BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002A16

Length=305
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AAK48495.1|AF259983_1  putative cysteine protease                    141   2e-37   Ipomoea batatas [batate]
gb|KJB14608.1|  hypothetical protein B456_002G133800                    105   1e-24   Gossypium raimondii
dbj|BAF46304.1|  cysteine proteinase precursor                          105   2e-24   Ipomoea nil [qian niu]
ref|XP_011069730.1|  PREDICTED: low-temperature-induced cysteine ...    105   2e-24   Sesamum indicum [beniseed]
ref|NP_001234324.1|  low-temperature-induced cysteine proteinase ...    104   4e-24   Solanum lycopersicum
gb|KJB14610.1|  hypothetical protein B456_002G133800                    104   5e-24   Gossypium raimondii
gb|KJB14609.1|  hypothetical protein B456_002G133800                    103   7e-24   Gossypium raimondii
dbj|BAE80740.1|  cysteine proteinase                                    103   9e-24   Platycodon grandiflorus [balloon-flower]
gb|AGV15823.1|  cysteine protease CP15                                  103   1e-23   Nicotiana tabacum [American tobacco]
ref|XP_007017153.1|  Granulin repeat cysteine protease family pro...    103   1e-23   Theobroma cacao [chocolate]
gb|KHG05637.1|  Cysteinease RD21a -like protein                         102   3e-23   Gossypium arboreum [tree cotton]
ref|XP_006342644.1|  PREDICTED: low-temperature-induced cysteine ...    102   3e-23   Solanum tuberosum [potatoes]
gb|KHG12125.1|  Cysteinease RD21a -like protein                         103   4e-23   Gossypium arboreum [tree cotton]
ref|XP_006354848.1|  PREDICTED: cysteine proteinase RD21a-like          102   4e-23   
ref|XP_009775102.1|  PREDICTED: low-temperature-induced cysteine ...    101   7e-23   Nicotiana sylvestris
emb|CDP01294.1|  unnamed protein product                                101   7e-23   Coffea canephora [robusta coffee]
ref|XP_004238129.1|  PREDICTED: low-temperature-induced cysteine ...    101   8e-23   Solanum lycopersicum
ref|XP_009604895.1|  PREDICTED: low-temperature-induced cysteine ...    100   9e-23   Nicotiana tomentosiformis
gb|KJB58557.1|  hypothetical protein B456_009G214900                    100   1e-22   Gossypium raimondii
gb|KJB58559.1|  hypothetical protein B456_009G214900                    100   1e-22   Gossypium raimondii
ref|XP_003589135.1|  Cysteine proteinase                                100   1e-22   
gb|KJB58558.1|  hypothetical protein B456_009G214900                    100   1e-22   Gossypium raimondii
ref|NP_001274877.1|  low-temperature-induced cysteine proteinase-...    100   1e-22   Solanum tuberosum [potatoes]
gb|KJB63901.1|  hypothetical protein B456_010G022700                    100   2e-22   Gossypium raimondii
ref|XP_003589133.1|  Cysteine proteinase                                100   2e-22   Medicago truncatula
gb|AEZ65083.1|  cysteine protease                                     99.8    2e-22   Carica papaya [mamon]
gb|AAL14614.1|AF417109_1  cysteine proteinase precursor               96.3    3e-22   Vasconcellea cundinamarcensis
gb|KDO36580.1|  hypothetical protein CISIN_1g037262mg                 94.0    4e-22   Citrus sinensis [apfelsine]
gb|ABG33750.1|  cysteine protease                                     98.6    6e-22   Hevea brasiliensis [jebe]
gb|AAU81594.1|  cysteine proteinase                                   94.7    8e-22   Petunia x hybrida [garden petunia]
ref|XP_007160879.1|  hypothetical protein PHAVU_001G024500g           98.2    9e-22   Phaseolus vulgaris [French bean]
ref|XP_010270819.1|  PREDICTED: cysteine proteinase RD21a-like        98.2    9e-22   Nelumbo nucifera [Indian lotus]
emb|CAB17076.1|  cysteine proteinase precursor                        97.8    9e-22   Phaseolus vulgaris [French bean]
ref|XP_010059895.1|  PREDICTED: low-temperature-induced cysteine ...  97.8    1e-21   Eucalyptus grandis [rose gum]
gb|KCW66364.1|  hypothetical protein EUGRSUZ_F00184                   97.8    1e-21   Eucalyptus grandis [rose gum]
ref|XP_009769754.1|  PREDICTED: low-temperature-induced cysteine ...  97.8    1e-21   Nicotiana sylvestris
ref|XP_009613155.1|  PREDICTED: low-temperature-induced cysteine ...  97.8    1e-21   Nicotiana tomentosiformis
ref|XP_011088223.1|  PREDICTED: low-temperature-induced cysteine ...  97.8    1e-21   Sesamum indicum [beniseed]
ref|XP_003589134.1|  Cysteine proteinase                              95.9    2e-21   
ref|XP_006473275.1|  PREDICTED: cysteine proteinase RD21a-like        97.1    2e-21   Citrus sinensis [apfelsine]
ref|XP_002284973.1|  PREDICTED: low-temperature-induced cysteine ...  97.1    2e-21   Vitis vinifera
emb|CAN61026.1|  hypothetical protein VITISV_001146                   97.1    2e-21   Vitis vinifera
ref|XP_011029381.1|  PREDICTED: cysteine proteinase RD21a             96.7    4e-21   Populus euphratica
ref|XP_003545327.1|  PREDICTED: cysteine proteinase RD21a-like        96.7    4e-21   
ref|XP_004230752.1|  PREDICTED: cysteine proteinase RD21a-like        96.3    5e-21   Solanum lycopersicum
ref|XP_010549252.1|  PREDICTED: cysteine proteinase RD21a-like        95.9    6e-21   Tarenaya hassleriana [spider flower]
gb|AJA74414.1|  cysteine protease                                     96.3    6e-21   Cicer arietinum [garbanzo]
gb|KDP41692.1|  hypothetical protein JCGZ_16099                       95.9    7e-21   Jatropha curcas
ref|XP_004499026.1|  PREDICTED: cysteine proteinase RD21a-like        95.9    7e-21   Cicer arietinum [garbanzo]
emb|CAA46863.1|  thiolprotease                                        95.5    7e-21   Pisum sativum [garden pea]
ref|XP_006434711.1|  hypothetical protein CICLE_v100010541mg          91.7    9e-21   
gb|AAX84673.1|  cysteine protease CP1                                 95.5    1e-20   Manihot esculenta [manioc]
gb|KHN22488.1|  Cysteine proteinase RD21a                             95.1    1e-20   Glycine soja [wild soybean]
ref|XP_010244238.1|  PREDICTED: cysteine proteinase RD21a-like        95.1    1e-20   Nelumbo nucifera [Indian lotus]
ref|XP_009390984.1|  PREDICTED: oryzain alpha chain-like              95.1    1e-20   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFO83614.1|  papain-like cysteine protease                         95.1    1e-20   Fagopyrum esculentum
ref|XP_011074404.1|  PREDICTED: low-temperature-induced cysteine ...  95.1    1e-20   Sesamum indicum [beniseed]
gb|EPS63305.1|  hypothetical protein M569_11479                       94.4    2e-20   Genlisea aurea
ref|XP_009772520.1|  PREDICTED: cysteine proteinase RD21a-like        94.7    2e-20   Nicotiana sylvestris
ref|XP_006374886.1|  cysteine proteinase                              94.7    2e-20   Populus trichocarpa [western balsam poplar]
ref|XP_009359945.1|  PREDICTED: low-temperature-induced cysteine ...  94.7    2e-20   Pyrus x bretschneideri [bai li]
ref|XP_009354165.1|  PREDICTED: low-temperature-induced cysteine ...  94.4    2e-20   Pyrus x bretschneideri [bai li]
ref|XP_006346518.1|  PREDICTED: cysteine proteinase RD21a-like        94.4    2e-20   Solanum tuberosum [potatoes]
ref|XP_008393776.1|  PREDICTED: low-temperature-induced cysteine ...  94.4    3e-20   
ref|XP_003550321.1|  PREDICTED: cysteine proteinase RD21a-like        94.0    3e-20   Glycine max [soybeans]
ref|XP_002863697.1|  hypothetical protein ARALYDRAFT_917391           93.6    4e-20   Arabidopsis lyrata subsp. lyrata
ref|XP_008799871.1|  PREDICTED: oryzain alpha chain-like isoform X1   93.6    6e-20   
ref|NP_001150196.1|  cysteine protease 1 precursor                    93.2    6e-20   Zea mays [maize]
gb|ABQ10202.1|  cysteine protease Cp4                                 93.2    6e-20   Actinidia deliciosa [Chinese gooseberry]
ref|XP_009396268.1|  PREDICTED: oryzain alpha chain-like              93.2    7e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008220266.1|  PREDICTED: low-temperature-induced cysteine ...  92.8    8e-20   Prunus mume [ume]
ref|XP_007222885.1|  hypothetical protein PRUPE_ppa005199mg           92.8    9e-20   Prunus persica
ref|XP_009395501.1|  PREDICTED: oryzain alpha chain-like              92.8    1e-19   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAD29957.1|  cysteine protease                                    92.0    1e-19   Daucus carota [carrots]
ref|XP_010556436.1|  PREDICTED: cysteine proteinase RD21a-like        92.0    1e-19   Tarenaya hassleriana [spider flower]
ref|XP_008813817.1|  PREDICTED: low-temperature-induced cysteine ...  91.7    2e-19   Phoenix dactylifera
ref|NP_568620.1|  Granulin repeat cysteine protease family protein    91.3    3e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008668054.1|  PREDICTED: cysteine protease 1 isoform X1        90.9    4e-19   Zea mays [maize]
ref|NP_001150266.1|  cysteine protease 1 precursor                    90.9    4e-19   
gb|ACR34204.1|  unknown                                               90.9    4e-19   Zea mays [maize]
ref|XP_009591184.1|  PREDICTED: cysteine proteinase RD21a-like        90.5    5e-19   Nicotiana tomentosiformis
tpg|DAA35450.1|  TPA: cysteine protease 1                             90.9    6e-19   
ref|XP_010540378.1|  PREDICTED: cysteine proteinase RD21a-like        90.5    6e-19   Tarenaya hassleriana [spider flower]
ref|XP_008365104.1|  PREDICTED: low-temperature-induced cysteine ...  90.5    6e-19   
dbj|BAC75923.1|  cysteine protease-1                                  90.1    7e-19   Helianthus annuus
ref|XP_010906541.1|  PREDICTED: oryzain alpha chain-like              90.1    8e-19   Elaeis guineensis
gb|ABR19827.1|  cysteine proteinase                                   90.1    8e-19   Elaeis guineensis
dbj|BAD29960.1|  cysteine protease                                    90.1    9e-19   Daucus carota [carrots]
emb|CDO97206.1|  unnamed protein product                              90.1    9e-19   Coffea canephora [robusta coffee]
ref|XP_002518705.1|  cysteine protease, putative                      89.7    1e-18   Ricinus communis
dbj|BAD29958.1|  cysteine protease                                    90.1    1e-18   Daucus carota [carrots]
gb|ACU18172.1|  unknown                                               87.8    2e-18   Glycine max [soybeans]
ref|XP_010094652.1|  Cysteine proteinase RD21a                        89.0    2e-18   Morus notabilis
gb|KHN22490.1|  Cysteine proteinase RD21a                             87.8    2e-18   Glycine soja [wild soybean]
ref|XP_004960237.1|  PREDICTED: oryzain beta chain-like isoform X2    89.0    2e-18   Setaria italica
ref|XP_004960236.1|  PREDICTED: oryzain beta chain-like isoform X1    89.0    3e-18   
gb|AAQ62999.1|  oil palm polygalacturonase allergen PEST472           89.0    3e-18   Elaeis guineensis
ref|XP_008342944.1|  PREDICTED: cysteine proteinase RD21a-like        88.6    3e-18   
ref|XP_010928366.1|  PREDICTED: oryzain alpha chain-like              88.6    3e-18   Elaeis guineensis
ref|XP_007042494.1|  Granulin repeat cysteine protease family pro...  89.0    3e-18   
gb|AER60490.1|  cysteine proteases                                    87.0    4e-18   Gossypium hirsutum [American cotton]
ref|XP_006652996.1|  PREDICTED: oryzain beta chain-like               88.2    4e-18   Oryza brachyantha
ref|XP_006595983.1|  PREDICTED: cysteine proteinase RD21a-like        86.3    4e-18   
ref|XP_002510170.1|  cysteine protease, putative                      88.2    4e-18   Ricinus communis
ref|XP_002448736.1|  hypothetical protein SORBIDRAFT_06g032320        88.2    5e-18   Sorghum bicolor [broomcorn]
ref|XP_008236565.1|  PREDICTED: cysteine proteinase RD21a-like        87.4    8e-18   Prunus mume [ume]
ref|XP_010691718.1|  PREDICTED: cysteine proteinase RD21a-like        87.4    9e-18   Beta vulgaris subsp. vulgaris [field beet]
gb|EYU37647.1|  hypothetical protein MIMGU_mgv1a005905mg              87.0    1e-17   Erythranthe guttata [common monkey flower]
ref|XP_010481911.1|  PREDICTED: cysteine proteinase RD21a             86.7    1e-17   Camelina sativa [gold-of-pleasure]
gb|KDO79088.1|  hypothetical protein CISIN_1g017419mg                 85.5    1e-17   Citrus sinensis [apfelsine]
ref|XP_006494485.1|  PREDICTED: cysteine proteinase RD21a-like        85.5    1e-17   Citrus sinensis [apfelsine]
ref|XP_007199820.1|  hypothetical protein PRUPE_ppa005328mg           86.7    2e-17   
ref|XP_009398671.1|  PREDICTED: oryzain alpha chain-like              86.7    2e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003603086.1|  Cysteine proteinase                              86.3    2e-17   Medicago truncatula
gb|EYU36326.1|  hypothetical protein MIMGU_mgv1a005614mg              86.3    2e-17   Erythranthe guttata [common monkey flower]
ref|XP_010442084.1|  PREDICTED: cysteine proteinase RD21a-like        85.9    3e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010494270.1|  PREDICTED: cysteine proteinase RD21a-like        85.5    4e-17   Camelina sativa [gold-of-pleasure]
ref|XP_009335016.1|  PREDICTED: cysteine proteinase RD21a-like is...  85.5    4e-17   Pyrus x bretschneideri [bai li]
ref|XP_009335017.1|  PREDICTED: cysteine proteinase RD21a-like is...  85.5    4e-17   Pyrus x bretschneideri [bai li]
dbj|BAH20463.1|  cysteine protease                                    85.5    5e-17   Spinacia oleracea
ref|XP_004291075.1|  PREDICTED: cysteine proteinase RD21a             85.1    5e-17   Fragaria vesca subsp. vesca
ref|XP_006393620.1|  hypothetical protein EUTSA_v10011464mg           85.1    6e-17   Eutrema salsugineum [saltwater cress]
gb|ABQ10200.1|  cysteine protease Cp2                                 84.0    6e-17   Actinidia deliciosa [Chinese gooseberry]
ref|XP_002285299.1|  PREDICTED: cysteine proteinase RD21a-like        85.1    6e-17   Vitis vinifera
ref|XP_008350332.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine pro...  84.7    6e-17   
gb|ABQ10204.1|  cysteine protease Cp6                                 84.7    7e-17   Actinidia deliciosa [Chinese gooseberry]
ref|NP_001242660.1|  uncharacterized protein LOC100807362 precursor   83.6    8e-17   Glycine max [soybeans]
gb|ABQ10198.1|  actinidin Act4b                                       83.6    8e-17   Actinidia eriantha
gb|KJB48624.1|  hypothetical protein B456_008G078300                  82.8    9e-17   Gossypium raimondii
gb|KHN04480.1|  Cysteine proteinase RD21a                             83.2    9e-17   Glycine soja [wild soybean]
ref|XP_008361440.1|  PREDICTED: cysteine proteinase RD21a-like        82.8    9e-17   
gb|AAL60580.1|AF454958_1  senescence-associated cysteine protease     84.7    9e-17   Brassica oleracea
dbj|BAG16371.1|  cysteine protease                                    84.3    1e-16   Brassica oleracea var. italica [asparagus broccoli]
emb|CAE54307.1|  cysteine proteinase                                  83.2    1e-16   Gossypium hirsutum [American cotton]
gb|AEV40973.1|  putative oryzain beta chain precursor                 84.3    1e-16   Oryza punctata
emb|CDY17093.1|  BnaC06g00260D                                        84.0    1e-16   Brassica napus [oilseed rape]
gb|KJB48626.1|  hypothetical protein B456_008G078300                  82.0    1e-16   Gossypium raimondii
gb|AEV41024.1|  putative oryzain beta chain precursor                 84.3    1e-16   Oryza minuta
gb|KJB48623.1|  hypothetical protein B456_008G078300                  82.0    1e-16   Gossypium raimondii
ref|XP_008377786.1|  PREDICTED: cysteine proteinase RD21a-like        82.4    2e-16   
gb|KJB48622.1|  hypothetical protein B456_008G078300                  82.4    2e-16   Gossypium raimondii
gb|KJB48625.1|  hypothetical protein B456_008G078300                  82.4    2e-16   Gossypium raimondii
ref|XP_006425969.1|  hypothetical protein CICLE_v10025887mg           82.0    3e-16   Citrus clementina [clementine]
gb|KFK44641.1|  hypothetical protein AALP_AA1G285100                  82.8    3e-16   Arabis alpina [alpine rockcress]
gb|KFK31760.1|  hypothetical protein AALP_AA6G155800                  82.8    3e-16   Arabis alpina [alpine rockcress]
gb|AEV41071.1|  putative oryzain beta chain precursor                 82.8    4e-16   Oryza minuta
gb|AEV41117.1|  putative oryzain beta chain precursor                 82.8    4e-16   Oryza officinalis
ref|XP_009358749.1|  PREDICTED: cysteine proteinase RD21a-like        82.8    4e-16   Pyrus x bretschneideri [bai li]
ref|XP_011097243.1|  PREDICTED: cysteine proteinase COT44             81.6    4e-16   Sesamum indicum [beniseed]
gb|KDP31986.1|  hypothetical protein JCGZ_12447                       81.6    4e-16   Jatropha curcas
ref|XP_010906543.1|  PREDICTED: ervatamin-B-like                      81.6    4e-16   Elaeis guineensis
ref|XP_002894032.1|  F2G19.31/F2G19.31                                82.4    4e-16   
emb|CDY06760.1|  BnaA10g05390D                                        82.4    5e-16   
dbj|BAG16377.1|  cysteine protease                                    82.0    5e-16   Brassica rapa var. perviridis [kabuna]
ref|XP_011000919.1|  PREDICTED: cysteine proteinase RD21a-like        82.4    5e-16   Populus euphratica
gb|AEZ65082.1|  cysteine protease                                     82.4    6e-16   Carica papaya [mamon]
gb|KDP47124.1|  hypothetical protein JCGZ_22120                       80.1    6e-16   Jatropha curcas
ref|XP_009123448.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine pro...  82.0    6e-16   
emb|CDY63586.1|  BnaCnng42340D                                        82.0    6e-16   Brassica napus [oilseed rape]
emb|CDY17044.1|  BnaA08g04080D                                        81.6    8e-16   Brassica napus [oilseed rape]
ref|XP_010461511.1|  PREDICTED: cysteine proteinase RD21a-like        81.3    1e-15   Camelina sativa [gold-of-pleasure]
ref|XP_010500237.1|  PREDICTED: cysteine proteinase RD21a-like        81.3    1e-15   Camelina sativa [gold-of-pleasure]
ref|NP_564497.1|  cysteine proteinase RD21a                           80.9    2e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009400290.1|  PREDICTED: oryzain alpha chain-like              80.9    2e-15   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAK62661.1|  F2G19.31/F2G19.31                                     80.9    2e-15   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD95392.1|  cysteine proteinase RD21A                            80.5    2e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006307278.1|  hypothetical protein CARUB_v10008893mg           80.9    2e-15   
emb|CAQ00115.1|  papain-like cysteine proteinase                      78.2    2e-15   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDX71540.1|  BnaC04g17750D                                        80.5    2e-15   
gb|AAL60579.1|AF454957_1  senescence-associated cysteine protease     80.5    2e-15   Brassica oleracea
ref|XP_009101816.1|  PREDICTED: cysteine proteinase RD21a             80.1    3e-15   Brassica rapa
emb|CDY22370.1|  BnaA06g36920D                                        80.1    3e-15   Brassica napus [oilseed rape]
dbj|BAE46567.1|  cysteine proteinase                                  76.6    3e-15   Dianthus caryophyllus [carnation]
ref|XP_008454976.1|  PREDICTED: low-temperature-induced cysteine ...  80.1    3e-15   Cucumis melo [Oriental melon]
ref|XP_010061721.1|  PREDICTED: low-temperature-induced cysteine ...  80.1    4e-15   Eucalyptus grandis [rose gum]
gb|KCW68708.1|  hypothetical protein EUGRSUZ_F02310                   80.1    4e-15   Eucalyptus grandis [rose gum]
ref|XP_004136967.1|  PREDICTED: cysteine proteinase RD21a-like        80.1    4e-15   Cucumis sativus [cucumbers]
gb|KHG00992.1|  Cysteinease RD21a -like protein                       79.0    4e-15   Gossypium arboreum [tree cotton]
ref|XP_006403303.1|  hypothetical protein EUTSA_v10003205mg           79.3    6e-15   Eutrema salsugineum [saltwater cress]
ref|XP_004304028.1|  PREDICTED: cysteine proteinase RD21a-like        79.3    7e-15   Fragaria vesca subsp. vesca
ref|XP_004171356.1|  PREDICTED: cysteine proteinase RD21a-like        76.3    8e-15   
ref|XP_002298740.2|  hypothetical protein POPTR_0001s30950g           79.0    9e-15   
ref|XP_002313136.2|  hypothetical protein POPTR_0009s10090g           79.0    1e-14   
ref|XP_010028205.1|  PREDICTED: cysteine proteinase COT44-like        77.8    1e-14   Eucalyptus grandis [rose gum]
ref|XP_011000142.1|  PREDICTED: cysteine proteinase RD21a-like        78.6    1e-14   Populus euphratica
ref|XP_002310708.2|  hypothetical protein POPTR_0007s10650g           77.4    1e-14   Populus trichocarpa [western balsam poplar]
gb|ABQ10197.1|  actinidin Act4a                                       77.4    2e-14   Actinidia eriantha
ref|XP_009396437.1|  PREDICTED: oryzain alpha chain-like              77.8    2e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010479116.1|  PREDICTED: cysteine proteinase RD21a             77.8    2e-14   Camelina sativa [gold-of-pleasure]
ref|XP_006422960.1|  hypothetical protein CICLE_v10028338mg           77.4    3e-14   Citrus clementina [clementine]
dbj|BAD16614.1|  cysteine proteinase                                  77.0    4e-14   Dianthus caryophyllus [carnation]
dbj|BAD29954.1|  cysteine protease                                    77.0    4e-14   Daucus carota [carrots]
gb|KEH44128.1|  papain family cysteine protease                       76.6    6e-14   Medicago truncatula
ref|XP_010688590.1|  PREDICTED: low-temperature-induced cysteine ...  76.6    6e-14   Beta vulgaris subsp. vulgaris [field beet]
gb|EYU34557.1|  hypothetical protein MIMGU_mgv1a007408mg              75.9    7e-14   Erythranthe guttata [common monkey flower]
ref|XP_006280322.1|  hypothetical protein CARUB_v10026245mg           76.3    8e-14   
ref|XP_010070600.1|  PREDICTED: cysteine proteinase COT44-like        75.5    8e-14   Eucalyptus grandis [rose gum]
gb|KDO59789.1|  hypothetical protein CISIN_1g012022mg                 75.9    1e-13   Citrus sinensis [apfelsine]
ref|XP_006487026.1|  PREDICTED: cysteine proteinase RD21a-like        75.9    1e-13   Citrus sinensis [apfelsine]
ref|XP_010028191.1|  PREDICTED: cysteine proteinase COT44-like        75.1    1e-13   Eucalyptus grandis [rose gum]
ref|XP_009618803.1|  PREDICTED: cysteine proteinase COT44-like        75.1    1e-13   Nicotiana tomentosiformis
ref|XP_002524912.1|  cysteine protease, putative                      75.1    1e-13   
dbj|BAD95667.1|  cysteine proteinase                                  70.9    1e-13   Dianthus caryophyllus [carnation]
ref|XP_002306486.2|  hypothetical protein POPTR_0005s18520g           75.1    1e-13   
ref|XP_010107858.1|  Cysteine proteinase RD21a                        75.5    1e-13   Morus notabilis
ref|XP_004496965.1|  PREDICTED: cysteine proteinase RD21a-like is...  75.5    2e-13   Cicer arietinum [garbanzo]
ref|XP_004496966.1|  PREDICTED: cysteine proteinase RD21a-like is...  75.5    2e-13   
gb|KJB43804.1|  hypothetical protein B456_007G216900                  73.2    2e-13   Gossypium raimondii
ref|XP_003579458.1|  PREDICTED: oryzain beta chain-like               75.1    2e-13   Brachypodium distachyon [annual false brome]
gb|AAK07730.1|  CPR1-like cysteine proteinase                         74.3    2e-13   Nicotiana tabacum [American tobacco]
ref|XP_002283263.1|  PREDICTED: cysteine proteinase COT44             73.9    3e-13   Vitis vinifera
gb|ABQ10192.1|  actinidin Act2a                                       73.6    4e-13   Actinidia deliciosa [Chinese gooseberry]
gb|KEH31479.1|  papain family cysteine protease                       73.6    4e-13   Medicago truncatula
gb|AFK47737.1|  unknown                                               73.6    4e-13   Medicago truncatula
emb|CDY17193.1|  BnaA05g09950D                                        72.4    5e-13   Brassica napus [oilseed rape]
gb|KHN08598.1|  Cysteine proteinase RD21a                             73.6    6e-13   Glycine soja [wild soybean]
gb|KJB43805.1|  hypothetical protein B456_007G216900                  73.2    6e-13   Gossypium raimondii
gb|KJB43803.1|  hypothetical protein B456_007G216900                  73.2    6e-13   Gossypium raimondii
ref|XP_008452589.1|  PREDICTED: low-temperature-induced cysteine ...  73.9    6e-13   
emb|CAR31335.1|  pro-asclepain f                                      72.4    9e-13   Gomphocarpus fruticosus subsp. fruticosus
ref|XP_007205396.1|  hypothetical protein PRUPE_ppa007467mg           72.4    1e-12   Prunus persica
gb|KHG18408.1|  Cysteinease RD21a -like protein                       72.4    1e-12   Gossypium arboreum [tree cotton]
ref|XP_010555986.1|  PREDICTED: LOW QUALITY PROTEIN: probable cys...  72.8    1e-12   Tarenaya hassleriana [spider flower]
ref|XP_002877310.1|  hypothetical protein ARALYDRAFT_484828           72.0    1e-12   Arabidopsis lyrata subsp. lyrata
gb|AIE88288.1|  hypothetical protein OG_BBa0063K01.19                 72.4    2e-12   Oryza glaberrima
dbj|BAF93840.1|  triticain beta 2                                     72.4    2e-12   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009784112.1|  PREDICTED: cysteine proteinase COT44-like        71.6    2e-12   Nicotiana sylvestris
ref|XP_007136708.1|  hypothetical protein PHAVU_009G067300g           71.6    2e-12   Phaseolus vulgaris [French bean]
ref|XP_008238897.1|  PREDICTED: cysteine proteinase COT44             71.6    2e-12   Prunus mume [ume]
ref|XP_006343212.1|  PREDICTED: cysteine proteinase RD21a-like        71.6    2e-12   
emb|CAB16317.1|  cysteine proteinase precursor                        71.6    2e-12   Nicotiana tabacum [American tobacco]
gb|ABQ10196.1|  actinidin Act3a                                       71.6    2e-12   Actinidia eriantha
gb|ACB87490.1|  mucunain                                              71.6    3e-12   Mucuna pruriens
emb|CAQ00105.1|  papain-like cysteine proteinase                      72.0    3e-12   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010919166.1|  PREDICTED: oryzain alpha chain-like              69.7    3e-12   
gb|ABQ10191.1|  actinidin Act1c                                       71.2    3e-12   Actinidia eriantha
gb|EYU25464.1|  hypothetical protein MIMGU_mgv1a006201mg              71.6    4e-12   Erythranthe guttata [common monkey flower]
dbj|BAJ85145.1|  predicted protein                                    71.2    4e-12   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KGN55227.1|  hypothetical protein Csa_4G641600                     71.2    4e-12   Cucumis sativus [cucumbers]
ref|XP_004169515.1|  PREDICTED: cysteine proteinase RD21a-like        71.2    4e-12   
ref|NP_001054211.2|  Os04g0670200                                     71.2    4e-12   
ref|XP_004141271.1|  PREDICTED: cysteine proteinase RD21a-like        71.2    4e-12   
ref|XP_004234718.1|  PREDICTED: cysteine proteinase COT44-like        70.9    4e-12   
dbj|BAA14403.1|  oryzain beta precursor                               71.2    4e-12   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ32359.1|  hypothetical protein OsJ_16569                        71.2    4e-12   Oryza sativa Japonica Group [Japonica rice]
gb|ABQ10195.1|  actinidin Act2d                                       70.5    5e-12   Actinidia eriantha
gb|EMS68758.1|  Oryzain beta chain                                    71.2    5e-12   Triticum urartu
emb|CBI40282.3|  unnamed protein product                              70.5    6e-12   Vitis vinifera
gb|ABQ10193.1|  actinidin Act2b                                       70.5    6e-12   Actinidia eriantha
gb|KCW66366.1|  hypothetical protein EUGRSUZ_F00186                   68.2    8e-12   Eucalyptus grandis [rose gum]
emb|CBI19479.3|  unnamed protein product                              70.1    8e-12   Vitis vinifera
emb|CDY25228.1|  BnaC02g30040D                                        70.5    8e-12   Brassica napus [oilseed rape]
ref|XP_003550041.1|  PREDICTED: cysteine proteinase RD21a-like        69.7    9e-12   Glycine max [soybeans]
gb|ACI00280.1|  triticain beta 2                                      70.5    9e-12   Hordeum vulgare [barley]
dbj|BAK03074.1|  predicted protein                                    70.5    9e-12   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CAQ00106.1|  papain-like cysteine proteinase                      70.5    9e-12   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KHN27075.1|  Cysteine proteinase RD21a                             69.7    9e-12   Glycine soja [wild soybean]
ref|XP_008357550.1|  PREDICTED: probable cysteine proteinase At3g...  67.4    1e-11   
gb|AAP41847.1|  senescence-associated cysteine protease               70.1    1e-11   Anthurium andraeanum [flamingo-lily]
gb|EMS56635.1|  Oryzain alpha chain                                   70.1    1e-11   Triticum urartu
ref|XP_008344336.1|  PREDICTED: probable cysteine proteinase At3g...  67.4    1e-11   
dbj|BAJ92693.1|  predicted protein                                    68.6    1e-11   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003580684.2|  PREDICTED: oryzain alpha chain-like              70.1    1e-11   Brachypodium distachyon [annual false brome]
dbj|BAF02546.1|  triticain alpha                                      69.7    1e-11   Triticum aestivum [Canadian hard winter wheat]
sp|P00785.4|ACTN_ACTCH  RecName: Full=Actinidain; Short=Actinidin...  69.3    1e-11   Actinidia chinensis
gb|EMT10408.1|  Oryzain alpha chain                                   69.7    1e-11   
sp|A5HII1.1|ACTN_ACTDE  RecName: Full=Actinidain; Short=Actinidin...  69.3    1e-11   Actinidia deliciosa [Chinese gooseberry]
gb|ADQ85986.1|  actinidin                                             69.3    2e-11   Actinidia chinensis
emb|CAA34486.1|  unnamed protein product                              69.3    2e-11   Actinidia deliciosa [Chinese gooseberry]
pir||TAGB  actinidain (EC 3.4.22.14) precursor - kiwi fruit           69.3    2e-11
ref|XP_011008779.1|  PREDICTED: cysteine proteinase COT44             68.9    2e-11   Populus euphratica
ref|NP_001054087.2|  Os04g0650000                                     66.6    2e-11   
dbj|BAN33745.1|  cysteine protease a                                  68.6    2e-11   Symplocarpus renifolius
gb|AEV41119.1|  putative cysteine protease                            69.3    2e-11   Oryza officinalis
ref|XP_009367558.1|  PREDICTED: cysteine proteinase COT44-like        68.6    3e-11   
sp|P25776.2|ORYA_ORYSJ  RecName: Full=Oryzain alpha chain; Flags:...  68.9    3e-11   Oryza sativa Japonica Group [Japonica rice]
gb|EEE61807.1|  hypothetical protein OsJ_16426                        68.9    3e-11   Oryza sativa Japonica Group [Japonica rice]
gb|ADQ85985.1|  actinidin                                             68.6    3e-11   Actinidia chinensis
gb|AEV41073.1|  putative cysteine protease                            68.9    3e-11   Oryza minuta
ref|XP_006652923.1|  PREDICTED: oryzain alpha chain-like              68.9    3e-11   
emb|CAE04498.2|  OSJNBb0059K02.8                                      68.6    4e-11   
dbj|BAA14402.1|  oryzain alpha precursor                              68.6    4e-11   
gb|EPS71857.1|  senescence-associated cysteine protease               67.4    4e-11   
ref|XP_008340386.1|  PREDICTED: cysteine proteinase COT44-like        67.8    4e-11   
ref|XP_007047371.1|  Granulin repeat cysteine protease family pro...  67.8    5e-11   
tpg|DAA35682.1|  TPA: cysteine proteinase Mir3                        68.2    5e-11   
ref|NP_566867.1|  putative cysteine proteinase                        67.8    6e-11   
dbj|BAN33746.1|  cysteine protease a2                                 67.4    6e-11   
ref|XP_008338342.1|  PREDICTED: cysteine proteinase COT44-like        67.4    6e-11   
gb|ABU51882.1|  ervatamin-C precursor                                 67.4    6e-11   
ref|NP_001105993.1|  cysteine protease component of protease-inhi...  68.2    6e-11   
ref|NP_001266166.1|  uncharacterized protein LOC101492472             67.0    7e-11   
gb|ACU13684.1|  unknown                                               65.5    8e-11   
emb|CAA53377.1|  cysteine protease                                    67.0    9e-11   
gb|EEC78138.1|  hypothetical protein OsI_17694                        67.4    9e-11   
gb|KFK39253.1|  hypothetical protein AALP_AA3G220200                  67.4    9e-11   
emb|CAJ86180.1|  H0212B02.7                                           67.4    9e-11   
ref|XP_004977049.1|  PREDICTED: oryzain alpha chain-like              67.4    1e-10   
gb|ABQ10194.1|  actinidin Act2c                                       67.0    1e-10   
ref|XP_010507701.1|  PREDICTED: probable cysteine proteinase At3g...  67.4    1e-10   
gb|ABQ10190.1|  actinidin Act1b                                       67.0    1e-10   
ref|NP_001104879.1|  cysteine proteinase Mir3 precursor               67.4    1e-10   
ref|XP_010466085.1|  PREDICTED: probable cysteine proteinase At3g...  67.0    1e-10   
ref|XP_010466084.1|  PREDICTED: probable cysteine proteinase At3g...  67.0    1e-10   
dbj|BAC75927.1|  cysteine protease-5                                  66.6    1e-10   
gb|KHN30007.1|  Cysteine proteinase RD21a                             66.6    1e-10   
ref|XP_003547817.1|  PREDICTED: cysteine proteinase RD21a             66.6    1e-10   
ref|NP_001242584.1|  uncharacterized protein LOC100804015 precursor   66.2    1e-10   
ref|XP_004289205.2|  PREDICTED: cysteine proteinase COT44             66.2    1e-10   
gb|AAB41816.1|  NTH1                                                  66.2    2e-10   
gb|AFR11773.1|  cysteine protease                                     66.2    2e-10   
gb|KHN12823.1|  Cysteine proteinase RD21a                             66.2    2e-10   
ref|XP_007145379.1|  hypothetical protein PHAVU_007G234100g           66.6    2e-10   
ref|XP_010679531.1|  PREDICTED: cysteine proteinase COT44-like        65.9    2e-10   
ref|XP_010093524.1|  Germination-specific cysteine protease 1         65.9    2e-10   
ref|NP_974341.1|  putative cysteine proteinase                        65.1    2e-10   
gb|AFO83613.1|  papain-like cysteine protease                         65.9    3e-10   
gb|AFW59666.1|  hypothetical protein ZEAMMB73_680472                  63.5    3e-10   
gb|ABK24233.1|  unknown                                               66.2    3e-10   
ref|XP_008678577.1|  PREDICTED: oryzain alpha chain-like              65.9    3e-10   
ref|XP_002883178.1|  hypothetical protein ARALYDRAFT_479457           65.9    3e-10   
gb|AFW59668.1|  LOW QUALITY PROTEIN: cysteine protease 1              65.9    3e-10   
ref|NP_001149658.1|  cysteine protease 1 precursor                    65.9    3e-10   
dbj|BAF02547.1|  triticain beta                                       65.9    4e-10   
ref|XP_009372437.1|  PREDICTED: cysteine proteinase COT44-like        65.1    4e-10   
ref|XP_004231872.1|  PREDICTED: zingipain-2-like                      65.1    4e-10   
ref|NP_001148706.1|  cysteine protease 1 precursor                    65.5    5e-10   
gb|AAM65468.1|  cysteine proteinase                                   65.1    5e-10   
gb|AFG67671.1|  hypothetical protein CL1374Contig1_05                 61.2    5e-10   
gb|AEV41026.1|  putative cysteine protease                            65.1    6e-10   
gb|AEV40975.1|  putative cysteine protease                            65.1    6e-10   
ref|XP_009128675.1|  PREDICTED: probable cysteine proteinase At4g...  64.7    6e-10   
ref|NP_566634.2|  putative cysteine proteinase                        64.7    7e-10   
dbj|BAC43113.1|  putative cysteine proteinase RD21A precursor         64.3    7e-10   
ref|XP_006297656.1|  hypothetical protein CARUB_v10013678mg           65.1    7e-10   
gb|AAL60578.1|AF454956_1  senescence-associated cysteine protease     64.7    7e-10   
ref|XP_010487882.1|  PREDICTED: probable cysteine proteinase At3g...  63.5    7e-10   
ref|XP_006339859.1|  PREDICTED: cysteine proteinase RD21a-like        64.3    8e-10   
gb|AFW59667.1|  hypothetical protein ZEAMMB73_680472                  63.9    9e-10   
ref|XP_006283942.1|  hypothetical protein CARUB_v10005061mg           64.3    9e-10   
dbj|BAH11164.1|  cysteine protease                                    64.7    9e-10   
emb|CDY46179.1|  BnaA05g20660D                                        64.7    9e-10   
ref|NP_566633.1|  Granulin repeat cysteine protease family protein    64.3    1e-09   
gb|EPS63179.1|  hypothetical protein M569_11610                       62.8    1e-09   
ref|XP_006415025.1|  hypothetical protein EUTSA_v10007664mg           64.3    1e-09   
ref|XP_008796668.1|  PREDICTED: oryzain alpha chain-like              64.3    1e-09   
ref|XP_004963406.1|  PREDICTED: cysteine protease 1-like              63.9    1e-09   
ref|XP_006406504.1|  hypothetical protein EUTSA_v10020714mg           63.9    1e-09   
dbj|BAJ33895.1|  unnamed protein product                              63.5    2e-09   
ref|XP_006415023.1|  hypothetical protein EUTSA_v10007931mg           63.5    2e-09   
ref|XP_006396922.1|  hypothetical protein EUTSA_v10028681mg           63.5    2e-09   
emb|CAA20473.1|  cysteine proteinase-like protein                     63.2    2e-09   
ref|XP_009145796.1|  PREDICTED: probable cysteine proteinase At3g...  63.5    2e-09   
ref|XP_008796470.1|  PREDICTED: oryzain alpha chain-like              63.5    2e-09   
ref|NP_567686.2|  putative cysteine proteinase                        62.8    2e-09   
ref|XP_009109364.1|  PREDICTED: cysteine proteinase COT44-like        63.2    2e-09   
ref|XP_002447300.1|  hypothetical protein SORBIDRAFT_06g032360        63.5    3e-09   
ref|XP_009137836.1|  PREDICTED: cysteine proteinase COT44             62.8    3e-09   
emb|CDX75633.1|  BnaA01g00690D                                        62.8    3e-09   
emb|CDX69285.1|  BnaC01g01680D                                        62.8    3e-09   
ref|XP_004141903.1|  PREDICTED: germination-specific cysteine pro...  62.8    3e-09   
emb|CDY44047.1|  BnaA08g15590D                                        62.8    3e-09   
ref|XP_009128676.1|  PREDICTED: probable cysteine proteinase At4g...  62.8    3e-09   
ref|XP_002867702.1|  hypothetical protein ARALYDRAFT_329301           62.4    3e-09   
gb|KFK31907.1|  hypothetical protein AALP_AA6G174500                  62.4    4e-09   
dbj|BAG50406.1|  peptidase                                            60.5    4e-09   
gb|AEW08726.1|  hypothetical protein CL1374Contig1_05                 58.9    4e-09   
ref|XP_010435084.1|  PREDICTED: probable cysteine proteinase At4g...  62.4    4e-09   
ref|XP_010064175.1|  PREDICTED: cysteine proteinase RD21a-like        60.1    4e-09   
ref|XP_009137125.1|  PREDICTED: zingipain-2                           62.0    5e-09   
emb|CDY63262.1|  BnaCnng41770D                                        60.8    5e-09   
ref|XP_010548429.1|  PREDICTED: germination-specific cysteine pro...  62.0    5e-09   
emb|CDX99227.1|  BnaC05g33420D                                        62.4    6e-09   
ref|XP_009420643.1|  PREDICTED: oryzain alpha chain-like              62.4    6e-09   
gb|AFG67672.1|  hypothetical protein CL1374Contig1_05                 58.2    6e-09   
gb|AAC49455.1|  Pseudotzain                                           62.0    6e-09   
ref|XP_002989790.1|  hypothetical protein SELMODRAFT_184826           61.6    6e-09   
ref|XP_008440309.1|  PREDICTED: cysteine proteinase COT44-like        61.6    7e-09   
gb|AEW08725.1|  hypothetical protein CL1374Contig1_05                 58.2    7e-09   
ref|XP_006291187.1|  hypothetical protein CARUB_v10017312mg           62.0    7e-09   
emb|CDY22445.1|  BnaC03g61580D                                        61.6    8e-09   
gb|ACC91281.1|  putative cysteine proteinase                          61.2    8e-09   
emb|CAB17074.1|  cysteine proteinase precursor                        61.6    8e-09   
ref|XP_010433893.1|  PREDICTED: zingipain-2-like                      61.2    8e-09   
ref|XP_006285150.1|  hypothetical protein CARUB_v10006494mg           61.2    8e-09   
gb|AAB68374.1|  cysteine endopeptidase 1                              61.2    8e-09   
ref|XP_006855225.1|  hypothetical protein AMTR_s00051p00208220        62.0    9e-09   
ref|XP_006287995.1|  hypothetical protein CARUB_v10001228mg           61.2    9e-09   
emb|CDX95456.1|  BnaC01g33480D                                        61.2    9e-09   
ref|XP_010445171.1|  PREDICTED: zingipain-2-like                      61.2    1e-08   
gb|AHY28813.1|  cysteine protease                                     59.3    1e-08   
gb|AAW66796.1|  cysteine protease                                     58.9    1e-08   
ref|XP_010422085.1|  PREDICTED: probable cysteine proteinase At4g...  60.8    1e-08   
gb|AHY28814.1|  cysteine protease                                     58.9    1e-08   
ref|XP_002990132.1|  hypothetical protein SELMODRAFT_428615           60.8    1e-08   
ref|XP_006413545.1|  hypothetical protein EUTSA_v10027165mg           60.8    1e-08   
gb|AIF75887.1|  cysteine protease                                     58.9    1e-08   
ref|XP_010448692.1|  PREDICTED: zingipain-2-like                      60.8    1e-08   
gb|AIF75886.1|  cysteine protease                                     58.9    1e-08   
gb|ABS83496.1|  cysteine protease                                     58.5    2e-08   
dbj|BAF00916.1|  cysteine proteinase                                  60.5    2e-08   
gb|ABZ69059.1|  cysteine protease                                     58.5    2e-08   
ref|NP_195406.2|  cysteine proteinase1                                60.5    2e-08   
ref|XP_010422086.1|  PREDICTED: probable cysteine proteinase At4g...  60.5    2e-08   
gb|AAW66799.1|  cysteine protease                                     58.5    2e-08   
ref|XP_009111886.1|  PREDICTED: probable cysteine proteinase At3g...  60.8    2e-08   
emb|CDY50154.1|  BnaA01g26140D                                        60.8    2e-08   
ref|XP_009111878.1|  PREDICTED: probable cysteine proteinase At3g...  60.8    2e-08   
gb|AAW66797.1|  cysteine protease                                     58.5    2e-08   
gb|AAW66794.1|  cysteine protease                                     58.5    2e-08   
gb|AAW66801.1|  cysteine protease                                     58.5    2e-08   
ref|XP_010487883.1|  PREDICTED: probable cysteine proteinase At3g...  60.5    2e-08   
gb|AFG67670.1|  hypothetical protein CL1374Contig1_05                 57.0    2e-08   
emb|CDY50156.1|  BnaA01g26160D                                        59.7    2e-08   
gb|EPS64955.1|  cysteine protease                                     58.2    2e-08   
sp|Q94B08.2|GCP1_ARATH  RecName: Full=Germination-specific cystei...  60.5    2e-08   
gb|ABZ69061.1|  cysteine protease                                     58.5    2e-08   
ref|XP_006396923.1|  hypothetical protein EUTSA_v10028733mg           60.1    3e-08   
gb|ACO57104.1|  cysteine protease                                     57.8    3e-08   
gb|AAW66804.1|  cysteine protease                                     57.8    3e-08   
gb|ABK24495.1|  unknown                                               60.1    3e-08   
ref|XP_006297986.1|  hypothetical protein CARUB_v10014028mg           59.7    3e-08   
ref|XP_009115337.1|  PREDICTED: probable cysteine proteinase At4g...  59.7    4e-08   
gb|AFB33876.1|  hypothetical protein CL1374Contig1_05                 56.2    4e-08   
ref|NP_567376.1|  putative cysteine proteinase                        59.3    5e-08   
ref|XP_009412959.1|  PREDICTED: oryzain alpha chain-like              59.3    5e-08   
gb|AAM13065.1|  drought-inducible cysteine proteinase RD21A precu...  59.3    5e-08   
gb|AIF75890.1|  cysteine protease                                     57.4    5e-08   
ref|XP_010455537.1|  PREDICTED: probable cysteine proteinase At4g...  59.3    5e-08   
ref|XP_009388208.1|  PREDICTED: oryzain alpha chain-like              58.9    5e-08   
ref|XP_010932205.1|  PREDICTED: oryzain alpha chain-like              59.3    6e-08   
ref|XP_010455538.1|  PREDICTED: probable cysteine proteinase At4g...  58.9    6e-08   
gb|AHX59270.1|  procerain B                                           58.9    6e-08   
ref|XP_002872576.1|  hypothetical protein ARALYDRAFT_489965           58.9    8e-08   
ref|XP_010435073.1|  PREDICTED: probable cysteine proteinase At4g...  58.5    8e-08   
gb|EPS57317.1|  cysteine proteinase                                   55.5    8e-08   
ref|XP_007155893.1|  hypothetical protein PHAVU_003G240800g           58.5    9e-08   
ref|XP_010437247.1|  PREDICTED: germination-specific cysteine pro...  58.5    1e-07   
ref|XP_010432076.1|  PREDICTED: germination-specific cysteine pro...  58.5    1e-07   
ref|NP_567377.1|  putative cysteine proteinase                        58.2    1e-07   
ref|XP_010466086.1|  PREDICTED: probable cysteine proteinase At3g...  58.2    1e-07   
ref|XP_002868998.1|  cysteine proteinase                              58.2    1e-07   
emb|CDY50157.1|  BnaA01g26170D                                        58.2    1e-07   
ref|XP_010927504.1|  PREDICTED: oryzain alpha chain-like              58.2    2e-07   
ref|XP_004971418.1|  PREDICTED: xylem cysteine proteinase 2-like      57.8    2e-07   
gb|KFK39254.1|  hypothetical protein AALP_AA3G220300                  57.4    2e-07   
emb|CDX95457.1|  BnaC01g33490D                                        57.8    2e-07   
emb|CDY37617.1|  BnaCnng08320D                                        57.8    2e-07   
ref|NP_001054213.1|  Os04g0670500                                     57.8    2e-07   
gb|EMT08475.1|  Oryzain alpha chain                                   57.4    2e-07   
emb|CAH67695.1|  H0624F09.3                                           57.8    2e-07   
ref|XP_006411912.1|  hypothetical protein EUTSA_v10025483mg           57.4    2e-07   
gb|AIE88271.1|  hypothetical protein OG_BBa0063K01.2                  57.4    3e-07   
emb|CDX95451.1|  BnaC01g33430D                                        57.4    3e-07   
gb|EPS58726.1|  cysteine proteinase                                   55.1    3e-07   
gb|KFK30309.1|  hypothetical protein AALP_AA7G245200                  57.0    3e-07   
ref|XP_006384862.1|  XYLEM CYSTEINE PEPTIDASE 1 family protein        56.6    4e-07   
sp|P00784.1|PAPA1_CARPA  RecName: Full=Papain; AltName: Full=Papa...  56.6    4e-07   
ref|XP_002872575.1|  hypothetical protein ARALYDRAFT_911472           56.6    4e-07   
ref|XP_002883179.1|  hypothetical protein ARALYDRAFT_318695           55.8    5e-07   
ref|XP_009145795.1|  PREDICTED: probable cysteine proteinase At3g...  56.2    6e-07   
emb|CDX75496.1|  BnaA01g02060D                                        56.2    6e-07   
gb|KFK22654.1|  hypothetical protein AALP_AAs45238U000100             55.8    7e-07   
emb|CDY46178.1|  BnaA05g20650D                                        55.8    7e-07   
ref|XP_002437487.1|  hypothetical protein SORBIDRAFT_10g027980        55.8    7e-07   
sp|P05994.3|PAPA4_CARPA  RecName: Full=Papaya proteinase 4; AltNa...  55.8    7e-07   
ref|XP_009102734.1|  PREDICTED: xylem cysteine proteinase 1           55.8    8e-07   
ref|XP_010446685.1|  PREDICTED: germination-specific cysteine pro...  55.8    9e-07   
ref|XP_010412496.1|  PREDICTED: probable cysteine proteinase At3g...  55.5    9e-07   
ref|XP_010436251.1|  PREDICTED: xylem cysteine proteinase 1-like      54.7    1e-06   
pdb|3TNX|A  Chain A, Structure Of The Precursor Of A Thermostable...  55.1    1e-06   
ref|XP_010090710.1|  Xylem cysteine proteinase 1                      54.3    2e-06   
ref|XP_007043092.1|  Xylem cysteine peptidase 1                       54.3    2e-06   
ref|XP_006289222.1|  hypothetical protein CARUB_v10002678mg           54.3    3e-06   
ref|XP_011040826.1|  PREDICTED: xylem cysteine proteinase 1           54.3    3e-06   
ref|XP_006422409.1|  hypothetical protein CICLE_v10028739mg           54.3    3e-06   
ref|XP_009391873.1|  PREDICTED: xylem cysteine proteinase 1-like      53.9    3e-06   
ref|XP_006849990.1|  hypothetical protein AMTR_s00022p00165270        53.9    3e-06   
ref|XP_010928427.1|  PREDICTED: xylem cysteine proteinase 2-like      53.9    3e-06   
gb|EPS62067.1|  cysteine proteinase                                   53.5    3e-06   
gb|ACN36881.1|  unknown                                               53.5    4e-06   
ref|XP_007135981.1|  hypothetical protein PHAVU_009G008200g           53.5    4e-06   
gb|ABI30272.1|  VXH-A                                                 53.5    4e-06   
gb|ABI30275.1|  VS-A                                                  53.5    4e-06   
ref|NP_974687.1|  xylem cysteine proteinase 1                         53.1    4e-06   
ref|XP_006412113.1|  hypothetical protein EUTSA_v10025568mg           53.1    5e-06   
gb|AFJ15103.1|  mexicain-like cystein protease                        53.1    6e-06   
sp|P10056.2|PAPA3_CARPA  RecName: Full=Caricain; AltName: Full=Pa...  53.1    6e-06   
emb|CDX69132.1|  BnaC01g03210D                                        53.1    6e-06   
dbj|BAD29956.1|  cysteine protease                                    53.1    6e-06   
ref|NP_001045533.2|  Os01g0971400                                     53.1    6e-06   
ref|XP_002437491.1|  hypothetical protein SORBIDRAFT_10g028010        53.1    6e-06   
emb|CAQ00103.1|  papain-like cysteine proteinase                      53.1    7e-06   
ref|XP_002437490.1|  hypothetical protein SORBIDRAFT_10g028000        53.1    7e-06   
gb|KDP47019.1|  hypothetical protein JCGZ_10746                       53.1    7e-06   
emb|CAA49504.1|  papaya proteinase omega                              53.1    7e-06   
ref|XP_002980210.1|  hypothetical protein SELMODRAFT_153766           53.1    7e-06   
ref|NP_567983.1|  xylem cysteine proteinase 1                         52.8    7e-06   
ref|XP_002963113.1|  hypothetical protein SELMODRAFT_270344           53.1    7e-06   
gb|EAZ32361.1|  hypothetical protein OsJ_16571                        53.1    8e-06   



>gb|AAK48495.1|AF259983_1 putative cysteine protease [Ipomoea batatas]
Length=462

 Score =   141 bits (355),  Expect = 2e-37, Method: Composition-based stats.
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSIITYDEEHPAKGLSR+DEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID
Sbjct  23   DMSIITYDEEHPAKGLSRSDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  82

Query  287  EQNSR  301
            EQNSR
Sbjct  83   EQNSR  87



>gb|KJB14608.1| hypothetical protein B456_002G133800 [Gossypium raimondii]
Length=341

 Score =   105 bits (261),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 48/68 (71%), Positives = 58/68 (85%), Gaps = 3/68 (4%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLS--RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRY  280
            DMSII+YDE HP K  S  RTD+EVMA+YE WLV+HGK+YNGL GEK++RF+IFKDNLR+
Sbjct  23   DMSIISYDETHPDKSTSSWRTDDEVMAMYEEWLVKHGKTYNGL-GEKERRFQIFKDNLRF  81

Query  281  IDEQNSRE  304
            IDE N+ E
Sbjct  82   IDEHNADE  89



>dbj|BAF46304.1| cysteine proteinase precursor [Ipomoea nil]
Length=474

 Score =   105 bits (263),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 46/66 (70%), Positives = 59/66 (89%), Gaps = 1/66 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSIITYD++HPAKGL R+++EV  ++ESWLV+HGKSYN +  EKDKRF+IF+DNL+YID
Sbjct  24   DMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKSYNAV-DEKDKRFKIFRDNLKYID  82

Query  287  EQNSRE  304
            E+NS E
Sbjct  83   EKNSLE  88



>ref|XP_011069730.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Sesamum 
indicum]
Length=471

 Score =   105 bits (261),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 47/64 (73%), Positives = 56/64 (88%), Gaps = 1/64 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+YDE H   G  R+DEEVM++YESW+V+HGKSYN L GEK+KRFEIFKDNLRYI+
Sbjct  29   DMSIISYDESHGGPGFVRSDEEVMSMYESWMVKHGKSYNAL-GEKEKRFEIFKDNLRYIE  87

Query  287  EQNS  298
            EQN+
Sbjct  88   EQNA  91



>ref|NP_001234324.1| low-temperature-induced cysteine proteinase precursor [Solanum 
lycopersicum]
 gb|AAD48496.1|AF172856_1 cysteine protease TDI-65 [Solanum lycopersicum]
 emb|CAA05894.1| CYP1 [Solanum lycopersicum]
 emb|CEL26633.1| cysteine protease [Solanum lycopersicum]
Length=466

 Score =   104 bits (259),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 50/64 (78%), Positives = 55/64 (86%), Gaps = 4/64 (6%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+YDE H  +   RTD+EV ALYESWL+EHGKSYN L GEKDKRF+IFKDNLRYID
Sbjct  26   DMSIISYDETHIHR---RTDDEVSALYESWLIEHGKSYNAL-GEKDKRFQIFKDNLRYID  81

Query  287  EQNS  298
            EQNS
Sbjct  82   EQNS  85



>gb|KJB14610.1| hypothetical protein B456_002G133800 [Gossypium raimondii]
Length=457

 Score =   104 bits (259),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 48/68 (71%), Positives = 58/68 (85%), Gaps = 3/68 (4%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLS--RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRY  280
            DMSII+YDE HP K  S  RTD+EVMA+YE WLV+HGK+YNGL GEK++RF+IFKDNLR+
Sbjct  23   DMSIISYDETHPDKSTSSWRTDDEVMAMYEEWLVKHGKTYNGL-GEKERRFQIFKDNLRF  81

Query  281  IDEQNSRE  304
            IDE N+ E
Sbjct  82   IDEHNADE  89



>gb|KJB14609.1| hypothetical protein B456_002G133800 [Gossypium raimondii]
Length=477

 Score =   103 bits (258),  Expect = 7e-24, Method: Composition-based stats.
 Identities = 48/68 (71%), Positives = 58/68 (85%), Gaps = 3/68 (4%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLS--RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRY  280
            DMSII+YDE HP K  S  RTD+EVMA+YE WLV+HGK+YNGL GEK++RF+IFKDNLR+
Sbjct  23   DMSIISYDETHPDKSTSSWRTDDEVMAMYEEWLVKHGKTYNGL-GEKERRFQIFKDNLRF  81

Query  281  IDEQNSRE  304
            IDE N+ E
Sbjct  82   IDEHNADE  89



>dbj|BAE80740.1| cysteine proteinase [Platycodon grandiflorus]
Length=462

 Score =   103 bits (257),  Expect = 9e-24, Method: Composition-based stats.
 Identities = 47/66 (71%), Positives = 55/66 (83%), Gaps = 1/66 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII YD  H +K   RTD+EVMA+YESWLV+HGKSYN L GEK+KRF+IFKDNLR+ID
Sbjct  24   DMSIINYDATHASKSSWRTDDEVMAMYESWLVKHGKSYNAL-GEKEKRFQIFKDNLRFID  82

Query  287  EQNSRE  304
            E N+ E
Sbjct  83   EHNAEE  88



>gb|AGV15823.1| cysteine protease CP15 [Nicotiana tabacum]
Length=474

 Score =   103 bits (257),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 50/67 (75%), Positives = 56/67 (84%), Gaps = 4/67 (6%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLS---RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLR  277
            DMSII+Y+E+H   G S   RTD+EVM+LYESWLVEH K YN LG EKDKRF+IFKDNLR
Sbjct  28   DMSIISYNEKHHTNGESTVWRTDDEVMSLYESWLVEHKKVYNALG-EKDKRFQIFKDNLR  86

Query  278  YIDEQNS  298
            YIDEQNS
Sbjct  87   YIDEQNS  93



>ref|XP_007017153.1| Granulin repeat cysteine protease family protein [Theobroma cacao]
 gb|EOY14378.1| Granulin repeat cysteine protease family protein [Theobroma cacao]
Length=466

 Score =   103 bits (256),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 47/66 (71%), Positives = 58/66 (88%), Gaps = 3/66 (5%)
 Frame = +2

Query  107  DMSIITYDEEHP--AKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRY  280
            DMSII+YDE HP  +K + RTD+EVMA+YE WLV+HGK+YNGL GEK++RFEIFKDNLR+
Sbjct  23   DMSIISYDEGHPDKSKSIWRTDDEVMAMYEEWLVKHGKAYNGL-GEKERRFEIFKDNLRF  81

Query  281  IDEQNS  298
            IDE N+
Sbjct  82   IDEHNA  87



>gb|KHG05637.1| Cysteinease RD21a -like protein [Gossypium arboreum]
Length=457

 Score =   102 bits (253),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 47/68 (69%), Positives = 57/68 (84%), Gaps = 3/68 (4%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLS--RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRY  280
            DMSII+YDE HP K  S  RTD+EVMA+YE WLV+HGK+YNGL GEK++R +IFKDNLR+
Sbjct  23   DMSIISYDEAHPDKSTSSWRTDDEVMAMYEEWLVKHGKTYNGL-GEKERRLQIFKDNLRF  81

Query  281  IDEQNSRE  304
            IDE N+ E
Sbjct  82   IDEHNADE  89



>ref|XP_006342644.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Solanum 
tuberosum]
Length=466

 Score =   102 bits (253),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 49/64 (77%), Positives = 54/64 (84%), Gaps = 4/64 (6%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+YDE H      RTD+EV ALYESWL+EHGKSYN L GEKDKRF+IFKDNL+YID
Sbjct  26   DMSIISYDETHIHH---RTDDEVSALYESWLIEHGKSYNAL-GEKDKRFQIFKDNLKYID  81

Query  287  EQNS  298
            EQNS
Sbjct  82   EQNS  85



>gb|KHG12125.1| Cysteinease RD21a -like protein [Gossypium arboreum]
Length=615

 Score =   103 bits (256),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 47/68 (69%), Positives = 57/68 (84%), Gaps = 3/68 (4%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLS--RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRY  280
            DMSII+YDE HP K  S  RTD+EVM +YE WLV+HGK+YNGL GEK++RF+IFKDNLR+
Sbjct  23   DMSIISYDEGHPDKSKSSWRTDDEVMVMYEEWLVKHGKAYNGL-GEKERRFKIFKDNLRF  81

Query  281  IDEQNSRE  304
            IDE N+ E
Sbjct  82   IDEHNANE  89



>ref|XP_006354848.1| PREDICTED: cysteine proteinase RD21a-like [Solanum tuberosum]
Length=471

 Score =   102 bits (253),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 46/64 (72%), Positives = 54/64 (84%), Gaps = 1/64 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+Y+E+H   G  RTD+EVM+LYESWLVEH K YN L GEKDKRF+IFKDNL+YID
Sbjct  28   DMSIISYNEKHHKIGAGRTDDEVMSLYESWLVEHKKVYNAL-GEKDKRFQIFKDNLKYID  86

Query  287  EQNS  298
            E N+
Sbjct  87   EHNA  90



>ref|XP_009775102.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Nicotiana 
sylvestris]
Length=473

 Score =   101 bits (251),  Expect = 7e-23, Method: Composition-based stats.
 Identities = 49/67 (73%), Positives = 55/67 (82%), Gaps = 4/67 (6%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLS---RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLR  277
            DMSII+Y+E+H   G S   RTD+EVM+LYESWLVEH K YN L GEKDKRF+IFKDNLR
Sbjct  28   DMSIISYNEKHHTNGESTVWRTDDEVMSLYESWLVEHKKVYNAL-GEKDKRFQIFKDNLR  86

Query  278  YIDEQNS  298
            YIDE NS
Sbjct  87   YIDEHNS  93



>emb|CDP01294.1| unnamed protein product [Coffea canephora]
Length=465

 Score =   101 bits (251),  Expect = 7e-23, Method: Composition-based stats.
 Identities = 50/65 (77%), Positives = 54/65 (83%), Gaps = 2/65 (3%)
 Frame = +2

Query  107  DMSIITYDEEH-PAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYI  283
            DMSI++Y   +    G  RTDEEVMALYE WLV+HGKSYNGL GEKDKRFEIFKDNLRYI
Sbjct  20   DMSILSYGNANLKTSGSGRTDEEVMALYEEWLVKHGKSYNGL-GEKDKRFEIFKDNLRYI  78

Query  284  DEQNS  298
            DEQNS
Sbjct  79   DEQNS  83



>ref|XP_004238129.1| PREDICTED: low-temperature-induced cysteine proteinase [Solanum 
lycopersicum]
Length=472

 Score =   101 bits (251),  Expect = 8e-23, Method: Composition-based stats.
 Identities = 45/64 (70%), Positives = 54/64 (84%), Gaps = 1/64 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+Y+E+H   G  RTD+EVM++YESWLVEH K YN L GEKDKRF+IFKDNL+YID
Sbjct  29   DMSIISYNEKHHTIGAGRTDDEVMSMYESWLVEHKKVYNAL-GEKDKRFQIFKDNLKYID  87

Query  287  EQNS  298
            E N+
Sbjct  88   EHNA  91



>ref|XP_009604895.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Nicotiana 
tomentosiformis]
Length=473

 Score =   100 bits (250),  Expect = 9e-23, Method: Composition-based stats.
 Identities = 48/67 (72%), Positives = 56/67 (84%), Gaps = 4/67 (6%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLS---RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLR  277
            DMSII+Y+E+H   G S   RTD+E+++LYESWLVEH K YN LG EKDKRF+IFKDNLR
Sbjct  27   DMSIISYNEKHHTNGESTVWRTDDEIVSLYESWLVEHKKVYNALG-EKDKRFQIFKDNLR  85

Query  278  YIDEQNS  298
            YIDEQNS
Sbjct  86   YIDEQNS  92



>gb|KJB58557.1| hypothetical protein B456_009G214900 [Gossypium raimondii]
Length=467

 Score =   100 bits (250),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 47/68 (69%), Positives = 56/68 (82%), Gaps = 3/68 (4%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLS--RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRY  280
            DMSII+YDE HP K  S  RTD+EVM +YE WLV+HGK+YNGL GEK++RF+IFKDNLR+
Sbjct  23   DMSIISYDEGHPDKSKSSWRTDDEVMVMYEEWLVKHGKAYNGL-GEKERRFKIFKDNLRF  81

Query  281  IDEQNSRE  304
            IDE N  E
Sbjct  82   IDEHNVDE  89



>gb|KJB58559.1| hypothetical protein B456_009G214900 [Gossypium raimondii]
Length=437

 Score =   100 bits (248),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 47/68 (69%), Positives = 56/68 (82%), Gaps = 3/68 (4%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLS--RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRY  280
            DMSII+YDE HP K  S  RTD+EVM +YE WLV+HGK+YNGL GEK++RF+IFKDNLR+
Sbjct  23   DMSIISYDEGHPDKSKSSWRTDDEVMVMYEEWLVKHGKAYNGL-GEKERRFKIFKDNLRF  81

Query  281  IDEQNSRE  304
            IDE N  E
Sbjct  82   IDEHNVDE  89



>ref|XP_003589135.1| Cysteine proteinase [Medicago truncatula]
 gb|AES59386.1| papain family cysteine protease [Medicago truncatula]
Length=457

 Score =   100 bits (249),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 46/64 (72%), Positives = 55/64 (86%), Gaps = 2/64 (3%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYI  283
            DMSII+YD+ HP K  S RT++EV+ +YE WLV+HGKSYNGL GEKDKRFEIFKDNL++I
Sbjct  28   DMSIISYDKTHPDKSTSKRTNKEVLTMYEEWLVKHGKSYNGL-GEKDKRFEIFKDNLKFI  86

Query  284  DEQN  295
            DE N
Sbjct  87   DEHN  90



>gb|KJB58558.1| hypothetical protein B456_009G214900 [Gossypium raimondii]
Length=452

 Score =   100 bits (248),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 47/68 (69%), Positives = 56/68 (82%), Gaps = 3/68 (4%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLS--RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRY  280
            DMSII+YDE HP K  S  RTD+EVM +YE WLV+HGK+YNGL GEK++RF+IFKDNLR+
Sbjct  23   DMSIISYDEGHPDKSKSSWRTDDEVMVMYEEWLVKHGKAYNGL-GEKERRFKIFKDNLRF  81

Query  281  IDEQNSRE  304
            IDE N  E
Sbjct  82   IDEHNVDE  89



>ref|NP_001274877.1| low-temperature-induced cysteine proteinase-like precursor [Solanum 
tuberosum]
 emb|CAB53515.1| cysteine protease [Solanum tuberosum]
Length=466

 Score =   100 bits (249),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 48/64 (75%), Positives = 54/64 (84%), Gaps = 4/64 (6%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+YDE H      R+D+EV ALYESWL+EHGKSYN L GEKDKRF+IFKDNL+YID
Sbjct  26   DMSIISYDETHIHH---RSDDEVSALYESWLIEHGKSYNAL-GEKDKRFQIFKDNLKYID  81

Query  287  EQNS  298
            EQNS
Sbjct  82   EQNS  85



>gb|KJB63901.1| hypothetical protein B456_010G022700 [Gossypium raimondii]
Length=467

 Score =   100 bits (248),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 45/68 (66%), Positives = 57/68 (84%), Gaps = 3/68 (4%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLS--RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRY  280
            DMS+++YD+ HP + +S  RT +E+MA+YE WLV+HGK YNGLG EK+KRFEIFKDNLR+
Sbjct  23   DMSVVSYDKSHPDRSMSSWRTFDEIMAMYEDWLVKHGKVYNGLG-EKEKRFEIFKDNLRF  81

Query  281  IDEQNSRE  304
            IDE NS E
Sbjct  82   IDEHNSEE  89



>ref|XP_003589133.1| Cysteine proteinase [Medicago truncatula]
 gb|ABD32628.1| Granulin; Peptidase C1A, papain [Medicago truncatula]
 gb|AES59384.1| papain family cysteine protease [Medicago truncatula]
Length=474

 Score =   100 bits (248),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 46/64 (72%), Positives = 55/64 (86%), Gaps = 2/64 (3%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYI  283
            DMSII+YD+ HP K  S RT++EV+ +YE WLV+HGKSYNGL GEKDKRFEIFKDNL++I
Sbjct  28   DMSIISYDKTHPDKSTSKRTNKEVLTMYEEWLVKHGKSYNGL-GEKDKRFEIFKDNLKFI  86

Query  284  DEQN  295
            DE N
Sbjct  87   DEHN  90



>gb|AEZ65083.1| cysteine protease [Carica papaya]
Length=467

 Score = 99.8 bits (247),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 44/65 (68%), Positives = 55/65 (85%), Gaps = 1/65 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSI++YD+ H  K   RTD+EVMA+YE+WLV+HGK+YN L GEK+KRF IFKDNLR+ID
Sbjct  23   DMSIVSYDQRHADKSSWRTDDEVMAMYEAWLVKHGKAYNAL-GEKEKRFGIFKDNLRFID  81

Query  287  EQNSR  301
            E NS+
Sbjct  82   EHNSQ  86



>gb|AAL14614.1|AF417109_1 cysteine proteinase precursor [Vasconcellea cundinamarcensis]
Length=179

 Score = 96.3 bits (238),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 56/65 (86%), Gaps = 1/65 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSI++YD++H  K   RTD+EVMA+YE+WLV+HGK YN L GEK+KRF+IFKDNLR+ID
Sbjct  51   DMSIVSYDQKHADKSSWRTDDEVMAMYEAWLVKHGKVYNAL-GEKEKRFDIFKDNLRFID  109

Query  287  EQNSR  301
            E NS+
Sbjct  110  EHNSQ  114



>gb|KDO36580.1| hypothetical protein CISIN_1g037262mg, partial [Citrus sinensis]
Length=107

 Score = 94.0 bits (232),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 57/65 (88%), Gaps = 2/65 (3%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYI  283
            DMSI++YD+ H +K  S RTD+EVMA++E+WLV+HGK+YN L GEK+KRFEIFK+NLR+I
Sbjct  24   DMSIVSYDKTHESKSSSWRTDDEVMAMFEAWLVKHGKAYNAL-GEKEKRFEIFKENLRFI  82

Query  284  DEQNS  298
            DE NS
Sbjct  83   DEHNS  87



>gb|ABG33750.1| cysteine protease [Hevea brasiliensis]
Length=457

 Score = 98.6 bits (244),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 43/64 (67%), Positives = 54/64 (84%), Gaps = 1/64 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            D+SII+YD+ H  K   RTD+EVMA+YE WLV+HGK+YN L GEK++RFE+FKDNLR+ID
Sbjct  16   DLSIISYDQSHGTKSSWRTDDEVMAIYEDWLVKHGKAYNSL-GEKERRFEVFKDNLRFID  74

Query  287  EQNS  298
            E NS
Sbjct  75   EHNS  78



>gb|AAU81594.1| cysteine proteinase, partial [Petunia x hybrida]
Length=167

 Score = 94.7 bits (234),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 54/64 (84%), Gaps = 7/64 (11%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+YD+ H      RTD+E+M+LYE+WLV+HGKSYNGL  EKDKRF+IFKDNL YID
Sbjct  60   DMSIISYDKNH------RTDDEIMSLYEAWLVQHGKSYNGL-QEKDKRFQIFKDNLNYID  112

Query  287  EQNS  298
            EQNS
Sbjct  113  EQNS  116



>ref|XP_007160879.1| hypothetical protein PHAVU_001G024500g [Phaseolus vulgaris]
 gb|ESW32873.1| hypothetical protein PHAVU_001G024500g [Phaseolus vulgaris]
Length=466

 Score = 98.2 bits (243),  Expect = 9e-22, Method: Composition-based stats.
 Identities = 45/64 (70%), Positives = 52/64 (81%), Gaps = 1/64 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+YD  H  K   RTDEEV +LYE WLV+HGK YN L GEKDKRF+IFKDNLR+ID
Sbjct  25   DMSIISYDNAHQDKATWRTDEEVNSLYEEWLVKHGKLYNAL-GEKDKRFQIFKDNLRFID  83

Query  287  EQNS  298
            +QN+
Sbjct  84   QQNA  87



>ref|XP_010270819.1| PREDICTED: cysteine proteinase RD21a-like [Nelumbo nucifera]
Length=474

 Score = 98.2 bits (243),  Expect = 9e-22, Method: Composition-based stats.
 Identities = 45/64 (70%), Positives = 52/64 (81%), Gaps = 1/64 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSI+ YDEEH  K   R+D+EV  LYESWLV HGK+YN L GEK++RFEIFKDNLR+ID
Sbjct  30   DMSIVKYDEEHGMKTGWRSDQEVRGLYESWLVTHGKAYNAL-GEKERRFEIFKDNLRFID  88

Query  287  EQNS  298
            E NS
Sbjct  89   EHNS  92



>emb|CAB17076.1| cysteine proteinase precursor [Phaseolus vulgaris]
Length=455

 Score = 97.8 bits (242),  Expect = 9e-22, Method: Composition-based stats.
 Identities = 45/64 (70%), Positives = 52/64 (81%), Gaps = 1/64 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+YD  H  K   RTDEEV +LYE WLV+HGK YN L GEKDKRF+IFKDNLR+ID
Sbjct  14   DMSIISYDNAHQDKATWRTDEEVNSLYEEWLVKHGKLYNAL-GEKDKRFQIFKDNLRFID  72

Query  287  EQNS  298
            +QN+
Sbjct  73   QQNA  76



>ref|XP_010059895.1| PREDICTED: low-temperature-induced cysteine proteinase [Eucalyptus 
grandis]
 gb|KCW66363.1| hypothetical protein EUGRSUZ_F00184 [Eucalyptus grandis]
Length=470

 Score = 97.8 bits (242),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 45/64 (70%), Positives = 52/64 (81%), Gaps = 1/64 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+YD  H      RTD EVMALYESWLV+HGK+YN L GEK++RF+IFKDNLR+ID
Sbjct  27   DMSIISYDRAHGGDPGQRTDAEVMALYESWLVKHGKAYNAL-GEKERRFDIFKDNLRFID  85

Query  287  EQNS  298
            E NS
Sbjct  86   EHNS  89



>gb|KCW66364.1| hypothetical protein EUGRSUZ_F00184 [Eucalyptus grandis]
Length=470

 Score = 97.8 bits (242),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 45/64 (70%), Positives = 52/64 (81%), Gaps = 1/64 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+YD  H      RTD EVMALYESWLV+HGK+YN L GEK++RF+IFKDNLR+ID
Sbjct  27   DMSIISYDRAHGGDPGQRTDAEVMALYESWLVKHGKAYNAL-GEKERRFDIFKDNLRFID  85

Query  287  EQNS  298
            E NS
Sbjct  86   EHNS  89



>ref|XP_009769754.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Nicotiana 
sylvestris]
Length=470

 Score = 97.8 bits (242),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 48/64 (75%), Positives = 53/64 (83%), Gaps = 5/64 (8%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSI+TYDE        RTD+EVM+LYESWL+EHGKSYN L  EKDKRF+IFKDNLRYID
Sbjct  32   DMSILTYDENQHF----RTDDEVMSLYESWLLEHGKSYNAL-DEKDKRFQIFKDNLRYID  86

Query  287  EQNS  298
            EQNS
Sbjct  87   EQNS  90



>ref|XP_009613155.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Nicotiana 
tomentosiformis]
 gb|AGV15820.1| cysteine protease CP6 [Nicotiana tabacum]
Length=466

 Score = 97.8 bits (242),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 48/64 (75%), Positives = 53/64 (83%), Gaps = 5/64 (8%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSI+TYDE        RTD+EVM+LYESWLVEHGKSYN L  EKDKRF+IFK+NLRYID
Sbjct  28   DMSILTYDENQHF----RTDDEVMSLYESWLVEHGKSYNAL-DEKDKRFQIFKENLRYID  82

Query  287  EQNS  298
            EQNS
Sbjct  83   EQNS  86



>ref|XP_011088223.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Sesamum 
indicum]
Length=468

 Score = 97.8 bits (242),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 44/66 (67%), Positives = 53/66 (80%), Gaps = 1/66 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSIITYDE H      R++ EVMALYESWL +HGK+YN + GEK+KRFEIFKDNL++ID
Sbjct  24   DMSIITYDENHKMGSPHRSENEVMALYESWLAKHGKAYNAI-GEKEKRFEIFKDNLKFID  82

Query  287  EQNSRE  304
            E NS +
Sbjct  83   EHNSAD  88



>ref|XP_003589134.1| Cysteine proteinase [Medicago truncatula]
Length=299

 Score = 95.9 bits (237),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 55/64 (86%), Gaps = 2/64 (3%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYI  283
            DMSII+YD+ HP K  S RT++EV+ +YE WLV+HGKSYNGL GEKDKRFEIFKDNL++I
Sbjct  28   DMSIISYDKTHPDKSTSKRTNKEVLTMYEEWLVKHGKSYNGL-GEKDKRFEIFKDNLKFI  86

Query  284  DEQN  295
            DE N
Sbjct  87   DEHN  90



>ref|XP_006473275.1| PREDICTED: cysteine proteinase RD21a-like [Citrus sinensis]
Length=468

 Score = 97.1 bits (240),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 44/65 (68%), Positives = 57/65 (88%), Gaps = 2/65 (3%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYI  283
            DMSI++YD+ H +K  S RTD+EVMA++E+WLV+HGK+YN L GEK+KRFEIFK+NLR+I
Sbjct  24   DMSIVSYDKTHESKSSSWRTDDEVMAMFEAWLVKHGKAYNAL-GEKEKRFEIFKENLRFI  82

Query  284  DEQNS  298
            DE NS
Sbjct  83   DEHNS  87



>ref|XP_002284973.1| PREDICTED: low-temperature-induced cysteine proteinase [Vitis 
vinifera]
Length=467

 Score = 97.1 bits (240),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 44/64 (69%), Positives = 53/64 (83%), Gaps = 1/64 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII YDE H  K   RTDE+VMA+YE+WL +HGKSYN L GEK++RF+IFKDNLR+ID
Sbjct  25   DMSIIGYDETHGDKSSWRTDEDVMAVYEAWLAKHGKSYNAL-GEKERRFQIFKDNLRFID  83

Query  287  EQNS  298
            E N+
Sbjct  84   EHNA  87



>emb|CAN61026.1| hypothetical protein VITISV_001146 [Vitis vinifera]
Length=469

 Score = 97.1 bits (240),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 44/64 (69%), Positives = 53/64 (83%), Gaps = 1/64 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII YDE H  K   RTDE+VMA+YE+WL +HGKSYN L GEK++RF+IFKDNLR+ID
Sbjct  27   DMSIIGYDETHGDKSSWRTDEDVMAVYEAWLAKHGKSYNAL-GEKERRFQIFKDNLRFID  85

Query  287  EQNS  298
            E N+
Sbjct  86   EHNA  89



>ref|XP_011029381.1| PREDICTED: cysteine proteinase RD21a [Populus euphratica]
Length=465

 Score = 96.7 bits (239),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 44/64 (69%), Positives = 53/64 (83%), Gaps = 1/64 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+YD+ H  K   RTD+EVMA+YE WLV+HGK+YN L GEK+KRFEIFKDNL +ID
Sbjct  25   DMSIISYDQTHVTKSSWRTDDEVMAMYEEWLVKHGKNYNAL-GEKEKRFEIFKDNLMFID  83

Query  287  EQNS  298
            + NS
Sbjct  84   QHNS  87



>ref|XP_003545327.1| PREDICTED: cysteine proteinase RD21a-like [Glycine max]
Length=496

 Score = 96.7 bits (239),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 44/66 (67%), Positives = 55/66 (83%), Gaps = 3/66 (5%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+YD  H A   SR+DEE+M++YE WLV+HGK YN L GEK+KRF+IFKDNLR+ID
Sbjct  55   DMSIISYDNAHAAT--SRSDEELMSMYEQWLVKHGKVYNAL-GEKEKRFQIFKDNLRFID  111

Query  287  EQNSRE  304
            + NS+E
Sbjct  112  DHNSQE  117



>ref|XP_004230752.1| PREDICTED: cysteine proteinase RD21a-like [Solanum lycopersicum]
Length=470

 Score = 96.3 bits (238),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 45/66 (68%), Positives = 56/66 (85%), Gaps = 3/66 (5%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLS--RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRY  280
            DMSII+YDE+H   G +  RTD+EV  LYESW+V+HGK+YN + GEK+KRFEIFKDNLR+
Sbjct  22   DMSIISYDEKHADLGATNHRTDDEVKGLYESWIVKHGKNYNAI-GEKEKRFEIFKDNLRF  80

Query  281  IDEQNS  298
            IDEQN+
Sbjct  81   IDEQNA  86



>ref|XP_010549252.1| PREDICTED: cysteine proteinase RD21a-like [Tarenaya hassleriana]
Length=458

 Score = 95.9 bits (237),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 42/65 (65%), Positives = 52/65 (80%), Gaps = 1/65 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+YDE+H   G  R++ E   +YE+WLV+HGK YN L GEKD+RFEIFKDNLR+ID
Sbjct  23   DMSIISYDEKHHVSGGGRSEAETEEMYEAWLVKHGKFYNAL-GEKDRRFEIFKDNLRFID  81

Query  287  EQNSR  301
            E N+R
Sbjct  82   EHNAR  86



>gb|AJA74414.1| cysteine protease [Cicer arietinum]
Length=495

 Score = 96.3 bits (238),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 43/63 (68%), Positives = 52/63 (83%), Gaps = 1/63 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+YD+ H  K   RT++EV+ LYE WLV+HGK YNGL GEKDKRF+IFKDNL++ID
Sbjct  28   DMSIISYDKTHTDKSSHRTEKEVLTLYEEWLVKHGKVYNGL-GEKDKRFDIFKDNLKFID  86

Query  287  EQN  295
            E N
Sbjct  87   EHN  89



>gb|KDP41692.1| hypothetical protein JCGZ_16099 [Jatropha curcas]
Length=466

 Score = 95.9 bits (237),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 43/64 (67%), Positives = 54/64 (84%), Gaps = 1/64 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+YD+ H AK   RTD+EVMA+YE WL ++GK+YN L GEK++RF+IFKDNLR+ID
Sbjct  25   DMSIISYDQSHAAKSSWRTDDEVMAIYEEWLEKNGKAYNAL-GEKERRFQIFKDNLRFID  83

Query  287  EQNS  298
            E NS
Sbjct  84   EHNS  87



>ref|XP_004499026.1| PREDICTED: cysteine proteinase RD21a-like [Cicer arietinum]
Length=472

 Score = 95.9 bits (237),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 43/63 (68%), Positives = 52/63 (83%), Gaps = 1/63 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+YD+ H  K   RT++EV+ LYE WLV+HGK YNGL GEKDKRF+IFKDNL++ID
Sbjct  28   DMSIISYDKTHTDKSSHRTEKEVLTLYEEWLVKHGKVYNGL-GEKDKRFDIFKDNLKFID  86

Query  287  EQN  295
            E N
Sbjct  87   EHN  89



>emb|CAA46863.1| thiolprotease [Pisum sativum]
Length=464

 Score = 95.5 bits (236),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 41/65 (63%), Positives = 53/65 (82%), Gaps = 1/65 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DM II+YD+ HP K   RT+++V+ +YE WLV+HGK+YN L GEK+KRFEIFKDNL +ID
Sbjct  21   DMCIISYDKTHPDKSTPRTNDQVLTMYEEWLVKHGKNYNAL-GEKEKRFEIFKDNLGFID  79

Query  287  EQNSR  301
            E NS+
Sbjct  80   EHNSK  84



>ref|XP_006434711.1| hypothetical protein CICLE_v100010541mg, partial [Citrus clementina]
 gb|ESR47951.1| hypothetical protein CICLE_v100010541mg, partial [Citrus clementina]
Length=160

 Score = 91.7 bits (226),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 55/65 (85%), Gaps = 2/65 (3%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYI  283
            DMSI++YD+ H +K  S RTD+EVM ++E+W V+HGK+YN L GEK+KRFEIFKDNLR+I
Sbjct  24   DMSIVSYDKTHESKSSSWRTDDEVMGMFEAWFVKHGKAYNAL-GEKEKRFEIFKDNLRFI  82

Query  284  DEQNS  298
            DE NS
Sbjct  83   DEHNS  87



>gb|AAX84673.1| cysteine protease CP1 [Manihot esculenta]
Length=467

 Score = 95.5 bits (236),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 42/64 (66%), Positives = 52/64 (81%), Gaps = 1/64 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+YD+ H  K   RTD+EVMA+YE WLV+ GK YN L GE++KRF++FKDNLR+ID
Sbjct  26   DMSIISYDQTHATKSSWRTDDEVMAIYEEWLVKQGKVYNAL-GEREKRFQVFKDNLRFID  84

Query  287  EQNS  298
            E NS
Sbjct  85   EHNS  88



>gb|KHN22488.1| Cysteine proteinase RD21a [Glycine soja]
Length=464

 Score = 95.1 bits (235),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 43/67 (64%), Positives = 55/67 (82%), Gaps = 2/67 (3%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYI  283
            DMSII+YD  H A   + RT+EE+M++YE WLV+HGK YN L GEK+KRF+IFKDNLR+I
Sbjct  20   DMSIISYDNAHAATAATLRTEEELMSMYEQWLVKHGKVYNAL-GEKEKRFQIFKDNLRFI  78

Query  284  DEQNSRE  304
            D+ NS+E
Sbjct  79   DDHNSQE  85



>ref|XP_010244238.1| PREDICTED: cysteine proteinase RD21a-like [Nelumbo nucifera]
Length=475

 Score = 95.1 bits (235),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 43/65 (66%), Positives = 54/65 (83%), Gaps = 1/65 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+Y++EH      RT+E+V ALYE+WLV HGK+YN L GEK+KRFEIFKDNL++ID
Sbjct  30   DMSIISYNKEHGLTSGGRTNEQVKALYETWLVRHGKAYNAL-GEKEKRFEIFKDNLKFID  88

Query  287  EQNSR  301
            E NS+
Sbjct  89   EHNSQ  93



>ref|XP_009390984.1| PREDICTED: oryzain alpha chain-like [Musa acuminata subsp. malaccensis]
Length=469

 Score = 95.1 bits (235),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 40/64 (63%), Positives = 52/64 (81%), Gaps = 1/64 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+YDEEH  KGL R+ EE+  +YE WL++HG++YN L GE ++RFEIFKDNLR+ID
Sbjct  23   DMSIISYDEEHGVKGLERSKEEMRRMYEGWLIKHGRTYNAL-GEMERRFEIFKDNLRFID  81

Query  287  EQNS  298
              N+
Sbjct  82   AHNA  85



>gb|AFO83614.1| papain-like cysteine protease [Fagopyrum esculentum]
Length=468

 Score = 95.1 bits (235),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 44/70 (63%), Positives = 55/70 (79%), Gaps = 5/70 (7%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLS----RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNL  274
            D SII+YD  HP K  S    R+D+EVM+++ESWLV HGK+YN L GEK+KRF++FKDNL
Sbjct  27   DNSIISYDNTHPDKSSSSPNMRSDDEVMSMFESWLVHHGKNYNAL-GEKEKRFQVFKDNL  85

Query  275  RYIDEQNSRE  304
            R+IDE NS E
Sbjct  86   RFIDEHNSEE  95



>ref|XP_011074404.1| PREDICTED: low-temperature-induced cysteine proteinase [Sesamum 
indicum]
Length=469

 Score = 95.1 bits (235),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 46/65 (71%), Positives = 55/65 (85%), Gaps = 2/65 (3%)
 Frame = +2

Query  107  DMSIITYDEE-HPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYI  283
            DMSIITYDE  H A    R+ +EVM++YESWL++HGKSYN LG EK++RFEIFKDNLRYI
Sbjct  26   DMSIITYDENNHLAGPGLRSHDEVMSMYESWLMKHGKSYNALG-EKERRFEIFKDNLRYI  84

Query  284  DEQNS  298
            DEQN+
Sbjct  85   DEQNA  89



>gb|EPS63305.1| hypothetical protein M569_11479, partial [Genlisea aurea]
Length=453

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 42/64 (66%), Positives = 53/64 (83%), Gaps = 1/64 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSI++Y E    +   R++EE M+LYESW+VEHG+SYN L GEK++RFEIFKDNLRYID
Sbjct  24   DMSIVSYGESRGHRTPLRSEEEAMSLYESWIVEHGRSYNAL-GEKERRFEIFKDNLRYID  82

Query  287  EQNS  298
            EQN+
Sbjct  83   EQNA  86



>ref|XP_009772520.1| PREDICTED: cysteine proteinase RD21a-like [Nicotiana sylvestris]
Length=468

 Score = 94.7 bits (234),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 44/66 (67%), Positives = 55/66 (83%), Gaps = 3/66 (5%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLS--RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRY  280
            DMSII+Y+E+H   G +  RTD+EV  LYESWLV+HGK+YN + GEK+KRFEIFKDNLR+
Sbjct  22   DMSIISYNEQHGQMGTTHHRTDDEVRGLYESWLVKHGKNYNAI-GEKEKRFEIFKDNLRF  80

Query  281  IDEQNS  298
            IDE N+
Sbjct  81   IDEHNA  86



>ref|XP_006374886.1| cysteine proteinase [Populus trichocarpa]
 gb|ABK95110.1| unknown [Populus trichocarpa]
 gb|ERP52683.1| cysteine proteinase [Populus trichocarpa]
Length=465

 Score = 94.7 bits (234),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 43/64 (67%), Positives = 52/64 (81%), Gaps = 1/64 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+Y + H  K   RTD+EVMA+YE WLV+HGK+YN L GEK+KRFEIFKDNL +ID
Sbjct  25   DMSIISYHQTHATKSSWRTDDEVMAMYEEWLVKHGKNYNAL-GEKEKRFEIFKDNLMFID  83

Query  287  EQNS  298
            + NS
Sbjct  84   QHNS  87



>ref|XP_009359945.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Pyrus 
x bretschneideri]
Length=474

 Score = 94.7 bits (234),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 44/70 (63%), Positives = 55/70 (79%), Gaps = 6/70 (9%)
 Frame = +2

Query  107  DMSIITYDE-----EHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDN  271
            DMSII+YD      +  + G  RTD+EVM++YE WL EHGK+YN L GEK++RF+IFKDN
Sbjct  25   DMSIISYDSNNHLGDSKSSGSWRTDDEVMSIYEGWLAEHGKAYNAL-GEKERRFQIFKDN  83

Query  272  LRYIDEQNSR  301
            LRYIDEQNS+
Sbjct  84   LRYIDEQNSK  93



>ref|XP_009354165.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Pyrus 
x bretschneideri]
Length=469

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 43/68 (63%), Positives = 55/68 (81%), Gaps = 4/68 (6%)
 Frame = +2

Query  107  DMSIITYDE---EHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLR  277
            DMSI++YD    +  + G  RTD+EVM++YE WL EHGK+YN L GEK++RF+IFKDNLR
Sbjct  25   DMSIVSYDNNLGDGKSTGSWRTDDEVMSMYEGWLAEHGKAYNAL-GEKERRFQIFKDNLR  83

Query  278  YIDEQNSR  301
            YIDEQNS+
Sbjct  84   YIDEQNSK  91



>ref|XP_006346518.1| PREDICTED: cysteine proteinase RD21a-like [Solanum tuberosum]
Length=470

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 44/66 (67%), Positives = 56/66 (85%), Gaps = 3/66 (5%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLS--RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRY  280
            DMSII+Y E+H   G++  RTD+EV  LYESW+V+HGK+YN + GEK+KRFEIFKDNLR+
Sbjct  22   DMSIISYGEKHADLGVTSHRTDDEVKGLYESWIVKHGKNYNAI-GEKEKRFEIFKDNLRF  80

Query  281  IDEQNS  298
            IDEQN+
Sbjct  81   IDEQNA  86



>ref|XP_008393776.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Malus 
domestica]
Length=475

 Score = 94.4 bits (233),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 44/70 (63%), Positives = 55/70 (79%), Gaps = 6/70 (9%)
 Frame = +2

Query  107  DMSIITYDE-----EHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDN  271
            DMSII+YD      +  + G  RTD+EVM++YE WL EHGK+YN L GEK++RF+IFKDN
Sbjct  26   DMSIISYDSNNHVGDSKSSGSWRTDDEVMSIYEGWLXEHGKAYNAL-GEKERRFQIFKDN  84

Query  272  LRYIDEQNSR  301
            LRYIDEQNS+
Sbjct  85   LRYIDEQNSK  94



>ref|XP_003550321.1| PREDICTED: cysteine proteinase RD21a-like [Glycine max]
 gb|KHN12811.1| Cysteine proteinase RD21a [Glycine soja]
Length=476

 Score = 94.0 bits (232),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 43/67 (64%), Positives = 54/67 (81%), Gaps = 2/67 (3%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYI  283
            DMSII+YD  H  K  + RT+EE+M++YE WLV+HGK YN L GEK+KRF+IFKDNLR+I
Sbjct  32   DMSIISYDSAHADKAATLRTEEELMSMYEQWLVKHGKVYNAL-GEKEKRFQIFKDNLRFI  90

Query  284  DEQNSRE  304
            D+ NS E
Sbjct  91   DDHNSAE  97



>ref|XP_002863697.1| hypothetical protein ARALYDRAFT_917391 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39956.1| hypothetical protein ARALYDRAFT_917391 [Arabidopsis lyrata subsp. 
lyrata]
Length=463

 Score = 93.6 bits (231),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 44/69 (64%), Positives = 54/69 (78%), Gaps = 4/69 (6%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGK---SYNGLGGEKDKRFEIFKDNL  274
            DMSII+YDE H    +S R+D EV  +YE+W+VEHGK   + NGLG EKD+RFEIFKDNL
Sbjct  23   DMSIISYDENHHISTVSSRSDAEVERIYEAWMVEHGKKKMNQNGLGAEKDQRFEIFKDNL  82

Query  275  RYIDEQNSR  301
            RYIDE N++
Sbjct  83   RYIDEHNTK  91



>ref|XP_008799871.1| PREDICTED: oryzain alpha chain-like isoform X1 [Phoenix dactylifera]
 ref|XP_008799878.1| PREDICTED: oryzain alpha chain-like isoform X2 [Phoenix dactylifera]
Length=473

 Score = 93.6 bits (231),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 39/64 (61%), Positives = 52/64 (81%), Gaps = 1/64 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+YDE H  +GL R++EE+  LYE WL +HG++YN L GEK++RFEIFKDN+R+ID
Sbjct  27   DMSIISYDEAHGVRGLERSEEEMRLLYEGWLAKHGRAYNAL-GEKERRFEIFKDNVRFID  85

Query  287  EQNS  298
              N+
Sbjct  86   AHNA  89



>ref|NP_001150196.1| cysteine protease 1 precursor [Zea mays]
 gb|ACF84983.1| unknown [Zea mays]
 gb|ACF86484.1| unknown [Zea mays]
 gb|ACG38208.1| cysteine protease 1 precursor [Zea mays]
 gb|AFW59827.1| cysteine protease 1 [Zea mays]
Length=470

 Score = 93.2 bits (230),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 40/67 (60%), Positives = 52/67 (78%), Gaps = 3/67 (4%)
 Frame = +2

Query  110  MSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLG---GEKDKRFEIFKDNLRY  280
            MSIITY+EEH A+GL RT+ EV A+Y+ WL EHG++YN LG   GE+D+RF +F DNLR+
Sbjct  32   MSIITYNEEHGARGLERTEPEVRAMYDLWLAEHGRAYNALGEGEGERDRRFLVFWDNLRF  91

Query  281  IDEQNSR  301
            +D  N R
Sbjct  92   VDAHNER  98



>gb|ABQ10202.1| cysteine protease Cp4 [Actinidia deliciosa]
Length=463

 Score = 93.2 bits (230),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 40/64 (63%), Positives = 51/64 (80%), Gaps = 4/64 (6%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+YD+ HP +   RTD E MA+YE WL  HGK+YN + GEK++RFEIFKDNLR++D
Sbjct  24   DMSIISYDQTHPPQ---RTDAEAMAIYEKWLTTHGKAYNAI-GEKERRFEIFKDNLRFVD  79

Query  287  EQNS  298
            E N+
Sbjct  80   EHNA  83



>ref|XP_009396268.1| PREDICTED: oryzain alpha chain-like [Musa acuminata subsp. malaccensis]
Length=473

 Score = 93.2 bits (230),  Expect = 7e-20, Method: Composition-based stats.
 Identities = 36/64 (56%), Positives = 53/64 (83%), Gaps = 1/64 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+YDE+H  +GL R+DEEV  +Y++W+  HG++YN L GE+++RFE+FKDNLR++D
Sbjct  26   DMSIISYDEKHGVRGLERSDEEVRRMYDAWMAAHGRAYNAL-GERERRFEVFKDNLRFVD  84

Query  287  EQNS  298
              N+
Sbjct  85   AHNA  88



>ref|XP_008220266.1| PREDICTED: low-temperature-induced cysteine proteinase [Prunus 
mume]
Length=472

 Score = 92.8 bits (229),  Expect = 8e-20, Method: Composition-based stats.
 Identities = 42/68 (62%), Positives = 57/68 (84%), Gaps = 4/68 (6%)
 Frame = +2

Query  107  DMSIITYDEEH---PAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLR  277
            DMSII+YD+++    +K   RTDEEVM++YE WL +HGK+YNGL GEK++RF+IFKDNLR
Sbjct  25   DMSIISYDDKNVVGESKSSWRTDEEVMSIYEGWLAKHGKAYNGL-GEKERRFQIFKDNLR  83

Query  278  YIDEQNSR  301
            YID+ N++
Sbjct  84   YIDDHNAK  91



>ref|XP_007222885.1| hypothetical protein PRUPE_ppa005199mg [Prunus persica]
 gb|EMJ24084.1| hypothetical protein PRUPE_ppa005199mg [Prunus persica]
Length=472

 Score = 92.8 bits (229),  Expect = 9e-20, Method: Composition-based stats.
 Identities = 42/68 (62%), Positives = 57/68 (84%), Gaps = 4/68 (6%)
 Frame = +2

Query  107  DMSIITYDEEH---PAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLR  277
            DMSII+YD+++    +K   RTDEEVM++YE WL +HGK+YNGL GEK++RF+IFKDNLR
Sbjct  25   DMSIISYDDKNVVGESKSSWRTDEEVMSIYEGWLAKHGKAYNGL-GEKERRFQIFKDNLR  83

Query  278  YIDEQNSR  301
            YID+ N++
Sbjct  84   YIDDHNAK  91



>ref|XP_009395501.1| PREDICTED: oryzain alpha chain-like [Musa acuminata subsp. malaccensis]
Length=469

 Score = 92.8 bits (229),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 38/64 (59%), Positives = 54/64 (84%), Gaps = 1/64 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+YDEEH A+GL R++EEV  +Y++W+ EHG+ +N L GE+++RFE+FKDNLR+ID
Sbjct  25   DMSIISYDEEHGARGLERSEEEVRRMYDAWVAEHGRVHNAL-GEREQRFEVFKDNLRFID  83

Query  287  EQNS  298
              N+
Sbjct  84   AHNA  87



>dbj|BAD29957.1| cysteine protease [Daucus carota]
Length=437

 Score = 92.0 bits (227),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 43/64 (67%), Positives = 50/64 (78%), Gaps = 2/64 (3%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII YD+ H    L RTD+EVM +Y SWLV+HGKSYN L GEK+ RF+IFKDNLRYID
Sbjct  24   DMSIINYDQTH-TNSLIRTDDEVMTMYNSWLVKHGKSYNAL-GEKETRFQIFKDNLRYID  81

Query  287  EQNS  298
              N+
Sbjct  82   NHNA  85



>ref|XP_010556436.1| PREDICTED: cysteine proteinase RD21a-like [Tarenaya hassleriana]
Length=459

 Score = 92.0 bits (227),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 43/64 (67%), Positives = 51/64 (80%), Gaps = 1/64 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DM+I +Y + H AK   RTDEE MA+YE+WLV+HGK YN L GEK+KR EIFKDNLR+ID
Sbjct  23   DMTITSYGQSHVAKTDWRTDEEAMAMYEAWLVKHGKIYNEL-GEKEKRLEIFKDNLRFID  81

Query  287  EQNS  298
            E NS
Sbjct  82   EHNS  85



>ref|XP_008813817.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Phoenix 
dactylifera]
Length=469

 Score = 91.7 bits (226),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 38/64 (59%), Positives = 52/64 (81%), Gaps = 1/64 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+YDE H  +GL R++E++  LYE WL +HG++YN L GEK++RFEIFKDN+R+ID
Sbjct  25   DMSIISYDETHGVRGLERSEEDMRLLYEGWLAKHGRAYNAL-GEKERRFEIFKDNVRFID  83

Query  287  EQNS  298
              N+
Sbjct  84   AHNA  87



>ref|NP_568620.1| Granulin repeat cysteine protease family protein [Arabidopsis 
thaliana]
 dbj|BAB08269.1| cysteine protease component of protease-inhibitor complex [Arabidopsis 
thaliana]
 gb|AAL32686.1| cysteine protease component of protease-inhibitor complex [Arabidopsis 
thaliana]
 gb|AAM47980.1| cysteine protease component of protease-inhibitor complex [Arabidopsis 
thaliana]
 gb|AED94905.1| Granulin repeat cysteine protease family protein [Arabidopsis 
thaliana]
Length=463

 Score = 91.3 bits (225),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 43/69 (62%), Positives = 53/69 (77%), Gaps = 4/69 (6%)
 Frame = +2

Query  107  DMSIITYDEEHP-AKGLSRTDEEVMALYESWLVEHGK---SYNGLGGEKDKRFEIFKDNL  274
            DMSII+YDE H      SR+D EV  +YE+W+VEHGK   + NGLG EKD+RFEIFKDNL
Sbjct  23   DMSIISYDENHHITTETSRSDSEVERIYEAWMVEHGKKKMNQNGLGAEKDQRFEIFKDNL  82

Query  275  RYIDEQNSR  301
            R+IDE N++
Sbjct  83   RFIDEHNTK  91



>ref|XP_008668054.1| PREDICTED: cysteine protease 1 isoform X1 [Zea mays]
Length=457

 Score = 90.9 bits (224),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 38/64 (59%), Positives = 49/64 (77%), Gaps = 1/64 (2%)
 Frame = +2

Query  110  MSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDE  289
            MSII+Y+EEH A+GL RT+ E   LYE WL EHG++YN L GE+D+RF +F DNLR++D 
Sbjct  27   MSIISYNEEHAARGLERTEPEARTLYELWLAEHGRAYNAL-GERDRRFRVFWDNLRFVDA  85

Query  290  QNSR  301
             N R
Sbjct  86   HNER  89



>ref|NP_001150266.1| cysteine protease 1 precursor [Zea mays]
 gb|ACG38442.1| cysteine protease 1 precursor [Zea mays]
Length=462

 Score = 90.9 bits (224),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 38/64 (59%), Positives = 49/64 (77%), Gaps = 1/64 (2%)
 Frame = +2

Query  110  MSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDE  289
            MSII+Y+EEH A+GL RT+ E   LYE WL EHG++YN L GE+D+RF +F DNLR++D 
Sbjct  24   MSIISYNEEHAARGLERTEPEARTLYELWLAEHGRAYNAL-GERDRRFRVFWDNLRFVDA  82

Query  290  QNSR  301
             N R
Sbjct  83   HNER  86



>gb|ACR34204.1| unknown [Zea mays]
Length=465

 Score = 90.9 bits (224),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 38/64 (59%), Positives = 49/64 (77%), Gaps = 1/64 (2%)
 Frame = +2

Query  110  MSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDE  289
            MSII+Y+EEH A+GL RT+ E   LYE WL EHG++YN L GE+D+RF +F DNLR++D 
Sbjct  27   MSIISYNEEHAARGLERTEPEARTLYELWLAEHGRAYNAL-GERDRRFRVFWDNLRFVDA  85

Query  290  QNSR  301
             N R
Sbjct  86   HNER  89



>ref|XP_009591184.1| PREDICTED: cysteine proteinase RD21a-like [Nicotiana tomentosiformis]
Length=468

 Score = 90.5 bits (223),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 42/66 (64%), Positives = 53/66 (80%), Gaps = 3/66 (5%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLS--RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRY  280
            D SII+YDE+H   G +  RTD+EV  LYESWLV+HGK+YN + GEK++RFEIF DNLR+
Sbjct  22   DKSIISYDEQHGQMGTTHHRTDDEVRGLYESWLVKHGKNYNAI-GEKERRFEIFNDNLRF  80

Query  281  IDEQNS  298
            IDE N+
Sbjct  81   IDEHNA  86



>tpg|DAA35450.1| TPA: cysteine protease 1 [Zea mays]
Length=522

 Score = 90.9 bits (224),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 38/64 (59%), Positives = 49/64 (77%), Gaps = 1/64 (2%)
 Frame = +2

Query  110  MSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDE  289
            MSII+Y+EEH A+GL RT+ E   LYE WL EHG++YN L GE+D+RF +F DNLR++D 
Sbjct  84   MSIISYNEEHAARGLERTEPEARTLYELWLAEHGRAYNAL-GERDRRFRVFWDNLRFVDA  142

Query  290  QNSR  301
             N R
Sbjct  143  HNER  146



>ref|XP_010540378.1| PREDICTED: cysteine proteinase RD21a-like [Tarenaya hassleriana]
Length=460

 Score = 90.5 bits (223),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 49/99 (49%), Positives = 62/99 (63%), Gaps = 23/99 (23%)
 Frame = +2

Query  11   LFTTVITLSSPDMakllilslfvlaavsaaaaDMSIITYDEEH--PAKGLSRTDEEVMAL  184
            LF TVI+LSS                      DMSII+YDE+H     G  R++ +  AL
Sbjct  11   LFLTVISLSSA--------------------MDMSIISYDEKHHVSGGGGGRSEVDTAAL  50

Query  185  YESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSR  301
            YE+WLV+HGK YN LG EKD+RFEIFK+NLR+IDE N++
Sbjct  51   YEAWLVKHGKFYNALG-EKDRRFEIFKENLRFIDEHNAK  88



>ref|XP_008365104.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Malus 
domestica]
Length=472

 Score = 90.5 bits (223),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 43/68 (63%), Positives = 53/68 (78%), Gaps = 4/68 (6%)
 Frame = +2

Query  107  DMSIITYDE---EHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLR  277
            DMSII+ D    +  + G  RTD+EVM+ YE WL EHGK+YN L GEK++RF+IFKDNLR
Sbjct  25   DMSIISXDNXLGDGKSTGSWRTDDEVMSXYEGWLAEHGKAYNAL-GEKERRFQIFKDNLR  83

Query  278  YIDEQNSR  301
            YIDEQNS+
Sbjct  84   YIDEQNSK  91



>dbj|BAC75923.1| cysteine protease-1 [Helianthus annuus]
Length=461

 Score = 90.1 bits (222),  Expect = 7e-19, Method: Composition-based stats.
 Identities = 46/68 (68%), Positives = 53/68 (78%), Gaps = 5/68 (7%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLS----RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNL  274
            DMSII YD  H +   S    RTD+EV ALYESWLV+HGK+YN L GEKD+RF+IFKDNL
Sbjct  22   DMSIINYDATHMSSSSSSAPLRTDDEVNALYESWLVKHGKTYNAL-GEKDRRFQIFKDNL  80

Query  275  RYIDEQNS  298
            R+IDE NS
Sbjct  81   RFIDEHNS  88



>ref|XP_010906541.1| PREDICTED: oryzain alpha chain-like [Elaeis guineensis]
Length=470

 Score = 90.1 bits (222),  Expect = 8e-19, Method: Composition-based stats.
 Identities = 38/64 (59%), Positives = 51/64 (80%), Gaps = 1/64 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+YDE H  +GL R++EE+  LYE WL +HG++YN L GEK++RFEIFKDN+ +ID
Sbjct  24   DMSIISYDEAHGVRGLERSEEEMRILYEGWLAKHGRAYNAL-GEKERRFEIFKDNVLFID  82

Query  287  EQNS  298
              N+
Sbjct  83   AHNA  86



>gb|ABR19827.1| cysteine proteinase [Elaeis guineensis]
Length=470

 Score = 90.1 bits (222),  Expect = 8e-19, Method: Composition-based stats.
 Identities = 38/64 (59%), Positives = 51/64 (80%), Gaps = 1/64 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+YDE H  +GL R++EE+  LYE WL +HG++YN L GEK++RFEIFKDN+ +ID
Sbjct  24   DMSIISYDEAHGVRGLERSEEEMRILYEGWLAKHGRAYNAL-GEKERRFEIFKDNVLFID  82

Query  287  EQNS  298
              N+
Sbjct  83   AHNA  86



>dbj|BAD29960.1| cysteine protease [Daucus carota]
Length=460

 Score = 90.1 bits (222),  Expect = 9e-19, Method: Composition-based stats.
 Identities = 42/64 (66%), Positives = 51/64 (80%), Gaps = 4/64 (6%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSIITYD+ H    +  TD+ +MA YESWLV+HGKSYN L GEK++RF+IFKDN  YID
Sbjct  21   DMSIITYDQTH---AVGSTDDVIMAAYESWLVKHGKSYNAL-GEKEQRFQIFKDNFLYID  76

Query  287  EQNS  298
            EQN+
Sbjct  77   EQNA  80



>emb|CDO97206.1| unnamed protein product [Coffea canephora]
Length=462

 Score = 90.1 bits (222),  Expect = 9e-19, Method: Composition-based stats.
 Identities = 43/66 (65%), Positives = 53/66 (80%), Gaps = 5/66 (8%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII YD++H     S  D+EV ALYESWLV+HGK+YN L GEK+KRFEIFKDNLR+I 
Sbjct  22   DMSIIDYDKKHK----SSDDDEVKALYESWLVKHGKNYNAL-GEKEKRFEIFKDNLRFIK  76

Query  287  EQNSRE  304
            E N+++
Sbjct  77   EHNAQD  82



>ref|XP_002518705.1| cysteine protease, putative [Ricinus communis]
 gb|EEF43630.1| cysteine protease, putative [Ricinus communis]
Length=471

 Score = 89.7 bits (221),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 42/64 (66%), Positives = 50/64 (78%), Gaps = 1/64 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSI+ Y+ +H  K   RTD +V  +YE WLVEHGK+YN L GEK+KRFEIFKDNLR+ID
Sbjct  25   DMSIVDYNIKHGTKYPLRTDSQVRRMYEMWLVEHGKAYNAL-GEKEKRFEIFKDNLRFID  83

Query  287  EQNS  298
            E NS
Sbjct  84   EHNS  87



>dbj|BAD29958.1| cysteine protease [Daucus carota]
Length=496

 Score = 90.1 bits (222),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 45/63 (71%), Positives = 52/63 (83%), Gaps = 3/63 (5%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSIITYDE H A G  +TD+E   L+ESWLV HGKSYN L GE++KRF+IFK+NLRYID
Sbjct  21   DMSIITYDETH-AVGF-KTDDEATTLFESWLVTHGKSYNAL-GEEEKRFQIFKNNLRYID  77

Query  287  EQN  295
            EQN
Sbjct  78   EQN  80



>gb|ACU18172.1| unknown [Glycine max]
Length=355

 Score = 87.8 bits (216),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 39/64 (61%), Positives = 52/64 (81%), Gaps = 1/64 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII++D  H  +   RTD+EVM+++E WLV+H K YN L GEK+KRF+IFK+NLR+ID
Sbjct  19   DMSIISHDNAHADRATRRTDDEVMSMFEEWLVKHDKVYNAL-GEKEKRFQIFKNNLRFID  77

Query  287  EQNS  298
            E+NS
Sbjct  78   ERNS  81



>ref|XP_010094652.1| Cysteine proteinase RD21a [Morus notabilis]
 gb|EXB56503.1| Cysteine proteinase RD21a [Morus notabilis]
Length=463

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 41/66 (62%), Positives = 55/66 (83%), Gaps = 3/66 (5%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSI++Y+    +   SRTD+EVMA+YE+WLV+HGK YN L GEK+KRF+IFKDNLR+ID
Sbjct  27   DMSIVSYNLVDQSS--SRTDDEVMAIYEAWLVKHGKVYNAL-GEKEKRFQIFKDNLRFID  83

Query  287  EQNSRE  304
            E N+++
Sbjct  84   EHNAQD  89



>gb|KHN22490.1| Cysteine proteinase RD21a [Glycine soja]
Length=355

 Score = 87.8 bits (216),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 39/64 (61%), Positives = 52/64 (81%), Gaps = 1/64 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII++D  H  +   RTD+EVM+++E WLV+H K YN L GEK+KRF+IFK+NLR+ID
Sbjct  19   DMSIISHDNAHADRATRRTDDEVMSMFEEWLVKHDKVYNAL-GEKEKRFQIFKNNLRFID  77

Query  287  EQNS  298
            E+NS
Sbjct  78   ERNS  81



>ref|XP_004960237.1| PREDICTED: oryzain beta chain-like isoform X2 [Setaria italica]
Length=461

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 37/65 (57%), Positives = 50/65 (77%), Gaps = 1/65 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+Y+EEH A+GL RT+ E  A+Y+ WL EHG++YN L  E D+RF +F DNLR++D
Sbjct  27   DMSIISYNEEHGARGLERTEAEARAMYDLWLAEHGRAYNAL-DEHDRRFRVFWDNLRFVD  85

Query  287  EQNSR  301
              N+R
Sbjct  86   AHNAR  90



>ref|XP_004960236.1| PREDICTED: oryzain beta chain-like isoform X1 [Setaria italica]
Length=489

 Score = 89.0 bits (219),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 37/65 (57%), Positives = 50/65 (77%), Gaps = 1/65 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+Y+EEH A+GL RT+ E  A+Y+ WL EHG++YN L  E D+RF +F DNLR++D
Sbjct  27   DMSIISYNEEHGARGLERTEAEARAMYDLWLAEHGRAYNAL-DEHDRRFRVFWDNLRFVD  85

Query  287  EQNSR  301
              N+R
Sbjct  86   AHNAR  90



>gb|AAQ62999.1| oil palm polygalacturonase allergen PEST472 [Elaeis guineensis]
Length=525

 Score = 89.0 bits (219),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 38/64 (59%), Positives = 51/64 (80%), Gaps = 1/64 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+YDE H  +GL R++EE+  LYE WL +HG++ N L GEK++RFEIFKDN+R+ID
Sbjct  24   DMSIISYDEAHGVQGLERSEEEMRLLYEGWLAKHGRADNAL-GEKERRFEIFKDNVRFID  82

Query  287  EQNS  298
              N+
Sbjct  83   AHNA  86



>ref|XP_008342944.1| PREDICTED: cysteine proteinase RD21a-like [Malus domestica]
Length=473

 Score = 88.6 bits (218),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 43/67 (64%), Positives = 54/67 (81%), Gaps = 4/67 (6%)
 Frame = +2

Query  107  DMSIITYDEEH--PAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRY  280
            DMSI+ Y+E+H  PA    RT+ EV ALYESWLV+H K+YN L GEK++RFEIFKDNLR+
Sbjct  31   DMSIVDYNEKHGMPASS-DRTETEVKALYESWLVKHAKNYNAL-GEKERRFEIFKDNLRF  88

Query  281  IDEQNSR  301
            IDE N++
Sbjct  89   IDEHNNQ  95



>ref|XP_010928366.1| PREDICTED: oryzain alpha chain-like [Elaeis guineensis]
Length=465

 Score = 88.6 bits (218),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 38/64 (59%), Positives = 51/64 (80%), Gaps = 1/64 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+YDE H  +GL R++EE+  LYE WL +HG++ N L GEK++RFEIFKDN+R+ID
Sbjct  24   DMSIISYDEAHGVQGLERSEEEMRLLYEGWLAKHGRADNAL-GEKERRFEIFKDNVRFID  82

Query  287  EQNS  298
              N+
Sbjct  83   AHNA  86



>ref|XP_007042494.1| Granulin repeat cysteine protease family protein [Theobroma cacao]
 gb|EOX98325.1| Granulin repeat cysteine protease family protein [Theobroma cacao]
Length=579

 Score = 89.0 bits (219),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 39/64 (61%), Positives = 52/64 (81%), Gaps = 1/64 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII YD +H  +   RT+ ++  +YE+WLV+HGK+YNGL GEK+KRFEIFKDNL++I+
Sbjct  134  DMSIIDYDLKHGGQQQKRTETQIRRMYETWLVKHGKAYNGL-GEKEKRFEIFKDNLKFIE  192

Query  287  EQNS  298
            E NS
Sbjct  193  EHNS  196



>gb|AER60490.1| cysteine proteases [Gossypium hirsutum]
Length=371

 Score = 87.0 bits (214),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 37/63 (59%), Positives = 53/63 (84%), Gaps = 1/63 (2%)
 Frame = +2

Query  110  MSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDE  289
            +S +T ++ HP+    R+D+EVM LY+SW+++HGK+YNG+ GE++KRFEIFKDNLR+IDE
Sbjct  20   ISTLTLNQNHPSSSSWRSDDEVMGLYKSWVIQHGKAYNGI-GEEEKRFEIFKDNLRFIDE  78

Query  290  QNS  298
             NS
Sbjct  79   HNS  81



>ref|XP_006652996.1| PREDICTED: oryzain beta chain-like [Oryza brachyantha]
Length=460

 Score = 88.2 bits (217),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 38/65 (58%), Positives = 50/65 (77%), Gaps = 1/65 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+Y+EEH A+GL RT+ E  A Y+ WL E+G+SYN L GE D+RF +F DNLR++D
Sbjct  26   DMSIISYNEEHGARGLERTEAEARAAYDLWLAENGRSYNAL-GEYDRRFRVFWDNLRFVD  84

Query  287  EQNSR  301
              N+R
Sbjct  85   AHNAR  89



>ref|XP_006595983.1| PREDICTED: cysteine proteinase RD21a-like [Glycine max]
Length=250

 Score = 86.3 bits (212),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 52/64 (81%), Gaps = 1/64 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII++D  H  +   RTD+EVM+++E WLV+H K YN L GEK+KRF+IFK+NLR+ID
Sbjct  19   DMSIISHDNAHADRATRRTDDEVMSMFEEWLVKHDKVYNAL-GEKEKRFQIFKNNLRFID  77

Query  287  EQNS  298
            E+NS
Sbjct  78   ERNS  81



>ref|XP_002510170.1| cysteine protease, putative [Ricinus communis]
 gb|EEF52357.1| cysteine protease, putative [Ricinus communis]
Length=469

 Score = 88.2 bits (217),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 39/66 (59%), Positives = 53/66 (80%), Gaps = 2/66 (3%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSY--NGLGGEKDKRFEIFKDNLRY  280
            DMSI++YD+ H  K   RTD+EVMA+YE WLV++GK++  N   GEK++RF++FKDNLR+
Sbjct  25   DMSIVSYDQTHLTKSSWRTDDEVMAIYEEWLVKNGKAHSNNNALGEKERRFQVFKDNLRF  84

Query  281  IDEQNS  298
            IDE NS
Sbjct  85   IDEHNS  90



>ref|XP_002448736.1| hypothetical protein SORBIDRAFT_06g032320 [Sorghum bicolor]
 gb|EES13064.1| hypothetical protein SORBIDRAFT_06g032320 [Sorghum bicolor]
Length=467

 Score = 88.2 bits (217),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 37/64 (58%), Positives = 48/64 (75%), Gaps = 0/64 (0%)
 Frame = +2

Query  110  MSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDE  289
            MSII+Y+EEH A+GL RT+ EV A+YE WLVEHG+  + + GE D RF +F DNLR++D 
Sbjct  31   MSIISYNEEHGARGLERTEAEVRAMYELWLVEHGRRVSNVLGEHDSRFRVFWDNLRFVDA  90

Query  290  QNSR  301
             N R
Sbjct  91   HNER  94



>ref|XP_008236565.1| PREDICTED: cysteine proteinase RD21a-like [Prunus mume]
Length=476

 Score = 87.4 bits (215),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 43/66 (65%), Positives = 52/66 (79%), Gaps = 2/66 (3%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYI  283
            DMSII YDE+H     S RT+ EV ALYESWLV+H K+YN L GEK++RFEIFKDNLR++
Sbjct  30   DMSIIDYDEKHGMGVPSDRTEAEVKALYESWLVKHRKNYNAL-GEKERRFEIFKDNLRFV  88

Query  284  DEQNSR  301
            DE N +
Sbjct  89   DEHNKQ  94



>ref|XP_010691718.1| PREDICTED: cysteine proteinase RD21a-like [Beta vulgaris subsp. 
vulgaris]
Length=471

 Score = 87.4 bits (215),  Expect = 9e-18, Method: Composition-based stats.
 Identities = 41/66 (62%), Positives = 54/66 (82%), Gaps = 3/66 (5%)
 Frame = +2

Query  107  DMSIITYDEEHPAK--GLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRY  280
            DMSII+YD++H       SR+++EVM LYESWLV+H K+YN L GEK+KRF+IFKDNL++
Sbjct  30   DMSIISYDQDHHTNIVSSSRSEDEVMNLYESWLVKHRKNYNAL-GEKEKRFQIFKDNLKF  88

Query  281  IDEQNS  298
            ID+ NS
Sbjct  89   IDQHNS  94



>gb|EYU37647.1| hypothetical protein MIMGU_mgv1a005905mg [Erythranthe guttata]
Length=465

 Score = 87.0 bits (214),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 39/66 (59%), Positives = 53/66 (80%), Gaps = 6/66 (9%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSIITYDE+H      R++ + MA+YESWLV+HGK+YN + GEK+KRF+IFKDNL +++
Sbjct  25   DMSIITYDEKH-----QRSEGDAMAMYESWLVKHGKAYNAI-GEKEKRFQIFKDNLMFVE  78

Query  287  EQNSRE  304
            E NS +
Sbjct  79   EHNSAD  84



>ref|XP_010481911.1| PREDICTED: cysteine proteinase RD21a [Camelina sativa]
Length=467

 Score = 86.7 bits (213),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 43/73 (59%), Positives = 52/73 (71%), Gaps = 8/73 (11%)
 Frame = +2

Query  107  DMSIITYDEEH----PAKGLSRTDEEVMALYESWLVEHGKSY----NGLGGEKDKRFEIF  262
            DMSIITYDE+H         SR+D EV  +Y++WLVEHGK      N LG EKD+RFEIF
Sbjct  23   DMSIITYDEKHHITTTTTVTSRSDAEVERIYDAWLVEHGKKKMNQNNVLGAEKDQRFEIF  82

Query  263  KDNLRYIDEQNSR  301
            KDNLR+IDE N++
Sbjct  83   KDNLRFIDEHNTK  95



>gb|KDO79088.1| hypothetical protein CISIN_1g017419mg [Citrus sinensis]
Length=372

 Score = 85.5 bits (210),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 38/64 (59%), Positives = 49/64 (77%), Gaps = 1/64 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+YD  H      RTD+EVM +Y++WL +HGK+ NG+ G  +KRF+IFKDNLR+ID
Sbjct  26   DMSIISYDNNHDHSSSWRTDDEVMTIYQTWLAKHGKTSNGM-GHNEKRFQIFKDNLRFID  84

Query  287  EQNS  298
            E NS
Sbjct  85   EHNS  88



>ref|XP_006494485.1| PREDICTED: cysteine proteinase RD21a-like [Citrus sinensis]
Length=372

 Score = 85.5 bits (210),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 38/64 (59%), Positives = 49/64 (77%), Gaps = 1/64 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+YD  H      RTD+EVM +Y++WL +HGK+ NG+ G  +KRF+IFKDNLR+ID
Sbjct  26   DMSIISYDNNHDHSSSWRTDDEVMTIYQTWLAKHGKTSNGM-GHNEKRFQIFKDNLRFID  84

Query  287  EQNS  298
            E NS
Sbjct  85   EHNS  88



>ref|XP_007199820.1| hypothetical protein PRUPE_ppa005328mg [Prunus persica]
 gb|EMJ01019.1| hypothetical protein PRUPE_ppa005328mg [Prunus persica]
Length=466

 Score = 86.7 bits (213),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 42/66 (64%), Positives = 52/66 (79%), Gaps = 2/66 (3%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYI  283
            DMSII YD++H     S RT+ EV ALYESWLV+H K+YN L GEK++RFEIFKDNLR++
Sbjct  20   DMSIINYDDKHGMGVPSDRTEAEVKALYESWLVKHRKNYNAL-GEKERRFEIFKDNLRFV  78

Query  284  DEQNSR  301
            DE N +
Sbjct  79   DEHNKQ  84



>ref|XP_009398671.1| PREDICTED: oryzain alpha chain-like [Musa acuminata subsp. malaccensis]
Length=473

 Score = 86.7 bits (213),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 34/64 (53%), Positives = 50/64 (78%), Gaps = 1/64 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSI++Y+EEH  +GL R+++E+  +YE WL  HG++YN L GEK+ RFE+FKDNL ++D
Sbjct  26   DMSIVSYNEEHGVRGLERSEDEMRRIYEGWLARHGRAYNAL-GEKEARFEVFKDNLHFVD  84

Query  287  EQNS  298
              N+
Sbjct  85   GHNA  88



>ref|XP_003603086.1| Cysteine proteinase [Medicago truncatula]
 gb|AES73337.1| papain family cysteine protease [Medicago truncatula]
Length=474

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 39/65 (60%), Positives = 49/65 (75%), Gaps = 1/65 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGL-GGEKDKRFEIFKDNLRYI  283
            DMSII+YD+ H  K   R+D+EV  +YE W V+HGK  N + G EKDKRFEIFKDNL++I
Sbjct  27   DMSIISYDKTHSDKSSRRSDKEVKNIYEEWRVKHGKLNNNIDGSEKDKRFEIFKDNLKFI  86

Query  284  DEQNS  298
            DE N+
Sbjct  87   DEHNA  91



>gb|EYU36326.1| hypothetical protein MIMGU_mgv1a005614mg [Erythranthe guttata]
Length=477

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 44/70 (63%), Positives = 57/70 (81%), Gaps = 7/70 (10%)
 Frame = +2

Query  107  DMSIITYDEEH----PAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNL  274
            DMSII+YD ++    PA GL R+ +EV++++ESW+ EHGKSYN +G EK+KR EIFKDNL
Sbjct  32   DMSIISYDRKNNLAVPA-GL-RSHDEVVSMHESWMAEHGKSYNAVG-EKEKRLEIFKDNL  88

Query  275  RYIDEQNSRE  304
            RYIDEQN+ E
Sbjct  89   RYIDEQNAIE  98



>ref|XP_010442084.1| PREDICTED: cysteine proteinase RD21a-like [Camelina sativa]
Length=466

 Score = 85.9 bits (211),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 42/72 (58%), Positives = 52/72 (72%), Gaps = 7/72 (10%)
 Frame = +2

Query  107  DMSIITYDEEH---PAKGLSRTDEEVMALYESWLVEHGKSY----NGLGGEKDKRFEIFK  265
            DMSII+YDE+H        SR+D EV  +Y++WLVEHGK      N LG EKD+RFEIFK
Sbjct  23   DMSIISYDEKHHITTTTVTSRSDAEVERIYDAWLVEHGKKKMNQNNVLGAEKDQRFEIFK  82

Query  266  DNLRYIDEQNSR  301
            DNLR+IDE N++
Sbjct  83   DNLRFIDEHNTK  94



>ref|XP_010494270.1| PREDICTED: cysteine proteinase RD21a-like [Camelina sativa]
Length=467

 Score = 85.5 bits (210),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 42/73 (58%), Positives = 52/73 (71%), Gaps = 8/73 (11%)
 Frame = +2

Query  107  DMSIITYDEEH----PAKGLSRTDEEVMALYESWLVEHGK----SYNGLGGEKDKRFEIF  262
            DMSII+YDE+H         SR+D EV  +Y++WLVEHGK      N LG EKD+RFEIF
Sbjct  23   DMSIISYDEKHHITTTTTVTSRSDAEVERIYDAWLVEHGKKKMNQKNVLGAEKDQRFEIF  82

Query  263  KDNLRYIDEQNSR  301
            KDNLR+IDE N++
Sbjct  83   KDNLRFIDEHNTK  95



>ref|XP_009335016.1| PREDICTED: cysteine proteinase RD21a-like isoform X1 [Pyrus x 
bretschneideri]
Length=474

 Score = 85.5 bits (210),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 42/67 (63%), Positives = 52/67 (78%), Gaps = 4/67 (6%)
 Frame = +2

Query  107  DMSIITYDEEH--PAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRY  280
            DMSI+ Y+E+H  PA     T+ EV ALYESWLV+H K+YN LG EK++RFEIFKDNLR+
Sbjct  31   DMSIVDYNEKHGMPASS-DPTETEVRALYESWLVKHAKNYNALG-EKERRFEIFKDNLRF  88

Query  281  IDEQNSR  301
            IDE N +
Sbjct  89   IDEHNKQ  95



>ref|XP_009335017.1| PREDICTED: cysteine proteinase RD21a-like isoform X2 [Pyrus x 
bretschneideri]
Length=474

 Score = 85.5 bits (210),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 42/67 (63%), Positives = 52/67 (78%), Gaps = 4/67 (6%)
 Frame = +2

Query  107  DMSIITYDEEH--PAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRY  280
            DMSI+ Y+E+H  PA     T+ EV ALYESWLV+H K+YN LG EK++RFEIFKDNLR+
Sbjct  31   DMSIVDYNEKHGMPASS-DPTEPEVRALYESWLVKHAKNYNALG-EKERRFEIFKDNLRF  88

Query  281  IDEQNSR  301
            IDE N +
Sbjct  89   IDEHNKQ  95



>dbj|BAH20463.1| cysteine protease [Spinacia oleracea]
Length=473

 Score = 85.5 bits (210),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 42/67 (63%), Positives = 52/67 (78%), Gaps = 6/67 (9%)
 Frame = +2

Query  107  DMSIITYDEEH---PAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLR  277
            DMSII+YD  H   P+   SR+D+EVM +YESWLV+H K+YN L GEK+KRF IFKDNL 
Sbjct  26   DMSIISYDHNHNLLPSS--SRSDDEVMRIYESWLVQHRKNYNAL-GEKEKRFAIFKDNLE  82

Query  278  YIDEQNS  298
            +ID+ NS
Sbjct  83   FIDQHNS  89



>ref|XP_004291075.1| PREDICTED: cysteine proteinase RD21a [Fragaria vesca subsp. vesca]
Length=469

 Score = 85.1 bits (209),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 41/65 (63%), Positives = 50/65 (77%), Gaps = 2/65 (3%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDE-EVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYI  283
            DMSII YD  H +   S   + EVM+LYE WL EHGK+YNGL GEK+KRF+IFKDNL++I
Sbjct  26   DMSIIAYDNNHASSSDSGRSDDEVMSLYERWLAEHGKAYNGL-GEKEKRFQIFKDNLKFI  84

Query  284  DEQNS  298
            DE N+
Sbjct  85   DEHNA  89



>ref|XP_006393620.1| hypothetical protein EUTSA_v10011464mg [Eutrema salsugineum]
 gb|ESQ30906.1| hypothetical protein EUTSA_v10011464mg [Eutrema salsugineum]
Length=459

 Score = 85.1 bits (209),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 40/65 (62%), Positives = 49/65 (75%), Gaps = 1/65 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+YDE H      R+D EV  LYE+WLV+HGK  N L  EKD+RFEIFKDNLR+ID
Sbjct  23   DMSIISYDESHHTVSGGRSDAEVKRLYETWLVKHGKVQNSL-VEKDRRFEIFKDNLRFID  81

Query  287  EQNSR  301
            + N++
Sbjct  82   DHNAK  86



>gb|ABQ10200.1| cysteine protease Cp2 [Actinidia deliciosa]
Length=376

 Score = 84.0 bits (206),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 38/63 (60%), Positives = 49/63 (78%), Gaps = 1/63 (2%)
 Frame = +2

Query  110  MSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDE  289
            MSII Y+     K  SRTDEEVM +Y  WL +HGK+YNG+ GE+++RFEIFKDNL+++DE
Sbjct  22   MSIIDYNTNPNHKSSSRTDEEVMGIYAEWLAKHGKAYNGI-GERERRFEIFKDNLKFVDE  80

Query  290  QNS  298
             NS
Sbjct  81   HNS  83



>ref|XP_002285299.1| PREDICTED: cysteine proteinase RD21a-like [Vitis vinifera]
Length=469

 Score = 85.1 bits (209),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 40/64 (63%), Positives = 51/64 (80%), Gaps = 5/64 (8%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+Y +        RTD EVMA+YE+WLV+HGKSYN L GE+++RFEIFKDNLR+I+
Sbjct  32   DMSIISYGDRLE----KRTDAEVMAVYEAWLVKHGKSYNAL-GERERRFEIFKDNLRFIE  86

Query  287  EQNS  298
            E N+
Sbjct  87   EHNA  90



>ref|XP_008350332.1| PREDICTED: LOW QUALITY PROTEIN: cysteine proteinase RD21a-like 
[Malus domestica]
Length=462

 Score = 84.7 bits (208),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 40/64 (63%), Positives = 51/64 (80%), Gaps = 2/64 (3%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYI  283
            D+SII Y+++H     S RT+ E  ALYESWL++HGK+YN L GEK++RFEIFKDNLR+I
Sbjct  20   DVSIIDYNDKHGMTTPSDRTEPEAKALYESWLIKHGKNYNAL-GEKERRFEIFKDNLRFI  78

Query  284  DEQN  295
            DE N
Sbjct  79   DEHN  82



>gb|ABQ10204.1| cysteine protease Cp6 [Actinidia deliciosa]
Length=461

 Score = 84.7 bits (208),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 45/48 (94%), Gaps = 1/48 (2%)
 Frame = +2

Query  155  SRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNS  298
            SRTD+EVMA+YESWLV+HGKSYN + GEK+KRF+IFKDNLR+IDE N+
Sbjct  36   SRTDDEVMAMYESWLVKHGKSYNAI-GEKEKRFQIFKDNLRFIDEHNA  82



>ref|NP_001242660.1| uncharacterized protein LOC100807362 precursor [Glycine max]
 gb|ACU18666.1| unknown [Glycine max]
Length=367

 Score = 83.6 bits (205),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 38/64 (59%), Positives = 50/64 (78%), Gaps = 1/64 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+YD  H  K   ++DEEVM++YE WLV+HGK YN +  EK+KRF+IFKDNL +I+
Sbjct  26   DMSIISYDRSHADKSGWKSDEEVMSIYEEWLVKHGKVYNAV-EEKEKRFQIFKDNLNFIE  84

Query  287  EQNS  298
            E N+
Sbjct  85   EHNA  88



>gb|ABQ10198.1| actinidin Act4b [Actinidia eriantha]
Length=379

 Score = 83.6 bits (205),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 41/64 (64%), Positives = 52/64 (81%), Gaps = 5/64 (8%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            D SIITY +    K   RT++EVMA++ESWLVE+GKSYN L GEK++RFEIFKDNLR++D
Sbjct  26   DASIITYAK----KWEQRTNDEVMAMFESWLVEYGKSYNAL-GEKERRFEIFKDNLRFVD  80

Query  287  EQNS  298
            E N+
Sbjct  81   EHNA  84



>gb|KJB48624.1| hypothetical protein B456_008G078300 [Gossypium raimondii]
Length=314

 Score = 82.8 bits (203),  Expect = 9e-17, Method: Composition-based stats.
 Identities = 38/64 (59%), Positives = 54/64 (84%), Gaps = 2/64 (3%)
 Frame = +2

Query  110  MSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            +S +T ++ HP+   S R+D+EVM LY+SW+++HGK+YNG+ GE++KRFEIFKDNLR+ID
Sbjct  20   ISTLTLNQNHPSSSSSWRSDDEVMGLYKSWVIQHGKAYNGI-GEEEKRFEIFKDNLRFID  78

Query  287  EQNS  298
            E NS
Sbjct  79   EHNS  82



>gb|KHN04480.1| Cysteine proteinase RD21a [Glycine soja]
Length=360

 Score = 83.2 bits (204),  Expect = 9e-17, Method: Composition-based stats.
 Identities = 38/64 (59%), Positives = 50/64 (78%), Gaps = 1/64 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+YD  H  K   ++DEEVM++YE WLV+HGK YN +  EK+KRF+IFKDNL +I+
Sbjct  19   DMSIISYDRSHADKSGWKSDEEVMSIYEEWLVKHGKVYNAV-EEKEKRFQIFKDNLNFIE  77

Query  287  EQNS  298
            E N+
Sbjct  78   EHNA  81



>ref|XP_008361440.1| PREDICTED: cysteine proteinase RD21a-like [Malus domestica]
Length=289

 Score = 82.8 bits (203),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 53/70 (76%), Gaps = 6/70 (9%)
 Frame = +2

Query  107  DMSIITYDE-----EHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDN  271
            DMSII+YD      ++ + G  RTD  VM++YE WL EHGK+YN L GEK++ F+IFKDN
Sbjct  25   DMSIISYDSNNHLGDNKSLGSWRTDNVVMSIYEGWLAEHGKAYNAL-GEKERSFQIFKDN  83

Query  272  LRYIDEQNSR  301
            LRYIDE+NS+
Sbjct  84   LRYIDEKNSK  93



>gb|AAL60580.1|AF454958_1 senescence-associated cysteine protease [Brassica oleracea]
Length=485

 Score = 84.7 bits (208),  Expect = 9e-17, Method: Composition-based stats.
 Identities = 41/65 (63%), Positives = 49/65 (75%), Gaps = 2/65 (3%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+YD+ H     SR+D EV  LYE WLV+HGK+ N L  EKD+RFEIFKDNLR+ID
Sbjct  23   DMSIISYDKNHHTVS-SRSDAEVSRLYEEWLVKHGKAQNSLT-EKDRRFEIFKDNLRFID  80

Query  287  EQNSR  301
            E N +
Sbjct  81   EHNGK  85



>dbj|BAG16371.1| cysteine protease [Brassica oleracea var. italica]
Length=441

 Score = 84.3 bits (207),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 41/65 (63%), Positives = 49/65 (75%), Gaps = 2/65 (3%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+YD+ H     SR+D EV  LYE WLV+HGK+ N L  EKD+RFEIFKDNLR+ID
Sbjct  17   DMSIISYDKNHHTVS-SRSDAEVSRLYEEWLVKHGKAQNSLT-EKDRRFEIFKDNLRFID  74

Query  287  EQNSR  301
            E N +
Sbjct  75   EHNGK  79



>emb|CAE54307.1| cysteine proteinase [Gossypium hirsutum]
Length=372

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 38/64 (59%), Positives = 54/64 (84%), Gaps = 2/64 (3%)
 Frame = +2

Query  110  MSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            +S +T ++ HP+   S R+D+EVM LY+SW+++HGK+YNG+ GE++KRFEIFKDNLR+ID
Sbjct  20   ISTLTLNQNHPSSSSSWRSDDEVMGLYKSWVIQHGKAYNGI-GEEEKRFEIFKDNLRFID  78

Query  287  EQNS  298
            E NS
Sbjct  79   EHNS  82



>gb|AEV40973.1| putative oryzain beta chain precursor [Oryza punctata]
Length=461

 Score = 84.3 bits (207),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 35/65 (54%), Positives = 50/65 (77%), Gaps = 1/65 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+Y+ EH A+GL RT+ E  A Y+ WL E+G+SYN L GE+++RF +F DNL+++D
Sbjct  23   DMSIISYNAEHGARGLERTEAEARAAYDLWLAENGRSYNAL-GERERRFRVFWDNLKFVD  81

Query  287  EQNSR  301
              N+R
Sbjct  82   AHNAR  86



>emb|CDY17093.1| BnaC06g00260D [Brassica napus]
Length=457

 Score = 84.0 bits (206),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 41/65 (63%), Positives = 49/65 (75%), Gaps = 2/65 (3%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+YD+ H     SR+D EV  LYE WLV+HGK+ N L  EKD+RFEIFKDNLR+ID
Sbjct  23   DMSIISYDKNHHTVS-SRSDAEVSRLYEEWLVKHGKAQNSLT-EKDRRFEIFKDNLRFID  80

Query  287  EQNSR  301
            E N +
Sbjct  81   EHNGK  85



>gb|KJB48626.1| hypothetical protein B456_008G078300 [Gossypium raimondii]
Length=286

 Score = 82.0 bits (201),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 54/64 (84%), Gaps = 2/64 (3%)
 Frame = +2

Query  110  MSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            +S +T ++ HP+   S R+D+EVM LY+SW+++HGK+YNG+ GE++KRFEIFKDNLR+ID
Sbjct  20   ISTLTLNQNHPSSSSSWRSDDEVMGLYKSWVIQHGKAYNGI-GEEEKRFEIFKDNLRFID  78

Query  287  EQNS  298
            E NS
Sbjct  79   EHNS  82



>gb|AEV41024.1| putative oryzain beta chain precursor [Oryza minuta]
Length=493

 Score = 84.3 bits (207),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 35/65 (54%), Positives = 50/65 (77%), Gaps = 1/65 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+Y+ EH A+GL RT+ E  A Y+ WL E+G+SYN L GE+++RF +F DNL+++D
Sbjct  23   DMSIISYNAEHGARGLERTEAEARAAYDLWLAENGRSYNAL-GERERRFRVFWDNLKFVD  81

Query  287  EQNSR  301
              N+R
Sbjct  82   AHNAR  86



>gb|KJB48623.1| hypothetical protein B456_008G078300 [Gossypium raimondii]
Length=240

 Score = 82.0 bits (201),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 54/64 (84%), Gaps = 2/64 (3%)
 Frame = +2

Query  110  MSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            +S +T ++ HP+   S R+D+EVM LY+SW+++HGK+YNG+ GE++KRFEIFKDNLR+ID
Sbjct  20   ISTLTLNQNHPSSSSSWRSDDEVMGLYKSWVIQHGKAYNGI-GEEEKRFEIFKDNLRFID  78

Query  287  EQNS  298
            E NS
Sbjct  79   EHNS  82



>ref|XP_008377786.1| PREDICTED: cysteine proteinase RD21a-like [Malus domestica]
Length=349

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 53/70 (76%), Gaps = 6/70 (9%)
 Frame = +2

Query  107  DMSIITYDE-----EHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDN  271
            DMSII+YD      ++ + G  RTD  VM++YE WL EHGK+YN L GEK++ F+IFKDN
Sbjct  25   DMSIISYDSNNHLGDNKSLGSWRTDNVVMSIYEGWLAEHGKAYNAL-GEKERSFQIFKDN  83

Query  272  LRYIDEQNSR  301
            LRYIDE+NS+
Sbjct  84   LRYIDEKNSK  93



>gb|KJB48622.1| hypothetical protein B456_008G078300 [Gossypium raimondii]
Length=372

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 38/64 (59%), Positives = 54/64 (84%), Gaps = 2/64 (3%)
 Frame = +2

Query  110  MSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            +S +T ++ HP+   S R+D+EVM LY+SW+++HGK+YNG+ GE++KRFEIFKDNLR+ID
Sbjct  20   ISTLTLNQNHPSSSSSWRSDDEVMGLYKSWVIQHGKAYNGI-GEEEKRFEIFKDNLRFID  78

Query  287  EQNS  298
            E NS
Sbjct  79   EHNS  82



>gb|KJB48625.1| hypothetical protein B456_008G078300 [Gossypium raimondii]
Length=372

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 38/64 (59%), Positives = 54/64 (84%), Gaps = 2/64 (3%)
 Frame = +2

Query  110  MSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            +S +T ++ HP+   S R+D+EVM LY+SW+++HGK+YNG+ GE++KRFEIFKDNLR+ID
Sbjct  20   ISTLTLNQNHPSSSSSWRSDDEVMGLYKSWVIQHGKAYNGI-GEEEKRFEIFKDNLRFID  78

Query  287  EQNS  298
            E NS
Sbjct  79   EHNS  82



>ref|XP_006425969.1| hypothetical protein CICLE_v10025887mg [Citrus clementina]
 gb|ESR39209.1| hypothetical protein CICLE_v10025887mg [Citrus clementina]
Length=372

 Score = 82.0 bits (201),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 37/64 (58%), Positives = 48/64 (75%), Gaps = 1/64 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+YD  H      RTD+EVM +Y++WL + GK+ NG+ G  +KRF+IFKDNLR+ID
Sbjct  26   DMSIISYDNNHDHSSSWRTDDEVMTIYQTWLAKRGKTSNGM-GHNEKRFQIFKDNLRFID  84

Query  287  EQNS  298
            E NS
Sbjct  85   EHNS  88



>gb|KFK44641.1| hypothetical protein AALP_AA1G285100 [Arabis alpina]
Length=460

 Score = 82.8 bits (203),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 43/67 (64%), Positives = 49/67 (73%), Gaps = 3/67 (4%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGK--SYNGLGGEKDKRFEIFKDNLRY  280
            DMSII+YDE H      RTD EV  +YE+WLV+HGK  S N L  EKD RFEIFKDNLR+
Sbjct  23   DMSIISYDETHGLAVGGRTDAEVAKIYEAWLVKHGKKMSENSL-VEKDPRFEIFKDNLRF  81

Query  281  IDEQNSR  301
            IDE NS+
Sbjct  82   IDEHNSK  88



>gb|KFK31760.1| hypothetical protein AALP_AA6G155800 [Arabis alpina]
Length=468

 Score = 82.8 bits (203),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 42/74 (57%), Positives = 51/74 (69%), Gaps = 8/74 (11%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGL----SRTDEEVMALYESWLVEHGKSYNG----LGGEKDKRFEIF  262
            DMSII+YDE H         SRTD EV ++YE+WLV+HGK+ N     L GE  +RFEIF
Sbjct  23   DMSIISYDENHHITTTTTVNSRTDAEVASIYEAWLVKHGKNKNKNDLLLVGETKQRFEIF  82

Query  263  KDNLRYIDEQNSRE  304
            KDNLRYIDE N+ +
Sbjct  83   KDNLRYIDEHNNNK  96



>gb|AEV41071.1| putative oryzain beta chain precursor [Oryza minuta]
Length=464

 Score = 82.8 bits (203),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 36/65 (55%), Positives = 48/65 (74%), Gaps = 1/65 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+Y+ EH A+GL RT+ E  A Y+ WL E+G+SYN L GE ++RF +F DNLR+ D
Sbjct  27   DMSIISYNAEHGARGLERTEAEARAAYDLWLAENGRSYNAL-GEHERRFRVFWDNLRFAD  85

Query  287  EQNSR  301
              N+R
Sbjct  86   AHNAR  90



>gb|AEV41117.1| putative oryzain beta chain precursor [Oryza officinalis]
Length=465

 Score = 82.8 bits (203),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 36/65 (55%), Positives = 48/65 (74%), Gaps = 1/65 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+Y+ EH A+GL RT+ E  A Y+ WL E+G+SYN L GE ++RF +F DNLR+ D
Sbjct  28   DMSIISYNAEHGARGLERTEAEARAAYDLWLAENGRSYNAL-GEHERRFRVFWDNLRFAD  86

Query  287  EQNSR  301
              N+R
Sbjct  87   AHNAR  91



>ref|XP_009358749.1| PREDICTED: cysteine proteinase RD21a-like [Pyrus x bretschneideri]
 ref|XP_009348984.1| PREDICTED: cysteine proteinase RD21a-like [Pyrus x bretschneideri]
Length=456

 Score = 82.8 bits (203),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 39/64 (61%), Positives = 50/64 (78%), Gaps = 2/64 (3%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSR-TDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYI  283
            D+SII Y+++H     S  T+ E  ALYESWL++HGK+YN L GEK++RFEIFKDNLR+I
Sbjct  14   DLSIIDYNDKHGMTAPSDPTETEAKALYESWLIKHGKNYNAL-GEKERRFEIFKDNLRFI  72

Query  284  DEQN  295
            DE N
Sbjct  73   DEHN  76



>ref|XP_011097243.1| PREDICTED: cysteine proteinase COT44 [Sesamum indicum]
Length=371

 Score = 81.6 bits (200),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 36/64 (56%), Positives = 50/64 (78%), Gaps = 2/64 (3%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            D SI+ Y+ +H A    R++E+V  LYE WL +HGK+YNG+G EKD+RF+IFKDNL+++D
Sbjct  22   DFSILDYNNKHAASN-PRSEEQVKGLYERWLAKHGKAYNGIG-EKDRRFQIFKDNLKFVD  79

Query  287  EQNS  298
            E NS
Sbjct  80   EHNS  83



>gb|KDP31986.1| hypothetical protein JCGZ_12447 [Jatropha curcas]
Length=366

 Score = 81.6 bits (200),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 37/64 (58%), Positives = 50/64 (78%), Gaps = 1/64 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+YD+ H  +   R+D+EVM +Y  WL +H K+YN L GE+++RFEIFK+NLR+ID
Sbjct  22   DMSIISYDDHHNHQSGWRSDDEVMDMYNWWLAKHQKAYNKL-GERERRFEIFKNNLRFID  80

Query  287  EQNS  298
            E NS
Sbjct  81   EHNS  84



>ref|XP_010906543.1| PREDICTED: ervatamin-B-like [Elaeis guineensis]
Length=362

 Score = 81.6 bits (200),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 36/64 (56%), Positives = 50/64 (78%), Gaps = 3/64 (5%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+YDE H  +GL R++EE+  L+E WLV++G+SYN    EK+ RFEIFK+N+R+ID
Sbjct  24   DMSIISYDEAHGMRGLERSEEEMQILFEGWLVKYGRSYN---TEKEWRFEIFKNNVRFID  80

Query  287  EQNS  298
              N+
Sbjct  81   AHNA  84



>ref|XP_002894032.1| F2G19.31/F2G19.31 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70291.1| F2G19.31/F2G19.31 [Arabidopsis lyrata subsp. lyrata]
Length=455

 Score = 82.4 bits (202),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 41/70 (59%), Positives = 54/70 (77%), Gaps = 8/70 (11%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLS----RTDEEVMALYESWLVEHGKSYNGLG-GEKDKRFEIFKDN  271
            DMSII+YDE+H   G+S    R+D EVM++YE+WLV+HGK+ N     EKD+RFEIFKDN
Sbjct  16   DMSIISYDEKH---GVSTTGGRSDAEVMSIYEAWLVKHGKAQNQNSLVEKDRRFEIFKDN  72

Query  272  LRYIDEQNSR  301
            LR+ID+ N +
Sbjct  73   LRFIDDHNKK  82



>emb|CDY06760.1| BnaA10g05390D [Brassica napus]
Length=457

 Score = 82.4 bits (202),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 40/65 (62%), Positives = 49/65 (75%), Gaps = 2/65 (3%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+YD+ H     SR+D EV  LYE W+V+HGK+ N L  EKD+RFEIFKDNLR+ID
Sbjct  23   DMSIISYDKNHHTVS-SRSDVEVSRLYEEWVVKHGKAQNSLT-EKDRRFEIFKDNLRFID  80

Query  287  EQNSR  301
            E N +
Sbjct  81   EHNGK  85



>dbj|BAG16377.1| cysteine protease [Brassica rapa var. perviridis]
Length=431

 Score = 82.0 bits (201),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 40/65 (62%), Positives = 49/65 (75%), Gaps = 2/65 (3%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+YD+ H     SR+D EV  LYE W+V+HGK+ N L  EKD+RFEIFKDNLR+ID
Sbjct  17   DMSIISYDKNHHTVS-SRSDVEVSRLYEEWVVKHGKAQNSLT-EKDRRFEIFKDNLRFID  74

Query  287  EQNSR  301
            E N +
Sbjct  75   EHNGK  79



>ref|XP_011000919.1| PREDICTED: cysteine proteinase RD21a-like [Populus euphratica]
Length=488

 Score = 82.4 bits (202),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 38/64 (59%), Positives = 50/64 (78%), Gaps = 2/64 (3%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII Y+ +H  +   RT+ E + LYE WLVEHGK+YN L GEK++RFEIFKDNL+++D
Sbjct  35   DMSIIDYNLKH-GQVPERTEAETLRLYEMWLVEHGKAYNAL-GEKERRFEIFKDNLKFVD  92

Query  287  EQNS  298
            + NS
Sbjct  93   QHNS  96



>gb|AEZ65082.1| cysteine protease [Carica papaya]
Length=471

 Score = 82.4 bits (202),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 38/64 (59%), Positives = 49/64 (77%), Gaps = 2/64 (3%)
 Frame = +2

Query  110  MSIITYD-EEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            MSII YD    P +   RT+  +M +YE WLV+HGK+YN +G EK++RFEIFKDNLR++D
Sbjct  26   MSIIDYDLPADPLQSTERTEAHMMKMYEHWLVKHGKNYNAIG-EKERRFEIFKDNLRFVD  84

Query  287  EQNS  298
            EQNS
Sbjct  85   EQNS  88



>gb|KDP47124.1| hypothetical protein JCGZ_22120 [Jatropha curcas]
Length=242

 Score = 80.1 bits (196),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 47/64 (73%), Gaps = 1/64 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII Y+  H      RTD  V  +YE WLV+HGK+YN L GEK+KRF+IFKDNL++ID
Sbjct  25   DMSIIDYNIRHGQNPEERTDANVRRIYEMWLVKHGKAYNAL-GEKEKRFQIFKDNLKFID  83

Query  287  EQNS  298
            E NS
Sbjct  84   EHNS  87



>ref|XP_009123448.1| PREDICTED: LOW QUALITY PROTEIN: cysteine proteinase RD21a-like 
[Brassica rapa]
Length=461

 Score = 82.0 bits (201),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 40/65 (62%), Positives = 49/65 (75%), Gaps = 2/65 (3%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+YD+ H     SR+D EV  LYE W+V+HGK+ N L  EKD+RFEIFKDNLR+ID
Sbjct  23   DMSIISYDKNHHTVS-SRSDVEVSRLYEEWVVKHGKAQNSLT-EKDRRFEIFKDNLRFID  80

Query  287  EQNSR  301
            E N +
Sbjct  81   EHNGK  85



>emb|CDY63586.1| BnaCnng42340D [Brassica napus]
Length=459

 Score = 82.0 bits (201),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 40/66 (61%), Positives = 48/66 (73%), Gaps = 2/66 (3%)
 Frame = +2

Query  107  DMSIITYDEEHPA-KGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYI  283
            DMSII+YD+ H      SR+D EV  LYE WLV+HGK  N L  EKD+RFEIFKDNLR+I
Sbjct  23   DMSIISYDKNHHTISAGSRSDAEVYKLYEEWLVKHGKVQNSLT-EKDRRFEIFKDNLRFI  81

Query  284  DEQNSR  301
            D+ N +
Sbjct  82   DDHNGK  87



>emb|CDY17044.1| BnaA08g04080D [Brassica napus]
Length=459

 Score = 81.6 bits (200),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 40/66 (61%), Positives = 48/66 (73%), Gaps = 2/66 (3%)
 Frame = +2

Query  107  DMSIITYDEEH-PAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYI  283
            DMSII+YD+ H      SR+D EV  LYE WLV+HGK  N L  EKD+RFEIFKDNLR+I
Sbjct  23   DMSIISYDKNHRTVSAGSRSDAEVSKLYEEWLVKHGKVQNSLT-EKDRRFEIFKDNLRFI  81

Query  284  DEQNSR  301
            D+ N +
Sbjct  82   DDHNGK  87



>ref|XP_010461511.1| PREDICTED: cysteine proteinase RD21a-like [Camelina sativa]
Length=462

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 41/68 (60%), Positives = 51/68 (75%), Gaps = 4/68 (6%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGK--SYNGLGGEKDKRFEIFKDNLR  277
            DMSII+YDE+H     S R+D EV ++YE WLV+HGK  + N L GEKD RFEIFKDNLR
Sbjct  23   DMSIISYDEKHGVSSSSGRSDAEVRSMYEEWLVKHGKVQNQNSLLGEKD-RFEIFKDNLR  81

Query  278  YIDEQNSR  301
            +ID+ N +
Sbjct  82   FIDDHNEK  89



>ref|XP_010500237.1| PREDICTED: cysteine proteinase RD21a-like [Camelina sativa]
Length=462

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 41/68 (60%), Positives = 51/68 (75%), Gaps = 4/68 (6%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGK--SYNGLGGEKDKRFEIFKDNLR  277
            DMSII+YDE+H     S R+D EV ++YE WLV+HGK  + N L GEKD RFEIFKDNLR
Sbjct  23   DMSIISYDEKHGVSSSSGRSDAEVRSMYEEWLVKHGKVQNQNSLLGEKD-RFEIFKDNLR  81

Query  278  YIDEQNSR  301
            +ID+ N +
Sbjct  82   FIDDHNEK  89



>ref|NP_564497.1| cysteine proteinase RD21a [Arabidopsis thaliana]
 sp|P43297.1|RD21A_ARATH RecName: Full=Cysteine proteinase RD21a; Short=RD21; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAG50628.1|AC083835_13 cysteine protease, putative [Arabidopsis thaliana]
 dbj|BAA02374.1| thiol protease [Arabidopsis thaliana]
 gb|AAL59952.1| putative cysteine proteinase RD21A [Arabidopsis thaliana]
 gb|AAM91715.1| putative cysteine proteinase RD21A [Arabidopsis thaliana]
 gb|AEE32135.1| cysteine proteinase RD21a [Arabidopsis thaliana]
Length=462

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 40/68 (59%), Positives = 52/68 (76%), Gaps = 4/68 (6%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGK--SYNGLGGEKDKRFEIFKDNLR  277
            DMSII+YDE+H       R++ EVM++YE+WLV+HGK  S N L  EKD+RFEIFKDNLR
Sbjct  23   DMSIISYDEKHGVSTTGGRSEAEVMSIYEAWLVKHGKAQSQNSLV-EKDRRFEIFKDNLR  81

Query  278  YIDEQNSR  301
            ++DE N +
Sbjct  82   FVDEHNEK  89



>ref|XP_009400290.1| PREDICTED: oryzain alpha chain-like [Musa acuminata subsp. malaccensis]
Length=470

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 32/64 (50%), Positives = 49/64 (77%), Gaps = 1/64 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSI+ Y++EH  +GL R++EE+  +YE WL +HG++ N L G+ + RF+IFKDNLR++D
Sbjct  24   DMSIVAYNKEHGVRGLERSEEEMRRMYEGWLAKHGRANNAL-GQNEMRFDIFKDNLRFVD  82

Query  287  EQNS  298
              N+
Sbjct  83   AHNA  86



>gb|AAK62661.1| F2G19.31/F2G19.31 [Arabidopsis thaliana]
 gb|AAL87383.1| F2G19.31/F2G19.31 [Arabidopsis thaliana]
Length=462

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 40/68 (59%), Positives = 52/68 (76%), Gaps = 4/68 (6%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGK--SYNGLGGEKDKRFEIFKDNLR  277
            DMSII+YDE+H       R++ EVM++YE+WLV+HGK  S N L  EKD+RFEIFKDNLR
Sbjct  23   DMSIISYDEKHGVSTTGGRSEAEVMSIYEAWLVKHGKAQSQNSLV-EKDRRFEIFKDNLR  81

Query  278  YIDEQNSR  301
            ++DE N +
Sbjct  82   FVDEHNEK  89



>dbj|BAD95392.1| cysteine proteinase RD21A [Arabidopsis thaliana]
Length=433

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 40/68 (59%), Positives = 52/68 (76%), Gaps = 4/68 (6%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGK--SYNGLGGEKDKRFEIFKDNLR  277
            DMSII+YDE+H       R++ EVM++YE+WLV+HGK  S N L  EKD+RFEIFKDNLR
Sbjct  23   DMSIISYDEKHGVSTTGGRSEAEVMSIYEAWLVKHGKAQSQNSLV-EKDRRFEIFKDNLR  81

Query  278  YIDEQNSR  301
            ++DE N +
Sbjct  82   FVDEHNEK  89



>ref|XP_006307278.1| hypothetical protein CARUB_v10008893mg, partial [Capsella rubella]
 gb|EOA40176.1| hypothetical protein CARUB_v10008893mg, partial [Capsella rubella]
Length=509

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 41/68 (60%), Positives = 51/68 (75%), Gaps = 4/68 (6%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGK--SYNGLGGEKDKRFEIFKDNLR  277
            DMSII+YDE H       R+D EV ++YE+WLVEHGK  + N L GEKD RFEIFKDNLR
Sbjct  70   DMSIISYDETHGVSSTGGRSDAEVRSIYEAWLVEHGKVENKNTLLGEKD-RFEIFKDNLR  128

Query  278  YIDEQNSR  301
            +ID+ N++
Sbjct  129  FIDDHNAK  136



>emb|CAQ00115.1| papain-like cysteine proteinase [Hordeum vulgare subsp. vulgare]
Length=190

 Score = 78.2 bits (191),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 53/66 (80%), Gaps = 4/66 (6%)
 Frame = +2

Query  110  MSIITYDEEHPAKGLS---RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRY  280
            +S +T ++ HP+   S   R+D+EVM LY+SW+++HGK+YNG+ GE++KRFEIFKDNL +
Sbjct  21   ISTLTLNQNHPSSSSSSSWRSDDEVMGLYKSWVIQHGKAYNGI-GEEEKRFEIFKDNLMF  79

Query  281  IDEQNS  298
            +DE NS
Sbjct  80   VDEHNS  85



>emb|CDX71540.1| BnaC04g17750D [Brassica napus]
Length=460

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 40/69 (58%), Positives = 52/69 (75%), Gaps = 4/69 (6%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGK--SYNGL-GGEKDKRFEIFKDNL  274
            DMSII+YDE+H     + R+D EV  +YE+W+ +HGK    NGL G EKD+RFEIFKDNL
Sbjct  22   DMSIISYDEKHHITAENERSDAEVARIYEAWMEKHGKKAQSNGLVGEEKDQRFEIFKDNL  81

Query  275  RYIDEQNSR  301
            R+IDE N++
Sbjct  82   RFIDEHNNK  90



>gb|AAL60579.1|AF454957_1 senescence-associated cysteine protease [Brassica oleracea]
Length=460

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 40/69 (58%), Positives = 52/69 (75%), Gaps = 4/69 (6%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGK--SYNGL-GGEKDKRFEIFKDNL  274
            DMSII+YDE+H     + R+D EV  +YE+W+ +HGK    NGL G EKD+RFEIFKDNL
Sbjct  22   DMSIISYDEKHHITAENERSDAEVARIYEAWMEKHGKKAQSNGLVGEEKDQRFEIFKDNL  81

Query  275  RYIDEQNSR  301
            R+IDE N++
Sbjct  82   RFIDEHNNK  90



>ref|XP_009101816.1| PREDICTED: cysteine proteinase RD21a [Brassica rapa]
Length=460

 Score = 80.1 bits (196),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 40/69 (58%), Positives = 52/69 (75%), Gaps = 4/69 (6%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGK--SYNGL-GGEKDKRFEIFKDNL  274
            DMSII+YDE+H     + R+D EV  +YE+W+ +HGK    NGL G EKD+RFEIFKDNL
Sbjct  22   DMSIISYDEKHHITADNERSDAEVARIYEAWMEKHGKKAQSNGLVGEEKDQRFEIFKDNL  81

Query  275  RYIDEQNSR  301
            R+IDE N++
Sbjct  82   RFIDEHNNK  90



>emb|CDY22370.1| BnaA06g36920D [Brassica napus]
Length=460

 Score = 80.1 bits (196),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 40/69 (58%), Positives = 52/69 (75%), Gaps = 4/69 (6%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGK--SYNGL-GGEKDKRFEIFKDNL  274
            DMSII+YDE+H     + R+D EV  +YE+W+ +HGK    NGL G EKD+RFEIFKDNL
Sbjct  22   DMSIISYDEKHHITADNERSDAEVARIYEAWMEKHGKKAQSNGLVGEEKDQRFEIFKDNL  81

Query  275  RYIDEQNSR  301
            R+IDE N++
Sbjct  82   RFIDEHNNK  90



>dbj|BAE46567.1| cysteine proteinase [Dianthus caryophyllus]
Length=140

 Score = 76.6 bits (187),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 46/65 (71%), Gaps = 4/65 (6%)
 Frame = +2

Query  107  DMSIITYDEEH---PAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLR  277
            DMSIITYD  H    A    RT  EVM +YESWLV+H K+YN L GEK+KRF IF+DNL 
Sbjct  36   DMSIITYDVNHHLSTASTPPRTTAEVMQIYESWLVKHRKNYNAL-GEKEKRFAIFRDNLE  94

Query  278  YIDEQ  292
            +ID+ 
Sbjct  95   FIDQH  99



>ref|XP_008454976.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Cucumis 
melo]
Length=480

 Score = 80.1 bits (196),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 36/46 (78%), Positives = 40/46 (87%), Gaps = 1/46 (2%)
 Frame = +2

Query  158  RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQN  295
            RTDEEV ALYESWLV HGK+YN L GEK++RFEIFKDNL +IDE N
Sbjct  54   RTDEEVAALYESWLVHHGKAYNAL-GEKERRFEIFKDNLMFIDEHN  98



>ref|XP_010061721.1| PREDICTED: low-temperature-induced cysteine proteinase [Eucalyptus 
grandis]
 gb|KCW68707.1| hypothetical protein EUGRSUZ_F02310 [Eucalyptus grandis]
Length=478

 Score = 80.1 bits (196),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 39/69 (57%), Positives = 53/69 (77%), Gaps = 6/69 (9%)
 Frame = +2

Query  107  DMSIITYDEEH-----PAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDN  271
            DMSI++YD  H      +    R+D+EVMA+YESWL +HGK+YN L GEK+KRF++FKDN
Sbjct  29   DMSIVSYDRAHGDRSSSSSSSWRSDDEVMAVYESWLAKHGKAYNAL-GEKEKRFQVFKDN  87

Query  272  LRYIDEQNS  298
            LR+ID+ N+
Sbjct  88   LRFIDDHNA  96



>gb|KCW68708.1| hypothetical protein EUGRSUZ_F02310 [Eucalyptus grandis]
Length=478

 Score = 80.1 bits (196),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 39/69 (57%), Positives = 53/69 (77%), Gaps = 6/69 (9%)
 Frame = +2

Query  107  DMSIITYDEEH-----PAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDN  271
            DMSI++YD  H      +    R+D+EVMA+YESWL +HGK+YN L GEK+KRF++FKDN
Sbjct  29   DMSIVSYDRAHGDRSSSSSSSWRSDDEVMAVYESWLAKHGKAYNAL-GEKEKRFQVFKDN  87

Query  272  LRYIDEQNS  298
            LR+ID+ N+
Sbjct  88   LRFIDDHNA  96



>ref|XP_004136967.1| PREDICTED: cysteine proteinase RD21a-like [Cucumis sativus]
 gb|KGN43904.1| Cysteine protease [Cucumis sativus]
Length=479

 Score = 80.1 bits (196),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 35/46 (76%), Positives = 40/46 (87%), Gaps = 1/46 (2%)
 Frame = +2

Query  158  RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQN  295
            R DEEV ALYESWLV HGK+YN + GEK++RFEIFKDNLR+IDE N
Sbjct  53   RPDEEVAALYESWLVHHGKAYNAI-GEKERRFEIFKDNLRFIDEHN  97



>gb|KHG00992.1| Cysteinease RD21a -like protein [Gossypium arboreum]
Length=375

 Score = 79.0 bits (193),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 36/66 (55%), Positives = 53/66 (80%), Gaps = 4/66 (6%)
 Frame = +2

Query  110  MSIITYDEEHPAKGLS---RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRY  280
            +S +T ++ HP+   S   R+D+EVM LY+SW+++HGK+YNG+ GE++KRFEIFKDNL +
Sbjct  21   ISTLTLNQNHPSSSSSSSWRSDDEVMGLYKSWVIQHGKAYNGI-GEEEKRFEIFKDNLMF  79

Query  281  IDEQNS  298
            +DE NS
Sbjct  80   VDEHNS  85



>ref|XP_006403303.1| hypothetical protein EUTSA_v10003205mg [Eutrema salsugineum]
 gb|ESQ44756.1| hypothetical protein EUTSA_v10003205mg [Eutrema salsugineum]
Length=457

 Score = 79.3 bits (194),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 38/67 (57%), Positives = 51/67 (76%), Gaps = 3/67 (4%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGK-SYNGLGGEKDKRFEIFKDNLRY  280
            DMSII+YDE+H    ++ R++ EV  +YE W+ +HGK + NGL GE D RFEIFKDNLR+
Sbjct  22   DMSIISYDEKHHISAVNGRSEAEVAKIYEEWMAKHGKKTQNGLLGE-DHRFEIFKDNLRF  80

Query  281  IDEQNSR  301
            IDE N++
Sbjct  81   IDEHNTK  87



>ref|XP_004304028.1| PREDICTED: cysteine proteinase RD21a-like [Fragaria vesca subsp. 
vesca]
Length=476

 Score = 79.3 bits (194),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 38/64 (59%), Positives = 48/64 (75%), Gaps = 2/64 (3%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGL-SRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYI  283
            DMSII YD +H    +  RT+ EV A+YESWLV+H K+YN L GE ++RFEIF DNLR++
Sbjct  32   DMSIIDYDNKHHMGVVPERTEAEVKAMYESWLVKHRKAYNAL-GEMERRFEIFMDNLRFV  90

Query  284  DEQN  295
            DE N
Sbjct  91   DEHN  94



>ref|XP_004171356.1| PREDICTED: cysteine proteinase RD21a-like, partial [Cucumis sativus]
Length=168

 Score = 76.3 bits (186),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 40/47 (85%), Gaps = 1/47 (2%)
 Frame = +2

Query  155  SRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQN  295
             R DEEV ALYESWLV HGK+YN + GEK++RFEIFKDNLR+IDE N
Sbjct  52   QRPDEEVAALYESWLVHHGKAYNAI-GEKERRFEIFKDNLRFIDEHN  97



>ref|XP_002298740.2| hypothetical protein POPTR_0001s30950g [Populus trichocarpa]
 gb|EEE83545.2| hypothetical protein POPTR_0001s30950g [Populus trichocarpa]
Length=479

 Score = 79.0 bits (193),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 37/64 (58%), Positives = 49/64 (77%), Gaps = 2/64 (3%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII Y+ +H  +   RT+ E   +YE WLV+HG++YN LG EK++RFEIFKDNL++ID
Sbjct  24   DMSIIDYNIKH-GQVPERTEAETRRIYEMWLVKHGRAYNALG-EKERRFEIFKDNLKFID  81

Query  287  EQNS  298
            E NS
Sbjct  82   EHNS  85



>ref|XP_002313136.2| hypothetical protein POPTR_0009s10090g [Populus trichocarpa]
 gb|EEE87091.2| hypothetical protein POPTR_0009s10090g [Populus trichocarpa]
Length=477

 Score = 79.0 bits (193),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 36/64 (56%), Positives = 50/64 (78%), Gaps = 2/64 (3%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII Y+ +H  +   RT+ E + LYE WLV++GK+YN LG EK++RFEIFKDNL+++D
Sbjct  24   DMSIIDYNLKH-GQVPERTEAETLRLYEMWLVKYGKAYNALG-EKERRFEIFKDNLKFVD  81

Query  287  EQNS  298
            + NS
Sbjct  82   QHNS  85



>ref|XP_010028205.1| PREDICTED: cysteine proteinase COT44-like [Eucalyptus grandis]
 gb|KCW54899.1| hypothetical protein EUGRSUZ_I00879 [Eucalyptus grandis]
Length=364

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 42/47 (89%), Gaps = 1/47 (2%)
 Frame = +2

Query  158  RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNS  298
            RTDEEVM +YE WL +HGK+YNGL GE+++RFEIF+DNLR++DE N+
Sbjct  25   RTDEEVMGMYELWLAKHGKAYNGL-GERERRFEIFRDNLRFVDEHNA  70



>ref|XP_011000142.1| PREDICTED: cysteine proteinase RD21a-like [Populus euphratica]
Length=479

 Score = 78.6 bits (192),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 37/64 (58%), Positives = 49/64 (77%), Gaps = 2/64 (3%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII Y+ +H  +   RT+ E   +YE WLV+HG++YN LG EK++RFEIFKDNL++ID
Sbjct  24   DMSIIDYNIKH-GQIPERTEAETRRIYEMWLVKHGRAYNALG-EKERRFEIFKDNLKFID  81

Query  287  EQNS  298
            E NS
Sbjct  82   EHNS  85



>ref|XP_002310708.2| hypothetical protein POPTR_0007s10650g [Populus trichocarpa]
 gb|EEE91158.2| hypothetical protein POPTR_0007s10650g [Populus trichocarpa]
Length=376

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 52/67 (78%), Gaps = 3/67 (4%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLS--RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRY  280
            DMSI  +D+ H +   S  R+D+EVM++Y+ WL +HGK+YN LG EK KRFEIFK+NLR+
Sbjct  20   DMSIFNHDDNHLSHDQSSWRSDDEVMSIYKWWLQKHGKAYNRLG-EKAKRFEIFKNNLRF  78

Query  281  IDEQNSR  301
            IDE NS+
Sbjct  79   IDEHNSQ  85



>gb|ABQ10197.1| actinidin Act4a [Actinidia eriantha]
Length=385

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 44/47 (94%), Gaps = 1/47 (2%)
 Frame = +2

Query  158  RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNS  298
            RT++EV+A++ESWLVE+GKSYN L GEK++RFEIFKDNLR++DE N+
Sbjct  39   RTNDEVIAMFESWLVEYGKSYNAL-GEKERRFEIFKDNLRFVDEHNA  84



>ref|XP_009396437.1| PREDICTED: oryzain alpha chain-like [Musa acuminata subsp. malaccensis]
Length=473

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 32/64 (50%), Positives = 48/64 (75%), Gaps = 1/64 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            D SI++Y+      GL R++E+V  LYE W+V+H +SY+ + GEK+KRFE+FKDNLR++D
Sbjct  29   DTSIVSYEARRRVGGLRRSEEDVRRLYEEWMVKHRRSYDAV-GEKEKRFEVFKDNLRFVD  87

Query  287  EQNS  298
              N+
Sbjct  88   AHNA  91



>ref|XP_010479116.1| PREDICTED: cysteine proteinase RD21a [Camelina sativa]
Length=462

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 39/68 (57%), Positives = 51/68 (75%), Gaps = 4/68 (6%)
 Frame = +2

Query  107  DMSIITYDEEHP-AKGLSRTDEEVMALYESWLVEHGK--SYNGLGGEKDKRFEIFKDNLR  277
            DMSII+YDE+H  +    R++ EV ++YE WLV+HGK  + N L GEKD RFEIFKDNLR
Sbjct  23   DMSIISYDEKHGVSSSGGRSEAEVRSMYEEWLVKHGKVQNQNSLLGEKD-RFEIFKDNLR  81

Query  278  YIDEQNSR  301
            +ID+ N +
Sbjct  82   FIDDHNEK  89



>ref|XP_006422960.1| hypothetical protein CICLE_v10028338mg [Citrus clementina]
 gb|ESR36200.1| hypothetical protein CICLE_v10028338mg [Citrus clementina]
Length=479

 Score = 77.4 bits (189),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 33/64 (52%), Positives = 48/64 (75%), Gaps = 1/64 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII Y+  H   G + ++  +  +YE WLV+HGK+YN L GEK++RFEIFKDNL++++
Sbjct  27   DMSIIDYNRMHGNGGGNMSESHMRMMYEHWLVKHGKNYNAL-GEKERRFEIFKDNLKFVN  85

Query  287  EQNS  298
            E N+
Sbjct  86   EHNA  89



>dbj|BAD16614.1| cysteine proteinase [Dianthus caryophyllus]
Length=459

 Score = 77.0 bits (188),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 36/64 (56%), Positives = 48/64 (75%), Gaps = 8/64 (13%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            D+SII        +  +R D+E+ +LYE+WLV+HGK+YNGL GEK  RF IFKDNLR++D
Sbjct  24   DLSIID-------RAFNRPDDEIASLYETWLVKHGKNYNGL-GEKQLRFNIFKDNLRFVD  75

Query  287  EQNS  298
            E+NS
Sbjct  76   ERNS  79



>dbj|BAD29954.1| cysteine protease [Daucus carota]
Length=474

 Score = 77.0 bits (188),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 39/68 (57%), Positives = 51/68 (75%), Gaps = 8/68 (12%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLS----RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNL  274
            DMSIITYDE H   GL+    RT +++++LYESWLV+H K+YN L GEK+ RF IFKDN+
Sbjct  33   DMSIITYDETH---GLNSPPLRTHDQLLSLYESWLVKHHKNYNAL-GEKETRFGIFKDNV  88

Query  275  RYIDEQNS  298
             ++D  NS
Sbjct  89   GFVDRHNS  96



>gb|KEH44128.1| papain family cysteine protease [Medicago truncatula]
Length=473

 Score = 76.6 bits (187),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 38/66 (58%), Positives = 48/66 (73%), Gaps = 4/66 (6%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII YD +  A   ++ +  +M LYESWL++HGK YN LG EK +RFEIFKDNLRYI+
Sbjct  27   DMSIIDYDAKLDA---AKNENHLMKLYESWLMKHGKVYNALG-EKVRRFEIFKDNLRYIE  82

Query  287  EQNSRE  304
              N+ E
Sbjct  83   NHNNFE  88



>ref|XP_010688590.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Beta 
vulgaris subsp. vulgaris]
Length=463

 Score = 76.6 bits (187),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 34/50 (68%), Positives = 43/50 (86%), Gaps = 1/50 (2%)
 Frame = +2

Query  155  SRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSRE  304
            SRTD EVMALYESWL++HGK+YN L GEK++R E+FKDNL +ID+ NS +
Sbjct  38   SRTDAEVMALYESWLMKHGKNYNAL-GEKERRLEVFKDNLWFIDQHNSDQ  86



>gb|EYU34557.1| hypothetical protein MIMGU_mgv1a007408mg [Erythranthe guttata]
Length=408

 Score = 75.9 bits (185),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 42/47 (89%), Gaps = 1/47 (2%)
 Frame = +2

Query  158  RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNS  298
            RTDE+V  LYESWL +HGK+YNG+ GEKD+RF+IFKDNL+++D+ NS
Sbjct  36   RTDEQVKGLYESWLAKHGKAYNGI-GEKDRRFDIFKDNLKFVDDHNS  81



>ref|XP_006280322.1| hypothetical protein CARUB_v10026245mg, partial [Capsella rubella]
 gb|EOA13220.1| hypothetical protein CARUB_v10026245mg, partial [Capsella rubella]
Length=511

 Score = 76.3 bits (186),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 42/76 (55%), Positives = 53/76 (70%), Gaps = 10/76 (13%)
 Frame = +2

Query  107  DMSIITYDEEH-----PAKGLSRTDEEVMALYESWLVEHGK---SYNG-LGGEKDK-RFE  256
            DMSII+YD+ H          SR+D EV  +Y+SWLVEHGK     NG LG +KD+ RFE
Sbjct  63   DMSIISYDKNHHITTTTTTVTSRSDAEVERIYDSWLVEHGKKKEKMNGLLGSDKDQERFE  122

Query  257  IFKDNLRYIDEQNSRE  304
            IFKDNLR+IDE N+++
Sbjct  123  IFKDNLRFIDEHNNKK  138



>ref|XP_010070600.1| PREDICTED: cysteine proteinase COT44-like [Eucalyptus grandis]
 gb|KCW59473.1| hypothetical protein EUGRSUZ_H02220 [Eucalyptus grandis]
Length=386

 Score = 75.5 bits (184),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 35/64 (55%), Positives = 45/64 (70%), Gaps = 1/64 (2%)
 Frame = +2

Query  113  SIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQ  292
            SII Y  +       RTD EV+ +YE WL  HGK+YNGL GE++ RF++FKDNLR+IDE 
Sbjct  28   SIIDYAAKGRTASAPRTDGEVVEMYELWLARHGKAYNGL-GEREMRFQVFKDNLRFIDEH  86

Query  293  NSRE  304
            NS +
Sbjct  87   NSSQ  90



>gb|KDO59789.1| hypothetical protein CISIN_1g012022mg [Citrus sinensis]
Length=472

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 32/64 (50%), Positives = 48/64 (75%), Gaps = 1/64 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII Y+  H   G + ++  +  +YE WLV+HGK+YN L GE+++RFEIFKDNL++++
Sbjct  20   DMSIIDYNRMHGNGGGNMSESHMRMMYEHWLVKHGKNYNAL-GEQERRFEIFKDNLKFVN  78

Query  287  EQNS  298
            E N+
Sbjct  79   EHNA  82



>ref|XP_006487026.1| PREDICTED: cysteine proteinase RD21a-like [Citrus sinensis]
Length=472

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 32/64 (50%), Positives = 48/64 (75%), Gaps = 1/64 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII Y+  H   G + ++  +  +YE WLV+HGK+YN L GE+++RFEIFKDNL++++
Sbjct  20   DMSIIDYNRMHGNGGGNMSESHMRMMYEHWLVKHGKNYNAL-GEQERRFEIFKDNLKFVN  78

Query  287  EQNS  298
            E N+
Sbjct  79   EHNA  82



>ref|XP_010028191.1| PREDICTED: cysteine proteinase COT44-like [Eucalyptus grandis]
 gb|KCW54882.1| hypothetical protein EUGRSUZ_I00844 [Eucalyptus grandis]
Length=370

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 31/47 (66%), Positives = 41/47 (87%), Gaps = 1/47 (2%)
 Frame = +2

Query  158  RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNS  298
            RTDEEVM +YE WL +HGK+YNGL GE+++RFEIF+DNLR++DE  +
Sbjct  29   RTDEEVMGMYELWLAKHGKAYNGL-GERERRFEIFRDNLRFVDEHTA  74



>ref|XP_009618803.1| PREDICTED: cysteine proteinase COT44-like [Nicotiana tomentosiformis]
Length=376

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 37/68 (54%), Positives = 46/68 (68%), Gaps = 5/68 (7%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSR----TDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNL  274
            DMSII Y        + +     DEEV  +YE WL EHGK+YN L GEK+KRFEIFKDNL
Sbjct  22   DMSIIDYKNNQHVGNMKKWTWQNDEEVKGIYELWLAEHGKAYNAL-GEKEKRFEIFKDNL  80

Query  275  RYIDEQNS  298
            ++I+E N+
Sbjct  81   KFIEEHNN  88



>ref|XP_002524912.1| cysteine protease, putative [Ricinus communis]
 gb|EEF37409.1| cysteine protease, putative [Ricinus communis]
Length=366

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 33/64 (52%), Positives = 49/64 (77%), Gaps = 1/64 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSI++++  H  +   R+D EV+++Y  WL +H K+YN L GE++KRFEIFK+NLR+ID
Sbjct  22   DMSILSHNHGHHHQSSWRSDNEVISMYNWWLAKHSKTYNKL-GEREKRFEIFKNNLRFID  80

Query  287  EQNS  298
            E N+
Sbjct  81   EHNN  84



>dbj|BAD95667.1| cysteine proteinase [Dianthus caryophyllus]
Length=77

 Score = 70.9 bits (172),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 46/62 (74%), Gaps = 8/62 (13%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            D+SII        +  +R D+E+ +LYE+WLV+HGK+YNGL GEK  RF IFKDNLR++D
Sbjct  24   DLSIID-------RAFNRPDDEIASLYETWLVKHGKNYNGL-GEKQLRFNIFKDNLRFVD  75

Query  287  EQ  292
            E+
Sbjct  76   ER  77



>ref|XP_002306486.2| hypothetical protein POPTR_0005s18520g [Populus trichocarpa]
 gb|EEE93482.2| hypothetical protein POPTR_0005s18520g [Populus trichocarpa]
Length=396

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 52/67 (78%), Gaps = 3/67 (4%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLS--RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRY  280
            DMSI+T ++  P    S  R+D+EVM++Y+ WL +HGK+YN L GE+ +RFEIFK+NLR+
Sbjct  20   DMSILTSNDNQPNHDRSSWRSDDEVMSMYKWWLAKHGKAYNRL-GEEAERFEIFKNNLRF  78

Query  281  IDEQNSR  301
            IDE NS+
Sbjct  79   IDEHNSQ  85



>ref|XP_010107858.1| Cysteine proteinase RD21a [Morus notabilis]
 gb|EXC17258.1| Cysteine proteinase RD21a [Morus notabilis]
Length=476

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 37/68 (54%), Positives = 49/68 (72%), Gaps = 8/68 (12%)
 Frame = +2

Query  107  DMSIITYDEEH----PAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNL  274
            DMSII YD +H    P +   R++ E+ A+YESWLV H K+YN L  EK++RFEIFKDNL
Sbjct  30   DMSIIDYDAKHGIVVPTE---RSETEMRAMYESWLVIHAKAYNALR-EKERRFEIFKDNL  85

Query  275  RYIDEQNS  298
            R++D  N+
Sbjct  86   RFVDAHNA  93



>ref|XP_004496965.1| PREDICTED: cysteine proteinase RD21a-like isoform X1 [Cicer arietinum]
Length=472

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 37/66 (56%), Positives = 48/66 (73%), Gaps = 4/66 (6%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII YD +  A   ++TD  +M +YESWL++HGK YN L GEK+ RFEIFKDNL++I 
Sbjct  27   DMSIIDYDAKLEA---AKTDIHLMKIYESWLLKHGKVYNAL-GEKEHRFEIFKDNLQFIQ  82

Query  287  EQNSRE  304
              N+ E
Sbjct  83   NHNNME  88



>ref|XP_004496966.1| PREDICTED: cysteine proteinase RD21a-like isoform X2 [Cicer arietinum]
Length=474

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 37/66 (56%), Positives = 48/66 (73%), Gaps = 4/66 (6%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII YD +  A   ++TD  +M +YESWL++HGK YN L GEK+ RFEIFKDNL++I 
Sbjct  27   DMSIIDYDAKLEA---AKTDIHLMKIYESWLLKHGKVYNAL-GEKEHRFEIFKDNLQFIQ  82

Query  287  EQNSRE  304
              N+ E
Sbjct  83   NHNNME  88



>gb|KJB43804.1| hypothetical protein B456_007G216900 [Gossypium raimondii]
Length=277

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 44/48 (92%), Gaps = 1/48 (2%)
 Frame = +2

Query  158  RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSR  301
            R+D+EVM+LY++WLV+HGK YNG+ GE++ RF+IFKDNL++ID+ NS+
Sbjct  30   RSDDEVMSLYQAWLVKHGKQYNGI-GEEENRFDIFKDNLKFIDQHNSK  76



>ref|XP_003579458.1| PREDICTED: oryzain beta chain-like [Brachypodium distachyon]
Length=470

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 32/65 (49%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+Y+ EH A+GL RT+ E  A+Y  W  EHG   +   GE+++RF  F DNLR++D
Sbjct  26   DMSIISYNAEHGARGLERTEAEARAIYGLWRAEHGSGNSNSLGEEERRFRAFWDNLRFVD  85

Query  287  EQNSR  301
              N+R
Sbjct  86   AHNAR  90



>gb|AAK07730.1| CPR1-like cysteine proteinase [Nicotiana tabacum]
Length=374

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 37/66 (56%), Positives = 47/66 (71%), Gaps = 3/66 (5%)
 Frame = +2

Query  107  DMSIITYDEEHPAKG--LSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRY  280
            DMSII Y   H A+   L   +++V   YE WL EHG++YN LG EK+KRFEIFKDNLR+
Sbjct  22   DMSIIDYKNNHYARKWTLQSDEDQVKNRYEMWLAEHGRAYNALG-EKEKRFEIFKDNLRF  80

Query  281  IDEQNS  298
            I+E N+
Sbjct  81   IEEHNN  86



>ref|XP_002283263.1| PREDICTED: cysteine proteinase COT44 [Vitis vinifera]
Length=374

 Score = 73.9 bits (180),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 43/48 (90%), Gaps = 1/48 (2%)
 Frame = +2

Query  158  RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSR  301
            R++EEVM +Y+ W+ +HGK+YNGL GEK+KRFEIFKDNL++IDE N++
Sbjct  37   RSEEEVMGMYQWWMAKHGKAYNGL-GEKEKRFEIFKDNLKFIDEHNAQ  83



>gb|ABQ10192.1| actinidin Act2a [Actinidia deliciosa]
Length=378

 Score = 73.6 bits (179),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 33/49 (67%), Positives = 42/49 (86%), Gaps = 1/49 (2%)
 Frame = +2

Query  152  LSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNS  298
            + RT+++VMA+YESWLVEHGKSYN L  EK+ RFEIFK+NLR ID+ N+
Sbjct  31   VQRTNDQVMAMYESWLVEHGKSYNSL-DEKEMRFEIFKENLRIIDDHNA  78



>gb|KEH31479.1| papain family cysteine protease [Medicago truncatula]
Length=359

 Score = 73.6 bits (179),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 33/48 (69%), Positives = 41/48 (85%), Gaps = 1/48 (2%)
 Frame = +2

Query  158  RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSR  301
            R++EEVM +YE WLV+H K YNGL GEKD+RFEIFKDNL +IDE N++
Sbjct  26   RSNEEVMTMYEEWLVKHHKVYNGL-GEKDQRFEIFKDNLGFIDEHNAQ  72



>gb|AFK47737.1| unknown [Medicago truncatula]
Length=359

 Score = 73.6 bits (179),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 33/48 (69%), Positives = 41/48 (85%), Gaps = 1/48 (2%)
 Frame = +2

Query  158  RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSR  301
            R++EEVM +YE WLV+H K YNGL GEKD+RFEIFKDNL +IDE N++
Sbjct  26   RSNEEVMTMYEEWLVKHHKVYNGL-GEKDQRFEIFKDNLGFIDEHNAQ  72



>emb|CDY17193.1| BnaA05g09950D [Brassica napus]
Length=318

 Score = 72.4 bits (176),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 48/66 (73%), Gaps = 2/66 (3%)
 Frame = +2

Query  107  DMSIITYDEEH-PAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYI  283
            DMSII+YD+ H      SR++ EV  LYE WL +HGK  + L  EKD+RFEIFKDNLR+I
Sbjct  23   DMSIISYDDSHHTVSAGSRSEAEVSRLYEEWLGKHGKVQSSLT-EKDRRFEIFKDNLRFI  81

Query  284  DEQNSR  301
            D+ N++
Sbjct  82   DDHNAK  87



>gb|KHN08598.1| Cysteine proteinase RD21a [Glycine soja]
Length=435

 Score = 73.6 bits (179),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 35/63 (56%), Positives = 44/63 (70%), Gaps = 12/63 (19%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII YDE H              +YE+WLV+HGK+YN LG EK++RF+IFKDNLR+I+
Sbjct  2    DMSIIDYDESH-----------TRHVYEAWLVKHGKAYNALG-EKERRFKIFKDNLRFIE  49

Query  287  EQN  295
            E N
Sbjct  50   EHN  52



>gb|KJB43805.1| hypothetical protein B456_007G216900 [Gossypium raimondii]
Length=366

 Score = 73.2 bits (178),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 30/48 (63%), Positives = 44/48 (92%), Gaps = 1/48 (2%)
 Frame = +2

Query  158  RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSR  301
            R+D+EVM+LY++WLV+HGK YNG+ GE++ RF+IFKDNL++ID+ NS+
Sbjct  30   RSDDEVMSLYQAWLVKHGKQYNGI-GEEENRFDIFKDNLKFIDQHNSK  76



>gb|KJB43803.1| hypothetical protein B456_007G216900 [Gossypium raimondii]
Length=367

 Score = 73.2 bits (178),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 30/48 (63%), Positives = 44/48 (92%), Gaps = 1/48 (2%)
 Frame = +2

Query  158  RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSR  301
            R+D+EVM+LY++WLV+HGK YNG+ GE++ RF+IFKDNL++ID+ NS+
Sbjct  30   RSDDEVMSLYQAWLVKHGKQYNGI-GEEENRFDIFKDNLKFIDQHNSK  76



>ref|XP_008452589.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Cucumis 
melo]
Length=495

 Score = 73.9 bits (180),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 31/48 (65%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +2

Query  158  RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSR  301
            RTDEEVMALY+ W   HGK +N LG E + RF IFKDNL+YIDE N++
Sbjct  68   RTDEEVMALYDQWRANHGKLHNNLGAEPENRFHIFKDNLKYIDEINAQ  115



>emb|CAR31335.1| pro-asclepain f [Gomphocarpus fruticosus subsp. fruticosus]
Length=340

 Score = 72.4 bits (176),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 34/46 (74%), Positives = 40/46 (87%), Gaps = 1/46 (2%)
 Frame = +2

Query  158  RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQN  295
            R+D+EV+ALYE WLV+H K Y+ LG EK KRFEIFKDNLRYID+QN
Sbjct  25   RSDDEVIALYEEWLVKHQKLYSSLG-EKIKRFEIFKDNLRYIDQQN  69



>ref|XP_007205396.1| hypothetical protein PRUPE_ppa007467mg [Prunus persica]
 gb|EMJ06595.1| hypothetical protein PRUPE_ppa007467mg [Prunus persica]
Length=366

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 31/50 (62%), Positives = 43/50 (86%), Gaps = 1/50 (2%)
 Frame = +2

Query  155  SRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSRE  304
            SR++ EV  +Y+ WLV+H K+YNG+G E+D+RFEIFKDNLR+IDE NS++
Sbjct  28   SRSEAEVKQIYQEWLVKHQKTYNGIG-EEDRRFEIFKDNLRFIDEHNSQD  76



>gb|KHG18408.1| Cysteinease RD21a -like protein [Gossypium arboreum]
 gb|KHG29615.1| Cysteinease RD21a -like protein [Gossypium arboreum]
Length=367

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 44/48 (92%), Gaps = 1/48 (2%)
 Frame = +2

Query  158  RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSR  301
            R+D+EVM+LY++WL++HGK YNG+ GE++ RF+IFKDNL++ID+ NS+
Sbjct  30   RSDDEVMSLYQAWLIKHGKQYNGI-GEEENRFDIFKDNLKFIDQHNSK  76



>ref|XP_010555986.1| PREDICTED: LOW QUALITY PROTEIN: probable cysteine proteinase 
At3g19400 [Tarenaya hassleriana]
Length=456

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 40/47 (85%), Gaps = 1/47 (2%)
 Frame = +2

Query  158  RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNS  298
            RT+ E   +YE WLVE+ K+YNG+G EK+KRFEIFKDNLR++DEQNS
Sbjct  32   RTEVETRRMYERWLVENRKNYNGIG-EKEKRFEIFKDNLRFVDEQNS  77



>ref|XP_002877310.1| hypothetical protein ARALYDRAFT_484828 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53569.1| hypothetical protein ARALYDRAFT_484828 [Arabidopsis lyrata subsp. 
lyrata]
Length=376

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 34/61 (56%), Positives = 45/61 (74%), Gaps = 7/61 (11%)
 Frame = +2

Query  116  IITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQN  295
            ++T  E H      R + EV  +YE WLVEHGK+YNGL GEK++RF+IFKDNL++I+E N
Sbjct  24   VVTATESH------RNEAEVRTIYERWLVEHGKNYNGL-GEKERRFKIFKDNLKHIEEHN  76

Query  296  S  298
            S
Sbjct  77   S  77



>gb|AIE88288.1| hypothetical protein OG_BBa0063K01.19 [Oryza glaberrima]
Length=479

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 34/68 (50%), Positives = 47/68 (69%), Gaps = 3/68 (4%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSR--TDEEVMALYESWLVEHGK-SYNGLGGEKDKRFEIFKDNLR  277
            DMSII+Y+ EH A+GL    T+ E  A Y+ WL E+G  S N LGGE ++RF +F DNL+
Sbjct  37   DMSIISYNAEHGARGLEEGPTEAEARAAYDLWLAENGGGSPNALGGEHERRFHVFWDNLK  96

Query  278  YIDEQNSR  301
            ++D  N+R
Sbjct  97   FVDAHNAR  104



>dbj|BAF93840.1| triticain beta 2 [Triticum aestivum]
Length=469

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 34/68 (50%), Positives = 45/68 (66%), Gaps = 3/68 (4%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEH-GKSYNGLGG--EKDKRFEIFKDNLR  277
            DMSII Y+ EH A+GL RT+ E  A+Y+ WL EH G SY       E+++RF  F DNLR
Sbjct  24   DMSIIAYNAEHGARGLERTEAEARAVYDLWLAEHGGGSYPNANSIPERERRFRAFWDNLR  83

Query  278  YIDEQNSR  301
            ++D  N+R
Sbjct  84   FVDAHNAR  91



>ref|XP_009784112.1| PREDICTED: cysteine proteinase COT44-like [Nicotiana sylvestris]
Length=374

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 46/66 (70%), Gaps = 3/66 (5%)
 Frame = +2

Query  107  DMSIITYDEEHPAKG--LSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRY  280
            DMSII Y   H A    L   +++V   YE WL EHG++YN LG EK+KRFEIFKDNLR+
Sbjct  22   DMSIIDYKNNHYASKWTLQSDEDQVKNRYEMWLAEHGRAYNALG-EKEKRFEIFKDNLRF  80

Query  281  IDEQNS  298
            I+E N+
Sbjct  81   IEEHNN  86



>ref|XP_007136708.1| hypothetical protein PHAVU_009G067300g [Phaseolus vulgaris]
 gb|ESW08702.1| hypothetical protein PHAVU_009G067300g [Phaseolus vulgaris]
Length=373

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 36/65 (55%), Positives = 48/65 (74%), Gaps = 2/65 (3%)
 Frame = +2

Query  107  DMSIITYDEE-HPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYI  283
            DMSII+YD   H  K   R+DEEV ++YE WLV+HGK  + L   K+KRF+IFKDNL++I
Sbjct  26   DMSIISYDRTTHADKTERRSDEEVRSIYEEWLVKHGKVPSTL-ALKEKRFQIFKDNLKFI  84

Query  284  DEQNS  298
            D+ N+
Sbjct  85   DDHNA  89



>ref|XP_008238897.1| PREDICTED: cysteine proteinase COT44 [Prunus mume]
Length=366

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/50 (60%), Positives = 43/50 (86%), Gaps = 1/50 (2%)
 Frame = +2

Query  155  SRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSRE  304
            SR++ EV  +Y+ WLV+H K+YNG+G E+D+RFEIFKDNLR+IDE N+++
Sbjct  28   SRSEAEVKQIYQEWLVKHQKTYNGIG-EEDRRFEIFKDNLRFIDEHNAQD  76



>ref|XP_006343212.1| PREDICTED: cysteine proteinase RD21a-like [Solanum tuberosum]
Length=366

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 38/45 (84%), Gaps = 1/45 (2%)
 Frame = +2

Query  164  DEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNS  298
            DEEV  +YE WLVEHGK YNGL GEK KRFEIFKDNLR+I+E N+
Sbjct  34   DEEVKGIYEIWLVEHGKIYNGL-GEKGKRFEIFKDNLRFIEEHNN  77



>emb|CAB16317.1| cysteine proteinase precursor [Nicotiana tabacum]
Length=374

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 36/66 (55%), Positives = 46/66 (70%), Gaps = 3/66 (5%)
 Frame = +2

Query  107  DMSIITYDEEHPAKG--LSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRY  280
            DMSII Y   H A+   L   +++V   YE WL EHG++YN LG EK+KRFEIFKDNLR+
Sbjct  22   DMSIIDYKNNHYARKWTLQSDEDQVKNRYEMWLAEHGRAYNALG-EKEKRFEIFKDNLRF  80

Query  281  IDEQNS  298
            I+  N+
Sbjct  81   IEGHNN  86



>gb|ABQ10196.1| actinidin Act3a [Actinidia eriantha]
Length=380

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 42/47 (89%), Gaps = 1/47 (2%)
 Frame = +2

Query  158  RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNS  298
            RT++EVMALYESWLV++GKSYN L GE++ R EIFK+NLR+IDE N+
Sbjct  33   RTNDEVMALYESWLVKYGKSYNSL-GEREMRIEIFKENLRFIDEHNA  78



>gb|ACB87490.1| mucunain [Mucuna pruriens]
Length=422

 Score = 71.6 bits (174),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 37/41 (90%), Gaps = 1/41 (2%)
 Frame = +2

Query  176  MALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNS  298
            M+LYE WLV+HGK+YN LG EKDKRF+IFKDNLR+ID+ N+
Sbjct  1    MSLYEQWLVKHGKAYNALG-EKDKRFDIFKDNLRFIDDHNA  40



>emb|CAQ00105.1| papain-like cysteine proteinase [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87864.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96253.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=463

 Score = 72.0 bits (175),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 31/64 (48%), Positives = 45/64 (70%), Gaps = 9/64 (14%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSI++Y E        R++EEV  +Y  W+ EHG +YN + GE+++RFE F+DNLRYID
Sbjct  25   DMSIVSYGE--------RSEEEVRRMYAEWMAEHGSTYNAI-GEEERRFEAFRDNLRYID  75

Query  287  EQNS  298
            + N+
Sbjct  76   QHNA  79



>ref|XP_010919166.1| PREDICTED: oryzain alpha chain-like [Elaeis guineensis]
Length=221

 Score = 69.7 bits (169),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 44/58 (76%), Gaps = 1/58 (2%)
 Frame = +2

Query  125  YDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNS  298
            Y+E H  +GL  ++E++  LYE WL +HG++YN L  EK++RFEIFKDN+R+ID  N+
Sbjct  85   YNEAHGVRGLEWSEEQMRLLYEGWLAKHGRTYNAL-EEKERRFEIFKDNVRFIDAHNA  141



>gb|ABQ10191.1| actinidin Act1c [Actinidia eriantha]
Length=368

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 42/47 (89%), Gaps = 1/47 (2%)
 Frame = +2

Query  158  RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNS  298
            RT++EV A+YESWL++HGKSYN L GE+++RFEIFK+ LR+IDE N+
Sbjct  29   RTNDEVKAMYESWLIKHGKSYNSL-GERERRFEIFKETLRFIDEHNA  74



>gb|EYU25464.1| hypothetical protein MIMGU_mgv1a006201mg [Erythranthe guttata]
Length=453

 Score = 71.6 bits (174),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 32/67 (48%), Positives = 51/67 (76%), Gaps = 4/67 (6%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSY-NGLGGEKDKRFEIFKDNLRYI  283
            DMSI+++     ++   R+  E+++++ESW+V+HG+SY N   GEK++RFEIF+DNL YI
Sbjct  29   DMSILSHGG---SRSFLRSHSEMVSMHESWMVKHGRSYGNAAVGEKERRFEIFRDNLMYI  85

Query  284  DEQNSRE  304
            DEQN+ +
Sbjct  86   DEQNAED  92



>dbj|BAJ85145.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=436

 Score = 71.2 bits (173),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 31/64 (48%), Positives = 45/64 (70%), Gaps = 9/64 (14%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSI++Y E        R++EEV  +Y  W+ EHG +YN + GE+++RFE F+DNLRYID
Sbjct  25   DMSIVSYGE--------RSEEEVRRMYAEWMAEHGSTYNAI-GEEERRFEAFRDNLRYID  75

Query  287  EQNS  298
            + N+
Sbjct  76   QHNA  79



>gb|KGN55227.1| hypothetical protein Csa_4G641600 [Cucumis sativus]
Length=459

 Score = 71.2 bits (173),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 29/48 (60%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +2

Query  158  RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSR  301
            RTD+EVMALY+ W  +HGK +N LG E + RF IFKDNL++IDE N++
Sbjct  32   RTDDEVMALYDQWRAKHGKLHNNLGAEPENRFHIFKDNLKFIDEINAQ  79



>ref|XP_004169515.1| PREDICTED: cysteine proteinase RD21a-like [Cucumis sativus]
Length=459

 Score = 71.2 bits (173),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 29/48 (60%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +2

Query  158  RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSR  301
            RTD+EVMALY+ W  +HGK +N LG E + RF IFKDNL++IDE N++
Sbjct  32   RTDDEVMALYDQWRAKHGKLHNNLGAEPENRFHIFKDNLKFIDEINAQ  79



>ref|NP_001054211.2| Os04g0670200 [Oryza sativa Japonica Group]
 sp|P25777.2|ORYB_ORYSJ RecName: Full=Oryzain beta chain; Flags: Precursor [Oryza sativa 
Japonica Group]
 emb|CAE02823.1| OSJNBa0043A12.28 [Oryza sativa Japonica Group]
 emb|CAJ86092.1| H0818H01.14 [Oryza sativa Indica Group]
 gb|EAY95991.1| hypothetical protein OsI_17862 [Oryza sativa Indica Group]
 dbj|BAG98700.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF16125.2| Os04g0670200 [Oryza sativa Japonica Group]
Length=466

 Score = 71.2 bits (173),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 34/68 (50%), Positives = 47/68 (69%), Gaps = 3/68 (4%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSR--TDEEVMALYESWLVEHGK-SYNGLGGEKDKRFEIFKDNLR  277
            DMSII+Y+ EH A+GL    T+ E  A Y+ WL E+G  S N LGGE ++RF +F DNL+
Sbjct  24   DMSIISYNAEHGARGLEEGPTEAEARAAYDLWLAENGGGSPNALGGEHERRFLVFWDNLK  83

Query  278  YIDEQNSR  301
            ++D  N+R
Sbjct  84   FVDAHNAR  91



>ref|XP_004141271.1| PREDICTED: cysteine proteinase RD21a-like [Cucumis sativus]
Length=458

 Score = 71.2 bits (173),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 29/48 (60%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +2

Query  158  RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSR  301
            RTD+EVMALY+ W  +HGK +N LG E + RF IFKDNL++IDE N++
Sbjct  32   RTDDEVMALYDQWRAKHGKLHNNLGAEPENRFHIFKDNLKFIDEINAQ  79



>ref|XP_004234718.1| PREDICTED: cysteine proteinase COT44-like [Solanum lycopersicum]
Length=379

 Score = 70.9 bits (172),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 33/46 (72%), Positives = 38/46 (83%), Gaps = 1/46 (2%)
 Frame = +2

Query  161  TDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNS  298
            TDEEV  +YE WL EHGK YNGL GE+ KRFEIFKDNLR+I+E N+
Sbjct  34   TDEEVKRIYEIWLAEHGKIYNGL-GEQGKRFEIFKDNLRFIEEHNN  78



>dbj|BAA14403.1| oryzain beta precursor [Oryza sativa Japonica Group]
Length=471

 Score = 71.2 bits (173),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 34/68 (50%), Positives = 47/68 (69%), Gaps = 3/68 (4%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSR--TDEEVMALYESWLVEHGK-SYNGLGGEKDKRFEIFKDNLR  277
            DMSII+Y+ EH A+GL    T+ E  A Y+ WL E+G  S N LGGE ++RF +F DNL+
Sbjct  23   DMSIISYNAEHGARGLEEGPTEAEARAAYDLWLAENGGGSPNALGGEHERRFLVFWDNLK  82

Query  278  YIDEQNSR  301
            ++D  N+R
Sbjct  83   FVDAHNAR  90



>gb|EAZ32359.1| hypothetical protein OsJ_16569 [Oryza sativa Japonica Group]
Length=480

 Score = 71.2 bits (173),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 34/68 (50%), Positives = 47/68 (69%), Gaps = 3/68 (4%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSR--TDEEVMALYESWLVEHGK-SYNGLGGEKDKRFEIFKDNLR  277
            DMSII+Y+ EH A+GL    T+ E  A Y+ WL E+G  S N LGGE ++RF +F DNL+
Sbjct  24   DMSIISYNAEHGARGLEEGPTEAEARAAYDLWLAENGGGSPNALGGEHERRFLVFWDNLK  83

Query  278  YIDEQNSR  301
            ++D  N+R
Sbjct  84   FVDAHNAR  91



>gb|ABQ10195.1| actinidin Act2d [Actinidia eriantha]
Length=381

 Score = 70.5 bits (171),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 32/49 (65%), Positives = 41/49 (84%), Gaps = 1/49 (2%)
 Frame = +2

Query  152  LSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNS  298
            + RT+++VMA+YESWLVE GKSYN L  EK+ RFEIFK+NLR ID+ N+
Sbjct  33   VQRTNDQVMAMYESWLVEQGKSYNSL-DEKEMRFEIFKENLRIIDDHNA  80



>gb|EMS68758.1| Oryzain beta chain [Triticum urartu]
Length=472

 Score = 71.2 bits (173),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 32/68 (47%), Positives = 44/68 (65%), Gaps = 3/68 (4%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGG---EKDKRFEIFKDNLR  277
            DMSII Y+ EH A+GL RT+ E  A+Y+ WL EHG   +       E+++RF  F DNLR
Sbjct  27   DMSIIAYNAEHGARGLERTEAEARAVYDLWLAEHGGGSSPNANSIPERERRFRAFWDNLR  86

Query  278  YIDEQNSR  301
            ++D  N+R
Sbjct  87   FVDAHNAR  94



>emb|CBI40282.3| unnamed protein product [Vitis vinifera]
Length=386

 Score = 70.5 bits (171),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 38/41 (93%), Gaps = 1/41 (2%)
 Frame = +2

Query  176  MALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNS  298
            MA+YE+WLV+HGKSYN LG E+++RFEIFKDNLR+I+E N+
Sbjct  1    MAVYEAWLVKHGKSYNALG-ERERRFEIFKDNLRFIEEHNA  40



>gb|ABQ10193.1| actinidin Act2b [Actinidia eriantha]
Length=378

 Score = 70.5 bits (171),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 32/49 (65%), Positives = 41/49 (84%), Gaps = 1/49 (2%)
 Frame = +2

Query  152  LSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNS  298
            + RT+++VMA+YESWLVE GKSYN L  EK+ RFEIFK+NLR ID+ N+
Sbjct  31   VQRTNDQVMAMYESWLVEQGKSYNSL-DEKEMRFEIFKENLRIIDDHNA  78



>gb|KCW66366.1| hypothetical protein EUGRSUZ_F00186 [Eucalyptus grandis]
Length=183

 Score = 68.2 bits (165),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 39/47 (83%), Gaps = 1/47 (2%)
 Frame = +2

Query  158  RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNS  298
            RT+ EVMAL+ESW+V+HGK YN + GEK+ RFEIFKD LR +D+ NS
Sbjct  6    RTEAEVMALFESWIVKHGKVYN-VPGEKEMRFEIFKDTLRRVDQHNS  51



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 562775562090