  A  RGFG +FRSP L+ED+
Sbjct  554  RRMCRLQVEDWAHVQAFWKMHERAASRGFGLLFRSPTLWEDI  595



>gb|EPR64782.1| hypothetical protein TGGT1_270750 [Toxoplasma gondii GT1]
 gb|KFG43647.1| hypothetical protein TGDOM2_270750 [Toxoplasma gondii GAB2-2007-GAL-DOM2]
Length=1011

 Score = 55.1 bits (131),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 50/102 (49%), Gaps = 7/102 (7%)
 Frame = +2

Query  209  LTKTLERPLRLSDDHHCADHEISVTVRVSHPSDSPQSLRLHVFGTDCLSAQQHQSLMAQV  388
            L  +  RPLR        +    V++R+         LRL +     L  +    ++ QV
Sbjct  501  LAGSFSRPLRFGP---LMEKSCEVSLRMQEAGK----LRLEIAAGALLGPEDEAEILHQV  553

Query  389  RRMLRLSEEEEKMVREFQEMYGEAKERGFGRVFRSPILFEDM  514
            RRM RL  E+   V+ F +M+  A  RGFG +FRSP L+ED+
Sbjct  554  RRMCRLQVEDWAHVQAFWKMHERAASRGFGLLFRSPTLWEDI  595



>gb|KFG54358.1| hypothetical protein TGFOU_270750, partial [Toxoplasma gondii 
FOU]
Length=854

 Score = 55.1 bits (131),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 50/102 (49%), Gaps = 7/102 (7%)
 Frame = +2

Query  209  LTKTLERPLRLSDDHHCADHEISVTVRVSHPSDSPQSLRLHVFGTDCLSAQQHQSLMAQV  388
            L  +  RPLR        +    V++R+         LRL +     L  +    ++ QV
Sbjct  344  LAGSFSRPLRFGP---LMEKSCEVSLRMQEAGK----LRLEIAAGALLGPEDEAEILHQV  396

Query  389  RRMLRLSEEEEKMVREFQEMYGEAKERGFGRVFRSPILFEDM  514
            RRM RL  E+   V+ F +M+  A  RGFG +FRSP L+ED+
Sbjct  397  RRMCRLQVEDWAHVQAFWKMHERAASRGFGLLFRSPTLWEDI  438



>gb|KFG52135.1| hypothetical protein TGP89_270750, partial [Toxoplasma gondii 
p89]
Length=868

 Score = 55.1 bits (131),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 50/102 (49%), Gaps = 7/102 (7%)
 Frame = +2

Query  209  LTKTLERPLRLSDDHHCADHEISVTVRVSHPSDSPQSLRLHVFGTDCLSAQQHQSLMAQV  388
            L  +  RPLR        +    V++R+         LRL +     L  +    ++ QV
Sbjct  358  LAGSFSRPLRFGP---LMEKSCEVSLRMQEAGK----LRLEIAAGALLGPEDEAEILHQV  410

Query  389  RRMLRLSEEEEKMVREFQEMYGEAKERGFGRVFRSPILFEDM  514
            RRM RL  E+   V+ F +M+  A  RGFG +FRSP L+ED+
Sbjct  411  RRMCRLQVEDWAHVQAFWKMHERAASRGFGLLFRSPTLWEDI  452



>gb|KFH16636.1| hypothetical protein TGMAS_270750 [Toxoplasma gondii MAS]
Length=742

 Score = 55.1 bits (131),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 50/102 (49%), Gaps = 7/102 (7%)
 Frame = +2

Query  209  LTKTLERPLRLSDDHHCADHEISVTVRVSHPSDSPQSLRLHVFGTDCLSAQQHQSLMAQV  388
            L  +  RPLR        +    V++R+         LRL +     L  +    ++ QV
Sbjct  232  LAGSFSRPLRFGP---LMEKSCEVSLRMQEAG----KLRLEIAAGALLGPEDEAEILHQV  284

Query  389  RRMLRLSEEEEKMVREFQEMYGEAKERGFGRVFRSPILFEDM  514
            RRM RL  E+   V+ F +M+  A  RGFG +FRSP L+ED+
Sbjct  285  RRMCRLQVEDWAHVQAFWKMHERAASRGFGLLFRSPTLWEDI  326



>ref|XP_002365741.1| hypothetical protein TGME49_070750 [Toxoplasma gondii ME49]
 gb|EPT28444.1| hypothetical protein TGME49_270750 [Toxoplasma gondii ME49]
Length=1011

 Score = 55.1 bits (131),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 50/102 (49%), Gaps = 7/102 (7%)
 Frame = +2

Query  209  LTKTLERPLRLSDDHHCADHEISVTVRVSHPSDSPQSLRLHVFGTDCLSAQQHQSLMAQV  388
            L  +  RPLR        +    V++R+         LRL +     L  +    ++ QV
Sbjct  501  LAGSFSRPLRFGP---LMEKSCEVSLRMQEAGK----LRLEIAAGALLQPEDEAEILHQV  553

Query  389  RRMLRLSEEEEKMVREFQEMYGEAKERGFGRVFRSPILFEDM  514
            RRM RL  E+   V+ F +M+  A  RGFG +FRSP L+ED+
Sbjct  554  RRMCRLQVEDWAHVQAFWKMHERAASRGFGLLFRSPTLWEDI  595



>ref|XP_005842500.1| hypothetical protein GUITHDRAFT_160483 [Guillardia theta CCMP2712]
 gb|EKX55520.1| hypothetical protein GUITHDRAFT_160483 [Guillardia theta CCMP2712]
Length=322

 Score = 54.3 bits (129),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 38/123 (31%), Positives = 61/123 (50%), Gaps = 16/123 (13%)
 Frame = +2

Query  182  MMAPNHWDPLTKTLE------------RPLRLSDDHHCADHEISVTVRVSHPSDSPQSLR  325
            M+APN WDP    LE            RPL +          + +    S  +D   S R
Sbjct  1    MLAPNTWDPHQTLLEGPWGRPLPGVFSRPLSIGGSKTV---HVKLCFSASKWTDEDSSER  57

Query  326  -LHVFGTDCLSAQQHQSLMAQVRRMLRLSEEEEKMVREFQEMYGEAKERGFGRVFRSPIL  502
             L  F  + L  ++   ++ QV RMLR+S E+ +  +EF+ ++ +A++  + R+FRSP +
Sbjct  58   ELIAFLEESLGEEEVGEVVRQVTRMLRISPEDNRREQEFRSLFPQAEQDHWFRLFRSPSM  117

Query  503  FED  511
            FED
Sbjct  118  FED  120



>gb|KFH05928.1| hypothetical protein TGVAND_270750 [Toxoplasma gondii VAND]
Length=1011

 Score = 54.7 bits (130),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 50/102 (49%), Gaps = 7/102 (7%)
 Frame = +2

Query  209  LTKTLERPLRLSDDHHCADHEISVTVRVSHPSDSPQSLRLHVFGTDCLSAQQHQSLMAQV  388
            L  +  RPLR        +    V++R+         LRL +     L  +    ++ QV
Sbjct  501  LAGSFSRPLRFGP---LMEKSCEVSLRMQEAGK----LRLEIAAGALLEPEDEAEILHQV  553

Query  389  RRMLRLSEEEEKMVREFQEMYGEAKERGFGRVFRSPILFEDM  514
            RRM RL  E+   V+ F +M+  A  RGFG +FRSP L+ED+
Sbjct  554  RRMCRLQVEDWAHVQAFWKMHERAASRGFGLLFRSPTLWEDI  595



>gb|KJB33231.1| hypothetical protein B456_006G003300 [Gossypium raimondii]
Length=259

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  395  MLRLSEEEEKMVREFQEMYGEAKERGFGRVFRSPILFED  511
            MLR+S+++E+ V EFQEM+  A+E G GR+FRSP  FED
Sbjct  1    MLRISKKDERDVTEFQEMHSSARENGLGRIFRSPSFFED  39



>gb|KIY98719.1| hypothetical protein MNEG_9241 [Monoraphidium neglectum]
Length=615

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 37/55 (67%), Gaps = 0/55 (0%)
 Frame = +2

Query  350  LSAQQHQSLMAQVRRMLRLSEEEEKMVREFQEMYGEAKERGFGRVFRSPILFEDM  514
            LS +  +++  QV RMLRLS  +   V E+Q +  EA + GFGR+FRSP L+ED+
Sbjct  259  LSPEDWRAIEQQVTRMLRLSPGDALAVAEYQALDPEAADAGFGRLFRSPDLWEDV  313



>ref|XP_008882441.1| hypothetical protein HHA_270750 [Hammondia hammondi]
 gb|KEP66818.1| hypothetical protein HHA_270750 [Hammondia hammondi]
Length=1040

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/104 (34%), Positives = 51/104 (49%), Gaps = 11/104 (11%)
 Frame = +2

Query  209  LTKTLERPLRLSD--DHHCADHEISVTVRVSHPSDSPQSLRLHVFGTDCLSAQQHQSLMA  382
            L  T  RPLR     +  C   E+S+ ++ +        LRL +     L+      ++ 
Sbjct  531  LEGTFSRPLRFGPLMEKCC---EVSLRMQEAG------KLRLEIAAGALLAPADEAEILH  581

Query  383  QVRRMLRLSEEEEKMVREFQEMYGEAKERGFGRVFRSPILFEDM  514
            QVRRM RL  E+   V  F   + +A  RGFG +FRSP L+ED+
Sbjct  582  QVRRMCRLRVEDWAHVEAFWRKHEKAASRGFGLLFRSPTLWEDI  625



>gb|KFK33320.1| hypothetical protein AALP_AA6G359700 [Arabis alpina]
Length=388

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +2

Query  395  MLRLSEEEEKMVREFQEMYGEAKERGFGRVFRSPILFEDM  514
            MLR + E+++ V +F +++  AKE GFGR+FRSP LFEDM
Sbjct  1    MLRFTTEDQRDVADFHQLHDSAKESGFGRIFRSPSLFEDM  40



>ref|XP_003883854.1| conserved hypothetical protein [Neospora caninum Liverpool]
 emb|CBZ53822.1| conserved hypothetical protein [Neospora caninum Liverpool]
Length=1064

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 54/103 (52%), Gaps = 9/103 (9%)
 Frame = +2

Query  209  LTKTLERPLRLSDD-HHCADHEISVTVRVSHPSDSPQSLRLHVFGTDCLSAQQHQSLMAQ  385
            L  +  RPLR   +   C   E+S++++          LRL +      S  + + ++ Q
Sbjct  562  LDGSFSRPLRFGPEMAKCC--EVSLSMQAVG------KLRLDISAGAPFSRAEEEEIVHQ  613

Query  386  VRRMLRLSEEEEKMVREFQEMYGEAKERGFGRVFRSPILFEDM  514
            V+RM RL  E+ + V+ F + +  A  RGFG +FRSP L+ED+
Sbjct  614  VKRMCRLRVEDWEHVQAFWKKHEAAAARGFGLLFRSPTLWEDI  656



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 554939364720