BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002A17

Length=226
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_007027053.1|  Heat shock cognate protein 70-1 isoform 2          114   2e-28   
gb|KHG30764.1|  Heat shock cognate 70 kDa                               107   3e-28   Gossypium arboreum [tree cotton]
gb|EAY81902.1|  hypothetical protein OsI_37074                          107   3e-28   Oryza sativa Indica Group [Indian rice]
gb|KHG18124.1|  Heat shock cognate 70 kDa                               107   3e-28   Gossypium arboreum [tree cotton]
emb|CAA78036.1|  70-kD heat shock protein                               107   4e-28   Solanum tuberosum [potatoes]
emb|CAA78037.1|  70-Kd heat shock protein                               107   4e-28   Solanum tuberosum [potatoes]
gb|AAA32820.1|  heat shock protein HSP70-2                              106   2e-27   Arabidopsis thaliana [mouse-ear cress]
gb|AAC84134.1|  heat shock protein                                      107   2e-27   Cichorium intybus [radicchio]
ref|XP_010041882.1|  PREDICTED: heat shock 70 kDa protein cognate...    105   2e-27   Eucalyptus grandis [rose gum]
ref|XP_010456364.1|  PREDICTED: probable mediator of RNA polymera...    106   2e-27   
ref|XP_010423854.1|  PREDICTED: probable mediator of RNA polymera...    108   3e-27   Camelina sativa [gold-of-pleasure]
gb|EYU41710.1|  hypothetical protein MIMGU_mgv1a022248mg                111   3e-27   Erythranthe guttata [common monkey flower]
ref|XP_003554320.2|  PREDICTED: probable mediator of RNA polymera...    113   4e-27   
gb|KHG09207.1|  Heat shock 70 kDa 1 -like protein                       111   5e-27   Gossypium arboreum [tree cotton]
gb|ADB85325.1|  putative heat shock cognate                             104   7e-27   Phyllostachys edulis [kikko-chiku]
gb|KDO67651.1|  hypothetical protein CISIN_1g0212721mg                  105   7e-27   Citrus sinensis [apfelsine]
gb|AAA32819.1|  heat shock protein HSP70-1                              105   8e-27   Arabidopsis thaliana [mouse-ear cress]
gb|EAY89449.1|  hypothetical protein OsI_10981                          103   8e-27   Oryza sativa Indica Group [Indian rice]
emb|CAA54420.1|  heat shock cognate 70-2                                104   9e-27   Arabidopsis thaliana [mouse-ear cress]
emb|CDY02235.1|  BnaA03g39320D                                          107   1e-26   
gb|KDO72893.1|  hypothetical protein CISIN_1g036208mg                   108   1e-26   Citrus sinensis [apfelsine]
gb|KJB16980.1|  hypothetical protein B456_002G258500                    111   1e-26   Gossypium raimondii
emb|CDP00073.1|  unnamed protein product                                111   1e-26   Coffea canephora [robusta coffee]
gb|KJB36734.1|  hypothetical protein B456_006G174000                    111   1e-26   Gossypium raimondii
ref|XP_007027052.1|  Heat shock cognate protein 70-1 isoform 1          111   1e-26   
ref|XP_004493886.1|  PREDICTED: probable mediator of RNA polymera...    111   1e-26   Cicer arietinum [garbanzo]
ref|XP_008223372.1|  PREDICTED: probable mediator of RNA polymera...    110   2e-26   
ref|XP_009353696.1|  PREDICTED: probable mediator of RNA polymera...    110   2e-26   
gb|ABG22608.1|  Heat shock cognate 70 kDa protein, putative, expr...    111   2e-26   Oryza sativa Japonica Group [Japonica rice]
emb|CDX89754.1|  BnaC03g46680D                                          107   2e-26   
emb|CDY53148.1|  BnaAnng12070D                                          107   2e-26   Brassica napus [oilseed rape]
gb|ACJ11740.1|  heat shock protein 70                                   111   2e-26   Gossypium hirsutum [American cotton]
ref|XP_010423867.1|  PREDICTED: heat shock 70 kDa protein 18-like       103   2e-26   Camelina sativa [gold-of-pleasure]
ref|XP_009786102.1|  PREDICTED: heat shock cognate 70 kDa protein 2     111   2e-26   Nicotiana sylvestris
ref|XP_009597695.1|  PREDICTED: heat shock cognate 70 kDa protein 2     111   2e-26   Nicotiana tomentosiformis
ref|NP_001068540.1|  Os11g0703900                                       111   2e-26   
ref|XP_006663128.1|  PREDICTED: heat shock cognate 70 kDa protein...    111   2e-26   Oryza brachyantha
ref|XP_004246402.1|  PREDICTED: heat shock cognate 70 kDa protein...    111   2e-26   Solanum lycopersicum
gb|KHG00348.1|  Heat shock 70 kDa 4 -like protein                       110   2e-26   Gossypium arboreum [tree cotton]
ref|XP_003521330.1|  PREDICTED: probable mediator of RNA polymera...    111   2e-26   Glycine max [soybeans]
ref|XP_004249574.1|  PREDICTED: heat shock cognate 70 kDa protein 2     111   2e-26   
gb|KJB46580.1|  hypothetical protein B456_007G375600                    111   2e-26   Gossypium raimondii
gb|ACJ11741.1|  heat shock protein 70                                   111   2e-26   Gossypium hirsutum [American cotton]
ref|XP_006436010.1|  hypothetical protein CICLE_v10030928mg             111   2e-26   Citrus clementina [clementine]
ref|XP_009622753.1|  PREDICTED: heat shock cognate 70 kDa protein...    111   2e-26   Nicotiana tomentosiformis
ref|XP_004493999.1|  PREDICTED: heat shock cognate 70 kDa protein...    111   2e-26   
ref|NP_001234491.1|  heat shock cognate 70 kDa protein 1                110   2e-26   
gb|KJB16979.1|  hypothetical protein B456_002G258500                    110   2e-26   Gossypium raimondii
ref|XP_009620324.1|  PREDICTED: heat shock cognate 70 kDa protein...    110   2e-26   Nicotiana tomentosiformis
gb|AAR17080.1|  heat shock protein 70-3                                 110   2e-26   Nicotiana tabacum [American tobacco]
emb|CAA47948.2|  heat shock protein 70                                  110   2e-26   Oryza sativa Indica Group [Indian rice]
ref|XP_009785159.1|  PREDICTED: heat shock cognate 70 kDa protein...    110   2e-26   Nicotiana sylvestris
ref|XP_006349514.1|  PREDICTED: heat shock cognate 70 kDa protein...    110   2e-26   Solanum tuberosum [potatoes]
ref|XP_006350760.1|  PREDICTED: heat shock cognate 70 kDa protein...    110   2e-26   Solanum tuberosum [potatoes]
gb|ADD71975.1|  heat shock protein 70                                   110   2e-26   Rhododendron calophytum
gb|AFU34347.1|  70-kDa heat shock protein                               110   2e-26   Ipomoea batatas [batate]
ref|XP_009777579.1|  PREDICTED: heat shock cognate 70 kDa protein...    110   2e-26   Nicotiana sylvestris
gb|AAS57913.1|  70 kDa heat shock cognate protein 2                     110   2e-26   Vigna radiata [mung bean]
gb|AAP04522.1|  heat shock protein 70                                   110   2e-26   Nicotiana tabacum [American tobacco]
ref|XP_006348998.1|  PREDICTED: heat shock cognate 70 kDa protein...    110   2e-26   Solanum tuberosum [potatoes]
sp|P27322.1|HSP72_SOLLC  RecName: Full=Heat shock cognate 70 kDa ...    110   2e-26   Solanum lycopersicum
gb|AAN86276.1|  cell-autonomous heat shock cognate protein 70           110   2e-26   Cucurbita maxima [Boston marrow]
gb|EAY81899.1|  hypothetical protein OsI_37065                          108   2e-26   Oryza sativa Indica Group [Indian rice]
ref|XP_006341042.1|  PREDICTED: heat shock cognate 70 kDa protein...    110   3e-26   Solanum tuberosum [potatoes]
ref|XP_004250958.1|  PREDICTED: heat shock cognate 70 kDa protein...    110   3e-26   Solanum lycopersicum
emb|CDY36723.1|  BnaC02g31440D                                          105   3e-26   Brassica napus [oilseed rape]
ref|XP_002891955.1|  early-responsive to dehydration 2                  110   3e-26   
gb|EYU26579.1|  hypothetical protein MIMGU_mgv1a002667mg                110   3e-26   Erythranthe guttata [common monkey flower]
sp|P09189.1|HSP7C_PETHY  RecName: Full=Heat shock cognate 70 kDa ...    110   3e-26   Petunia x hybrida [garden petunia]
ref|XP_002532297.1|  heat shock protein, putative                       110   3e-26   Ricinus communis
ref|XP_010558317.1|  PREDICTED: probable mediator of RNA polymera...    110   3e-26   Tarenaya hassleriana [spider flower]
gb|ABA95501.2|  Heat shock cognate 70 kDa protein, putative, expr...    110   3e-26   Oryza sativa Japonica Group [Japonica rice]
emb|CCA29121.1|  heat shock protein 70 isoform 2                        110   3e-26   Solanum lycopersicum
ref|XP_010253202.1|  PREDICTED: heat shock cognate 70 kDa protein 2     110   3e-26   Nelumbo nucifera [Indian lotus]
ref|XP_011094842.1|  PREDICTED: heat shock cognate 70 kDa protein 2     110   3e-26   Sesamum indicum [beniseed]
gb|KJB55903.1|  hypothetical protein B456_009G100400                    110   3e-26   Gossypium raimondii
ref|XP_009604213.1|  PREDICTED: heat shock cognate 70 kDa protein       110   3e-26   Nicotiana tomentosiformis
ref|XP_010253221.1|  PREDICTED: heat shock cognate 70 kDa protein...    110   3e-26   Nelumbo nucifera [Indian lotus]
gb|ABP35942.1|  heat shock protein 70                                   110   3e-26   Cyclamen persicum
ref|XP_009784009.1|  PREDICTED: heat shock cognate 70 kDa protein       110   3e-26   Nicotiana sylvestris
ref|XP_011077460.1|  PREDICTED: heat shock cognate 70 kDa protein...    110   3e-26   Sesamum indicum [beniseed]
ref|XP_010553033.1|  PREDICTED: probable mediator of RNA polymera...    110   3e-26   Tarenaya hassleriana [spider flower]
ref|NP_176036.1|  heat shock protein ERD2                               110   3e-26   Arabidopsis thaliana [mouse-ear cress]
gb|KFK38606.1|  hypothetical protein AALP_AA3G135800                    108   3e-26   Arabis alpina [alpine rockcress]
ref|XP_009112006.1|  PREDICTED: probable mediator of RNA polymera...    109   3e-26   Brassica rapa
emb|CCD74508.1|  early-responsive to dehydration 2                      110   3e-26   Arabidopsis halleri subsp. halleri
ref|NP_001119156.1|  heat shock cognate protein 70-1                    109   4e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004492118.1|  PREDICTED: heat shock cognate 70 kDa protein...    110   4e-26   Cicer arietinum [garbanzo]
ref|XP_007162654.1|  hypothetical protein PHAVU_001G169000g             110   4e-26   Phaseolus vulgaris [French bean]
emb|CCA29120.1|  heat shock protein 70 isoform 1                        110   4e-26   Solanum lycopersicum
emb|CDY16175.1|  BnaA09g29090D                                          106   5e-26   Brassica napus [oilseed rape]
ref|XP_010931247.1|  PREDICTED: heat shock cognate 70 kDa protein...    109   7e-26   Elaeis guineensis
ref|XP_009414319.1|  PREDICTED: heat shock cognate 70 kDa protein...    109   8e-26   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006664117.1|  PREDICTED: heat shock cognate 70 kDa protein...    109   8e-26   Oryza brachyantha
ref|XP_006297174.1|  hypothetical protein CARUB_v10013178mg             109   8e-26   Capsella rubella
ref|XP_007139240.1|  hypothetical protein PHAVU_008G013000g             109   8e-26   Phaseolus vulgaris [French bean]
gb|AFV46216.1|  hypothetical protein                                    105   8e-26   Scutellaria baicalensis [Baikal skullcap]
gb|KHN27222.1|  Heat shock cognate 70 kDa protein 2                     109   9e-26   Glycine soja [wild soybean]
ref|XP_008776699.1|  PREDICTED: probable mediator of RNA polymera...    109   9e-26   Phoenix dactylifera
ref|NP_187555.1|  heat shock protein 70-3                               109   9e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007132076.1|  hypothetical protein PHAVU_011G065000g             109   9e-26   Phaseolus vulgaris [French bean]
emb|CAA83548.1|  PsHSC71.0                                              109   9e-26   Pisum sativum [garden pea]
gb|ACD93209.1|  heat shock protein 70                                   109   9e-26   Camellia sinensis [black tea]
ref|XP_006407676.1|  hypothetical protein EUTSA_v10020258mg             109   9e-26   Eutrema salsugineum [saltwater cress]
dbj|BAJ34054.1|  unnamed protein product                                109   9e-26   Eutrema halophilum
ref|XP_010922357.1|  PREDICTED: heat shock cognate 70 kDa protein 2     109   9e-26   Elaeis guineensis
ref|XP_002884737.1|  heat shock cognate 70 kDa protein 3                109   9e-26   Arabidopsis lyrata subsp. lyrata
ref|XP_008784528.1|  PREDICTED: heat shock cognate 70 kDa protein...    109   9e-26   Phoenix dactylifera
gb|AFA51946.1|  heat shock protein 70                                   109   9e-26   Paeonia suffruticosa [moutan peony]
gb|AEK70336.1|  heat shock protein 70                                   109   9e-26   Paeonia lactiflora [common garden peony]
ref|XP_008371640.1|  PREDICTED: uncharacterized protein LOC103435023    103   1e-25   Malus domestica [apple tree]
ref|XP_009419750.1|  PREDICTED: heat shock cognate 70 kDa protein...    109   1e-25   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABD32895.1|  Heat shock protein Hsp70                                109   1e-25   Medicago truncatula
gb|ACB70177.1|  70 kDa heat shock protein                               109   1e-25   Capparis spinosa [caper]
emb|CDY50531.1|  BnaA01g30490D                                          109   1e-25   Brassica napus [oilseed rape]
emb|CDY31804.1|  BnaC01g27600D                                          107   1e-25   Brassica napus [oilseed rape]
gb|KCW74480.1|  hypothetical protein EUGRSUZ_E03189                     108   1e-25   Eucalyptus grandis [rose gum]
ref|XP_003625487.1|  Heat shock protein                                 109   1e-25   
gb|AIZ68155.1|  heat shock protein 70                                   109   1e-25   Ornithogalum longebracteatum [sea-onion]
ref|XP_006290203.1|  hypothetical protein CARUB_v10003889mg             109   1e-25   Capsella rubella
gb|AAS57912.1|  70 kDa heat shock cognate protein 1                     108   1e-25   Vigna radiata [mung bean]
gb|EMT11425.1|  Heat shock cognate 70 kDa protein 1                     108   1e-25   
ref|XP_003539680.2|  PREDICTED: heat shock cognate 70 kDa protein 2     108   1e-25   
gb|KCW50226.1|  hypothetical protein EUGRSUZ_J00025                     109   1e-25   Eucalyptus grandis [rose gum]
ref|XP_010464591.1|  PREDICTED: heat shock 70 kDa protein 3             108   1e-25   Camelina sativa [gold-of-pleasure]
ref|XP_003621869.1|  Heat shock protein                                 108   1e-25   Medicago truncatula
gb|AAN86274.1|  non-cell-autonomous heat shock cognate protein 70       108   1e-25   Cucurbita maxima [Boston marrow]
ref|XP_002873055.1|  predicted protein                                  108   1e-25   Arabidopsis lyrata subsp. lyrata
ref|XP_010473075.1|  PREDICTED: heat shock 70 kDa protein 3-like        108   1e-25   Camelina sativa [gold-of-pleasure]
gb|KCW50227.1|  hypothetical protein EUGRSUZ_J00025                     109   1e-25   Eucalyptus grandis [rose gum]
ref|XP_010253827.1|  PREDICTED: heat shock cognate 70 kDa protein...    108   1e-25   Nelumbo nucifera [Indian lotus]
gb|KDP44975.1|  hypothetical protein JCGZ_01475                         108   1e-25   Jatropha curcas
ref|XP_010095013.1|  Heat shock 70 kDa protein 4                        108   1e-25   Morus notabilis
gb|AGZ15406.1|  heat shock cognate 70 kDa protein                       108   1e-25   Phaseolus vulgaris [French bean]
gb|EYU19900.1|  hypothetical protein MIMGU_mgv1a002641mg                108   1e-25   Erythranthe guttata [common monkey flower]
ref|XP_004307527.1|  PREDICTED: heat shock cognate 70 kDa protein 2     108   1e-25   Fragaria vesca subsp. vesca
ref|XP_009409520.1|  PREDICTED: heat shock cognate 70 kDa protein 2     108   1e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006424799.1|  hypothetical protein CICLE_v10027981mg             108   1e-25   Citrus clementina [clementine]
ref|XP_004287404.1|  PREDICTED: heat shock cognate 70 kDa protein...    108   1e-25   Fragaria vesca subsp. vesca
ref|XP_009120551.1|  PREDICTED: probable mediator of RNA polymera...    108   1e-25   Brassica rapa
ref|XP_007009362.1|  Heat shock cognate protein 70-1                    108   1e-25   
ref|XP_008802761.1|  PREDICTED: heat shock cognate 70 kDa protein...    108   1e-25   Phoenix dactylifera
gb|KDP35613.1|  hypothetical protein JCGZ_09051                         108   1e-25   Jatropha curcas
gb|AIU34470.1|  putative heat shock protein                             108   1e-25   Taraxacum brevicorniculatum
ref|XP_006429028.1|  hypothetical protein CICLE_v10011260mg             108   1e-25   Citrus clementina [clementine]
ref|XP_008223380.1|  PREDICTED: heat shock cognate 70 kDa protein...    108   1e-25   Prunus mume [ume]
ref|XP_002311161.1|  heat shock protein 70                              108   1e-25   Populus trichocarpa [western balsam poplar]
ref|XP_009353695.1|  PREDICTED: heat shock cognate 70 kDa protein...    108   1e-25   Pyrus x bretschneideri [bai li]
ref|XP_003537997.1|  PREDICTED: heat shock cognate 70 kDa protein 2     108   1e-25   Glycine max [soybeans]
emb|CDY00784.1|  BnaC03g37680D                                          108   1e-25   
ref|XP_006407319.1|  hypothetical protein EUTSA_v10020257mg             108   1e-25   Eutrema salsugineum [saltwater cress]
gb|KEH30132.1|  heat shock cognate 70 kDa protein                       108   1e-25   Medicago truncatula
ref|WP_039310754.1|  molecular chaperone DnaK                           108   1e-25   Paenibacillus sp. IHB B 3415
gb|KHN21966.1|  Heat shock cognate 70 kDa protein                       108   1e-25   Glycine soja [wild soybean]
ref|XP_010486515.1|  PREDICTED: heat shock 70 kDa protein 3-like        108   1e-25   Camelina sativa [gold-of-pleasure]
ref|XP_008784530.1|  PREDICTED: heat shock cognate 70 kDa protein 2     108   1e-25   Phoenix dactylifera
ref|XP_006488297.1|  PREDICTED: heat shock cognate 70 kDa protein...    108   1e-25   Citrus sinensis [apfelsine]
ref|XP_002527736.1|  heat shock protein, putative                       108   1e-25   Ricinus communis
gb|AAA62445.1|  heat shock protein                                      108   1e-25   Spinacia oleracea
ref|XP_010534306.1|  PREDICTED: probable mediator of RNA polymera...    108   1e-25   Tarenaya hassleriana [spider flower]
ref|XP_008458892.1|  PREDICTED: heat shock cognate 70 kDa protein       108   1e-25   Cucumis melo [Oriental melon]
gb|KDP44987.1|  hypothetical protein JCGZ_01487                         108   1e-25   Jatropha curcas
gb|ACJ11745.1|  heat shock protein 70                                   108   1e-25   Gossypium hirsutum [American cotton]
gb|KEH30133.1|  heat shock cognate 70 kDa protein                       108   1e-25   Medicago truncatula
gb|KEH30131.1|  heat shock cognate 70 kDa protein                       108   1e-25   Medicago truncatula
ref|XP_006378715.1|  hypothetical protein POPTR_0010s21280g             108   1e-25   Populus trichocarpa [western balsam poplar]
ref|XP_007207204.1|  hypothetical protein PRUPE_ppa002646mg             108   1e-25   Prunus persica
gb|EPS68565.1|  hypothetical protein M569_06198                         108   1e-25   Genlisea aurea
ref|XP_011027172.1|  PREDICTED: probable mediator of RNA polymera...    108   1e-25   Populus euphratica
ref|XP_011027580.1|  PREDICTED: heat shock cognate 70 kDa protein...    108   1e-25   Populus euphratica
ref|XP_008812042.1|  PREDICTED: heat shock cognate 70 kDa protein...    108   1e-25   Phoenix dactylifera
ref|XP_011027180.1|  PREDICTED: heat shock cognate 70 kDa protein...    108   1e-25   Populus euphratica
ref|XP_002263599.1|  PREDICTED: heat shock cognate 70 kDa protein 2     108   1e-25   Vitis vinifera
gb|KFK38330.1|  hypothetical protein AALP_AA3G100200                    108   2e-25   Arabis alpina [alpine rockcress]
ref|XP_001783048.1|  predicted protein                                  108   2e-25   
gb|ACJ11742.1|  heat shock protein 70                                   108   2e-25   Gossypium hirsutum [American cotton]
ref|XP_007009369.1|  Heat shock protein 70                              108   2e-25   
gb|AIA22210.1|  heat shock protein 70                                   108   2e-25   Chrysanthemum indicum
ref|XP_006297173.1|  hypothetical protein CARUB_v10013177mg             108   2e-25   Capsella rubella
ref|XP_004156718.1|  PREDICTED: heat shock cognate 70 kDa protein...    108   2e-25   
ref|XP_011027182.1|  PREDICTED: heat shock cognate 70 kDa protein...    108   2e-25   Populus euphratica
ref|XP_010937646.1|  PREDICTED: heat shock cognate 70 kDa protein...    108   2e-25   Elaeis guineensis
gb|KDP44981.1|  hypothetical protein JCGZ_01481                         108   2e-25   Jatropha curcas
ref|XP_002312089.1|  heat shock protein 70 cognate                      108   2e-25   
ref|XP_006378714.1|  heat shock protein 70 cognate                      108   2e-25   Populus trichocarpa [western balsam poplar]
ref|XP_007144451.1|  hypothetical protein PHAVU_007G157200g             108   2e-25   Phaseolus vulgaris [French bean]
ref|XP_010558794.1|  PREDICTED: probable mediator of RNA polymera...    108   2e-25   Tarenaya hassleriana [spider flower]
ref|XP_010030977.1|  PREDICTED: heat shock cognate 70 kDa protein 2     108   2e-25   Eucalyptus grandis [rose gum]
ref|XP_010030975.1|  PREDICTED: heat shock cognate 70 kDa protein...    108   2e-25   Eucalyptus grandis [rose gum]
ref|XP_010486980.1|  PREDICTED: probable mediator of RNA polymera...    108   2e-25   Camelina sativa [gold-of-pleasure]
ref|XP_002884912.1|  hypothetical protein ARALYDRAFT_897465             108   2e-25   Arabidopsis lyrata subsp. lyrata
emb|CDX73815.1|  BnaA03g32320D                                          108   2e-25   
ref|XP_010106444.1|  Heat shock cognate 70 kDa protein                  108   2e-25   Morus notabilis
gb|AGR45355.1|  HSP70                                                   108   2e-25   Dendrobium officinale
ref|NP_195869.1|  heat shock protein 70                                 108   2e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009592776.1|  PREDICTED: heat shock cognate 70 kDa protein...    108   2e-25   Nicotiana tomentosiformis
ref|XP_007016460.1|  Heat shock cognate protein 70-1                    108   2e-25   
gb|KHN02428.1|  Heat shock cognate 70 kDa protein                       108   2e-25   Glycine soja [wild soybean]
ref|XP_006833219.1|  hypothetical protein AMTR_s00072p00181720          108   2e-25   Amborella trichopoda
ref|XP_002284063.1|  PREDICTED: heat shock cognate 70 kDa protein 2     108   2e-25   Vitis vinifera
ref|XP_008447699.1|  PREDICTED: heat shock cognate 70 kDa protein 2     108   2e-25   Cucumis melo [Oriental melon]
ref|XP_004302715.1|  PREDICTED: probable mediator of RNA polymera...    108   2e-25   Fragaria vesca subsp. vesca
gb|AAV97978.1|  heat shock protein hsp70                                108   2e-25   Saussurea medusa
gb|AAM48131.1|AF509336_1  heat shock protein 70                         108   2e-25   Saussurea medusa
gb|AAS57914.1|  70 kDa heat shock cognate protein 3                     108   2e-25   Vigna radiata [mung bean]
ref|XP_004142749.1|  PREDICTED: heat shock cognate 70 kDa protein...    108   2e-25   Cucumis sativus [cucumbers]
ref|XP_004505872.1|  PREDICTED: heat shock cognate 70 kDa protein...    108   2e-25   Cicer arietinum [garbanzo]
ref|XP_007220208.1|  hypothetical protein PRUPE_ppa002641mg             108   2e-25   Prunus persica
ref|XP_010465032.1|  PREDICTED: probable mediator of RNA polymera...    108   2e-25   Camelina sativa [gold-of-pleasure]
ref|XP_010456365.1|  PREDICTED: probable mediator of RNA polymera...    109   2e-25   Camelina sativa [gold-of-pleasure]
ref|XP_010499184.1|  PREDICTED: probable mediator of RNA polymera...    108   2e-25   Camelina sativa [gold-of-pleasure]
ref|XP_002312090.1|  heat shock protein 70 cognate                      108   2e-25   Populus trichocarpa [western balsam poplar]
ref|XP_010484430.1|  PREDICTED: probable mediator of RNA polymera...    108   2e-25   Camelina sativa [gold-of-pleasure]
dbj|BAP90755.1|  heat shock protein 70                                  108   2e-25   Chrysanthemum x morifolium [florist's chrysanthemum]
ref|XP_011028442.1|  PREDICTED: heat shock cognate 70 kDa protein...    108   2e-25   Populus euphratica
emb|CDP09040.1|  unnamed protein product                                108   2e-25   Coffea canephora [robusta coffee]
ref|XP_008370710.1|  PREDICTED: heat shock cognate 70 kDa protein 2     108   2e-25   
ref|XP_004142076.1|  PREDICTED: probable mediator of RNA polymera...    108   2e-25   
ref|XP_009135236.1|  PREDICTED: probable mediator of RNA polymera...    108   2e-25   Brassica rapa
ref|XP_004492128.1|  PREDICTED: heat shock cognate 70 kDa protein...    108   2e-25   
ref|NP_187864.1|  heat shock protein 70-4                               108   2e-25   Arabidopsis thaliana [mouse-ear cress]
gb|AII99890.1|  heat shock protein                                      108   2e-25   Cicer arietinum [garbanzo]
gb|KCW50224.1|  hypothetical protein EUGRSUZ_J00023                     108   2e-25   Eucalyptus grandis [rose gum]
ref|XP_011016414.1|  PREDICTED: heat shock cognate 70 kDa protein 2     108   2e-25   Populus euphratica
ref|XP_010669896.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    109   2e-25   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002316294.1|  heat shock protein 70                              108   2e-25   Populus trichocarpa [western balsam poplar]
ref|XP_009606077.1|  PREDICTED: heat shock cognate 70 kDa protein...    108   2e-25   Nicotiana tomentosiformis
ref|XP_007144450.1|  hypothetical protein PHAVU_007G157200g             108   2e-25   Phaseolus vulgaris [French bean]
ref|XP_009388623.1|  PREDICTED: heat shock cognate 70 kDa protein...    108   2e-25   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACJ85522.1|  unknown                                                 108   2e-25   Medicago truncatula
emb|CAA05547.1|  heat shock protein 70                                  108   2e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010555208.1|  PREDICTED: heat shock cognate 70 kDa protein...    108   2e-25   Tarenaya hassleriana [spider flower]
gb|AAN86275.1|  non-cell-autonomous heat shock cognate protein 70       108   2e-25   Cucurbita maxima [Boston marrow]
gb|EYU19903.1|  hypothetical protein MIMGU_mgv1a002628mg                108   2e-25   Erythranthe guttata [common monkey flower]
ref|XP_004142745.1|  PREDICTED: heat shock cognate 70 kDa protein...    108   2e-25   
ref|XP_006424798.1|  hypothetical protein CICLE_v10028007mg             108   2e-25   
ref|XP_006365705.1|  PREDICTED: heat shock cognate 70 kDa protein...    108   2e-25   Solanum tuberosum [potatoes]
ref|XP_004307259.1|  PREDICTED: probable mediator of RNA polymera...    108   2e-25   Fragaria vesca subsp. vesca
ref|XP_009778799.1|  PREDICTED: heat shock cognate 70 kDa protein...    108   2e-25   Nicotiana sylvestris
ref|XP_010495044.1|  PREDICTED: probable mediator of RNA polymera...    108   2e-25   Camelina sativa [gold-of-pleasure]
ref|XP_010490742.1|  PREDICTED: probable mediator of RNA polymera...    108   2e-25   Camelina sativa [gold-of-pleasure]
ref|XP_010423825.1|  PREDICTED: LOW QUALITY PROTEIN: probable med...    108   2e-25   
ref|XP_009122772.1|  PREDICTED: LOW QUALITY PROTEIN: probable med...    108   2e-25   Brassica rapa
gb|KCW50223.1|  hypothetical protein EUGRSUZ_J00023                     108   2e-25   Eucalyptus grandis [rose gum]
ref|XP_002284008.1|  PREDICTED: heat shock cognate 70 kDa protein 2     108   2e-25   
ref|XP_008233611.1|  PREDICTED: heat shock cognate 70 kDa protein 2     108   2e-25   Prunus mume [ume]
gb|AAV98051.1|  heat shock protein 70                                   108   2e-25   Medicago sativa [alfalfa]
ref|XP_002283532.2|  PREDICTED: heat shock cognate 70 kDa protein 2     108   2e-25   Vitis vinifera
gb|AAB88009.1|  heat shock cognate protein HSC70                        108   2e-25   Brassica napus [oilseed rape]
ref|XP_010095022.1|  Heat shock 70 kDa protein 4                        108   2e-25   Morus notabilis
ref|XP_010463615.1|  PREDICTED: probable mediator of RNA polymera...    108   2e-25   Camelina sativa [gold-of-pleasure]
gb|EPS60056.1|  heat shock protein 70                                   108   2e-25   Genlisea aurea
ref|XP_001759874.1|  predicted protein                                  108   2e-25   
ref|XP_003621886.1|  Heat shock protein                                 108   2e-25   Medicago truncatula
emb|CAB72130.1|  heat shock protein 70                                  108   2e-25   Cucumis sativus [cucumbers]
ref|XP_001751923.1|  predicted protein                                  108   2e-25   
ref|XP_011091460.1|  PREDICTED: heat shock cognate 70 kDa protein...    108   2e-25   Sesamum indicum [beniseed]
ref|XP_001767839.1|  predicted protein                                  108   2e-25   
ref|XP_009357717.1|  PREDICTED: heat shock cognate 70 kDa protein...    108   2e-25   Pyrus x bretschneideri [bai li]
ref|XP_008371627.1|  PREDICTED: heat shock cognate 70 kDa protein...    108   2e-25   
gb|ADZ46371.1|  HSP70                                                   108   2e-25   Malus hupehensis
gb|AAB42159.1|  Hsc70                                                   108   2e-25   Solanum lycopersicum
ref|XP_006349004.1|  PREDICTED: heat shock cognate 70 kDa protein...    108   2e-25   Solanum tuberosum [potatoes]
ref|XP_004984739.1|  PREDICTED: probable mediator of RNA polymera...    108   2e-25   Setaria italica
ref|XP_010452093.1|  PREDICTED: probable mediator of RNA polymera...    108   2e-25   Camelina sativa [gold-of-pleasure]
ref|XP_010423853.1|  PREDICTED: probable mediator of RNA polymera...    108   2e-25   Camelina sativa [gold-of-pleasure]
ref|NP_195870.1|  heat shock cognate protein 70-1                       108   2e-25   Arabidopsis thaliana [mouse-ear cress]
emb|CAA52684.1|  heat shock protein 70 cognate                          108   2e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008241192.1|  PREDICTED: probable mediator of RNA polymera...    108   2e-25   Prunus mume [ume]
ref|XP_010423858.1|  PREDICTED: probable mediator of RNA polymera...    108   3e-25   Camelina sativa [gold-of-pleasure]
ref|XP_011027667.1|  PREDICTED: probable mediator of RNA polymera...    107   3e-25   Populus euphratica
ref|XP_007207158.1|  hypothetical protein PRUPE_ppa024477mg             108   3e-25   
ref|NP_001266213.1|  heat shock protein 70 isoform 3                    108   3e-25   Solanum lycopersicum
ref|XP_006349005.1|  PREDICTED: heat shock cognate 70 kDa protein...    108   3e-25   Solanum tuberosum [potatoes]
gb|EYU33210.1|  hypothetical protein MIMGU_mgv1a002616mg                108   3e-25   Erythranthe guttata [common monkey flower]
ref|XP_006436017.1|  hypothetical protein CICLE_v10033622mg             108   3e-25   Citrus clementina [clementine]
ref|XP_002873056.1|  HSC70-1                                            107   3e-25   Arabidopsis lyrata subsp. lyrata
ref|XP_010446275.1|  PREDICTED: probable mediator of RNA polymera...    107   3e-25   Camelina sativa [gold-of-pleasure]
ref|XP_006287234.1|  hypothetical protein CARUB_v10000420mg             107   3e-25   Capsella rubella
ref|XP_002528432.1|  heat shock protein, putative                       107   3e-25   
ref|XP_004962705.1|  PREDICTED: probable mediator of RNA polymera...    107   3e-25   
ref|XP_002442353.1|  hypothetical protein SORBIDRAFT_08g018750          107   3e-25   
ref|XP_009414320.1|  PREDICTED: probable mediator of RNA polymera...    107   3e-25   
ref|XP_009374678.1|  PREDICTED: probable mediator of RNA polymera...    107   3e-25   
ref|XP_008369876.1|  PREDICTED: probable mediator of RNA polymera...    107   3e-25   
ref|XP_010319122.1|  PREDICTED: heat shock protein 70 isoform 3 i...    107   3e-25   
ref|XP_009338761.1|  PREDICTED: probable mediator of RNA polymera...    107   3e-25   
gb|AAB97316.1|  cytosolic heat shock 70 protein                         107   3e-25   
ref|XP_006398709.1|  hypothetical protein EUTSA_v10012922mg             107   3e-25   
gb|AGL07711.1|  heat shock protein 70                                   107   3e-25   
emb|CDX85038.1|  BnaC05g20170D                                          104   3e-25   
ref|XP_004250959.1|  PREDICTED: heat shock cognate 70 kDa protein       107   4e-25   
gb|ACR38891.1|  heat shock protein 70                                   107   4e-25   
emb|CDP09035.1|  unnamed protein product                                107   4e-25   
gb|KFK24738.1|  hypothetical protein AALP_AA8G018100                    107   4e-25   
gb|AAS09825.1|  heat shock cognate protein 70                           107   4e-25   
gb|ACM42161.1|  heat shock protein 70.58                                107   4e-25   
gb|KHN13891.1|  Heat shock cognate 70 kDa protein 2                     107   5e-25   
ref|XP_003552691.1|  PREDICTED: heat shock cognate 70 kDa protein...    107   5e-25   
ref|XP_008674324.1|  PREDICTED: probable mediator of RNA polymera...    107   5e-25   
ref|NP_001148198.1|  heat shock cognate 70 kDa protein 2                107   5e-25   
ref|XP_008660826.1|  PREDICTED: probable mediator of RNA polymera...    107   5e-25   
ref|XP_010685795.1|  PREDICTED: heat shock cognate 70 kDa protein 2     107   5e-25   
emb|CAB72129.1|  heat shock protein 70                                  107   5e-25   
ref|NP_001167696.1|  heat shock cognate 70 kDa protein 2                107   5e-25   
ref|XP_008649290.1|  PREDICTED: heat shock 70 kDa protein 18-like...    100   5e-25   
emb|CDY52661.1|  BnaC01g38510D                                          107   5e-25   
ref|XP_002468097.1|  hypothetical protein SORBIDRAFT_01g039530          107   5e-25   
ref|XP_008649291.1|  PREDICTED: heat shock 70 kDa protein 18-like...    100   6e-25   
ref|XP_009102555.1|  PREDICTED: probable mediator of RNA polymera...    107   6e-25   
ref|XP_007139236.1|  hypothetical protein PHAVU_008G012600g             107   6e-25   
ref|XP_006649850.1|  PREDICTED: probable mediator of RNA polymera...    107   7e-25   
ref|XP_004307529.1|  PREDICTED: heat shock cognate 70 kDa protein...    107   7e-25   
dbj|BAJ86014.1|  predicted protein                                      107   7e-25   
ref|NP_001049712.1|  Os03g0276500                                       107   7e-25   
ref|XP_004984743.1|  PREDICTED: heat shock cognate 70 kDa protein...    107   8e-25   
gb|KHN13890.1|  Heat shock cognate 70 kDa protein 2                     107   8e-25   
gb|EMT11692.1|  Heat shock cognate 70 kDa protein                       106   8e-25   
gb|AFW88810.1|  hypothetical protein ZEAMMB73_832667                    107   8e-25   
gb|EMS65159.1|  Heat shock cognate 70 kDa protein                       107   9e-25   
gb|EAY89450.1|  hypothetical protein OsI_10982                          104   9e-25   
ref|XP_003558228.1|  PREDICTED: heat shock cognate 70 kDa protein...    106   9e-25   
ref|XP_010520113.1|  PREDICTED: heat shock cognate 70 kDa protein...    106   9e-25   
ref|XP_001767221.1|  predicted protein                                  106   1e-24   
gb|KJB73858.1|  hypothetical protein B456_011G256600                    106   1e-24   
emb|CAA27293.1|  unnamed protein product                              98.6    1e-24   
gb|EPS64948.1|  hypothetical protein M569_09829                         106   1e-24   
ref|XP_009115390.1|  PREDICTED: probable mediator of RNA polymera...    106   1e-24   
gb|AAA86903.1|  heat shock protein cognate 70                           102   1e-24   
ref|XP_006392363.1|  hypothetical protein EUTSA_v10023343mg             106   1e-24   
gb|EMT15100.1|  Heat shock cognate 70 kDa protein 1                     107   2e-24   
gb|EMS45385.1|  Heat shock cognate 70 kDa protein 1                     106   2e-24   
gb|EEC76425.1|  hypothetical protein OsI_14101                          103   2e-24   
ref|XP_001785822.1|  predicted protein                                  105   2e-24   
gb|ABX76301.1|  heat shock protein 70                                   105   2e-24   
gb|EMS52605.1|  Heat shock cognate 70 kDa protein 1                     105   2e-24   
ref|XP_003564580.1|  PREDICTED: heat shock cognate 70 kDa protein       105   2e-24   
ref|NP_001051724.1|  Os03g0821100                                       105   2e-24   
dbj|BAJ91305.1|  predicted protein                                      105   2e-24   
ref|XP_004981251.1|  PREDICTED: heat shock cognate 70 kDa protein...    105   2e-24   
gb|KFK37144.1|  hypothetical protein AALP_AA4G218800                    105   2e-24   
gb|EMT07406.1|  Heat shock cognate 70 kDa protein 1                     105   2e-24   
ref|XP_007016452.1|  Heat shock cognate protein 70-1                    105   2e-24   
ref|XP_008458906.1|  PREDICTED: heat shock cognate 70 kDa protein...    105   2e-24   
ref|XP_003578898.1|  PREDICTED: heat shock cognate 70 kDa protein 2     105   3e-24   
gb|EMT06830.1|  Heat shock cognate 70 kDa protein                       105   3e-24   
ref|XP_009407484.1|  PREDICTED: probable mediator of RNA polymera...    105   3e-24   
ref|XP_003563611.1|  PREDICTED: heat shock cognate 70 kDa protein...    104   4e-24   
ref|XP_003552695.1|  PREDICTED: heat shock cognate 70 kDa protein...    104   5e-24   
sp|P29357.3|HSP7E_SPIOL  RecName: Full=Chloroplast envelope membr...    104   6e-24   
ref|XP_004300725.1|  PREDICTED: heat shock cognate 70 kDa protein...    103   7e-24   
gb|ACT34017.1|  heat shock cognate 70 kDa protein                       103   8e-24   
gb|EEC71767.1|  hypothetical protein OsI_04375                          102   9e-24   
gb|EMS51135.1|  Heat shock cognate 70 kDa protein                       103   1e-23   
ref|XP_008658250.1|  PREDICTED: uncharacterized protein LOC100272...    103   1e-23   
gb|ACJ54890.1|  heat shock protein 70                                   103   1e-23   
gb|ABF95267.1|  Heat shock cognate 70 kDa protein, putative, expr...    103   1e-23   
ref|XP_008812036.1|  PREDICTED: probable mediator of RNA polymera...    103   1e-23   
ref|XP_008656365.1|  PREDICTED: probable mediator of RNA polymera...    103   1e-23   
ref|XP_002465468.1|  hypothetical protein SORBIDRAFT_01g039390          103   1e-23   
gb|KDP44978.1|  hypothetical protein JCGZ_01478                         103   1e-23   
ref|XP_008776656.1|  PREDICTED: heat shock cognate 70 kDa protein...    103   1e-23   
ref|XP_003064239.1|  heat shock protein 70kDa                           103   1e-23   
dbj|BAA04848.1|  HSP70                                                  103   1e-23   
gb|EAY98319.1|  hypothetical protein OsI_20227                          101   1e-23   
gb|ACD45076.1|  heat-shock protein 70                                   103   1e-23   
gb|EAY89457.1|  hypothetical protein OsI_10990                          101   1e-23   
gb|AAB99745.1|  HSP70                                                   103   1e-23   
dbj|BAK00257.1|  predicted protein                                      103   1e-23   
gb|KDP44977.1|  hypothetical protein JCGZ_01477                         103   1e-23   
ref|NP_001044757.1|  Os01g0840100                                       103   1e-23   
ref|XP_006649853.1|  PREDICTED: heat shock cognate 70 kDa protein...    103   1e-23   
ref|XP_010937656.1|  PREDICTED: probable mediator of RNA polymera...    103   1e-23   
ref|XP_009380663.1|  PREDICTED: heat shock cognate 70 kDa protein...    103   1e-23   
sp|P11143.2|HSP70_MAIZE  RecName: Full=Heat shock 70 kDa protein        103   2e-23   
ref|XP_003558220.1|  PREDICTED: heat shock cognate 70 kDa protein...    103   2e-23   
ref|XP_004961848.1|  PREDICTED: probable mediator of RNA polymera...    103   2e-23   
ref|XP_002975959.1|  hypothetical protein SELMODRAFT_104343           96.3    2e-23   
ref|XP_002441219.1|  hypothetical protein SORBIDRAFT_09g022580          103   2e-23   
ref|XP_010321717.1|  PREDICTED: heat shock 70 kDa protein 18-like     95.9    2e-23   
gb|KJB20110.1|  hypothetical protein B456_003G133400                    102   2e-23   
ref|XP_008458071.1|  PREDICTED: heat shock cognate 70 kDa protein...  98.6    2e-23   
gb|EMS68426.1|  Heat shock cognate 70 kDa protein 4                     102   2e-23   
ref|XP_008674843.1|  PREDICTED: heat shock 70 kDa protein-like          102   2e-23   
prf||1205208A  heat shock protein hsp70                                 102   2e-23
ref|NP_001183165.1|  uncharacterized protein LOC100501536               102   2e-23   
dbj|BAK07857.1|  predicted protein                                      103   2e-23   
gb|ABR18415.1|  unknown                                                 102   2e-23   
ref|NP_001055754.1|  Os05g0460000                                       102   2e-23   
ref|XP_010918390.1|  PREDICTED: heat shock cognate 70 kDa protein...    102   2e-23   
gb|EMT17408.1|  Heat shock cognate 70 kDa protein                       102   2e-23   
pir||PC1156  dnaK-type molecular chaperone (clone pMON9508) - mai...  94.7    3e-23
ref|XP_010231300.1|  PREDICTED: probable mediator of RNA polymera...    102   3e-23   
ref|XP_006644983.1|  PREDICTED: probable mediator of RNA polymera...    102   3e-23   
dbj|BAK02194.1|  predicted protein                                      102   3e-23   
gb|EMS65063.1|  Heat shock cognate 70 kDa protein                       102   3e-23   
ref|XP_009630236.1|  PREDICTED: heat shock cognate 70 kDa protein...    102   3e-23   
ref|XP_009122774.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock 7...    101   3e-23   
ref|XP_004292156.2|  PREDICTED: probable mediator of RNA polymera...    101   5e-23   
gb|EMS51616.1|  Heat shock cognate 70 kDa protein 1                     102   5e-23   
ref|XP_001781229.1|  predicted protein                                  101   5e-23   
ref|XP_008802766.1|  PREDICTED: probable mediator of RNA polymera...    101   8e-23   
gb|KDO67637.1|  hypothetical protein CISIN_1g041815mg                 99.8    9e-23   
emb|CAA31663.1|  hsp70 (AA 6 - 651)                                     100   1e-22   
gb|AIU40169.1|  heat shock protein 70                                   100   1e-22   
ref|XP_006486093.1|  PREDICTED: probable mediator of RNA polymera...    101   1e-22   
ref|XP_002456611.1|  hypothetical protein SORBIDRAFT_03g039360          100   1e-22   
ref|XP_004970526.1|  PREDICTED: probable mediator of RNA polymera...    100   1e-22   
gb|AES65523.2|  animal HSPA9 nucleotide-binding domain protein          100   3e-22   
ref|XP_003595272.1|  Heat shock protein                                 100   3e-22   
gb|KEH37494.1|  animal HSPA9 nucleotide-binding domain protein          100   3e-22   
gb|KJB20862.1|  hypothetical protein B456_003G169700                  99.8    3e-22   
ref|XP_004300726.1|  PREDICTED: probable mediator of RNA polymera...  99.4    3e-22   
ref|XP_002502667.1|  heat shock 70 kDa protein                        99.4    3e-22   
emb|CEG00633.1|  Heat shock protein 70 family                         99.4    4e-22   
gb|KFK24739.1|  hypothetical protein AALP_AA8G018200                  99.8    5e-22   
gb|KJB83911.1|  hypothetical protein B456_013G270600                  99.0    5e-22   
ref|XP_002968525.1|  hypothetical protein SELMODRAFT_440382           99.0    6e-22   
gb|KJB49429.1|  hypothetical protein B456_008G119200                  98.6    6e-22   
gb|KDO55360.1|  hypothetical protein CISIN_1g038511mg                 98.6    6e-22   
ref|XP_002976219.1|  hypothetical protein SELMODRAFT_443120           98.6    6e-22   
ref|XP_002987127.1|  hypothetical protein SELMODRAFT_446858           98.6    6e-22   
gb|KDO55354.1|  hypothetical protein CISIN_1g043296mg                 98.6    8e-22   
ref|XP_006427662.1|  hypothetical protein CICLE_v10025114mg           98.6    8e-22   
ref|XP_006493389.1|  PREDICTED: heat shock 70 kDa protein-like        98.6    8e-22   
gb|KCW70839.1|  hypothetical protein EUGRSUZ_F03980                   98.6    8e-22   
ref|XP_008384260.1|  PREDICTED: heat shock 70 kDa protein isoform X1  98.2    8e-22   
ref|XP_010094064.1|  Heat shock cognate 70 kDa protein                98.2    9e-22   
ref|XP_001421920.1|  Heat Shock Protein 70, cytosolic                 98.2    1e-21   
ref|XP_004287145.1|  PREDICTED: heat shock 70 kDa protein             98.2    1e-21   
ref|XP_006427666.1|  hypothetical protein CICLE_v10025102mg           98.2    1e-21   
ref|XP_009366205.1|  PREDICTED: heat shock 70 kDa protein             98.2    1e-21   
emb|CDO98244.1|  unnamed protein product                              98.2    1e-21   
ref|XP_004292167.1|  PREDICTED: heat shock cognate 70 kDa protein...  97.4    1e-21   
ref|XP_008353760.1|  PREDICTED: heat shock 70 kDa protein isoform X4  97.8    1e-21   
ref|XP_011034569.1|  PREDICTED: heat shock 70 kDa protein-like        97.8    1e-21   
gb|KDP41951.1|  hypothetical protein JCGZ_26969                       97.4    2e-21   
ref|XP_008353758.1|  PREDICTED: heat shock 70 kDa protein isoform X2  97.4    2e-21   
emb|CAA78034.1|  70-kD heat shock protein                             90.5    2e-21   
ref|XP_009357719.1|  PREDICTED: heat shock cognate 70 kDa protein...  97.4    2e-21   
ref|XP_007216987.1|  hypothetical protein PRUPE_ppa002598mg           97.4    2e-21   
ref|XP_007023492.1|  Heat shock protein 70B                           97.4    2e-21   
ref|XP_010094065.1|  Heat shock 70 kDa protein                        97.4    2e-21   
ref|XP_007216991.1|  hypothetical protein PRUPE_ppa002591mg           97.4    2e-21   
ref|XP_007203774.1|  hypothetical protein PRUPE_ppa002595mg           97.4    2e-21   
ref|XP_008353759.1|  PREDICTED: heat shock 70 kDa protein isoform X3  97.4    2e-21   
ref|XP_008354483.1|  PREDICTED: heat shock cognate 70 kDa protein...  95.1    2e-21   
ref|XP_009354216.1|  PREDICTED: heat shock 70 kDa protein-like        97.1    2e-21   
ref|XP_006436009.1|  hypothetical protein CICLE_v10030893mg           97.1    2e-21   
ref|XP_006368490.1|  heat shock protein 70 cognate                    97.1    2e-21   
ref|XP_011034570.1|  PREDICTED: heat shock 70 kDa protein isoform X1  97.1    2e-21   
ref|XP_006368489.1|  heat shock protein 70 cognate                    97.1    2e-21   
ref|XP_008342821.1|  PREDICTED: heat shock 70 kDa protein-like        97.1    2e-21   
ref|XP_008342826.1|  PREDICTED: heat shock 70 kDa protein-like        97.1    3e-21   
ref|XP_009630237.1|  PREDICTED: heat shock cognate 70 kDa protein...  97.4    3e-21   
gb|KHN13881.1|  Heat shock 70 kDa protein 4                           89.7    3e-21   
ref|XP_008353757.1|  PREDICTED: heat shock 70 kDa protein isoform X1  96.7    3e-21   
ref|XP_008342822.1|  PREDICTED: heat shock 70 kDa protein-like        96.7    3e-21   
ref|XP_010063598.1|  PREDICTED: heat shock 70 kDa protein             96.7    4e-21   
gb|EMD49224.1|  heat shock protein hsp70A2, putative                  92.0    4e-21   
ref|XP_010273661.1|  PREDICTED: heat shock 70 kDa protein-like        96.3    4e-21   
gb|AES65513.2|  animal HSPA9 nucleotide-binding domain protein        97.1    5e-21   
ref|XP_003595262.1|  Heat shock protein                               97.1    5e-21   
ref|XP_009354217.1|  PREDICTED: heat shock 70 kDa protein-like        96.3    5e-21   
ref|XP_008677896.1|  PREDICTED: heat shock cognate 70 kDa protein...  95.1    5e-21   
gb|AAM94003.1|  heat shock protein 70                                 92.4    5e-21   
gb|EMS50129.1|  Heat shock cognate 70 kDa protein 1                   96.3    5e-21   
gb|ABR18417.1|  unknown                                               96.3    6e-21   
ref|XP_004300724.1|  PREDICTED: heat shock cognate 70 kDa protein...  95.9    6e-21   
gb|ACC93947.1|  heat-shock protein 70                                 95.9    6e-21   
dbj|BAM44861.1|  heat shock protein                                   93.2    6e-21   
emb|CBI36549.3|  unnamed protein product                              92.8    7e-21   
ref|XP_009358419.1|  PREDICTED: heat shock 70 kDa protein-like        95.9    7e-21   
emb|CDP11906.1|  unnamed protein product                              95.5    7e-21   
ref|XP_008228833.1|  PREDICTED: heat shock 70 kDa protein             95.5    7e-21   
gb|KDD74618.1|  heat shock protein Hsp70                              95.5    7e-21   
ref|XP_008677895.1|  PREDICTED: heat shock cognate 70 kDa protein...  94.7    1e-20   
ref|XP_005783192.1|  hypothetical protein EMIHUDRAFT_442340           95.1    1e-20   
ref|XP_004255736.1|  heat shock protein, putative                     89.7    1e-20   
ref|XP_002947129.1|  heat-shock inducible Hsp70                       95.1    1e-20   
sp|P25840.2|HSP70_CHLRE  RecName: Full=Heat shock 70 kDa protein      95.1    1e-20   
gb|AAL79999.3|  heat shock protein 70a                                95.1    1e-20   
ref|XP_001701326.1|  heat shock protein 70A                           95.1    1e-20   
ref|XP_002987209.1|  hypothetical protein SELMODRAFT_125427           95.1    1e-20   
ref|XP_005786775.1|  hypothetical protein EMIHUDRAFT_420962           94.7    1e-20   
gb|AFP65439.1|  heat shock protein 70KD                               95.1    1e-20   
gb|ACV52590.1|  heat shock protein 70-like protein                    90.9    1e-20   
sp|P48720.1|HSP70_BLAEM  RecName: Full=Heat shock 70 kDa protein      95.1    1e-20   
gb|KFK32679.1|  hypothetical protein AALP_AA6G274700                  94.7    1e-20   
ref|XP_002976367.1|  hypothetical protein SELMODRAFT_443126           94.7    1e-20   
gb|EPB82818.1|  heat shock protein HSS1                               94.7    2e-20   
gb|ENN76737.1|  hypothetical protein YQE_06802                        87.8    2e-20   
ref|XP_008365320.1|  PREDICTED: heat shock 70 kDa protein             94.7    2e-20   
gb|ETO79272.1|  hsp70-like protein                                    87.8    2e-20   
ref|XP_008485618.1|  PREDICTED: heat shock 70 kDa protein cognate...  87.0    2e-20   
ref|XP_002512742.1|  heat shock protein, putative                     94.4    2e-20   
gb|EPS62155.1|  heat shock protein 70                                 89.0    2e-20   
ref|XP_010273662.1|  PREDICTED: heat shock 70 kDa protein             94.0    3e-20   
gb|KIY98351.1|  heat shock 70kDa protein 1/8                          91.3    3e-20   
gb|ETL96982.1|  hsp70-like protein                                    89.4    3e-20   



>ref|XP_007027053.1| Heat shock cognate protein 70-1 isoform 2, partial [Theobroma 
cacao]
 gb|EOY07555.1| Heat shock cognate protein 70-1 isoform 2, partial [Theobroma 
cacao]
Length=457

 Score =   114 bits (286),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 50/56 (89%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +3

Query  57   TPHSKRAMAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            T   ++ MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD
Sbjct  10   TAKEEKVMAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  65



>gb|KHG30764.1| Heat shock cognate 70 kDa [Gossypium arboreum]
Length=73

 Score =   107 bits (268),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  49



>gb|EAY81902.1| hypothetical protein OsI_37074 [Oryza sativa Indica Group]
Length=85

 Score =   107 bits (268),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  49



>gb|KHG18124.1| Heat shock cognate 70 kDa [Gossypium arboreum]
Length=77

 Score =   107 bits (268),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  49



>emb|CAA78036.1| 70-kD heat shock protein [Solanum tuberosum]
Length=71

 Score =   107 bits (267),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  49



>emb|CAA78037.1| 70-Kd heat shock protein [Solanum tuberosum]
Length=72

 Score =   107 bits (266),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  49



>gb|AAA32820.1| heat shock protein HSP70-2, partial [Arabidopsis thaliana]
Length=102

 Score =   106 bits (264),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>gb|AAC84134.1| heat shock protein [Cichorium intybus]
Length=153

 Score =   107 bits (268),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>ref|XP_010041882.1| PREDICTED: heat shock 70 kDa protein cognate 1-like, partial 
[Eucalyptus grandis]
Length=83

 Score =   105 bits (263),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>ref|XP_010456364.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Camelina sativa]
Length=115

 Score =   106 bits (265),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>ref|XP_010423854.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Camelina sativa]
Length=190

 Score =   108 bits (270),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>gb|EYU41710.1| hypothetical protein MIMGU_mgv1a022248mg, partial [Erythranthe 
guttata]
Length=371

 Score =   111 bits (277),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  49



>ref|XP_003554320.2| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Glycine max]
Length=721

 Score =   113 bits (283),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 51/55 (93%), Positives = 53/55 (96%), Gaps = 1/55 (2%)
 Frame = +3

Query  60   PHSKRAMAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            PH++  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD
Sbjct  63   PHAE-TMAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  116



>gb|KHG09207.1| Heat shock 70 kDa 1 -like protein [Gossypium arboreum]
Length=506

 Score =   111 bits (278),  Expect = 5e-27, Method: Composition-based stats.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  49



>gb|ADB85325.1| putative heat shock cognate [Phyllostachys edulis]
Length=93

 Score =   104 bits (260),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 47/49 (96%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MA KG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD
Sbjct  1    MAAKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  49



>gb|KDO67651.1| hypothetical protein CISIN_1g0212721mg, partial [Citrus sinensis]
Length=109

 Score =   105 bits (261),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>gb|AAA32819.1| heat shock protein HSP70-1, partial [Arabidopsis thaliana]
Length=120

 Score =   105 bits (261),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 47/49 (96%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>gb|EAY89449.1| hypothetical protein OsI_10981 [Oryza sativa Indica Group]
Length=73

 Score =   103 bits (258),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 47/49 (96%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>emb|CAA54420.1| heat shock cognate 70-2 [Arabidopsis thaliana]
Length=98

 Score =   104 bits (259),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 47/49 (96%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGKGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>emb|CDY02235.1| BnaA03g39320D [Brassica napus]
Length=185

 Score =   107 bits (266),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 47/49 (96%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>gb|KDO72893.1| hypothetical protein CISIN_1g036208mg, partial [Citrus sinensis]
Length=279

 Score =   108 bits (270),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>gb|KJB16980.1| hypothetical protein B456_002G258500 [Gossypium raimondii]
Length=613

 Score =   111 bits (278),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  49



>emb|CDP00073.1| unnamed protein product [Coffea canephora]
Length=634

 Score =   111 bits (278),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  49



>gb|KJB36734.1| hypothetical protein B456_006G174000 [Gossypium raimondii]
Length=646

 Score =   111 bits (278),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  49



>ref|XP_007027052.1| Heat shock cognate protein 70-1 isoform 1 [Theobroma cacao]
 gb|EOY07554.1| Heat shock cognate protein 70-1 isoform 1 [Theobroma cacao]
Length=646

 Score =   111 bits (278),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  49



>ref|XP_004493886.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c-like [Cicer arietinum]
Length=650

 Score =   111 bits (278),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  49



>ref|XP_008223372.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e isoform X1 [Prunus mume]
Length=519

 Score =   110 bits (275),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MA KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD
Sbjct  1    MAAKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  49



>ref|XP_009353696.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e isoform X2 [Pyrus x bretschneideri]
Length=520

 Score =   110 bits (275),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MA KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD
Sbjct  1    MAAKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  49



>gb|ABG22608.1| Heat shock cognate 70 kDa protein, putative, expressed [Oryza 
sativa Japonica Group]
Length=602

 Score =   111 bits (277),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  49



>emb|CDX89754.1| BnaC03g46680D [Brassica napus]
Length=224

 Score =   107 bits (266),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 47/49 (96%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  40   MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  88



>emb|CDY53148.1| BnaAnng12070D [Brassica napus]
Length=256

 Score =   107 bits (267),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 47/49 (96%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>gb|ACJ11740.1| heat shock protein 70 [Gossypium hirsutum]
Length=647

 Score =   111 bits (277),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  49



>ref|XP_010423867.1| PREDICTED: heat shock 70 kDa protein 18-like [Camelina sativa]
Length=97

 Score =   103 bits (257),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 46/49 (94%), Positives = 47/49 (96%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTP YV FTD
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPCYVAFTD  49



>ref|XP_009786102.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Nicotiana sylvestris]
Length=648

 Score =   111 bits (277),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  49



>ref|XP_009597695.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Nicotiana tomentosiformis]
Length=648

 Score =   111 bits (277),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  49



>ref|NP_001068540.1| Os11g0703900 [Oryza sativa Japonica Group]
 gb|AAX95352.1| dnaK-type molecular chaperone hsp70 - rice (fragment) [Oryza 
sativa Japonica Group]
 gb|ABA95500.1| Heat shock cognate 70 kDa protein, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF28903.1| Os11g0703900 [Oryza sativa Japonica Group]
Length=649

 Score =   111 bits (277),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  49



>ref|XP_006663128.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Oryza brachyantha]
Length=649

 Score =   111 bits (277),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  49



>ref|XP_004246402.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Solanum 
lycopersicum]
Length=649

 Score =   111 bits (277),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  49



>gb|KHG00348.1| Heat shock 70 kDa 4 -like protein [Gossypium arboreum]
Length=570

 Score =   110 bits (275),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  49



>ref|XP_003521330.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Glycine max]
 gb|KHN09419.1| Heat shock cognate 70 kDa protein [Glycine soja]
Length=653

 Score =   111 bits (277),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  49



>ref|XP_004249574.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Solanum lycopersicum]
Length=644

 Score =   111 bits (277),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  49



>gb|KJB46580.1| hypothetical protein B456_007G375600 [Gossypium raimondii]
 gb|KJB46581.1| hypothetical protein B456_007G375600 [Gossypium raimondii]
 gb|KJB46582.1| hypothetical protein B456_007G375600 [Gossypium raimondii]
Length=647

 Score =   111 bits (277),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  49



>gb|ACJ11741.1| heat shock protein 70 [Gossypium hirsutum]
Length=648

 Score =   111 bits (277),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  49



>ref|XP_006436010.1| hypothetical protein CICLE_v10030928mg [Citrus clementina]
 gb|ESR49250.1| hypothetical protein CICLE_v10030928mg [Citrus clementina]
Length=648

 Score =   111 bits (277),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  49



>ref|XP_009622753.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nicotiana 
tomentosiformis]
Length=649

 Score =   111 bits (277),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  49



>ref|XP_004493999.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Cicer arietinum]
Length=661

 Score =   111 bits (277),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  49



>ref|NP_001234491.1| heat shock cognate 70 kDa protein 1 [Solanum lycopersicum]
 sp|P24629.1|HSP71_SOLLC RecName: Full=Heat shock cognate 70 kDa protein 1 [Solanum lycopersicum]
 emb|CAA37970.1| heat shock protein cognate 70 [Solanum lycopersicum]
Length=650

 Score =   110 bits (276),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  49



>gb|KJB16979.1| hypothetical protein B456_002G258500 [Gossypium raimondii]
Length=648

 Score =   110 bits (276),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  49



>ref|XP_009620324.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nicotiana 
tomentosiformis]
Length=648

 Score =   110 bits (276),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  49



>gb|AAR17080.1| heat shock protein 70-3 [Nicotiana tabacum]
Length=648

 Score =   110 bits (276),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  49



>emb|CAA47948.2| heat shock protein 70 [Oryza sativa Indica Group]
Length=648

 Score =   110 bits (276),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  49



>ref|XP_009785159.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nicotiana 
sylvestris]
 dbj|BAM24707.1| Heat shock protein 70 [Nicotiana tabacum]
Length=649

 Score =   110 bits (276),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  49



>ref|XP_006349514.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Solanum 
tuberosum]
Length=647

 Score =   110 bits (276),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  49



>ref|XP_006350760.1| PREDICTED: heat shock cognate 70 kDa protein 1-like [Solanum 
tuberosum]
Length=648

 Score =   110 bits (276),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  49



>gb|ADD71975.1| heat shock protein 70 [Rhododendron calophytum]
Length=651

 Score =   110 bits (276),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  49



>gb|AFU34347.1| 70-kDa heat shock protein [Ipomoea batatas]
 gb|AFU34348.1| 70-kDa heat shock protein [Ipomoea batatas]
 gb|AFU34349.1| 70-kDa heat shock protein [Ipomoea batatas]
 gb|AFU34350.1| 70-kDa heat shock protein [Ipomoea batatas]
Length=652

 Score =   110 bits (276),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  49



>ref|XP_009777579.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nicotiana 
sylvestris]
Length=648

 Score =   110 bits (276),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  49



>gb|AAS57913.1| 70 kDa heat shock cognate protein 2 [Vigna radiata]
Length=648

 Score =   110 bits (276),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  49



>gb|AAP04522.1| heat shock protein 70 [Nicotiana tabacum]
Length=648

 Score =   110 bits (276),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  49



>ref|XP_006348998.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Solanum 
tuberosum]
Length=649

 Score =   110 bits (276),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  49



>sp|P27322.1|HSP72_SOLLC RecName: Full=Heat shock cognate 70 kDa protein 2 [Solanum lycopersicum]
 emb|CAA37971.1| heat shock protein cognate 70 [Solanum lycopersicum]
Length=644

 Score =   110 bits (276),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  49



>gb|AAN86276.1| cell-autonomous heat shock cognate protein 70 [Cucurbita maxima]
Length=650

 Score =   110 bits (276),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  49



>gb|EAY81899.1| hypothetical protein OsI_37065 [Oryza sativa Indica Group]
Length=434

 Score =   108 bits (271),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  49



>ref|XP_006341042.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Solanum 
tuberosum]
Length=649

 Score =   110 bits (276),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  49



>ref|XP_004250958.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Solanum 
lycopersicum]
Length=649

 Score =   110 bits (276),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  49



>emb|CDY36723.1| BnaC02g31440D [Brassica napus]
Length=195

 Score =   105 bits (263),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 47/49 (96%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDR+EIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRIEIIANDQGNRTTPSYVAFTD  49



>ref|XP_002891955.1| early-responsive to dehydration 2 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68214.1| early-responsive to dehydration 2 [Arabidopsis lyrata subsp. 
lyrata]
Length=606

 Score =   110 bits (276),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>gb|EYU26579.1| hypothetical protein MIMGU_mgv1a002667mg [Erythranthe guttata]
Length=648

 Score =   110 bits (276),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  49



>sp|P09189.1|HSP7C_PETHY RecName: Full=Heat shock cognate 70 kDa protein [Petunia x hybrida]
 emb|CAA30018.1| heat shock protein 70 [Petunia x hybrida]
Length=651

 Score =   110 bits (276),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  49



>ref|XP_002532297.1| heat shock protein, putative [Ricinus communis]
 gb|EEF30081.1| heat shock protein, putative [Ricinus communis]
Length=652

 Score =   110 bits (276),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  49



>ref|XP_010558317.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Tarenaya hassleriana]
Length=654

 Score =   110 bits (276),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  49



>gb|ABA95501.2| Heat shock cognate 70 kDa protein, putative, expressed [Oryza 
sativa Japonica Group]
Length=615

 Score =   110 bits (275),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  49



>emb|CCA29121.1| heat shock protein 70 isoform 2 [Solanum lycopersicum]
Length=644

 Score =   110 bits (276),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  49



>ref|XP_010253202.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Nelumbo nucifera]
Length=648

 Score =   110 bits (276),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  49



>ref|XP_011094842.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Sesamum indicum]
Length=646

 Score =   110 bits (276),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  49



>gb|KJB55903.1| hypothetical protein B456_009G100400 [Gossypium raimondii]
Length=650

 Score =   110 bits (276),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  49



>ref|XP_009604213.1| PREDICTED: heat shock cognate 70 kDa protein [Nicotiana tomentosiformis]
Length=651

 Score =   110 bits (276),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  49



>ref|XP_010253221.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nelumbo 
nucifera]
Length=648

 Score =   110 bits (276),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  49



>gb|ABP35942.1| heat shock protein 70 [Cyclamen persicum]
Length=650

 Score =   110 bits (276),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  49



>ref|XP_009784009.1| PREDICTED: heat shock cognate 70 kDa protein [Nicotiana sylvestris]
Length=651

 Score =   110 bits (275),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  49



>ref|XP_011077460.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Sesamum 
indicum]
Length=646

 Score =   110 bits (275),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  49



>ref|XP_010553033.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Tarenaya hassleriana]
Length=652

 Score =   110 bits (275),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  49



>ref|NP_176036.1| heat shock protein ERD2 [Arabidopsis thaliana]
 sp|Q9C7X7.1|HSP7N_ARATH RecName: Full=Heat shock 70 kDa protein 18; AltName: Full=Heat 
shock protein 70-18; Short=AtHsp70-18; AltName: Full=Heat-shock 
protein 70T-1 [Arabidopsis thaliana]
 gb|AAG51503.1|AC058785_6 heat shock protein, putative [Arabidopsis thaliana]
 gb|ABE65717.1| heat shock cognate 70 kDa protein/HSC70/HSP70 [Arabidopsis thaliana]
 gb|AEE33389.1| heat shock protein ERD2 [Arabidopsis thaliana]
Length=617

 Score =   110 bits (275),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>gb|KFK38606.1| hypothetical protein AALP_AA3G135800 [Arabis alpina]
Length=357

 Score =   108 bits (269),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>ref|XP_009112006.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Brassica rapa]
Length=517

 Score =   109 bits (273),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 47/49 (96%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>emb|CCD74508.1| early-responsive to dehydration 2 [Arabidopsis halleri subsp. 
halleri]
Length=622

 Score =   110 bits (275),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>ref|NP_001119156.1| heat shock cognate protein 70-1 [Arabidopsis thaliana]
 gb|AED90481.1| heat shock cognate protein 70-1 [Arabidopsis thaliana]
Length=521

 Score =   109 bits (273),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 47/49 (96%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>ref|XP_004492118.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Cicer arietinum]
Length=649

 Score =   110 bits (275),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  49



>ref|XP_007162654.1| hypothetical protein PHAVU_001G169000g [Phaseolus vulgaris]
 gb|ESW34648.1| hypothetical protein PHAVU_001G169000g [Phaseolus vulgaris]
Length=651

 Score =   110 bits (275),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  49



>emb|CCA29120.1| heat shock protein 70 isoform 1 [Solanum lycopersicum]
Length=648

 Score =   110 bits (275),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  49



>emb|CDY16175.1| BnaA09g29090D [Brassica napus]
Length=257

 Score =   106 bits (265),  Expect = 5e-26, Method: Composition-based stats.
 Identities = 47/48 (98%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +3

Query  81   AGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            AGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  3    AGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  50



>ref|XP_010931247.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Elaeis guineensis]
Length=648

 Score =   109 bits (273),  Expect = 7e-26, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>ref|XP_009414319.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=649

 Score =   109 bits (273),  Expect = 8e-26, Method: Composition-based stats.
 Identities = 47/49 (96%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEI+ANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIVANDQGNRTTPSYVAFTD  49



>ref|XP_006664117.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Oryza brachyantha]
Length=649

 Score =   109 bits (273),  Expect = 8e-26, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD
Sbjct  1    MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  49



>ref|XP_006297174.1| hypothetical protein CARUB_v10013178mg [Capsella rubella]
 gb|EOA30072.1| hypothetical protein CARUB_v10013178mg [Capsella rubella]
Length=649

 Score =   109 bits (273),  Expect = 8e-26, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>ref|XP_007139240.1| hypothetical protein PHAVU_008G013000g [Phaseolus vulgaris]
 gb|ESW11234.1| hypothetical protein PHAVU_008G013000g [Phaseolus vulgaris]
Length=649

 Score =   109 bits (273),  Expect = 8e-26, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD
Sbjct  1    MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  49



>gb|AFV46216.1| hypothetical protein, partial [Scutellaria baicalensis]
Length=233

 Score =   105 bits (262),  Expect = 8e-26, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>gb|KHN27222.1| Heat shock cognate 70 kDa protein 2 [Glycine soja]
Length=649

 Score =   109 bits (272),  Expect = 9e-26, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD
Sbjct  1    MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  49



>ref|XP_008776699.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Phoenix dactylifera]
Length=648

 Score =   109 bits (272),  Expect = 9e-26, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>ref|NP_187555.1| heat shock protein 70-3 [Arabidopsis thaliana]
 ref|NP_001189847.1| heat shock protein 70-3 [Arabidopsis thaliana]
 sp|O65719.1|HSP7C_ARATH RecName: Full=Heat shock 70 kDa protein 3; AltName: Full=Heat 
shock cognate 70 kDa protein 3; AltName: Full=Heat shock cognate 
protein 70-3; Short=AtHsc70-3; AltName: Full=Heat shock 
protein 70-3; Short=AtHsp70-3 [Arabidopsis thaliana]
 gb|AAF14038.1|AC011436_22 heat-shock protein (At-hsc70-3) [Arabidopsis thaliana]
 gb|AAF23276.1|AC016661_1 heat shock cognate 70kD protein [Arabidopsis thaliana]
 emb|CAA76606.1| At-hsc70-3 [Arabidopsis thaliana]
 gb|AAK92833.1| putative heat-shock protein At-hsc70-3 [Arabidopsis thaliana]
 gb|AAM20310.1| putative heat-shock protein [Arabidopsis thaliana]
 gb|AAM26685.1| At3g09440/F11F8.1 [Arabidopsis thaliana]
 gb|AAN46823.1| At3g09440/F11F8.1 [Arabidopsis thaliana]
 gb|AEE74767.1| heat shock protein 70-3 [Arabidopsis thaliana]
 gb|AEE74768.1| heat shock protein 70-3 [Arabidopsis thaliana]
Length=649

 Score =   109 bits (272),  Expect = 9e-26, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>ref|XP_007132076.1| hypothetical protein PHAVU_011G065000g [Phaseolus vulgaris]
 gb|ESW04070.1| hypothetical protein PHAVU_011G065000g [Phaseolus vulgaris]
Length=649

 Score =   109 bits (272),  Expect = 9e-26, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>emb|CAA83548.1| PsHSC71.0 [Pisum sativum]
Length=647

 Score =   109 bits (272),  Expect = 9e-26, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>gb|ACD93209.1| heat shock protein 70 [Camellia sinensis]
Length=677

 Score =   109 bits (273),  Expect = 9e-26, Method: Composition-based stats.
 Identities = 47/49 (96%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>ref|XP_006407676.1| hypothetical protein EUTSA_v10020258mg [Eutrema salsugineum]
 gb|ESQ49129.1| hypothetical protein EUTSA_v10020258mg [Eutrema salsugineum]
Length=650

 Score =   109 bits (272),  Expect = 9e-26, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>dbj|BAJ34054.1| unnamed protein product [Thellungiella halophila]
Length=650

 Score =   109 bits (272),  Expect = 9e-26, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>ref|XP_010922357.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Elaeis guineensis]
Length=648

 Score =   109 bits (272),  Expect = 9e-26, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>ref|XP_002884737.1| heat shock cognate 70 kDa protein 3 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60996.1| heat shock cognate 70 kDa protein 3 [Arabidopsis lyrata subsp. 
lyrata]
Length=650

 Score =   109 bits (272),  Expect = 9e-26, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>ref|XP_008784528.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Phoenix 
dactylifera]
Length=648

 Score =   109 bits (272),  Expect = 9e-26, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>gb|AFA51946.1| heat shock protein 70 [Paeonia suffruticosa]
Length=650

 Score =   109 bits (272),  Expect = 9e-26, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>gb|AEK70336.1| heat shock protein 70 [Paeonia lactiflora]
Length=650

 Score =   109 bits (272),  Expect = 9e-26, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>ref|XP_008371640.1| PREDICTED: uncharacterized protein LOC103435023 [Malus domestica]
Length=173

 Score =   103 bits (258),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 46/49 (94%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEII NDQ NRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIVNDQSNRTTPSYVAFTD  49



>ref|XP_009419750.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=648

 Score =   109 bits (272),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>gb|ABD32895.1| Heat shock protein Hsp70 [Medicago truncatula]
 gb|AES81705.2| heat shock cognate 70 kDa protein [Medicago truncatula]
Length=649

 Score =   109 bits (272),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>gb|ACB70177.1| 70 kDa heat shock protein [Capparis spinosa]
Length=649

 Score =   109 bits (272),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>emb|CDY50531.1| BnaA01g30490D [Brassica napus]
Length=650

 Score =   109 bits (272),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>emb|CDY31804.1| BnaC01g27600D [Brassica napus]
Length=417

 Score =   107 bits (267),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 47/49 (96%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>gb|KCW74480.1| hypothetical protein EUGRSUZ_E03189 [Eucalyptus grandis]
Length=522

 Score =   108 bits (269),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQ+DRVEIIANDQGNRTTPSYVGFTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQYDRVEIIANDQGNRTTPSYVGFTD  49



>ref|XP_003625487.1| Heat shock protein [Medicago truncatula]
Length=719

 Score =   109 bits (272),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>gb|AIZ68155.1| heat shock protein 70 [Ornithogalum saundersiae]
Length=648

 Score =   109 bits (272),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>ref|XP_006290203.1| hypothetical protein CARUB_v10003889mg [Capsella rubella]
 gb|EOA23101.1| hypothetical protein CARUB_v10003889mg [Capsella rubella]
Length=650

 Score =   109 bits (272),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>gb|AAS57912.1| 70 kDa heat shock cognate protein 1 [Vigna radiata]
Length=649

 Score =   108 bits (271),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>gb|EMT11425.1| Heat shock cognate 70 kDa protein 1 [Aegilops tauschii]
Length=648

 Score =   108 bits (271),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>ref|XP_003539680.2| PREDICTED: heat shock cognate 70 kDa protein 2 [Glycine max]
 gb|KHN32117.1| Heat shock cognate 70 kDa protein [Glycine soja]
Length=649

 Score =   108 bits (271),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>gb|KCW50226.1| hypothetical protein EUGRSUZ_J00025 [Eucalyptus grandis]
Length=742

 Score =   109 bits (272),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 48/50 (96%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +3

Query  75   AMAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            +MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  93   SMAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  142



>ref|XP_010464591.1| PREDICTED: heat shock 70 kDa protein 3 [Camelina sativa]
Length=649

 Score =   108 bits (271),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 47/49 (96%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>ref|XP_003621869.1| Heat shock protein [Medicago truncatula]
 gb|AES78087.1| heat shock cognate 70 kDa protein [Medicago truncatula]
Length=648

 Score =   108 bits (271),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>gb|AAN86274.1| non-cell-autonomous heat shock cognate protein 70 [Cucurbita 
maxima]
Length=647

 Score =   108 bits (271),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>ref|XP_002873055.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49314.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=653

 Score =   108 bits (271),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>ref|XP_010473075.1| PREDICTED: heat shock 70 kDa protein 3-like [Camelina sativa]
Length=649

 Score =   108 bits (271),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 47/49 (96%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>gb|KCW50227.1| hypothetical protein EUGRSUZ_J00025 [Eucalyptus grandis]
Length=735

 Score =   109 bits (272),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 48/50 (96%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +3

Query  75   AMAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            +MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  93   SMAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  142



>ref|XP_010253827.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nelumbo 
nucifera]
Length=619

 Score =   108 bits (271),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>gb|KDP44975.1| hypothetical protein JCGZ_01475 [Jatropha curcas]
Length=617

 Score =   108 bits (271),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>ref|XP_010095013.1| Heat shock 70 kDa protein 4 [Morus notabilis]
 gb|EXB58119.1| Heat shock 70 kDa protein 4 [Morus notabilis]
Length=648

 Score =   108 bits (271),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>gb|AGZ15406.1| heat shock cognate 70 kDa protein [Phaseolus vulgaris]
Length=651

 Score =   108 bits (271),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  49



>gb|EYU19900.1| hypothetical protein MIMGU_mgv1a002641mg [Erythranthe guttata]
Length=651

 Score =   108 bits (271),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>ref|XP_004307527.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Fragaria vesca 
subsp. vesca]
Length=651

 Score =   108 bits (271),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>ref|XP_009409520.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Musa acuminata 
subsp. malaccensis]
Length=648

 Score =   108 bits (271),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>ref|XP_006424799.1| hypothetical protein CICLE_v10027981mg [Citrus clementina]
 gb|ESR38039.1| hypothetical protein CICLE_v10027981mg [Citrus clementina]
Length=649

 Score =   108 bits (271),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>ref|XP_004287404.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Fragaria 
vesca subsp. vesca]
Length=649

 Score =   108 bits (271),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>ref|XP_009120551.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Brassica rapa]
Length=650

 Score =   108 bits (271),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>ref|XP_007009362.1| Heat shock cognate protein 70-1 [Theobroma cacao]
 gb|EOY18172.1| Heat shock cognate protein 70-1 [Theobroma cacao]
Length=652

 Score =   108 bits (271),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>ref|XP_008802761.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Phoenix 
dactylifera]
Length=648

 Score =   108 bits (271),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>gb|KDP35613.1| hypothetical protein JCGZ_09051 [Jatropha curcas]
Length=648

 Score =   108 bits (271),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>gb|AIU34470.1| putative heat shock protein, partial [Taraxacum brevicorniculatum]
Length=646

 Score =   108 bits (271),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>ref|XP_006429028.1| hypothetical protein CICLE_v10011260mg [Citrus clementina]
 ref|XP_006480766.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e-like [Citrus sinensis]
 gb|ESR42268.1| hypothetical protein CICLE_v10011260mg [Citrus clementina]
 gb|KDO41235.1| hypothetical protein CISIN_1g006381mg [Citrus sinensis]
Length=647

 Score =   108 bits (271),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>ref|XP_008223380.1| PREDICTED: heat shock cognate 70 kDa protein 2-like isoform X2 
[Prunus mume]
Length=648

 Score =   108 bits (271),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MA KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD
Sbjct  1    MAAKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  49



>ref|XP_002311161.1| heat shock protein 70 [Populus trichocarpa]
 gb|EEE88528.1| heat shock protein 70 [Populus trichocarpa]
Length=648

 Score =   108 bits (271),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>ref|XP_009353695.1| PREDICTED: heat shock cognate 70 kDa protein 2-like isoform X1 
[Pyrus x bretschneideri]
Length=649

 Score =   108 bits (271),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MA KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD
Sbjct  1    MAAKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  49



>ref|XP_003537997.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Glycine max]
Length=649

 Score =   108 bits (271),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>emb|CDY00784.1| BnaC03g37680D [Brassica napus]
Length=650

 Score =   108 bits (271),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>ref|XP_006407319.1| hypothetical protein EUTSA_v10020257mg [Eutrema salsugineum]
 gb|ESQ48772.1| hypothetical protein EUTSA_v10020257mg [Eutrema salsugineum]
Length=650

 Score =   108 bits (271),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>gb|KEH30132.1| heat shock cognate 70 kDa protein [Medicago truncatula]
Length=578

 Score =   108 bits (270),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>ref|WP_039310754.1| molecular chaperone DnaK [Paenibacillus sp. IHB B 3415]
 gb|AHL69785.1| heat shock protein [Camellia sinensis]
 gb|KHL91223.1| molecular chaperone DnaK [Paenibacillus sp. IHB B 3415]
Length=650

 Score =   108 bits (271),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 47/49 (96%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>gb|KHN21966.1| Heat shock cognate 70 kDa protein [Glycine soja]
Length=646

 Score =   108 bits (271),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>ref|XP_010486515.1| PREDICTED: heat shock 70 kDa protein 3-like [Camelina sativa]
Length=649

 Score =   108 bits (271),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 47/49 (96%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>ref|XP_008784530.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Phoenix dactylifera]
Length=649

 Score =   108 bits (271),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>ref|XP_006488297.1| PREDICTED: heat shock cognate 70 kDa protein-like [Citrus sinensis]
Length=649

 Score =   108 bits (271),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>ref|XP_002527736.1| heat shock protein, putative [Ricinus communis]
 gb|EEF34649.1| heat shock protein, putative [Ricinus communis]
Length=647

 Score =   108 bits (271),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>gb|AAA62445.1| heat shock protein [Spinacia oleracea]
 gb|AAB88134.1| cytosolic heat shock 70 protein [Spinacia oleracea]
Length=647

 Score =   108 bits (271),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>ref|XP_010534306.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Tarenaya hassleriana]
Length=653

 Score =   108 bits (271),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>ref|XP_008458892.1| PREDICTED: heat shock cognate 70 kDa protein [Cucumis melo]
Length=648

 Score =   108 bits (271),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>gb|KDP44987.1| hypothetical protein JCGZ_01487 [Jatropha curcas]
Length=648

 Score =   108 bits (271),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>gb|ACJ11745.1| heat shock protein 70 [Gossypium hirsutum]
Length=648

 Score =   108 bits (271),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>gb|KEH30133.1| heat shock cognate 70 kDa protein [Medicago truncatula]
Length=649

 Score =   108 bits (271),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>gb|KEH30131.1| heat shock cognate 70 kDa protein [Medicago truncatula]
Length=649

 Score =   108 bits (271),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>ref|XP_006378715.1| hypothetical protein POPTR_0010s21280g [Populus trichocarpa]
 gb|ERP56512.1| hypothetical protein POPTR_0010s21280g [Populus trichocarpa]
Length=649

 Score =   108 bits (271),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>ref|XP_007207204.1| hypothetical protein PRUPE_ppa002646mg [Prunus persica]
 gb|EMJ08403.1| hypothetical protein PRUPE_ppa002646mg [Prunus persica]
Length=649

 Score =   108 bits (271),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MA KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD
Sbjct  1    MAAKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  49



>gb|EPS68565.1| hypothetical protein M569_06198 [Genlisea aurea]
Length=650

 Score =   108 bits (271),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>ref|XP_011027172.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c isoform X1 [Populus euphratica]
 ref|XP_011027173.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c isoform X2 [Populus euphratica]
Length=648

 Score =   108 bits (271),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>ref|XP_011027580.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Populus 
euphratica]
Length=648

 Score =   108 bits (271),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>ref|XP_008812042.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Phoenix 
dactylifera]
Length=648

 Score =   108 bits (271),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>ref|XP_011027180.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Populus 
euphratica]
Length=649

 Score =   108 bits (271),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>ref|XP_002263599.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Vitis vinifera]
Length=649

 Score =   108 bits (271),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>gb|KFK38330.1| hypothetical protein AALP_AA3G100200 [Arabis alpina]
Length=650

 Score =   108 bits (271),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>ref|XP_001783048.1| predicted protein [Physcomitrella patens]
 gb|EDQ52117.1| predicted protein [Physcomitrella patens]
Length=650

 Score =   108 bits (271),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>gb|ACJ11742.1| heat shock protein 70 [Gossypium hirsutum]
 gb|KJB67650.1| hypothetical protein B456_010G202100 [Gossypium raimondii]
Length=648

 Score =   108 bits (271),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>ref|XP_007009369.1| Heat shock protein 70 [Theobroma cacao]
 gb|EOY18179.1| Heat shock protein 70 [Theobroma cacao]
Length=649

 Score =   108 bits (271),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>gb|AIA22210.1| heat shock protein 70 [Chrysanthemum indicum]
Length=647

 Score =   108 bits (271),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>ref|XP_006297173.1| hypothetical protein CARUB_v10013177mg [Capsella rubella]
 gb|EOA30071.1| hypothetical protein CARUB_v10013177mg [Capsella rubella]
Length=650

 Score =   108 bits (271),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>ref|XP_004156718.1| PREDICTED: heat shock cognate 70 kDa protein-like isoform 1 [Cucumis 
sativus]
Length=659

 Score =   108 bits (271),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>ref|XP_011027182.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Populus 
euphratica]
Length=648

 Score =   108 bits (271),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>ref|XP_010937646.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Elaeis guineensis]
Length=648

 Score =   108 bits (271),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>gb|KDP44981.1| hypothetical protein JCGZ_01481 [Jatropha curcas]
Length=648

 Score =   108 bits (271),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>ref|XP_002312089.1| heat shock protein 70 cognate [Populus trichocarpa]
 gb|EEE89456.1| heat shock protein 70 cognate [Populus trichocarpa]
Length=648

 Score =   108 bits (271),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>ref|XP_006378714.1| heat shock protein 70 cognate [Populus trichocarpa]
 gb|ERP56511.1| heat shock protein 70 cognate [Populus trichocarpa]
Length=648

 Score =   108 bits (271),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>ref|XP_007144451.1| hypothetical protein PHAVU_007G157200g [Phaseolus vulgaris]
 gb|ESW16445.1| hypothetical protein PHAVU_007G157200g [Phaseolus vulgaris]
Length=648

 Score =   108 bits (271),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MA KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD
Sbjct  1    MAAKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  49



>ref|XP_010558794.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Tarenaya hassleriana]
Length=649

 Score =   108 bits (271),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>ref|XP_010030977.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Eucalyptus grandis]
Length=649

 Score =   108 bits (271),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>ref|XP_010030975.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Eucalyptus 
grandis]
 gb|KCW50222.1| hypothetical protein EUGRSUZ_J00023 [Eucalyptus grandis]
Length=649

 Score =   108 bits (271),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>ref|XP_010486980.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Camelina sativa]
Length=650

 Score =   108 bits (271),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>ref|XP_002884912.1| hypothetical protein ARALYDRAFT_897465 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61171.1| hypothetical protein ARALYDRAFT_897465 [Arabidopsis lyrata subsp. 
lyrata]
Length=650

 Score =   108 bits (271),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>emb|CDX73815.1| BnaA03g32320D [Brassica napus]
Length=652

 Score =   108 bits (271),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>ref|XP_010106444.1| Heat shock cognate 70 kDa protein [Morus notabilis]
 gb|EXC10620.1| Heat shock cognate 70 kDa protein [Morus notabilis]
Length=652

 Score =   108 bits (271),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 47/49 (96%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>gb|AGR45355.1| HSP70 [Dendrobium catenatum]
Length=647

 Score =   108 bits (270),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>ref|NP_195869.1| heat shock protein 70 [Arabidopsis thaliana]
 sp|P22954.2|MD37D_ARATH RecName: Full=Probable mediator of RNA polymerase II transcription 
subunit 37c; AltName: Full=Heat shock 70 kDa protein 2; 
AltName: Full=Heat shock cognate 70 kDa protein 2; AltName: 
Full=Heat shock cognate protein 70-2; Short=AtHsc70-2; AltName: 
Full=Heat shock protein 70-2; Short=AtHsp70-2 [Arabidopsis 
thaliana]
 emb|CAB85986.1| dnaK-type molecular chaperone hsc70.1-like [Arabidopsis thaliana]
 gb|AAM13151.1| DnaK-type molecular chaperone hsc70.1-like [Arabidopsis thaliana]
 gb|AAP37770.1| At5g02490 [Arabidopsis thaliana]
 dbj|BAE99142.1| dnaK-type molecular chaperone hsc70.1 - like [Arabidopsis thaliana]
 gb|AED90479.1| heat shock protein 70 [Arabidopsis thaliana]
Length=653

 Score =   108 bits (271),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>ref|XP_009592776.1| PREDICTED: heat shock cognate 70 kDa protein 1-like [Nicotiana 
tomentosiformis]
Length=648

 Score =   108 bits (270),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>ref|XP_007016460.1| Heat shock cognate protein 70-1 [Theobroma cacao]
 gb|EOY34079.1| Heat shock cognate protein 70-1 [Theobroma cacao]
Length=650

 Score =   108 bits (270),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>gb|KHN02428.1| Heat shock cognate 70 kDa protein [Glycine soja]
Length=654

 Score =   108 bits (270),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQ+DRVEIIANDQGNRTTPSYVGFTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVGFTD  49



>ref|XP_006833219.1| hypothetical protein AMTR_s00072p00181720 [Amborella trichopoda]
 gb|ERM98497.1| hypothetical protein AMTR_s00072p00181720 [Amborella trichopoda]
Length=657

 Score =   108 bits (270),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>ref|XP_002284063.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Vitis vinifera]
Length=652

 Score =   108 bits (270),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 47/49 (96%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>ref|XP_008447699.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Cucumis melo]
Length=647

 Score =   108 bits (270),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>ref|XP_004302715.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Fragaria vesca subsp. vesca]
Length=647

 Score =   108 bits (270),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>gb|AAV97978.1| heat shock protein hsp70 [Saussurea medusa]
Length=647

 Score =   108 bits (270),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>gb|AAM48131.1|AF509336_1 heat shock protein 70 [Saussurea medusa]
Length=647

 Score =   108 bits (270),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>gb|AAS57914.1| 70 kDa heat shock cognate protein 3 [Vigna radiata]
Length=650

 Score =   108 bits (270),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQ NRTTPSYVGFTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQSNRTTPSYVGFTD  49



>ref|XP_004142749.1| PREDICTED: heat shock cognate 70 kDa protein-like isoform 1 [Cucumis 
sativus]
 ref|XP_004156712.1| PREDICTED: heat shock cognate 70 kDa protein-like isoform 1 [Cucumis 
sativus]
 gb|KGN51294.1| hypothetical protein Csa_5G514500 [Cucumis sativus]
Length=648

 Score =   108 bits (270),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>ref|XP_004505872.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Cicer arietinum]
Length=649

 Score =   108 bits (270),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>ref|XP_007220208.1| hypothetical protein PRUPE_ppa002641mg [Prunus persica]
 gb|EMJ21407.1| hypothetical protein PRUPE_ppa002641mg [Prunus persica]
Length=649

 Score =   108 bits (270),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>ref|XP_010465032.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Camelina sativa]
Length=650

 Score =   108 bits (270),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>ref|XP_010456365.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Camelina sativa]
Length=931

 Score =   109 bits (272),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>ref|XP_010499184.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Camelina sativa]
Length=650

 Score =   108 bits (270),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>ref|XP_002312090.1| heat shock protein 70 cognate [Populus trichocarpa]
 gb|EEE89457.1| heat shock protein 70 cognate [Populus trichocarpa]
Length=648

 Score =   108 bits (270),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>ref|XP_010484430.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Camelina sativa]
Length=652

 Score =   108 bits (270),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 47/49 (96%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPS+V FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSFVAFTD  49



>dbj|BAP90755.1| heat shock protein 70 [Chrysanthemum x morifolium]
Length=647

 Score =   108 bits (270),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>ref|XP_011028442.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Populus 
euphratica]
Length=648

 Score =   108 bits (270),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>emb|CDP09040.1| unnamed protein product [Coffea canephora]
Length=649

 Score =   108 bits (270),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>ref|XP_008370710.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Malus domestica]
Length=649

 Score =   108 bits (270),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>ref|XP_004142076.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e-like [Cucumis sativus]
 ref|XP_004161675.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e-like [Cucumis sativus]
 gb|KGN54238.1| Heat shock protein 70 [Cucumis sativus]
Length=647

 Score =   108 bits (270),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>ref|XP_009135236.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Brassica rapa]
Length=652

 Score =   108 bits (270),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>ref|XP_004492128.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Cicer arietinum]
Length=647

 Score =   108 bits (270),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>ref|NP_187864.1| heat shock protein 70-4 [Arabidopsis thaliana]
 sp|Q9LHA8.1|MD37C_ARATH RecName: Full=Probable mediator of RNA polymerase II transcription 
subunit 37c; AltName: Full=Heat shock 70 kDa protein 4; 
AltName: Full=Heat shock cognate 70 kDa protein 4; AltName: 
Full=Heat shock cognate protein 70-4; Short=AtHsc70-4; AltName: 
Full=Heat shock protein 70-4; Short=AtHsp70-4 [Arabidopsis 
thaliana]
 gb|AAG51030.1|AC069474_29 heat shock protein 70; 34105-36307 [Arabidopsis thaliana]
 dbj|BAB02269.1| 70 kDa heat shock protein [Arabidopsis thaliana]
 gb|AAL06844.1| AT3g12580/T2E22_110 [Arabidopsis thaliana]
 gb|AAL06851.1| AT3g12580/T2E22_110 [Arabidopsis thaliana]
 gb|AAL24367.1| 70 kDa heat shock protein [Arabidopsis thaliana]
 gb|AEE75218.1| heat shock protein 70-4 [Arabidopsis thaliana]
Length=650

 Score =   108 bits (270),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>gb|AII99890.1| heat shock protein [Cicer arietinum]
Length=847

 Score =   108 bits (271),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>gb|KCW50224.1| hypothetical protein EUGRSUZ_J00023 [Eucalyptus grandis]
Length=632

 Score =   108 bits (270),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>ref|XP_011016414.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Populus euphratica]
Length=648

 Score =   108 bits (270),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 47/49 (96%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSC+GVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCIGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>ref|XP_010669896.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104887018 
[Beta vulgaris subsp. vulgaris]
Length=1526

 Score =   109 bits (273),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>ref|XP_002316294.1| heat shock protein 70 [Populus trichocarpa]
 gb|EEF02465.1| heat shock protein 70 [Populus trichocarpa]
Length=648

 Score =   108 bits (270),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>ref|XP_009606077.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nicotiana 
tomentosiformis]
Length=648

 Score =   108 bits (270),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>ref|XP_007144450.1| hypothetical protein PHAVU_007G157200g [Phaseolus vulgaris]
 gb|ESW16444.1| hypothetical protein PHAVU_007G157200g [Phaseolus vulgaris]
Length=614

 Score =   108 bits (269),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MA KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD
Sbjct  1    MAAKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  49



>ref|XP_009388623.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=649

 Score =   108 bits (270),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>gb|ACJ85522.1| unknown [Medicago truncatula]
 gb|AFK38758.1| unknown [Medicago truncatula]
Length=649

 Score =   108 bits (270),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>emb|CAA05547.1| heat shock protein 70 [Arabidopsis thaliana]
Length=650

 Score =   108 bits (270),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>ref|XP_010555208.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Tarenaya 
hassleriana]
Length=652

 Score =   108 bits (270),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>gb|AAN86275.1| non-cell-autonomous heat shock cognate protein 70 [Cucurbita 
maxima]
Length=652

 Score =   108 bits (270),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>gb|EYU19903.1| hypothetical protein MIMGU_mgv1a002628mg [Erythranthe guttata]
Length=652

 Score =   108 bits (270),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>ref|XP_004142745.1| PREDICTED: heat shock cognate 70 kDa protein-like [Cucumis sativus]
 gb|KGN51286.1| Heat shock protein 70 [Cucumis sativus]
Length=652

 Score =   108 bits (270),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>ref|XP_006424798.1| hypothetical protein CICLE_v10028007mg [Citrus clementina]
 gb|ESR38038.1| hypothetical protein CICLE_v10028007mg [Citrus clementina]
Length=636

 Score =   108 bits (269),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 47/49 (96%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FT+
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTN  49



>ref|XP_006365705.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Solanum 
tuberosum]
Length=649

 Score =   108 bits (270),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>ref|XP_004307259.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Fragaria vesca subsp. vesca]
Length=649

 Score =   108 bits (270),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>ref|XP_009778799.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nicotiana 
sylvestris]
Length=650

 Score =   108 bits (270),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>ref|XP_010495044.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Camelina sativa]
Length=611

 Score =   108 bits (269),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>ref|XP_010490742.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Camelina sativa]
Length=654

 Score =   108 bits (270),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>ref|XP_010423825.1| PREDICTED: LOW QUALITY PROTEIN: probable mediator of RNA polymerase 
II transcription subunit 37c [Camelina sativa]
Length=658

 Score =   108 bits (270),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>ref|XP_009122772.1| PREDICTED: LOW QUALITY PROTEIN: probable mediator of RNA polymerase 
II transcription subunit 37e [Brassica rapa]
Length=646

 Score =   108 bits (269),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 47/49 (96%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>gb|KCW50223.1| hypothetical protein EUGRSUZ_J00023 [Eucalyptus grandis]
Length=615

 Score =   108 bits (269),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>ref|XP_002284008.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Vitis vinifera]
 emb|CAN81694.1| hypothetical protein VITISV_017873 [Vitis vinifera]
Length=648

 Score =   108 bits (269),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>ref|XP_008233611.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Prunus mume]
Length=649

 Score =   108 bits (269),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>gb|AAV98051.1| heat shock protein 70 [Medicago sativa]
Length=649

 Score =   108 bits (269),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>ref|XP_002283532.2| PREDICTED: heat shock cognate 70 kDa protein 2 [Vitis vinifera]
Length=650

 Score =   108 bits (269),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>gb|AAB88009.1| heat shock cognate protein HSC70 [Brassica napus]
Length=645

 Score =   108 bits (269),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 47/49 (96%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



>ref|XP_010095022.1| Heat shock 70 kDa protein 4 [Morus notabilis]
 gb|EXB58128.1| Heat shock 70 kDa protein 4 [Morus notabilis]
Length=651

 Score =   108 bits (269),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD  224
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD  49



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 570526909590