BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002A15

Length=441
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006343784.1|  PREDICTED: methionine gamma-lyase-like             192   8e-56   Solanum tuberosum [potatoes]
gb|KDP25202.1|  hypothetical protein JCGZ_20358                         191   2e-55   Jatropha curcas
ref|XP_004245457.1|  PREDICTED: methionine gamma-lyase                  190   3e-55   Solanum lycopersicum
ref|XP_009796885.1|  PREDICTED: methionine gamma-lyase-like             190   3e-55   Nicotiana sylvestris
ref|XP_009631114.1|  PREDICTED: methionine gamma-lyase-like             189   8e-55   Nicotiana tomentosiformis
ref|XP_009625576.1|  PREDICTED: methionine gamma-lyase                  188   2e-54   Nicotiana tomentosiformis
gb|KCW77319.1|  hypothetical protein EUGRSUZ_D01681                     186   4e-54   Eucalyptus grandis [rose gum]
ref|XP_010053068.1|  PREDICTED: methionine gamma-lyase                  186   3e-53   
ref|XP_009785770.1|  PREDICTED: methionine gamma-lyase-like             183   1e-52   Nicotiana sylvestris
ref|XP_010251592.1|  PREDICTED: methionine gamma-lyase                  183   2e-52   Nelumbo nucifera [Indian lotus]
ref|XP_011026788.1|  PREDICTED: methionine gamma-lyase                  182   3e-52   Populus euphratica
ref|XP_002299428.1|  Cys/Met metabolism pyridoxal-phosphate-depen...    181   9e-52   Populus trichocarpa [western balsam poplar]
ref|XP_011070383.1|  PREDICTED: methionine gamma-lyase                  178   2e-50   Sesamum indicum [beniseed]
gb|EYU33474.1|  hypothetical protein MIMGU_mgv1a006470mg                177   2e-50   Erythranthe guttata [common monkey flower]
ref|XP_008374119.1|  PREDICTED: methionine gamma-lyase-like             177   3e-50   
emb|CAN83499.1|  hypothetical protein VITISV_026969                     176   4e-50   Vitis vinifera
ref|XP_002518910.1|  cystathionine gamma-synthase, putative             177   5e-50   Ricinus communis
ref|XP_002280162.1|  PREDICTED: methionine gamma-lyase                  176   8e-50   Vitis vinifera
ref|XP_010676903.1|  PREDICTED: methionine gamma-lyase                  176   2e-49   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011101902.1|  PREDICTED: methionine gamma-lyase-like             175   2e-49   Sesamum indicum [beniseed]
ref|XP_006439223.1|  hypothetical protein CICLE_v10020136mg             174   5e-49   Citrus clementina [clementine]
ref|XP_006476291.1|  PREDICTED: methionine gamma-lyase-like             174   6e-49   Citrus sinensis [apfelsine]
gb|KJB52368.1|  hypothetical protein B456_008G258500                    174   7e-49   Gossypium raimondii
gb|KFK21963.1|  hypothetical protein AALP_AAs48252U001300               164   2e-48   Arabis alpina [alpine rockcress]
ref|XP_010544898.1|  PREDICTED: methionine gamma-lyase                  171   5e-48   Tarenaya hassleriana [spider flower]
ref|XP_004495508.1|  PREDICTED: methionine gamma-lyase-like             170   1e-47   Cicer arietinum [garbanzo]
ref|XP_004502061.1|  PREDICTED: methionine gamma-lyase-like             170   2e-47   Cicer arietinum [garbanzo]
ref|XP_007039394.1|  Methionine gamma-lyase                             170   2e-47   Theobroma cacao [chocolate]
gb|KDO76719.1|  hypothetical protein CISIN_1g013079mg                   170   2e-47   Citrus sinensis [apfelsine]
gb|KJB37456.1|  hypothetical protein B456_006G205800                    170   3e-47   Gossypium raimondii
ref|XP_004309539.1|  PREDICTED: methionine gamma-lyase                  169   3e-47   Fragaria vesca subsp. vesca
gb|AGF70153.1|  methionine gamma-lyase                                  169   4e-47   Cucumis melo [Oriental melon]
ref|XP_004146134.1|  PREDICTED: methionine gamma-lyase-like             169   5e-47   Cucumis sativus [cucumbers]
ref|XP_006352296.1|  PREDICTED: methionine gamma-lyase-like             168   7e-47   
gb|KFK32962.1|  hypothetical protein AALP_AA6G312200                    167   9e-47   Arabis alpina [alpine rockcress]
ref|XP_010430614.1|  PREDICTED: methionine gamma-lyase isoform X3       167   1e-46   Camelina sativa [gold-of-pleasure]
ref|XP_007151964.1|  hypothetical protein PHAVU_004G090200g             167   1e-46   Phaseolus vulgaris [French bean]
ref|XP_008791621.1|  PREDICTED: methionine gamma-lyase                  167   2e-46   Phoenix dactylifera
ref|XP_008448562.1|  PREDICTED: methionine gamma-lyase-like             166   4e-46   
ref|XP_010473731.1|  PREDICTED: methionine gamma-lyase-like isofo...    166   6e-46   Camelina sativa [gold-of-pleasure]
ref|XP_010430612.1|  PREDICTED: methionine gamma-lyase isoform X1       166   6e-46   Camelina sativa [gold-of-pleasure]
ref|XP_006302266.1|  hypothetical protein CARUB_v10020309mg             166   7e-46   Capsella rubella
ref|XP_003542155.1|  PREDICTED: methionine gamma-lyase-like             165   1e-45   Glycine max [soybeans]
ref|XP_002891507.1|  predicted protein                                  164   2e-45   Arabidopsis lyrata subsp. lyrata
gb|KEH42908.1|  cystathionine beta-lyase/cystathionine gamma-synt...    164   2e-45   Medicago truncatula
gb|ADN33936.1|  cystathionine gamma-synthase                            164   3e-45   Cucumis melo subsp. melo
ref|XP_009112857.1|  PREDICTED: methionine gamma-lyase                  164   3e-45   Brassica rapa
ref|XP_003601451.1|  Cystathionine gamma-lyase                          164   4e-45   Medicago truncatula
ref|NP_176647.1|  methionine gamma-lyase                                163   5e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004244654.1|  PREDICTED: methionine gamma-lyase-like             162   9e-45   
emb|CDY53903.1|  BnaA09g53100D                                          162   1e-44   Brassica napus [oilseed rape]
ref|XP_009382322.1|  PREDICTED: methionine gamma-lyase-like             163   1e-44   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009358710.1|  PREDICTED: methionine gamma-lyase-like             160   1e-43   Pyrus x bretschneideri [bai li]
ref|XP_010919347.1|  PREDICTED: methionine gamma-lyase                  160   1e-43   Elaeis guineensis
ref|XP_006849146.1|  hypothetical protein AMTR_s00027p00096610          159   2e-43   
ref|XP_008390270.1|  PREDICTED: methionine gamma-lyase-like             159   2e-43   Malus domestica [apple tree]
ref|XP_009411481.1|  PREDICTED: methionine gamma-lyase-like             159   4e-43   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003520012.1|  PREDICTED: methionine gamma-lyase-like             158   4e-43   Glycine max [soybeans]
gb|ABK27101.1|  unknown                                                 157   6e-43   Picea sitchensis
ref|XP_008239227.1|  PREDICTED: methionine gamma-lyase                  158   8e-43   Prunus mume [ume]
ref|XP_007209123.1|  hypothetical protein PRUPE_ppa005470mg             157   1e-42   Prunus persica
ref|XP_009359544.1|  PREDICTED: methionine gamma-lyase-like             157   2e-42   Pyrus x bretschneideri [bai li]
ref|XP_010100197.1|  Methionine gamma-lyase                             154   2e-41   Morus notabilis
ref|XP_007161585.1|  hypothetical protein PHAVU_001G082000g             152   5e-41   Phaseolus vulgaris [French bean]
ref|XP_003536171.1|  PREDICTED: methionine gamma-lyase                  152   6e-41   Glycine max [soybeans]
ref|XP_008366029.1|  PREDICTED: LOW QUALITY PROTEIN: methionine g...    147   1e-39   
ref|XP_008437446.1|  PREDICTED: methionine gamma-lyase-like             147   9e-39   Cucumis melo [Oriental melon]
ref|XP_001751901.1|  predicted protein                                  145   1e-38   
ref|XP_002964805.1|  hypothetical protein SELMODRAFT_82714              146   1e-38   Selaginella moellendorffii
ref|XP_002961730.1|  hypothetical protein SELMODRAFT_76894              145   2e-38   Selaginella moellendorffii
ref|XP_004143943.1|  PREDICTED: methionine gamma-lyase-like             144   8e-38   
ref|XP_003574196.1|  PREDICTED: methionine gamma-lyase                  140   3e-36   Brachypodium distachyon [annual false brome]
dbj|BAK03127.1|  predicted protein                                      139   4e-36   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AFW68376.1|  hypothetical protein ZEAMMB73_868492                    138   1e-35   
ref|NP_001152224.1|  O-succinylhomoserine sulfhydrylase                 138   1e-35   
tpg|DAA49293.1|  TPA: O-succinylhomoserine sulfhydrylase                138   1e-35   
ref|XP_008646566.1|  PREDICTED: methionine gamma-lyase-like             138   1e-35   
ref|XP_002464368.1|  hypothetical protein SORBIDRAFT_01g017060          137   2e-35   Sorghum bicolor [broomcorn]
ref|NP_001065069.1|  Os10g0517500                                       137   5e-35   
gb|EAY79213.1|  hypothetical protein OsI_34329                          135   2e-34   Oryza sativa Indica Group [Indian rice]
ref|XP_004982603.1|  PREDICTED: methionine gamma-lyase-like             135   2e-34   Setaria italica
ref|XP_001759514.1|  predicted protein                                  126   2e-31   
ref|XP_011020545.1|  PREDICTED: methionine gamma-lyase-like             122   6e-30   Populus euphratica
ref|XP_002304835.2|  hypothetical protein POPTR_0003s18600g             122   9e-30   
ref|XP_002304836.2|  hypothetical protein POPTR_0003s18590g             119   1e-28   
gb|AFT91998.1|  cystathionine gamma-synthase                            117   3e-28   Populus alba x Populus glandulosa
gb|AFT91997.1|  cystathionine gamma-synthase                            117   4e-28   Populus tomentosa [Chinese white poplar]
ref|XP_006388026.1|  hypothetical protein POPTR_0393s00210g             115   1e-27   Populus trichocarpa [western balsam poplar]
ref|XP_001756897.1|  predicted protein                                  110   1e-25   
ref|WP_022667695.1|  cystathionine beta-lyase                           107   7e-25   Desulfospira joergensenii
gb|KHN47224.1|  Cystathionine gamma-lyase                               106   1e-24   Glycine soja [wild soybean]
ref|WP_024333343.1|  cystathionine beta-lyase                           104   1e-23   Desulfotignum balticum
ref|WP_006964281.1|  cystathionine gamma-lyase CysA                     104   1e-23   Desulfotignum phosphitoxidans
ref|XP_005848305.1|  hypothetical protein CHLNCDRAFT_35132              104   4e-23   Chlorella variabilis
ref|WP_027709412.1|  cystathionine beta-lyase                           102   1e-22   
ref|XP_006385806.1|  hypothetical protein POPTR_0003s14660g           98.2    3e-22   
ref|XP_002955875.1|  hypothetical protein VOLCADRAFT_66358            97.1    7e-21   Volvox carteri f. nagariensis
ref|XP_010497416.1|  PREDICTED: methionine gamma-lyase-like           92.0    6e-20   Camelina sativa [gold-of-pleasure]
ref|XP_005651025.1|  cystathionine gamma-synthase                     84.0    4e-16   Coccomyxa subellipsoidea C-169
ref|XP_006662513.1|  PREDICTED: LOW QUALITY PROTEIN: methionine g...  79.3    7e-15   Oryza brachyantha
ref|WP_038562571.1|  cystathionine beta-lyase                         70.9    1e-11   Draconibacterium orientale
gb|KJF42319.1|  cystathionine beta-lyase                              70.9    2e-11   Draconibacterium sediminis
ref|WP_025865695.1|  cystathionine beta-lyase                         69.7    4e-11   Prolixibacter bellariivorans
ref|WP_028584498.1|  cystathionine beta-lyase                         64.7    2e-09   Desulfobulbus mediterraneus
ref|WP_014561543.1|  cystathionine beta-lyase                         64.3    2e-09   Ignavibacterium album
ref|WP_027075614.1|  cystathionine beta-lyase                         63.5    5e-09   Maribacter antarcticus
ref|WP_035664548.1|  cystathionine beta-lyase                         63.5    5e-09   
ref|WP_027311134.1|  cystathionine beta-lyase                         62.8    1e-08   
ref|WP_007138646.1|  cystathionine beta-lyase                         62.8    1e-08   Flavobacterium frigoris
ref|WP_015480967.1|  cystathionine beta-lyase                         62.4    1e-08   Polaribacter sp. MED152
ref|WP_008615133.1|  cystathionine beta-lyase                         62.4    1e-08   Joostella marina
ref|WP_019669934.1|  cystathionine beta-lyase                         62.4    1e-08   Eudoraea adriatica
ref|WP_027126595.1|  cystathionine beta-lyase                         62.0    2e-08   Gelidibacter mesophilus
ref|WP_026992162.1|  cystathionine beta-lyase                         61.6    2e-08   Flavobacterium subsaxonicum
ref|WP_039118922.1|  cystathionine beta-lyase                         61.6    2e-08   Flavobacterium sp. JRM
ref|WP_039113897.1|  cystathionine beta-lyase                         61.6    2e-08   Flavobacterium sp. KMS
ref|WP_020214240.1|  cystathionine beta-lyase                         61.6    2e-08   Flavobacterium rivuli
ref|WP_035626372.1|  cystathionine beta-lyase                         61.6    2e-08   Flavobacterium hydatis
ref|WP_044048288.1|  cystathionine beta-lyase                         61.6    2e-08   
ref|WP_026775536.1|  cystathionine beta-lyase                         61.6    3e-08   Polaribacter sp. Hel_I_88
gb|ABQ05159.1|  Cystathionine gamma-synthase                          61.6    3e-08   Flavobacterium johnsoniae UW101
ref|WP_017495491.1|  cystathionine beta-lyase                         61.2    3e-08   Flavobacterium sp. WG21
ref|WP_039107807.1|  cystathionine beta-lyase                         61.2    3e-08   Flavobacterium sp. AED
ref|WP_026728807.1|  cystathionine beta-lyase                         61.2    3e-08   Flavobacterium denitrificans
ref|WP_031453699.1|  cystathionine beta-lyase                         61.2    3e-08   Flavobacterium chungangense
ref|WP_041519168.1|  cystathionine beta-lyase                         61.2    3e-08   Flavobacterium hibernum
ref|WP_035671447.1|  cystathionine beta-lyase                         61.2    3e-08   Flavobacterium sp. 83
ref|WP_024980967.1|  cystathionine beta-lyase                         61.2    3e-08   Flavobacterium succinicans
ref|WP_035666777.1|  cystathionine beta-lyase                         61.2    3e-08   
ref|WP_036123108.1|  cystathionine beta-lyase                         61.2    3e-08   Mangrovimonas yunxiaonensis
ref|WP_026985975.1|  cystathionine beta-lyase                         61.2    3e-08   Flavobacterium sp. URHB0058
ref|WP_035649238.1|  cystathionine beta-lyase                         61.2    3e-08   Flavobacterium sp. Fl
ref|WP_026708059.1|  cystathionine beta-lyase                         61.2    3e-08   Flavobacterium frigidarium
gb|KIX21419.1|  cystathionine beta-lyase                              61.2    3e-08   Flavobacterium sp. 316
ref|WP_035684485.1|  cystathionine beta-lyase                         61.2    3e-08   Flavobacterium reichenbachii
ref|WP_008272189.1|  cystathionine beta-lyase                         61.2    3e-08   Flavobacteriales bacterium ALC-1
ref|WP_042566587.1|  cystathionine beta-lyase                         61.2    3e-08   Flavobacterium sp. MEB061
ref|WP_011963843.1|  cystathionine beta-lyase                         61.2    3e-08   Flavobacterium psychrophilum
ref|WP_008239835.1|  cystathionine beta-lyase                         61.2    3e-08   Imtechella halotolerans
dbj|BAO77673.1|  O-acetylhomoserine sulfhydrylase                     61.2    4e-08   Winogradskyella sp. PG-2
ref|WP_026716030.1|  cystathionine beta-lyase                         60.8    4e-08   Flavobacterium gelidilacus
ref|WP_036827174.1|  cystathionine beta-lyase                         60.8    4e-08   Polaribacter sp. Hel1_85
ref|WP_008634437.1|  cystathionine beta-lyase                         60.8    4e-08   Bizionia argentinensis
ref|WP_038264494.1|  cystathionine beta-lyase                         60.8    4e-08   Zhouia amylolytica
ref|WP_007804337.1|  cystathionine beta-lyase                         60.8    4e-08   Flavobacterium sp. CF136
ref|WP_028290818.1|  cystathionine beta-lyase                         60.8    4e-08   Olleya sp. VCSA23
ref|WP_044633542.1|  cystathionine beta-lyase                         60.8    4e-08   Tamlana sedimentorum
ref|WP_027878816.1|  cystathionine beta-lyase                         60.8    4e-08   Mesoflavibacter zeaxanthinifaciens
ref|WP_026976217.1|  cystathionine beta-lyase                         60.8    4e-08   Flavobacterium tegetincola
ref|WP_020897041.1|  O-acetylhomoserine sulfhydrylase                 60.8    4e-08   Winogradskyella psychrotolerans
ref|WP_039353474.1|  cystathionine beta-lyase                         60.8    4e-08   Chryseobacterium jeonii
ref|WP_028606171.1|  cystathionine beta-lyase                         60.8    4e-08   Olleya
ref|WP_026451516.1|  cystathionine beta-lyase                         60.8    5e-08   Aequorivita capsosiphonis
ref|WP_026704856.1|  cystathionine beta-lyase                         60.8    5e-08   Flavobacterium soli
ref|WP_034719601.1|  cystathionine beta-lyase                         60.8    5e-08   Chryseobacterium antarcticum
ref|WP_008257661.1|  cystathionine beta-lyase                         60.8    5e-08   Flavobacteria bacterium BAL38
ref|WP_007646642.1|  O-acetylhomoserine sulfhydrylase                 60.5    5e-08   Xanthomarina gelatinilytica
ref|WP_022827196.1|  cystathionine beta-lyase                         60.5    5e-08   Flavobacterium antarcticum
ref|WP_031444038.1|  cystathionine beta-lyase                         60.5    5e-08   Arenibacter
ref|WP_004569139.1|  cystathionine beta-lyase                         60.5    5e-08   Polaribacter irgensii
ref|WP_013870851.1|  cystathionine beta-lyase                         60.5    5e-08   Lacinutrix sp. 5H-3-7-4
ref|WP_023572328.1|  cystathionine beta-lyase                         60.5    5e-08   Flavobacterium enshiense
ref|WP_027066687.1|  cystathionine beta-lyase                         60.5    5e-08   Maribacter sp. Hel_I_7
ref|WP_037324572.1|  cystathionine beta-lyase                         60.5    6e-08   Salinimicrobium terrae
ref|WP_026981459.1|  cystathionine beta-lyase                         60.5    6e-08   Flavobacterium suncheonense
ref|WP_036153848.1|  cystathionine beta-lyase                         60.5    6e-08   Maribacter forsetii
ref|WP_014387952.1|  cystathionine beta-lyase                         60.1    7e-08   Flavobacterium indicum
ref|WP_035130855.1|  cystathionine beta-lyase                         60.1    7e-08   Flavobacterium beibuense
ref|WP_007093497.1|  cystathionine beta-lyase                         60.1    7e-08   Kordia algicida
ref|WP_023576634.1|  cystathionine beta-lyase                         60.1    8e-08   Flavobacterium saliperosum
ref|WP_023579261.1|  cystathionine beta-lyase                         60.1    8e-08   Flavobacterium limnosediminis
emb|CCF99963.1|  methionine gamma-lyase                               60.1    8e-08   uncultured Flavobacteriia bacterium
ref|WP_034939616.1|  cystathionine beta-lyase                         60.1    8e-08   
ref|WP_014783742.1|  cystathionine beta-lyase                         59.7    9e-08   Aequorivita sublithincola
ref|WP_013307125.1|  cystathionine beta-lyase                         59.7    9e-08   Maribacter sp. HTCC2170
ref|WP_035128700.1|  cystathionine beta-lyase                         59.7    9e-08   Flavobacterium aquatile
ref|WP_026839051.1|  cystathionine beta-lyase                         59.7    1e-07   Gillisia sp. JM1
ref|WP_034920606.1|  cystathionine beta-lyase                         59.7    1e-07   Gillisia sp. CAL575
ref|WP_027137507.1|  cystathionine beta-lyase                         59.7    1e-07   Gaetbulibacter saemankumensis
ref|WP_026726694.1|  cystathionine beta-lyase                         59.7    1e-07   Flavobacterium sasangense
ref|WP_010231094.1|  cystathionine beta-lyase                         59.7    1e-07   Gillisia marina
ref|WP_044639103.1|  cystathionine beta-lyase                         59.7    1e-07   Siansivirga zeaxanthinifaciens
ref|WP_041327761.1|  cystathionine beta-lyase                         59.7    1e-07   Robiginitalea biformata
gb|EAR15507.1|  cystathionine beta-lyase                              59.7    1e-07   Robiginitalea biformata HTCC2501
ref|WP_029035905.1|  cystathionine beta-lyase                         59.7    1e-07   Salinimicrobium xinjiangense
ref|WP_023571459.1|  cystathionine beta-lyase                         59.7    1e-07   Flavobacterium cauense
dbj|GAL77579.1|  O-acetylhomoserine sulfhydrylase                     59.3    1e-07   Algibacter lectus
ref|WP_036783245.1|  cystathionine beta-lyase                         59.7    1e-07   Polaribacter
ref|WP_034059175.1|  cystathionine beta-lyase                         59.3    1e-07   Lacinutrix jangbogonensis
ref|WP_040253833.1|  cystathionine beta-lyase                         59.3    1e-07   Psychroserpens mesophilus
ref|WP_019387558.1|  cystathionine beta-lyase                         59.3    1e-07   Arenitalea lutea
ref|WP_042506508.1|  cystathionine beta-lyase                         59.3    1e-07   Algibacter lectus
ref|WP_034045025.1|  cystathionine beta-lyase                         59.3    1e-07   Flaviramulus ichthyoenteri
gb|EHQ04475.1|  Cys/Met metabolism pyridoxal-phosphate-dependent ...  59.3    1e-07   Gillisia limnaea DSM 15749
ref|WP_038530974.1|  cystathionine beta-lyase                         59.3    1e-07   Formosa agariphila
ref|WP_028887221.1|  cystathionine beta-lyase                         59.3    1e-07   Tenacibaculum ovolyticum
ref|WP_037320529.1|  cystathionine beta-lyase                         59.3    1e-07   Salegentibacter sp. Hel_I_6
ref|WP_040280051.1|  cystathionine beta-lyase                         59.3    1e-07   Psychroserpens damuponensis
ref|WP_040506325.1|  cystathionine beta-lyase                         59.3    2e-07   Gillisia limnaea
ref|WP_034893309.1|  cystathionine beta-lyase                         58.9    2e-07   
ref|WP_027377153.1|  cystathionine beta-lyase                         59.3    2e-07   Chryseobacterium palustre
ref|WP_039346486.1|  cystathionine beta-lyase                         59.3    2e-07   Chryseobacterium solincola
ref|WP_011710043.1|  cystathionine beta-lyase                         58.9    2e-07   Gramella forsetii
ref|WP_026815273.1|  cystathionine beta-lyase                         58.9    2e-07   Arenibacter certesii
ref|WP_034891363.1|  cystathionine beta-lyase                         58.9    2e-07   Gillisia sp. Hel_I_29
ref|WP_028891291.1|  cystathionine beta-lyase                         58.9    2e-07   Tenacibaculum sp. 47A_GOM-205m
ref|WP_034945820.1|  cystathionine beta-lyase                         58.9    2e-07   
gb|EDM43122.1|  probable Methionine gamma-lyase                       58.5    2e-07   unidentified eubacterium SCB49
ref|WP_026915592.1|  cystathionine beta-lyase                         58.5    2e-07   Gramella portivictoriae
ref|WP_034929922.1|  cystathionine beta-lyase                         58.5    2e-07   
ref|WP_028281947.1|  cystathionine beta-lyase                         58.5    3e-07   Olleya marilimosa
ref|WP_042336387.1|  cystathionine beta-lyase                         58.5    3e-07   
ref|WP_041496344.1|  cystathionine beta-lyase                         58.5    3e-07   Nonlabens marinus
ref|WP_026711287.1|  cystathionine beta-lyase                         58.5    3e-07   Flavobacterium filum
ref|WP_034257843.1|  cystathionine beta-lyase                         58.5    3e-07   Altibacter lentus
ref|WP_043567506.1|  cystathionine beta-lyase                         58.2    3e-07   
ref|WP_008991878.1|  cystathionine beta-lyase                         58.2    3e-07   Galbibacter marinus
ref|WP_008462050.1|  cystathionine beta-lyase                         58.2    3e-07   Flavobacterium sp. F52
ref|WP_029294450.1|  cystathionine beta-lyase                         58.2    4e-07   Chryseobacterium hispalense
ref|WP_021778620.1|  Cys/Met metabolism PLP-dependent enzyme          57.8    4e-07   Dokdonia sp. MED134
ref|WP_026811643.1|  cystathionine beta-lyase                         57.8    4e-07   Arenibacter latericius
ref|WP_035334044.1|  cystathionine beta-lyase                         57.8    4e-07   Dokdonia sp. PRO95
ref|WP_035325087.1|  cystathionine beta-lyase                         57.8    4e-07   Dokdonia donghaensis
ref|WP_044624939.1|  cystathionine beta-lyase                         57.8    4e-07   Tamlana nanhaiensis
ref|WP_013749695.1|  cystathionine beta-lyase                         57.8    4e-07   Dokdonia sp. 4H-3-7-5
ref|WP_027386160.1|  cystathionine beta-lyase                         57.8    4e-07   Chryseobacterium gregarium
ref|WP_042719927.1|  cystathionine beta-lyase                         57.8    4e-07   Flavobacterium sp. B17
ref|WP_042244621.1|  cystathionine beta-lyase                         57.8    5e-07   Jejuia pallidilutea
ref|WP_034678770.1|  cystathionine beta-lyase                         57.8    5e-07   Chryseobacterium formosense
ref|WP_039366244.1|  cystathionine beta-lyase                         57.4    6e-07   Chryseobacterium taiwanense
ref|WP_012806995.1|  cystathionine beta-lyase                         57.4    6e-07   Candidatus Accumulibacter phosphatis
ref|WP_034916156.1|  cystathionine beta-lyase                         57.4    6e-07   
ref|WP_013188250.1|  cystathionine beta-lyase                         57.4    7e-07   Croceibacter atlanticus
gb|EXI92773.1|  Methionine gamma-lyase                                57.0    7e-07   Candidatus Accumulibacter sp. BA-94
ref|WP_034743007.1|  cystathionine beta-lyase                         57.0    7e-07   Chryseobacterium vrystaatense
ref|WP_034726484.1|  cystathionine beta-lyase                         57.0    8e-07   Chryseobacterium
ref|WP_034704868.1|  cystathionine beta-lyase                         57.0    8e-07   Chryseobacterium luteum
ref|WP_040995836.1|  cystathionine beta-lyase                         57.0    8e-07   Chryseobacterium oranimense
ref|WP_034711020.1|  cystathionine beta-lyase                         56.6    1e-06   Chryseobacterium soli
ref|WP_041802134.1|  cystathionine beta-lyase                         56.6    1e-06   Muricauda ruestringensis
ref|WP_010516575.1|  cystathionine beta-lyase                         56.6    1e-06   Croceivirga radicis
ref|WP_007842611.1|  MULTISPECIES: cystathionine beta-lyase           56.6    1e-06   Chryseobacterium
ref|WP_020081610.1|  cystathionine beta-lyase                         56.6    1e-06   
gb|KFF74221.1|  cystathionine beta-lyase                              56.2    1e-06   Chryseobacterium sp. P1-3
gb|AEM72292.1|  Cystathionine gamma-lyase                             56.6    1e-06   Muricauda ruestringensis DSM 13258
dbj|BAP30620.1|  putative methionine gamma-lyase                      56.2    1e-06   Chryseobacterium sp. StRB126
ref|WP_002980746.1|  cystathionine beta-lyase                         56.2    1e-06   Chryseobacterium gleum
ref|WP_034695275.1|  cystathionine beta-lyase                         56.2    1e-06   Chryseobacterium sp. CF365
ref|WP_034685460.1|  cystathionine beta-lyase                         56.2    2e-06   Chryseobacterium piperi
ref|WP_027373193.1|  cystathionine beta-lyase                         56.2    2e-06   Chryseobacterium
ref|WP_034733845.1|  cystathionine beta-lyase                         56.2    2e-06   Chryseobacterium indologenes
ref|WP_027378279.1|  cystathionine beta-lyase                         56.2    2e-06   Chryseobacterium daeguense
ref|WP_036385279.1|  cystathionine beta-lyase                         56.2    2e-06   Muricauda sp. MAR_2010_75
ref|WP_024480783.1|  cystathionine beta-lyase                         55.8    2e-06   Cellulophaga baltica
ref|WP_025615136.1|  cystathionine beta-lyase                         55.8    2e-06   Cellulophaga baltica
ref|WP_034666996.1|  cystathionine beta-lyase                         55.8    2e-06   Cellulophaga sp. E6(2014)
ref|WP_029446484.1|  cystathionine beta-lyase                         55.8    2e-06   Cellulophaga baltica
ref|WP_029449234.1|  cystathionine beta-lyase                         55.8    2e-06   Cellulophaga baltica
ref|WP_013552336.1|  cystathionine beta-lyase                         55.8    2e-06   Cellulophaga algicola
ref|WP_026934033.1|  cystathionine beta-lyase                         55.5    3e-06   Gramella echinicola
gb|KDD74521.1|  Cys/Met metabolism PLP-dependent enzyme               53.5    1e-05   Helicosporidium sp. ATCC 50920
ref|WP_026481510.1|  methionine gamma-lyase                           53.1    2e-05   Ahrensia sp. 13_GOM-1096m
ref|WP_018688081.1|  methionine gamma-lyase                           53.1    2e-05   Ahrensia kielensis
ref|WP_019700948.1|  MULTISPECIES: O-succinylhomoserine sulfhydry...  52.4    3e-05   Acidovorax oryzae
ref|WP_020404638.1|  hypothetical protein                             50.8    8e-05   Gracilimonas tropica
ref|WP_027263953.1|  methionine gamma-lyase                           50.4    1e-04   Sedimentitalea nanhaiensis
ref|WP_028499129.1|  O-succinylhomoserine sulfhydrylase               50.1    2e-04   Microvirgula
ref|WP_011794994.1|  O-succinylhomoserine sulfhydrylase               50.1    2e-04   Acidovorax citrulli
ref|WP_013594239.1|  O-succinylhomoserine sulfhydrylase               49.7    2e-04   Acidovorax avenae
ref|WP_008867821.1|  cystathionine beta-lyase                         49.7    2e-04   Flavobacteria bacterium MS024-3C
ref|WP_008888401.1|  methionine gamma-lyase                           49.3    3e-04   Thalassospira
ref|WP_026285309.1|  O-succinylhomoserine sulfhydrylase               49.3    3e-04   Thiomonas sp. FB-6
ref|WP_007088882.1|  methionine gamma-lyase                           48.9    3e-04   Thalassospira xiamenensis
ref|WP_037986959.1|  methionine gamma-lyase                           48.9    3e-04   Thalassospira permensis
ref|WP_024588507.1|  O-succinylhomoserine sulfhydrylase               48.9    4e-04   Aliihoeflea sp. 2WW
ref|WP_028549053.1|  cystathionine beta-lyase                         48.9    4e-04   Paenibacillus sp. UNC451MF
ref|WP_043550710.1|  O-succinylhomoserine sulfhydrylase               48.9    4e-04   Acetobacter malorum
ref|WP_007255014.1|  O-succinylhomoserine sulfhydrylase               48.5    5e-04   Oceanicola granulosus
ref|WP_021099971.1|  O-acetylhomoserine sulfhydrylase                 48.5    5e-04   Litoreibacter arenae
gb|KFL90188.1|  O-acetylhomoserine sulfhydrylase                      48.5    5e-04   
ref|WP_019958792.1|  hypothetical protein                             48.5    6e-04   
ref|WP_039793289.1|  cystathionine beta-lyase                         48.5    6e-04   
ref|WP_033070564.1|  methionine gamma-lyase                           48.5    6e-04   
ref|WP_044829616.1|  methionine gamma-lyase                           48.1    6e-04   
ref|WP_036675995.1|  cystathionine beta-lyase                         48.1    7e-04   
ref|WP_034633239.1|  O-succinylhomoserine sulfhydrylase               48.1    7e-04   
ref|WP_040435711.1|  O-succinylhomoserine sulfhydrylase               48.1    7e-04   
ref|WP_027995972.1|  O-succinylhomoserine sulfhydrylase               47.8    8e-04   
ref|WP_027467565.1|  O-succinylhomoserine sulfhydrylase               47.8    9e-04   
ref|WP_003048948.1|  methionine gamma-lyase                           47.8    9e-04   
ref|WP_011805891.1|  O-succinylhomoserine sulfhydrylase               47.8    9e-04   
ref|WP_028449386.1|  O-succinylhomoserine sulfhydrylase               47.8    9e-04   
ref|WP_028451110.1|  O-succinylhomoserine sulfhydrylase               47.8    0.001   
ref|WP_015913659.1|  O-succinylhomoserine sulfhydrylase               47.8    0.001   
ref|WP_035744923.1|  O-succinylhomoserine sulfhydrylase               47.8    0.001   
ref|WP_035708234.1|  O-succinylhomoserine sulfhydrylase               47.8    0.001   



>ref|XP_006343784.1| PREDICTED: methionine gamma-lyase-like [Solanum tuberosum]
Length=451

 Score =   192 bits (488),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 96/132 (73%), Positives = 111/132 (84%), Gaps = 7/132 (5%)
 Frame = +2

Query  59   MAETIHQNVNV--SNKRRP-GSEEWER--DDMMKAKKGGKPAVQMWEDPAAALASARHEF  223
            MA+T++QN N+  SNK+R  GS+E +   D    +KK  K  V  WEDPAAALA+ARHEF
Sbjct  1    MADTLNQNTNIVASNKKRSSGSDECDHHDDSFFVSKKQSKSLV--WEDPAAALANARHEF  58

Query  224  GEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAME  403
            GEHGGVNMSIEASATFTVMEPE++RRMF+GELGPD D+FIYSRHFNPTVLN+ RLMAA+E
Sbjct  59   GEHGGVNMSIEASATFTVMEPETMRRMFAGELGPDRDFFIYSRHFNPTVLNLGRLMAALE  118

Query  404  GTEAAYCTASGM  439
            GTEAAYCTASGM
Sbjct  119  GTEAAYCTASGM  130



>gb|KDP25202.1| hypothetical protein JCGZ_20358 [Jatropha curcas]
Length=453

 Score =   191 bits (485),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 93/129 (72%), Positives = 109/129 (84%), Gaps = 2/129 (2%)
 Frame = +2

Query  59   MAETIHQNVNV-SNKRRPGSEEWERDDMMKAKKGGKP-AVQMWEDPAAALASARHEFGEH  232
            MAET   NV V S K+R G ++++ DD++KAKK   P A+   +DP AALA+ARHEFGEH
Sbjct  1    MAETKTNNVFVPSGKKRTGQDDFDGDDVIKAKKSMLPSALSFGDDPVAALAAARHEFGEH  60

Query  233  GGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEGTE  412
            GGVNMSIEASATFTVMEP+++RRMFSGELGPD D+FIYSRHFNPTVLN+ R MAA+EGTE
Sbjct  61   GGVNMSIEASATFTVMEPDTMRRMFSGELGPDRDFFIYSRHFNPTVLNLGRQMAALEGTE  120

Query  413  AAYCTASGM  439
            AAYCTASGM
Sbjct  121  AAYCTASGM  129



>ref|XP_004245457.1| PREDICTED: methionine gamma-lyase [Solanum lycopersicum]
Length=444

 Score =   190 bits (483),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 108/129 (84%), Gaps = 4/129 (3%)
 Frame = +2

Query  59   MAETIHQNVNVSNKRRPGSEEWERDD--MMKAKKGGKPAVQMWEDPAAALASARHEFGEH  232
            MA+T++QN   + KR  GS++ +  D  +  +KK  K  V  WEDPAAALA+ARHEFGEH
Sbjct  1    MADTLNQNTFSNKKRSSGSDDCDHHDDTLFVSKKQSKSLV--WEDPAAALANARHEFGEH  58

Query  233  GGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEGTE  412
            GGVNMSIEASATFTVMEPE++RRMF+GELGPD D+FIYSRHFNPTVLN+ RLMAA+EGTE
Sbjct  59   GGVNMSIEASATFTVMEPETMRRMFAGELGPDRDFFIYSRHFNPTVLNLGRLMAALEGTE  118

Query  413  AAYCTASGM  439
            AAYCTASGM
Sbjct  119  AAYCTASGM  127



>ref|XP_009796885.1| PREDICTED: methionine gamma-lyase-like [Nicotiana sylvestris]
Length=448

 Score =   190 bits (483),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 109/129 (84%), Gaps = 4/129 (3%)
 Frame = +2

Query  59   MAETIHQNVNV-SNKRRPGSEEWER-DDMMKAKKGGKPAVQMWEDPAAALASARHEFGEH  232
            MA+T++QN  + S+K+R GS+E +  DD    KK  K  +  WEDPAAALA+ARH FGEH
Sbjct  1    MADTLNQNNMIFSSKKRSGSDEKDHHDDFFVTKKQTKSLI--WEDPAAALANARHVFGEH  58

Query  233  GGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEGTE  412
            GGVNMSIEASATFTVMEPE++RRMFSGELGPD D+FIYSRHFNPTVLN+ RLMAA+EGTE
Sbjct  59   GGVNMSIEASATFTVMEPETMRRMFSGELGPDRDFFIYSRHFNPTVLNLGRLMAALEGTE  118

Query  413  AAYCTASGM  439
            AAYCTASGM
Sbjct  119  AAYCTASGM  127



>ref|XP_009631114.1| PREDICTED: methionine gamma-lyase-like [Nicotiana tomentosiformis]
Length=445

 Score =   189 bits (480),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 91/117 (78%), Positives = 101/117 (86%), Gaps = 3/117 (3%)
 Frame = +2

Query  92   SNKRRPGSEEWER-DDMMKAKKGGKPAVQMWEDPAAALASARHEFGEHGGVNMSIEASAT  268
            SNK+R GS+E +  DD    KK  K  +  WEDPAAALA+ARHEFGEHGGVNMSIEASAT
Sbjct  10   SNKKRSGSDEKDHHDDFFVTKKQTKSLI--WEDPAAALANARHEFGEHGGVNMSIEASAT  67

Query  269  FTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEGTEAAYCTASGM  439
            FTVMEPE++RRMFSGELGPD D+FIYSRHFNPTVLN+ RLMAA+EGTEAAYCTASGM
Sbjct  68   FTVMEPETMRRMFSGELGPDRDFFIYSRHFNPTVLNLGRLMAALEGTEAAYCTASGM  124



>ref|XP_009625576.1| PREDICTED: methionine gamma-lyase [Nicotiana tomentosiformis]
Length=443

 Score =   188 bits (478),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/128 (71%), Positives = 108/128 (84%), Gaps = 2/128 (2%)
 Frame = +2

Query  59   MAETIHQNVNVSNKRRPGSEEWER-DDMMKAKKGGKPAVQMWEDPAAALASARHEFGEHG  235
            MA+ + QN  VSNK+   S+E +  DD++ AKK  K  + +W+DPAAALA+ARHEFGEHG
Sbjct  1    MADKLQQNAVVSNKKLSASDERDHCDDVIVAKKPTKHHL-IWDDPAAALANARHEFGEHG  59

Query  236  GVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEGTEA  415
            GVNMSIEASATFTVM+PE L RMF+GELGPD D+FIYSRHFNPTVLN+ RLMAA+EGTEA
Sbjct  60   GVNMSIEASATFTVMDPEILSRMFAGELGPDRDFFIYSRHFNPTVLNLGRLMAALEGTEA  119

Query  416  AYCTASGM  439
            AYCT+SGM
Sbjct  120  AYCTSSGM  127



>gb|KCW77319.1| hypothetical protein EUGRSUZ_D01681 [Eucalyptus grandis]
Length=371

 Score =   186 bits (471),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 91/131 (69%), Positives = 105/131 (80%), Gaps = 4/131 (3%)
 Frame = +2

Query  59   MAETIHQNVNVSNKRRPGSEEWE--RDDMMKAKKG--GKPAVQMWEDPAAALASARHEFG  226
            MAE        ++K+RPGS++ +   D M+ AKK     P   +WEDPAAALA ARHEFG
Sbjct  1    MAEARAHGFVYASKKRPGSDDADGGEDAMVVAKKQMISGPVAGVWEDPAAALAGARHEFG  60

Query  227  EHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEG  406
            EHGGVNMSIEASATFTVMEPE++RRMF+GELGPD D+FIYSRHFNPTVLN+ R MAA+EG
Sbjct  61   EHGGVNMSIEASATFTVMEPETMRRMFTGELGPDRDFFIYSRHFNPTVLNLGRQMAALEG  120

Query  407  TEAAYCTASGM  439
            TEAAYCTASGM
Sbjct  121  TEAAYCTASGM  131



>ref|XP_010053068.1| PREDICTED: methionine gamma-lyase [Eucalyptus grandis]
 gb|KCW77318.1| hypothetical protein EUGRSUZ_D01681 [Eucalyptus grandis]
Length=455

 Score =   186 bits (471),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 91/131 (69%), Positives = 105/131 (80%), Gaps = 4/131 (3%)
 Frame = +2

Query  59   MAETIHQNVNVSNKRRPGSEEWE--RDDMMKAKKG--GKPAVQMWEDPAAALASARHEFG  226
            MAE        ++K+RPGS++ +   D M+ AKK     P   +WEDPAAALA ARHEFG
Sbjct  1    MAEARAHGFVYASKKRPGSDDADGGEDAMVVAKKQMISGPVAGVWEDPAAALAGARHEFG  60

Query  227  EHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEG  406
            EHGGVNMSIEASATFTVMEPE++RRMF+GELGPD D+FIYSRHFNPTVLN+ R MAA+EG
Sbjct  61   EHGGVNMSIEASATFTVMEPETMRRMFTGELGPDRDFFIYSRHFNPTVLNLGRQMAALEG  120

Query  407  TEAAYCTASGM  439
            TEAAYCTASGM
Sbjct  121  TEAAYCTASGM  131



>ref|XP_009785770.1| PREDICTED: methionine gamma-lyase-like [Nicotiana sylvestris]
Length=436

 Score =   183 bits (465),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 87/127 (69%), Positives = 101/127 (80%), Gaps = 7/127 (6%)
 Frame = +2

Query  59   MAETIHQNVNVSNKRRPGSEEWERDDMMKAKKGGKPAVQMWEDPAAALASARHEFGEHGG  238
            MA+ + QN  VSN++R  S+E +  D  K          +WEDPAAALA  RHEFGEHGG
Sbjct  1    MADKLQQNAIVSNQKRSASDEHDHRDDFKHH-------LIWEDPAAALADIRHEFGEHGG  53

Query  239  VNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEGTEAA  418
            VNMSIEASATFTVM+PE+L RMF+GELGPD D+FIYSRHFNPTVLN+ RLMAA+EGTEAA
Sbjct  54   VNMSIEASATFTVMDPETLSRMFAGELGPDRDFFIYSRHFNPTVLNLGRLMAALEGTEAA  113

Query  419  YCTASGM  439
            YCT+SGM
Sbjct  114  YCTSSGM  120



>ref|XP_010251592.1| PREDICTED: methionine gamma-lyase [Nelumbo nucifera]
Length=446

 Score =   183 bits (465),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/127 (69%), Positives = 105/127 (83%), Gaps = 4/127 (3%)
 Frame = +2

Query  59   MAETIHQNVNVSNKRRPGSEEWERDDMMKAKKGGKPAVQMWEDPAAALASARHEFGEHGG  238
            MAE+   +V++  K+R G +++E DD + AKK    +V    DPAA+LA ARHEFGEHGG
Sbjct  1    MAESRCLDVSLIGKKRNGKDDFENDDFVVAKK----SVVACNDPAASLAGARHEFGEHGG  56

Query  239  VNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEGTEAA  418
            VNMSIEASATFTVMEPE++RRMF+GELGPD D+FIYSRHFNPTVLN+ R MAA+EGTEAA
Sbjct  57   VNMSIEASATFTVMEPETMRRMFTGELGPDQDFFIYSRHFNPTVLNLGRQMAALEGTEAA  116

Query  419  YCTASGM  439
            YCTASGM
Sbjct  117  YCTASGM  123



>ref|XP_011026788.1| PREDICTED: methionine gamma-lyase [Populus euphratica]
Length=454

 Score =   182 bits (463),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 94/133 (71%), Positives = 106/133 (80%), Gaps = 8/133 (6%)
 Frame = +2

Query  59   MAETIHQNVNV-SNKRRPGSEEWERDDMMKAKKG-----GKPAVQMWEDPAAALASARHE  220
            MAET +Q   V S K+R  + +   DD + A K      G P+  MWEDPAAALASARHE
Sbjct  1    MAETKNQQGFVFSGKKRSSTGQDGDDDFIVANKKSMLSTGLPS--MWEDPAAALASARHE  58

Query  221  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  400
            FGEHGGVNMSIEASATFTVMEPE++RRMF+GELGPD D+FIYSRHFNPTVLN+ R MAA+
Sbjct  59   FGEHGGVNMSIEASATFTVMEPETMRRMFAGELGPDRDFFIYSRHFNPTVLNLGRQMAAL  118

Query  401  EGTEAAYCTASGM  439
            EGTEAAYCTASGM
Sbjct  119  EGTEAAYCTASGM  131



>ref|XP_002299428.1| Cys/Met metabolism pyridoxal-phosphate-dependent enzyme family 
protein [Populus trichocarpa]
 gb|EEE84233.1| Cys/Met metabolism pyridoxal-phosphate-dependent enzyme family 
protein [Populus trichocarpa]
Length=454

 Score =   181 bits (460),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 93/133 (70%), Positives = 106/133 (80%), Gaps = 8/133 (6%)
 Frame = +2

Query  59   MAETIHQNVNV-SNKRRPGSEEWERDDMMKAKKG-----GKPAVQMWEDPAAALASARHE  220
            MAET +Q   V S K+R  + +   DD + + K      G P+  MWEDPAAALASARHE
Sbjct  1    MAETKNQQGFVFSGKKRSSTGQDGDDDFIVSNKKSMLSTGLPS--MWEDPAAALASARHE  58

Query  221  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  400
            FGEHGGVNMSIEASATFTVMEPE++RRMF+GELGPD D+FIYSRHFNPTVLN+ R MAA+
Sbjct  59   FGEHGGVNMSIEASATFTVMEPETMRRMFAGELGPDRDFFIYSRHFNPTVLNLGRQMAAL  118

Query  401  EGTEAAYCTASGM  439
            EGTEAAYCTASGM
Sbjct  119  EGTEAAYCTASGM  131



>ref|XP_011070383.1| PREDICTED: methionine gamma-lyase [Sesamum indicum]
Length=456

 Score =   178 bits (451),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 88/122 (72%), Positives = 101/122 (83%), Gaps = 3/122 (2%)
 Frame = +2

Query  83   VNVSNKRRPGSEEWERDDMMKAKKG---GKPAVQMWEDPAAALASARHEFGEHGGVNMSI  253
            VN+S+K+R GS + + +    AKK     K      EDPAAALA+ARHEFGEHGGVNMSI
Sbjct  11   VNMSSKKRSGSSDDQWEQFSAAKKHQVMNKTPPPHAEDPAAALANARHEFGEHGGVNMSI  70

Query  254  EASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEGTEAAYCTAS  433
            EASATFTVMEPE++RRMF+GELGPD D+FIYSRHFNPTVLN+ RLMAA+EGTEAAYCTAS
Sbjct  71   EASATFTVMEPETMRRMFTGELGPDRDFFIYSRHFNPTVLNLGRLMAALEGTEAAYCTAS  130

Query  434  GM  439
            GM
Sbjct  131  GM  132



>gb|EYU33474.1| hypothetical protein MIMGU_mgv1a006470mg [Erythranthe guttata]
 gb|EYU33475.1| hypothetical protein MIMGU_mgv1a006470mg [Erythranthe guttata]
Length=443

 Score =   177 bits (450),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 91/129 (71%), Positives = 106/129 (82%), Gaps = 4/129 (3%)
 Frame = +2

Query  59   MAET-IHQNVN-VSNKRRPGSEEWERDDMMKAKKGGKPAVQMWEDPAAALASARHEFGEH  232
            MAET  + +V+ +S K+R GS + + D    A K  + A    +DPA ALA+ARHEFGEH
Sbjct  1    MAETAFNSDVSTISAKKRSGSSDDQWDQF--AAKKHQSASNKTDDPAVALANARHEFGEH  58

Query  233  GGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEGTE  412
            GGVNMSIEASATFTVMEPE++RRMF+GELGPD D+FIYSRHFNPTVLN+SRLMAAMEGTE
Sbjct  59   GGVNMSIEASATFTVMEPETMRRMFAGELGPDRDFFIYSRHFNPTVLNLSRLMAAMEGTE  118

Query  413  AAYCTASGM  439
            AAYCTASGM
Sbjct  119  AAYCTASGM  127



>ref|XP_008374119.1| PREDICTED: methionine gamma-lyase-like [Malus domestica]
Length=457

 Score =   177 bits (450),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 89/133 (67%), Positives = 105/133 (79%), Gaps = 6/133 (5%)
 Frame = +2

Query  59   MAETIHQNVN---VSNKRRPGSEEWERDDMMKAKKG---GKPAVQMWEDPAAALASARHE  220
            MA+T  Q +     ++K+R   ++ + +D + AKK       A   WEDPAAALASARHE
Sbjct  1    MADTKSQGLVFPPANSKKRAEHDDMDNNDYVAAKKSMLLSSAAAXAWEDPAAALASARHE  60

Query  221  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  400
            FGEHGGVNMSIEASATFTVMEPE+LR+MFSGELG D D+FIYSRHFNPTVLN+SR MAA+
Sbjct  61   FGEHGGVNMSIEASATFTVMEPETLRKMFSGELGADRDFFIYSRHFNPTVLNLSRQMAAL  120

Query  401  EGTEAAYCTASGM  439
            EGTEAAYCT+SGM
Sbjct  121  EGTEAAYCTSSGM  133



>emb|CAN83499.1| hypothetical protein VITISV_026969 [Vitis vinifera]
Length=400

 Score =   176 bits (446),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 83/116 (72%), Positives = 97/116 (84%), Gaps = 2/116 (2%)
 Frame = +2

Query  92   SNKRRPGSEEWERDDMMKAKKGGKPAVQMWEDPAAALASARHEFGEHGGVNMSIEASATF  271
            + K+R G+++   D ++  K    PAV   EDP AALA ARHEFGEHGGVNMSIEASATF
Sbjct  8    AGKKRKGADD--EDHLVAKKSASLPAVAKGEDPMAALAMARHEFGEHGGVNMSIEASATF  65

Query  272  TVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEGTEAAYCTASGM  439
            TVMEP+++RRMFSGELGPD D+FIYSRHFNPTVLN+SR MAA+EGTEAAYCT+SGM
Sbjct  66   TVMEPDTMRRMFSGELGPDRDFFIYSRHFNPTVLNLSRQMAALEGTEAAYCTSSGM  121



>ref|XP_002518910.1| cystathionine gamma-synthase, putative [Ricinus communis]
 gb|EEF43443.1| cystathionine gamma-synthase, putative [Ricinus communis]
Length=449

 Score =   177 bits (448),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 88/130 (68%), Positives = 105/130 (81%), Gaps = 3/130 (2%)
 Frame = +2

Query  59   MAETIHQNVNVSNKRR-PGSEEWER-DDMMKAKKGG-KPAVQMWEDPAAALASARHEFGE  229
            MA+T  Q   ++ K+R  G +E++  DD + +KK    P V   EDPAA LA++RHEFGE
Sbjct  1    MADTKTQGFLLAGKKRGAGQDEFDGGDDFIVSKKSMLPPGVAYGEDPAAGLAASRHEFGE  60

Query  230  HGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEGT  409
            HGGVNMSIEASATFTVMEP+++RRMFSGELGPD D+FIYSRHFNPTVLN+ R MAA+EGT
Sbjct  61   HGGVNMSIEASATFTVMEPDTMRRMFSGELGPDRDFFIYSRHFNPTVLNLGRQMAALEGT  120

Query  410  EAAYCTASGM  439
            EAAYCTASGM
Sbjct  121  EAAYCTASGM  130



>ref|XP_002280162.1| PREDICTED: methionine gamma-lyase [Vitis vinifera]
Length=438

 Score =   176 bits (446),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 83/116 (72%), Positives = 97/116 (84%), Gaps = 2/116 (2%)
 Frame = +2

Query  92   SNKRRPGSEEWERDDMMKAKKGGKPAVQMWEDPAAALASARHEFGEHGGVNMSIEASATF  271
            + K+R G+++   D ++  K    PAV   EDP AALA ARHEFGEHGGVNMSIEASATF
Sbjct  8    AGKKRKGADD--EDHLVAKKSASLPAVAKGEDPMAALAMARHEFGEHGGVNMSIEASATF  65

Query  272  TVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEGTEAAYCTASGM  439
            TVMEP+++RRMFSGELGPD D+FIYSRHFNPTVLN+SR MAA+EGTEAAYCT+SGM
Sbjct  66   TVMEPDTMRRMFSGELGPDRDFFIYSRHFNPTVLNLSRQMAALEGTEAAYCTSSGM  121



>ref|XP_010676903.1| PREDICTED: methionine gamma-lyase [Beta vulgaris subsp. vulgaris]
Length=454

 Score =   176 bits (445),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 98/124 (79%), Gaps = 4/124 (3%)
 Frame = +2

Query  68   TIHQNVNVSNKRRPGSEEWERDDMMKAKKGGKPAVQMWEDPAAALASARHEFGEHGGVNM  247
            +++    +  K+RPG    + D+        KP +   EDP AALASARHEFGEHGGVNM
Sbjct  10   SLNNTTTIHTKKRPG----DNDNYAPTIITKKPTMSASEDPVAALASARHEFGEHGGVNM  65

Query  248  SIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEGTEAAYCT  427
            SIEASATFTVMEPE++RR+F+GELGPD D++IYSRHFNPTVLN+ RLMAA+EGTEAAYCT
Sbjct  66   SIEASATFTVMEPETMRRLFNGELGPDRDFYIYSRHFNPTVLNLGRLMAALEGTEAAYCT  125

Query  428  ASGM  439
            ASGM
Sbjct  126  ASGM  129



>ref|XP_011101902.1| PREDICTED: methionine gamma-lyase-like [Sesamum indicum]
Length=443

 Score =   175 bits (443),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 98/120 (82%), Gaps = 1/120 (1%)
 Frame = +2

Query  80   NVNVSNKRRPGSEEWERDDMMKAKKGGKPAVQMWEDPAAALASARHEFGEHGGVNMSIEA  259
            NVN+S  +R GS++       K  +  K A    EDPAAALA+ RHEFGEHGGVNMSIEA
Sbjct  5    NVNLSTIKRSGSDDQFASSAAKKHQINK-APPHVEDPAAALANIRHEFGEHGGVNMSIEA  63

Query  260  SATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEGTEAAYCTASGM  439
            SATFTVMEP++LRRMF+GELGPD D+FIYSRHFNPTVLN+ RLMAA+EGTEAAYCTASGM
Sbjct  64   SATFTVMEPDTLRRMFAGELGPDRDFFIYSRHFNPTVLNLGRLMAALEGTEAAYCTASGM  123



>ref|XP_006439223.1| hypothetical protein CICLE_v10020136mg [Citrus clementina]
 gb|ESR52463.1| hypothetical protein CICLE_v10020136mg [Citrus clementina]
 gb|KDO76720.1| hypothetical protein CISIN_1g013079mg [Citrus sinensis]
Length=447

 Score =   174 bits (441),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 99/116 (85%), Gaps = 0/116 (0%)
 Frame = +2

Query  92   SNKRRPGSEEWERDDMMKAKKGGKPAVQMWEDPAAALASARHEFGEHGGVNMSIEASATF  271
            S KR  G+EE + DD+ K KK        WEDPAAALASARHEFGEHGGVNMSIEASATF
Sbjct  9    SKKRSAGTEETDGDDLYKTKKSMLSTAAAWEDPAAALASARHEFGEHGGVNMSIEASATF  68

Query  272  TVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEGTEAAYCTASGM  439
            TVMEPE++RRMF+GELGPD D+FIYSRHFNPTVLN+SR MAA+EGTEAAYCTASGM
Sbjct  69   TVMEPETMRRMFAGELGPDRDFFIYSRHFNPTVLNLSRQMAALEGTEAAYCTASGM  124



>ref|XP_006476291.1| PREDICTED: methionine gamma-lyase-like [Citrus sinensis]
Length=447

 Score =   174 bits (440),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 99/116 (85%), Gaps = 0/116 (0%)
 Frame = +2

Query  92   SNKRRPGSEEWERDDMMKAKKGGKPAVQMWEDPAAALASARHEFGEHGGVNMSIEASATF  271
            S KR  G+EE + DD+ K KK        WEDPAAALASARHEFGEHGGVNMSIEASATF
Sbjct  9    SKKRSAGTEETDGDDLYKTKKSMLSTAAAWEDPAAALASARHEFGEHGGVNMSIEASATF  68

Query  272  TVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEGTEAAYCTASGM  439
            TVMEPE++RRMF+GELGPD D+FIYSRHFNPTVLN+SR MAA+EGTEAAYCTASGM
Sbjct  69   TVMEPETMRRMFAGELGPDRDFFIYSRHFNPTVLNLSRQMAALEGTEAAYCTASGM  124



>gb|KJB52368.1| hypothetical protein B456_008G258500 [Gossypium raimondii]
Length=452

 Score =   174 bits (440),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 87/128 (68%), Positives = 101/128 (79%), Gaps = 1/128 (1%)
 Frame = +2

Query  59   MAETIHQNVNVSNKRRPGSEEWERDD-MMKAKKGGKPAVQMWEDPAAALASARHEFGEHG  235
            MAET  + +  + K+R    +    D +  AKK   P +    DPAAALA+ARHEFGEHG
Sbjct  1    MAETQSRGLVFAGKKRGTGTDDFDGDDIFVAKKSMLPTMATESDPAAALANARHEFGEHG  60

Query  236  GVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEGTEA  415
            GVNMSIEASATFTVMEPE++RRMF+GELGPD D+FIYSRHFNPTVLN+ RLMAA+EGTEA
Sbjct  61   GVNMSIEASATFTVMEPETMRRMFAGELGPDRDFFIYSRHFNPTVLNLGRLMAALEGTEA  120

Query  416  AYCTASGM  439
            AYCTASGM
Sbjct  121  AYCTASGM  128



>gb|KFK21963.1| hypothetical protein AALP_AAs48252U001300 [Arabis alpina]
Length=136

 Score =   164 bits (415),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/108 (72%), Positives = 91/108 (84%), Gaps = 2/108 (2%)
 Frame = +2

Query  116  EEWERDDMMKAKKGGKPAVQMWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESL  295
            E+ +  D M AKK    A ++  DP AA+AS RHEFGEHGGVNMSI ASATFTVMEPE++
Sbjct  24   EDNKGGDAMAAKKSALAACEV--DPVAAMASIRHEFGEHGGVNMSIVASATFTVMEPETM  81

Query  296  RRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEGTEAAYCTASGM  439
            RR+F GELGPDND+F+YSRHFNPTVLN+SR MAA+EGTEAAYCT+SGM
Sbjct  82   RRVFRGELGPDNDFFVYSRHFNPTVLNLSRKMAALEGTEAAYCTSSGM  129



>ref|XP_010544898.1| PREDICTED: methionine gamma-lyase [Tarenaya hassleriana]
Length=438

 Score =   171 bits (434),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 87/93 (94%), Gaps = 2/93 (2%)
 Frame = +2

Query  161  KPAVQMWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYF  340
            KPA   WEDPAAALAS RHEFGEHGGVNMSIEASATFTVMEPE++RRMF+GE+GPDND++
Sbjct  31   KPAA--WEDPAAALASIRHEFGEHGGVNMSIEASATFTVMEPETMRRMFTGEIGPDNDFY  88

Query  341  IYSRHFNPTVLNVSRLMAAMEGTEAAYCTASGM  439
            IYSRHFNPTVL +SR MAA+EGTEAAYCTASGM
Sbjct  89   IYSRHFNPTVLALSRQMAALEGTEAAYCTASGM  121



>ref|XP_004495508.1| PREDICTED: methionine gamma-lyase-like [Cicer arietinum]
Length=441

 Score =   170 bits (431),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 96/127 (76%), Gaps = 10/127 (8%)
 Frame = +2

Query  59   MAETIHQNVNVSNKRRPGSEEWERDDMMKAKKGGKPAVQMWEDPAAALASARHEFGEHGG  238
            MA+T  Q    + KR   + + E    +    G         DPAAALAS RHEFGEHGG
Sbjct  1    MADTF-QTTTTAAKRNRSNNDTEPKKKLTCGDG---------DPAAALASTRHEFGEHGG  50

Query  239  VNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEGTEAA  418
            VNMSIEASATFTVMEPE++RRMF+GELGPD DYFIYSRHFNPTVLN+SRLMA++EGTEAA
Sbjct  51   VNMSIEASATFTVMEPETMRRMFTGELGPDRDYFIYSRHFNPTVLNLSRLMASLEGTEAA  110

Query  419  YCTASGM  439
            YCTASGM
Sbjct  111  YCTASGM  117



>ref|XP_004502061.1| PREDICTED: methionine gamma-lyase-like [Cicer arietinum]
Length=443

 Score =   170 bits (430),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/132 (64%), Positives = 103/132 (78%), Gaps = 13/132 (10%)
 Frame = +2

Query  59   MAETIHQNVNVSNKRRPGSEEWERDDMMKAKKGGK-----PAVQMWEDPAAALASARHEF  223
            MA+T+   VNV N +R        +D+++ +   K      AV    DPAA+ A+ARHEF
Sbjct  1    MADTL---VNVHNNKRS-----NENDVVEGRDAKKLMLWSGAVDAESDPAASFANARHEF  52

Query  224  GEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAME  403
            GEHGGVNMSIEASATFTVMEP++LRRMF+GELGP+NDYF+YSRHFNPTVLN+SR MAA+E
Sbjct  53   GEHGGVNMSIEASATFTVMEPDTLRRMFAGELGPENDYFVYSRHFNPTVLNLSRQMAALE  112

Query  404  GTEAAYCTASGM  439
            GTEAAYCT+SGM
Sbjct  113  GTEAAYCTSSGM  124



>ref|XP_007039394.1| Methionine gamma-lyase [Theobroma cacao]
 gb|EOY23895.1| Methionine gamma-lyase [Theobroma cacao]
Length=454

 Score =   170 bits (430),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 101/130 (78%), Gaps = 3/130 (2%)
 Frame = +2

Query  59   MAETIHQNVNVSNKRRPGSEEWERDD-MMKAKKGGKPAVQ-MWE-DPAAALASARHEFGE  229
            MAET  +    S K+R    +    D +  +KK   P +   WE DPAAALASARHEFGE
Sbjct  1    MAETQSRGFVFSGKKRAAGADDFDGDDLFMSKKSMLPTLAPAWENDPAAALASARHEFGE  60

Query  230  HGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEGT  409
            HGGVNMSIEASATFTVMEPE++RRMF+GELGPD D+FIYSRHFNPTVLN+ R MAA+EGT
Sbjct  61   HGGVNMSIEASATFTVMEPETMRRMFAGELGPDRDFFIYSRHFNPTVLNLGRQMAALEGT  120

Query  410  EAAYCTASGM  439
            EAAYCTASGM
Sbjct  121  EAAYCTASGM  130



>gb|KDO76719.1| hypothetical protein CISIN_1g013079mg [Citrus sinensis]
Length=450

 Score =   170 bits (430),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 97/114 (85%), Gaps = 0/114 (0%)
 Frame = +2

Query  92   SNKRRPGSEEWERDDMMKAKKGGKPAVQMWEDPAAALASARHEFGEHGGVNMSIEASATF  271
            S KR  G+EE + DD+ K KK        WEDPAAALASARHEFGEHGGVNMSIEASATF
Sbjct  9    SKKRSAGTEETDGDDLYKTKKSMLSTAAAWEDPAAALASARHEFGEHGGVNMSIEASATF  68

Query  272  TVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEGTEAAYCTAS  433
            TVMEPE++RRMF+GELGPD D+FIYSRHFNPTVLN+SR MAA+EGTEAAYCTAS
Sbjct  69   TVMEPETMRRMFAGELGPDRDFFIYSRHFNPTVLNLSRQMAALEGTEAAYCTAS  122



>gb|KJB37456.1| hypothetical protein B456_006G205800 [Gossypium raimondii]
Length=459

 Score =   170 bits (430),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 87/134 (65%), Positives = 103/134 (77%), Gaps = 7/134 (5%)
 Frame = +2

Query  59   MAETIHQNVNVSN-KRRPGSEEWERDD-MMKAKKGGKPAVQM----WE-DPAAALASARH  217
            MAET      +S  KR   ++ +E DD +  AKK   P + +    WE DPAA+LA  RH
Sbjct  1    MAETRSCEFGISGMKRAAAADSFEVDDEIFVAKKSMLPTLAVAPAAWENDPAASLAGLRH  60

Query  218  EFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAA  397
            EFGEHGG+NMSIEASATFTVMEPE++RRMF+GELGPD D+FIYSRHFNPTVLN+ R +AA
Sbjct  61   EFGEHGGINMSIEASATFTVMEPETMRRMFTGELGPDRDFFIYSRHFNPTVLNLGRQVAA  120

Query  398  MEGTEAAYCTASGM  439
            +EGTEAAYCTASGM
Sbjct  121  LEGTEAAYCTASGM  134



>ref|XP_004309539.1| PREDICTED: methionine gamma-lyase [Fragaria vesca subsp. vesca]
Length=455

 Score =   169 bits (429),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 92/139 (66%), Positives = 101/139 (73%), Gaps = 20/139 (14%)
 Frame = +2

Query  59   MAETIHQNVNVSNKRRPGSEEWERDDM-------MKAKKG-----GKPAVQMWEDPAAAL  202
            MAET+    N + KR       E DDM         AKK        PA   WEDPA AL
Sbjct  1    MAETLLPTNNNTKKRT------EHDDMDGQDYAASAAKKSMFLPTAAPAT--WEDPAMAL  52

Query  203  ASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVS  382
            ASARHEFGEHGGVNMSIEASATFTVMEPE+L++MFSGELG D D+FIYSRHFNPTVLN+S
Sbjct  53   ASARHEFGEHGGVNMSIEASATFTVMEPETLQKMFSGELGADRDFFIYSRHFNPTVLNLS  112

Query  383  RLMAAMEGTEAAYCTASGM  439
            R MAA+EGTEAAYCT+SGM
Sbjct  113  RQMAALEGTEAAYCTSSGM  131



>gb|AGF70153.1| methionine gamma-lyase [Cucumis melo]
Length=449

 Score =   169 bits (428),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 99/127 (78%), Gaps = 3/127 (2%)
 Frame = +2

Query  59   MAETIHQNVNVSNKRRPGSEEWERDDMMKAKKGGKPAVQMWEDPAAALASARHEFGEHGG  238
            MAE   +N N    +RP  +E + D    +KK       + EDPAAA+A+ RHEFGEHGG
Sbjct  1    MAEL--KNHNFRGTKRPSPDESD-DVKTDSKKPTAMISSLLEDPAAAIANTRHEFGEHGG  57

Query  239  VNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEGTEAA  418
            VNMSIEASATFTVMEPE++RRMF+GELGPD D+FIYSRHFNPTVLN+SR MAA+EGT AA
Sbjct  58   VNMSIEASATFTVMEPETMRRMFAGELGPDRDFFIYSRHFNPTVLNLSRQMAALEGTAAA  117

Query  419  YCTASGM  439
            YCT+SGM
Sbjct  118  YCTSSGM  124



>ref|XP_004146134.1| PREDICTED: methionine gamma-lyase-like [Cucumis sativus]
 ref|XP_004170926.1| PREDICTED: methionine gamma-lyase-like [Cucumis sativus]
 gb|KGN55670.1| hypothetical protein Csa_3G002890 [Cucumis sativus]
Length=450

 Score =   169 bits (427),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 98/127 (77%), Gaps = 2/127 (2%)
 Frame = +2

Query  59   MAETIHQNVNVSNKRRPGSEEWERDDMMKAKKGGKPAVQMWEDPAAALASARHEFGEHGG  238
            MAE   +N      +RP S+  +   +  +KK       + EDPAAA+A+ RHEFGEHGG
Sbjct  1    MAEL--KNHTFRGTKRPSSDGSDDVKLADSKKPTAMISSLLEDPAAAIANTRHEFGEHGG  58

Query  239  VNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEGTEAA  418
            VNMSIEASATFTVMEPE++RRMF+GELGPD D+FIYSRHFNPTVLN+SR MAA+EGT AA
Sbjct  59   VNMSIEASATFTVMEPETMRRMFAGELGPDRDFFIYSRHFNPTVLNLSRQMAALEGTAAA  118

Query  419  YCTASGM  439
            YCT+SGM
Sbjct  119  YCTSSGM  125



>ref|XP_006352296.1| PREDICTED: methionine gamma-lyase-like [Solanum tuberosum]
Length=433

 Score =   168 bits (426),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 98/127 (77%), Gaps = 10/127 (8%)
 Frame = +2

Query  59   MAETIHQNVNVSNKRRPGSEEWERDDMMKAKKGGKPAVQMWEDPAAALASARHEFGEHGG  238
            MA    QN  V +K+RP +          A+K  K  + + EDPAAALA+ RHEFGEHGG
Sbjct  1    MAGKSEQNAVVLDKQRPAN---------VAQKSMKHHL-ILEDPAAALANVRHEFGEHGG  50

Query  239  VNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEGTEAA  418
            VNMSIEAS TFTVMEPE+L RMF+GELGPD D+FIYSRH NPTVLN+SRLMAA+EGTEAA
Sbjct  51   VNMSIEASITFTVMEPENLSRMFAGELGPDRDFFIYSRHLNPTVLNLSRLMAALEGTEAA  110

Query  419  YCTASGM  439
            YCT+SGM
Sbjct  111  YCTSSGM  117



>gb|KFK32962.1| hypothetical protein AALP_AA6G312200 [Arabis alpina]
Length=424

 Score =   167 bits (424),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 75/85 (88%), Positives = 83/85 (98%), Gaps = 0/85 (0%)
 Frame = +2

Query  185  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNP  364
            DPAAALAS RHEFGEHGGVNMSIEASATFTVMEPE++RRMF+GELGPDND+F+YSRHFNP
Sbjct  25   DPAAALASIRHEFGEHGGVNMSIEASATFTVMEPETMRRMFTGELGPDNDFFVYSRHFNP  84

Query  365  TVLNVSRLMAAMEGTEAAYCTASGM  439
            TVLN+SR MAA+EGTEAAYCT+SGM
Sbjct  85   TVLNLSRQMAALEGTEAAYCTSSGM  109



>ref|XP_010430614.1| PREDICTED: methionine gamma-lyase isoform X3 [Camelina sativa]
Length=445

 Score =   167 bits (424),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 82/121 (68%), Positives = 99/121 (82%), Gaps = 2/121 (2%)
 Frame = +2

Query  77   QNVNVSNKRRPGSEEWERDDMMKAKKGGKPAVQMWEDPAAALASARHEFGEHGGVNMSIE  256
            Q +  S K+R   ++ +  D M AKK      ++  DPAAALAS RHEFGEHGGVNMSIE
Sbjct  12   QPLVFSGKKRNDRDDDDDGDAMVAKKSALAVCEV--DPAAALASIRHEFGEHGGVNMSIE  69

Query  257  ASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEGTEAAYCTASG  436
            ASATFTVMEP+++RRMF+GELGPDND+F+YSRHFNPTVLN+SR MAA+EGT+AAYCT+SG
Sbjct  70   ASATFTVMEPDTMRRMFAGELGPDNDFFVYSRHFNPTVLNLSRQMAALEGTQAAYCTSSG  129

Query  437  M  439
            M
Sbjct  130  M  130



>ref|XP_007151964.1| hypothetical protein PHAVU_004G090200g [Phaseolus vulgaris]
 gb|ESW23958.1| hypothetical protein PHAVU_004G090200g [Phaseolus vulgaris]
Length=437

 Score =   167 bits (424),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 82/115 (71%), Positives = 91/115 (79%), Gaps = 5/115 (4%)
 Frame = +2

Query  95   NKRRPGSEEWERDDMMKAKKGGKPAVQMWEDPAAALASARHEFGEHGGVNMSIEASATFT  274
            N++R G+ +   D   K K   +       DPAAALA  RHEFGEHGGVNMSIEASATFT
Sbjct  8    NRKRSGALDVIADGDPKRKNAARDM-----DPAAALALTRHEFGEHGGVNMSIEASATFT  62

Query  275  VMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEGTEAAYCTASGM  439
            VMEPE+LRRMF+GELGPD D+FIYSRHFNPTVL + RLMAAMEGTEAAYCTASGM
Sbjct  63   VMEPETLRRMFAGELGPDRDFFIYSRHFNPTVLKLGRLMAAMEGTEAAYCTASGM  117



>ref|XP_008791621.1| PREDICTED: methionine gamma-lyase [Phoenix dactylifera]
Length=462

 Score =   167 bits (424),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 85/137 (62%), Positives = 100/137 (73%), Gaps = 16/137 (12%)
 Frame = +2

Query  59   MAETIHQNVNVSNKRRPGSEEWERDD----------MMKAKKGGKPAVQMWEDPAAALAS  208
            MAET    V  + K+R   +  + DD          ++  K+G +       DPA ALAS
Sbjct  1    MAETTQSMVFTNPKKRGHKDAADDDDGFVDGTGDWAVVSTKRGAR------NDPAGALAS  54

Query  209  ARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRL  388
            ARHEFGEHGGVNMSIEASATFTVMEP++LRRMF+GELGPD D+FIYSRH+NPTVLN+ R 
Sbjct  55   ARHEFGEHGGVNMSIEASATFTVMEPDTLRRMFAGELGPDRDFFIYSRHYNPTVLNLGRQ  114

Query  389  MAAMEGTEAAYCTASGM  439
            MAA+EGTEAAYCTASGM
Sbjct  115  MAALEGTEAAYCTASGM  131



>ref|XP_008448562.1| PREDICTED: methionine gamma-lyase-like [Cucumis melo]
Length=449

 Score =   166 bits (421),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 81/127 (64%), Positives = 97/127 (76%), Gaps = 3/127 (2%)
 Frame = +2

Query  59   MAETIHQNVNVSNKRRPGSEEWERDDMMKAKKGGKPAVQMWEDPAAALASARHEFGEHGG  238
            MAE  + N   + +  P   +  + D   +KK       + EDPAAA+A+ RHEFGEHGG
Sbjct  1    MAELKNHNFRGTKRASPDESDDVKTD---SKKPTAMISSLLEDPAAAIANTRHEFGEHGG  57

Query  239  VNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEGTEAA  418
            VNMSIEASATFTVMEPE++RRMF+GELGPD D+FIYSRHFNPTVLN+SR MAA+EGT AA
Sbjct  58   VNMSIEASATFTVMEPETMRRMFAGELGPDRDFFIYSRHFNPTVLNLSRQMAALEGTAAA  117

Query  419  YCTASGM  439
            YCT+SGM
Sbjct  118  YCTSSGM  124



>ref|XP_010473731.1| PREDICTED: methionine gamma-lyase-like isoform X1 [Camelina sativa]
 ref|XP_010473732.1| PREDICTED: methionine gamma-lyase-like isoform X2 [Camelina sativa]
Length=446

 Score =   166 bits (420),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 81/121 (67%), Positives = 99/121 (82%), Gaps = 2/121 (2%)
 Frame = +2

Query  77   QNVNVSNKRRPGSEEWERDDMMKAKKGGKPAVQMWEDPAAALASARHEFGEHGGVNMSIE  256
            Q +  S ++R   ++ +  D M AKK      ++  DPAAALAS RHEFGEHGGVNMSIE
Sbjct  13   QPLVFSGEKRNDRDDDDDGDAMVAKKSALAVCEV--DPAAALASIRHEFGEHGGVNMSIE  70

Query  257  ASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEGTEAAYCTASG  436
            ASATFTVMEP+++RRMF+GELGPDND+F+YSRHFNPTVLN+SR MAA+EGT+AAYCT+SG
Sbjct  71   ASATFTVMEPDTMRRMFAGELGPDNDFFVYSRHFNPTVLNLSRQMAALEGTQAAYCTSSG  130

Query  437  M  439
            M
Sbjct  131  M  131



>ref|XP_010430612.1| PREDICTED: methionine gamma-lyase isoform X1 [Camelina sativa]
 ref|XP_010430613.1| PREDICTED: methionine gamma-lyase isoform X2 [Camelina sativa]
Length=446

 Score =   166 bits (420),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 81/121 (67%), Positives = 99/121 (82%), Gaps = 2/121 (2%)
 Frame = +2

Query  77   QNVNVSNKRRPGSEEWERDDMMKAKKGGKPAVQMWEDPAAALASARHEFGEHGGVNMSIE  256
            Q +  S ++R   ++ +  D M AKK      ++  DPAAALAS RHEFGEHGGVNMSIE
Sbjct  13   QPLVFSGEKRNDRDDDDDGDAMVAKKSALAVCEV--DPAAALASIRHEFGEHGGVNMSIE  70

Query  257  ASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEGTEAAYCTASG  436
            ASATFTVMEP+++RRMF+GELGPDND+F+YSRHFNPTVLN+SR MAA+EGT+AAYCT+SG
Sbjct  71   ASATFTVMEPDTMRRMFAGELGPDNDFFVYSRHFNPTVLNLSRQMAALEGTQAAYCTSSG  130

Query  437  M  439
            M
Sbjct  131  M  131



>ref|XP_006302266.1| hypothetical protein CARUB_v10020309mg [Capsella rubella]
 gb|EOA35164.1| hypothetical protein CARUB_v10020309mg [Capsella rubella]
Length=441

 Score =   166 bits (419),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 86/129 (67%), Positives = 103/129 (80%), Gaps = 4/129 (3%)
 Frame = +2

Query  53   ATMAETIHQNVNVSNKRRPGSEEWERDDMMKAKKGGKPAVQMWEDPAAALASARHEFGEH  232
            A   ET H  V  S K+R   ++ + D M+ AKK      ++  DPAAALAS RHEFGEH
Sbjct  2    AHFLETTHPLV-FSGKKRNDRDDDDGDTMV-AKKSALAVSEV--DPAAALASIRHEFGEH  57

Query  233  GGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEGTE  412
            GGVNMSIEASATFTVMEP+++RRMF+GELGPDND+F+YSRHFNPTVLN+SR MAA+EGT+
Sbjct  58   GGVNMSIEASATFTVMEPDTMRRMFAGELGPDNDFFVYSRHFNPTVLNLSRQMAALEGTQ  117

Query  413  AAYCTASGM  439
            AAYCT+SGM
Sbjct  118  AAYCTSSGM  126



>ref|XP_003542155.1| PREDICTED: methionine gamma-lyase-like [Glycine max]
Length=440

 Score =   165 bits (418),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 82/118 (69%), Positives = 94/118 (80%), Gaps = 6/118 (5%)
 Frame = +2

Query  89   VSNKRRPGSEEWERDDMMKAKKGGKPAVQMWE-DPAAALASARHEFGEHGGVNMSIEASA  265
            V N++R G+     DD++    G +  V   + DPAAALA  RHEFGEHGGVNMSIEASA
Sbjct  6    VVNRKRSGT-----DDVVSENDGKRKNVVAPDMDPAAALALTRHEFGEHGGVNMSIEASA  60

Query  266  TFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEGTEAAYCTASGM  439
            TFTVMEPE+L RMF+GELGPD D+FIYSRHFNPTVLN+ R MAA+EGTEAAYCTASGM
Sbjct  61   TFTVMEPETLCRMFTGELGPDRDFFIYSRHFNPTVLNLGRHMAALEGTEAAYCTASGM  118



>ref|XP_002891507.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67766.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=441

 Score =   164 bits (416),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 73/85 (86%), Positives = 83/85 (98%), Gaps = 0/85 (0%)
 Frame = +2

Query  185  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNP  364
            DPAAAL+S RHEFGEHGGVNMSIEASATFTVMEP+++RRMFSGELGPDND+F+YSRHFNP
Sbjct  42   DPAAALSSIRHEFGEHGGVNMSIEASATFTVMEPDTMRRMFSGELGPDNDFFVYSRHFNP  101

Query  365  TVLNVSRLMAAMEGTEAAYCTASGM  439
            TVLN+SR MAA+EGT+AAYCT+SGM
Sbjct  102  TVLNLSRQMAALEGTQAAYCTSSGM  126



>gb|KEH42908.1| cystathionine beta-lyase/cystathionine gamma-synthase [Medicago 
truncatula]
Length=450

 Score =   164 bits (416),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/105 (74%), Positives = 89/105 (85%), Gaps = 2/105 (2%)
 Frame = +2

Query  131  DDMMKAKKGGKPAVQMWE--DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRM  304
            DD  + KK    A Q     +PA +LA+ARHEFGEHGGVNMSIEAS TFTVMEPE+LRRM
Sbjct  22   DDETETKKKLATATQNGTVFNPATSLANARHEFGEHGGVNMSIEASVTFTVMEPETLRRM  81

Query  305  FSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEGTEAAYCTASGM  439
            F+GELGPD D+F+YSRHFNPTVLN+SRLMAA+EGTEAAYCT+SGM
Sbjct  82   FAGELGPDRDFFVYSRHFNPTVLNLSRLMAALEGTEAAYCTSSGM  126



>gb|ADN33936.1| cystathionine gamma-synthase [Cucumis melo subsp. melo]
Length=417

 Score =   164 bits (414),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 73/88 (83%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = +2

Query  176  MWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRH  355
            + EDPAAA+A+ RHEFGEHGGVNMSIEASATFTVMEPE++RRMF+GELGPD D+FIYSRH
Sbjct  5    LLEDPAAAIANTRHEFGEHGGVNMSIEASATFTVMEPETMRRMFAGELGPDRDFFIYSRH  64

Query  356  FNPTVLNVSRLMAAMEGTEAAYCTASGM  439
            FNPTVLN+SR MAA+EGT AAYCT+SGM
Sbjct  65   FNPTVLNLSRQMAALEGTAAAYCTSSGM  92



>ref|XP_009112857.1| PREDICTED: methionine gamma-lyase [Brassica rapa]
Length=441

 Score =   164 bits (415),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 78/121 (64%), Positives = 97/121 (80%), Gaps = 2/121 (2%)
 Frame = +2

Query  77   QNVNVSNKRRPGSEEWERDDMMKAKKGGKPAVQMWEDPAAALASARHEFGEHGGVNMSIE  256
            Q++  ++ ++    + E  D   AKK    A +   DPA ALAS RHEFGEHGGVNMSIE
Sbjct  8    QHLLTTSGKKRNDRDDEDGDSTVAKKSSLMACE--ADPAVALASIRHEFGEHGGVNMSIE  65

Query  257  ASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEGTEAAYCTASG  436
            ASATFTVMEP+++RRMF+GELGP+ND+F+YSRHFNPTVLN+SR MAA+EGT+AAYCT+SG
Sbjct  66   ASATFTVMEPDTMRRMFAGELGPENDFFVYSRHFNPTVLNLSRQMAALEGTQAAYCTSSG  125

Query  437  M  439
            M
Sbjct  126  M  126



>ref|XP_003601451.1| Cystathionine gamma-lyase [Medicago truncatula]
 gb|AES71702.1| cystathionine beta-lyase/cystathionine gamma-synthase [Medicago 
truncatula]
Length=443

 Score =   164 bits (414),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 87/130 (67%), Positives = 103/130 (79%), Gaps = 8/130 (6%)
 Frame = +2

Query  59   MAETIHQNVNV-SNKRRPGSEEWERDDMMKAKK--GGKPAVQMWEDPAAALASARHEFGE  229
            MA+T+  NVNV +NKR   +   E  D  K  K  GG+  V    DP AALA+ARHEFGE
Sbjct  1    MADTLF-NVNVLNNKRSLENPVVEVKDTKKLTKFNGGESDV----DPEAALANARHEFGE  55

Query  230  HGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEGT  409
            HGGVNMSIEASATFTVMEP++LR++F+GELG + DY++YSRHFNPTVLN+SR MAA+EGT
Sbjct  56   HGGVNMSIEASATFTVMEPDTLRKIFAGELGHEGDYYVYSRHFNPTVLNLSRKMAALEGT  115

Query  410  EAAYCTASGM  439
            EAAYCTASGM
Sbjct  116  EAAYCTASGM  125



>ref|NP_176647.1| methionine gamma-lyase [Arabidopsis thaliana]
 sp|Q9SGU9.1|MGL_ARATH RecName: Full=Methionine gamma-lyase; Short=AtMGL; AltName: Full=L-methioninase 
[Arabidopsis thaliana]
 gb|AAF19680.1|AC009519_14 F1N19.23 [Arabidopsis thaliana]
 gb|AAL16181.1|AF428413_1 At1g64660/F1N19_22 [Arabidopsis thaliana]
 gb|AAK96737.1| similar to O-succinylhomoserine sulfhydrylase [Arabidopsis thaliana]
 gb|AAP31932.1| At1g64660 [Arabidopsis thaliana]
 dbj|BAE98522.1| similar to O-succinylhomoserine sulfhydrylase [Arabidopsis thaliana]
 gb|AEE34271.1| methionine gamma-lyase [Arabidopsis thaliana]
Length=441

 Score =   163 bits (413),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 78/116 (67%), Positives = 95/116 (82%), Gaps = 3/116 (3%)
 Frame = +2

Query  92   SNKRRPGSEEWERDDMMKAKKGGKPAVQMWEDPAAALASARHEFGEHGGVNMSIEASATF  271
            S K+R   ++ E  D + AKK          DPAAA+A+ RHEFGEHGGVNMSIEASATF
Sbjct  14   SGKKRNDRDD-EDGDALVAKKSALAVCD--ADPAAAIANIRHEFGEHGGVNMSIEASATF  70

Query  272  TVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEGTEAAYCTASGM  439
            TVMEP+++RRMF+GELGPDND+++YSRHFNPTVLN+SR MAA+EGT+AAYCT+SGM
Sbjct  71   TVMEPDTMRRMFTGELGPDNDFYVYSRHFNPTVLNLSRQMAALEGTQAAYCTSSGM  126



>ref|XP_004244654.1| PREDICTED: methionine gamma-lyase-like [Solanum lycopersicum]
Length=409

 Score =   162 bits (410),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 73/87 (84%), Positives = 81/87 (93%), Gaps = 0/87 (0%)
 Frame = +2

Query  179  WEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHF  358
             EDPAAALA+ RHEF EHGGVNMSIEAS TFTVMEPE+L RMF+GELGPDND+FIYSRH 
Sbjct  7    LEDPAAALANVRHEFSEHGGVNMSIEASITFTVMEPENLSRMFAGELGPDNDFFIYSRHL  66

Query  359  NPTVLNVSRLMAAMEGTEAAYCTASGM  439
            NPTVLN+SRL+AA+EGTEAAYCT+SGM
Sbjct  67   NPTVLNLSRLIAALEGTEAAYCTSSGM  93



>emb|CDY53903.1| BnaA09g53100D [Brassica napus]
Length=441

 Score =   162 bits (411),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 77/112 (69%), Positives = 91/112 (81%), Gaps = 2/112 (2%)
 Frame = +2

Query  110  GSEEWERDDMMKAKKGGKPAVQMW--EDPAAALASARHEFGEHGGVNMSIEASATFTVME  283
            G +  +RDD        K +  M    DPA ALAS RHEFGEHGGVNMSIEASATFTVME
Sbjct  15   GKKRNDRDDEDGVSTVAKKSSLMACEADPAVALASIRHEFGEHGGVNMSIEASATFTVME  74

Query  284  PESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEGTEAAYCTASGM  439
            P+++RRMF+GELGP+ND+F+YSRHFNPTVLN+SR MAA+EGT+AAYCT+SGM
Sbjct  75   PDTMRRMFAGELGPENDFFVYSRHFNPTVLNLSRQMAALEGTQAAYCTSSGM  126



>ref|XP_009382322.1| PREDICTED: methionine gamma-lyase-like [Musa acuminata subsp. 
malaccensis]
Length=477

 Score =   163 bits (412),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 86/137 (63%), Positives = 102/137 (74%), Gaps = 20/137 (15%)
 Frame = +2

Query  59   MAETIHQNVNVSNKRRPGSEEWERDD----------MMKAKKGGKPAVQMWEDPAAALAS  208
            MAET+  +++ S KR P  EE  R D            ++++GG        DP AALAS
Sbjct  1    MAETM--DISYSKKRGPKEEEDGRVDEGWAGPLASKRDRSERGG--------DPTAALAS  50

Query  209  ARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRL  388
            ARHEFGEHGGVNMSIEASATFTVME ++++RMF GELGPD D++IYSRHFNPTVLN+SR 
Sbjct  51   ARHEFGEHGGVNMSIEASATFTVMEADTMQRMFKGELGPDRDHYIYSRHFNPTVLNLSRQ  110

Query  389  MAAMEGTEAAYCTASGM  439
            MAA+EGTEAAYCTASGM
Sbjct  111  MAALEGTEAAYCTASGM  127



>ref|XP_009358710.1| PREDICTED: methionine gamma-lyase-like [Pyrus x bretschneideri]
Length=457

 Score =   160 bits (404),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 105/133 (79%), Gaps = 6/133 (5%)
 Frame = +2

Query  59   MAETIHQNV---NVSNKRRPGSEEWERDDMMKAKKG---GKPAVQMWEDPAAALASARHE  220
            MA+T  Q +     ++K+R   ++ + DD + AKK       A   WEDPAAALASARHE
Sbjct  1    MADTKSQGLVFPTTNSKKRAEHDDMDNDDYVAAKKSMLLSSAAAAAWEDPAAALASARHE  60

Query  221  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  400
            FGEHGGVNMSIEASATFTVMEPE+LR+MFSGELG D D+FIYSRHFNPTVLN+SR MAA+
Sbjct  61   FGEHGGVNMSIEASATFTVMEPETLRKMFSGELGADRDFFIYSRHFNPTVLNLSRQMAAL  120

Query  401  EGTEAAYCTASGM  439
            EGTEAAYCT+SGM
Sbjct  121  EGTEAAYCTSSGM  133



>ref|XP_010919347.1| PREDICTED: methionine gamma-lyase [Elaeis guineensis]
Length=464

 Score =   160 bits (405),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 84/131 (64%), Positives = 93/131 (71%), Gaps = 4/131 (3%)
 Frame = +2

Query  59   MAETIHQNVNVSNKRRPGSEEWERDDMMKAKKGGKPAVQMWE----DPAAALASARHEFG  226
            MAET    V  + K+R   +    DD      G   AV        DPA ALAS RHEFG
Sbjct  1    MAETEQSMVFTNPKKRGPKDATADDDGFVTGTGDWAAVSTKRVARNDPAGALASVRHEFG  60

Query  227  EHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEG  406
            EHGGVNMSIEASATFTVME ++LRRMF+GELGPD D+FIYSRH NPTVLN+ R MAA+EG
Sbjct  61   EHGGVNMSIEASATFTVMEADTLRRMFAGELGPDRDFFIYSRHCNPTVLNLGRQMAALEG  120

Query  407  TEAAYCTASGM  439
            TEAAYCTASGM
Sbjct  121  TEAAYCTASGM  131



>ref|XP_006849146.1| hypothetical protein AMTR_s00027p00096610 [Amborella trichopoda]
 gb|ERN10727.1| hypothetical protein AMTR_s00027p00096610 [Amborella trichopoda]
Length=457

 Score =   159 bits (403),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 82/129 (64%), Positives = 95/129 (74%), Gaps = 2/129 (2%)
 Frame = +2

Query  53   ATMAETIHQNVNVSNKRRPGSEEWERDDMMKAKKGGKPAVQMWEDPAAALASARHEFGEH  232
            ATM  T   ++++  KR+  SE  +  D    K       +   DPA ALASARHEFGEH
Sbjct  3    ATM--TPENSLSLPEKRQRYSEGDDNHDGGTKKMAQSVVKKPRRDPAEALASARHEFGEH  60

Query  233  GGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEGTE  412
            GGVNMSIEASATFTVMEPE++ RMF GELGPD D+FIYSRHFNPTVLN+ R MAA+E TE
Sbjct  61   GGVNMSIEASATFTVMEPETMSRMFKGELGPDRDFFIYSRHFNPTVLNLGRAMAALEATE  120

Query  413  AAYCTASGM  439
            AAYCTASG+
Sbjct  121  AAYCTASGL  129



>ref|XP_008390270.1| PREDICTED: methionine gamma-lyase-like [Malus domestica]
Length=457

 Score =   159 bits (403),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 89/133 (67%), Positives = 106/133 (80%), Gaps = 6/133 (5%)
 Frame = +2

Query  59   MAETIHQNV---NVSNKRRPGSEEWERDDMMKAKKG---GKPAVQMWEDPAAALASARHE  220
            MA+T  Q +    +++K+R   ++ + +D + AKK       A   WEDPAAALASARHE
Sbjct  1    MADTKSQGLVFPTINSKKRAEHDDIDNEDYVAAKKSMLLSSAAAAAWEDPAAALASARHE  60

Query  221  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  400
            FGEHGGVNMSIEASATFTVMEPE+LR+MFSGELG D D+FIYSRHFNPTVLN+SR MAA+
Sbjct  61   FGEHGGVNMSIEASATFTVMEPETLRKMFSGELGADRDFFIYSRHFNPTVLNLSRQMAAL  120

Query  401  EGTEAAYCTASGM  439
            EGTEAAYCT+SGM
Sbjct  121  EGTEAAYCTSSGM  133



>ref|XP_009411481.1| PREDICTED: methionine gamma-lyase-like [Musa acuminata subsp. 
malaccensis]
Length=460

 Score =   159 bits (401),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 73/85 (86%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = +2

Query  185  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNP  364
            DPA ALA+ARHEFGEHGGVNMSIEASATFTVME E++RRMFSGELGPD D++IYSRHFNP
Sbjct  46   DPAVALANARHEFGEHGGVNMSIEASATFTVMEAETMRRMFSGELGPDRDFYIYSRHFNP  105

Query  365  TVLNVSRLMAAMEGTEAAYCTASGM  439
            TVLN+ R MAA+EGTEAAYCTASGM
Sbjct  106  TVLNLGRQMAAVEGTEAAYCTASGM  130



>ref|XP_003520012.1| PREDICTED: methionine gamma-lyase-like [Glycine max]
Length=440

 Score =   158 bits (400),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 91/117 (78%), Gaps = 4/117 (3%)
 Frame = +2

Query  89   VSNKRRPGSEEWERDDMMKAKKGGKPAVQMWEDPAAALASARHEFGEHGGVNMSIEASAT  268
            V+N++R   ++   ++  K K      V    DPA ALA  RHEFGEHGGVNMSIEASAT
Sbjct  6    VTNRKRSSGDDAVSENDRKRKN----MVARNMDPAEALALTRHEFGEHGGVNMSIEASAT  61

Query  269  FTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEGTEAAYCTASGM  439
            FTVMEPE+L RMF+GELGPD D+FIYSRHFNPTV+N+ R MAA+EGTEAAYCTASGM
Sbjct  62   FTVMEPETLGRMFAGELGPDRDFFIYSRHFNPTVVNLGRHMAALEGTEAAYCTASGM  118



>gb|ABK27101.1| unknown [Picea sitchensis]
Length=438

 Score =   157 bits (398),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 69/91 (76%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = +2

Query  167  AVQMWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIY  346
             ++ W DP   LA+ARHEFGEHGGVNMSIEASATFTVMEPE++++MFSGELGP+ D++IY
Sbjct  25   VMKKWVDPVQGLANARHEFGEHGGVNMSIEASATFTVMEPETMKKMFSGELGPERDFYIY  84

Query  347  SRHFNPTVLNVSRLMAAMEGTEAAYCTASGM  439
            SRHFNPTVLN+ R MAA+EGTEAAYCT+SGM
Sbjct  85   SRHFNPTVLNLGRQMAALEGTEAAYCTSSGM  115



>ref|XP_008239227.1| PREDICTED: methionine gamma-lyase [Prunus mume]
Length=459

 Score =   158 bits (399),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 85/121 (70%), Positives = 99/121 (82%), Gaps = 3/121 (2%)
 Frame = +2

Query  86   NVSNKRRPGSEEWERDDMMKAKKG---GKPAVQMWEDPAAALASARHEFGEHGGVNMSIE  256
            N ++K+R   ++ + DD + AKK       A   W+DPAAA ASARHEFGEHGGVNMSIE
Sbjct  15   NATSKKRAERDDMDNDDYVAAKKSMLLSSAAAAAWDDPAAAFASARHEFGEHGGVNMSIE  74

Query  257  ASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEGTEAAYCTASG  436
            ASATFTVMEPE+LR+MFSGELG D D+FIYSRHFNPTVLN+SR MAA+EGTEAAYCT+SG
Sbjct  75   ASATFTVMEPETLRKMFSGELGADRDFFIYSRHFNPTVLNLSRQMAALEGTEAAYCTSSG  134

Query  437  M  439
            M
Sbjct  135  M  135



>ref|XP_007209123.1| hypothetical protein PRUPE_ppa005470mg [Prunus persica]
 gb|EMJ10322.1| hypothetical protein PRUPE_ppa005470mg [Prunus persica]
Length=459

 Score =   157 bits (398),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 86/119 (72%), Positives = 97/119 (82%), Gaps = 3/119 (3%)
 Frame = +2

Query  92   SNKRRPGSEEWERDDMMKAKKG---GKPAVQMWEDPAAALASARHEFGEHGGVNMSIEAS  262
            S+K+R   ++ + DD   AKK       A   WEDPAAA ASARHEFGEHGGVNMSIEAS
Sbjct  17   SSKKRAEHDDMDNDDYAVAKKSMLLSSAAAAAWEDPAAAFASARHEFGEHGGVNMSIEAS  76

Query  263  ATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEGTEAAYCTASGM  439
            ATFTVMEPE+LR+MFSGELG D D+FIYSRHFNPTVLN+SR MAA+EGTEAAYCT+SGM
Sbjct  77   ATFTVMEPETLRKMFSGELGADRDFFIYSRHFNPTVLNLSRQMAALEGTEAAYCTSSGM  135



>ref|XP_009359544.1| PREDICTED: methionine gamma-lyase-like [Pyrus x bretschneideri]
Length=457

 Score =   157 bits (396),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 100/120 (83%), Gaps = 3/120 (3%)
 Frame = +2

Query  89   VSNKRRPGSEEWERDDMMKAKKG---GKPAVQMWEDPAAALASARHEFGEHGGVNMSIEA  259
            +++K+R   ++ + +D + AKK       A   WEDPAAALASARHEFGEHGGVNM+IEA
Sbjct  14   INSKKRAEHDDIDNEDYVAAKKSMLLSSAAAAAWEDPAAALASARHEFGEHGGVNMAIEA  73

Query  260  SATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEGTEAAYCTASGM  439
            SATFTVMEPE+LR+MFSGELG D D+FIYSRHFNPTVLN+SR MAA+EGTEAAYCT+SGM
Sbjct  74   SATFTVMEPETLRKMFSGELGADRDFFIYSRHFNPTVLNLSRQMAALEGTEAAYCTSSGM  133



>ref|XP_010100197.1| Methionine gamma-lyase [Morus notabilis]
 gb|EXB81868.1| Methionine gamma-lyase [Morus notabilis]
Length=450

 Score =   154 bits (388),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 75/85 (88%), Positives = 82/85 (96%), Gaps = 0/85 (0%)
 Frame = +2

Query  185  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNP  364
            DPAAALA+ARHEFGEHGGVNMSIEASATFTVMEPE++RRMFSGELGPD D+FIYSRHFNP
Sbjct  42   DPAAALAAARHEFGEHGGVNMSIEASATFTVMEPETMRRMFSGELGPDRDFFIYSRHFNP  101

Query  365  TVLNVSRLMAAMEGTEAAYCTASGM  439
            TVL++ R MAA+EGTEAAYCTASGM
Sbjct  102  TVLSLGRQMAALEGTEAAYCTASGM  126



>ref|XP_007161585.1| hypothetical protein PHAVU_001G082000g [Phaseolus vulgaris]
 gb|ESW33579.1| hypothetical protein PHAVU_001G082000g [Phaseolus vulgaris]
Length=439

 Score =   152 bits (385),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 81/109 (74%), Positives = 92/109 (84%), Gaps = 0/109 (0%)
 Frame = +2

Query  113  SEEWERDDMMKAKKGGKPAVQMWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPES  292
            +++  R D   A    K  +    DPAAALASARHEFGEHGGVNMSIEASATFTVMEPE+
Sbjct  9    TQKRNRSDDADAGDSKKLMLHAEADPAAALASARHEFGEHGGVNMSIEASATFTVMEPET  68

Query  293  LRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEGTEAAYCTASGM  439
            ++RMF+GELGPD D+FIYSRHFNPTVLN+SRLMAA+EGTEAAYCTASGM
Sbjct  69   MQRMFNGELGPDRDFFIYSRHFNPTVLNLSRLMAALEGTEAAYCTASGM  117



>ref|XP_003536171.1| PREDICTED: methionine gamma-lyase [Glycine max]
Length=442

 Score =   152 bits (385),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 68/76 (89%), Positives = 75/76 (99%), Gaps = 0/76 (0%)
 Frame = +2

Query  212  RHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLM  391
            RHEFGEHGGVNMSIEASATFTVMEPE++RRMF+GELGPD D+FIYSRHFNPTVL++SRLM
Sbjct  43   RHEFGEHGGVNMSIEASATFTVMEPETMRRMFAGELGPDRDFFIYSRHFNPTVLSLSRLM  102

Query  392  AAMEGTEAAYCTASGM  439
            AA+EGTEAAYCTASGM
Sbjct  103  AALEGTEAAYCTASGM  118



>ref|XP_008366029.1| PREDICTED: LOW QUALITY PROTEIN: methionine gamma-lyase-like [Malus 
domestica]
Length=379

 Score =   147 bits (372),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 68/87 (78%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = +2

Query  179  WEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHF  358
            WEDPA ALA+ARHEFGEHGGVNMSIEASATFTVMEPE+LR+MF  ELG D D+FIY  HF
Sbjct  26   WEDPATALANARHEFGEHGGVNMSIEASATFTVMEPETLRKMFFDELGADRDFFIYRCHF  85

Query  359  NPTVLNVSRLMAAMEGTEAAYCTASGM  439
            N TVLN+S  MA +EG EAAYCT+SGM
Sbjct  86   NLTVLNLSPQMAVLEGIEAAYCTSSGM  112



>ref|XP_008437446.1| PREDICTED: methionine gamma-lyase-like [Cucumis melo]
Length=444

 Score =   147 bits (370),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 68/85 (80%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = +2

Query  185  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNP  364
            DPAAALA AR EFGEHGGVNMSIE S TFTVME E++RRMF GELGP+ D+FIYSRHFNP
Sbjct  41   DPAAALAMARPEFGEHGGVNMSIENSITFTVMEAETMRRMFEGELGPERDFFIYSRHFNP  100

Query  365  TVLNVSRLMAAMEGTEAAYCTASGM  439
            TV+ +SR MAA+EGTEAAYCT+SGM
Sbjct  101  TVMALSRQMAALEGTEAAYCTSSGM  125



>ref|XP_001751901.1| predicted protein [Physcomitrella patens]
 gb|EDQ83336.1| predicted protein [Physcomitrella patens]
Length=411

 Score =   145 bits (367),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 64/85 (75%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = +2

Query  185  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNP  364
            DP   LA+ R EFGEHGGVNMSIEAS TFTVMEPE++ ++F G+LGPD D++IYSRH+NP
Sbjct  2    DPVQGLANMRREFGEHGGVNMSIEASTTFTVMEPETMSKLFEGKLGPDRDFYIYSRHYNP  61

Query  365  TVLNVSRLMAAMEGTEAAYCTASGM  439
            TVLN+SR MAAMEGT+AAYCTASGM
Sbjct  62   TVLNLSRQMAAMEGTQAAYCTASGM  86



>ref|XP_002964805.1| hypothetical protein SELMODRAFT_82714 [Selaginella moellendorffii]
 gb|EFJ33643.1| hypothetical protein SELMODRAFT_82714 [Selaginella moellendorffii]
Length=441

 Score =   146 bits (368),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 86/120 (72%), Gaps = 1/120 (1%)
 Frame = +2

Query  83   VNVSNKRR-PGSEEWERDDMMKAKKGGKPAVQMWEDPAAALASARHEFGEHGGVNMSIEA  259
            ++ S KR   GS      D   AK+    +     DP   L S RHEFGEHGGVNMSIEA
Sbjct  1    MDASTKRGGSGSASGFFQDRYSAKRPRASSPPPPLDPEEGLVSIRHEFGEHGGVNMSIEA  60

Query  260  SATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEGTEAAYCTASGM  439
            S+TFTVME E++ +MF GELGPD D++IYSRHFNPTVLN+ R +AAMEGT+AAYCTASGM
Sbjct  61   SSTFTVMEAETMGKMFKGELGPDRDFYIYSRHFNPTVLNLGRQIAAMEGTQAAYCTASGM  120



>ref|XP_002961730.1| hypothetical protein SELMODRAFT_76894 [Selaginella moellendorffii]
 gb|EFJ36990.1| hypothetical protein SELMODRAFT_76894 [Selaginella moellendorffii]
Length=441

 Score =   145 bits (367),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 73/117 (62%), Positives = 84/117 (72%), Gaps = 1/117 (1%)
 Frame = +2

Query  92   SNKRR-PGSEEWERDDMMKAKKGGKPAVQMWEDPAAALASARHEFGEHGGVNMSIEASAT  268
            S KR   GS      D   AK+    +     DP   L S RHEFGEHGGVNMSIEAS+T
Sbjct  4    STKRGGSGSASGFFQDRYSAKRPRASSPPPPLDPEEGLVSIRHEFGEHGGVNMSIEASST  63

Query  269  FTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEGTEAAYCTASGM  439
            FTVME E++ +MF GELGPD D++IYSRHFNPTVLN+ R +AAMEGT+AAYCTASGM
Sbjct  64   FTVMEAETMAKMFKGELGPDRDFYIYSRHFNPTVLNLGRQIAAMEGTQAAYCTASGM  120



>ref|XP_004143943.1| PREDICTED: methionine gamma-lyase-like [Cucumis sativus]
 ref|XP_004163580.1| PREDICTED: methionine gamma-lyase-like [Cucumis sativus]
 gb|KGN49981.1| hypothetical protein Csa_5G148520 [Cucumis sativus]
Length=442

 Score =   144 bits (363),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 67/85 (79%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = +2

Query  185  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNP  364
            DPAAALA A  EFGEHGGVNMSIE S TFTVME E++RRMF GELGP+ D+FIYSRHFNP
Sbjct  41   DPAAALAMASPEFGEHGGVNMSIENSITFTVMEAETMRRMFEGELGPERDFFIYSRHFNP  100

Query  365  TVLNVSRLMAAMEGTEAAYCTASGM  439
            TV+ +SR MAA+EGTEAAYCT+SGM
Sbjct  101  TVMALSRQMAALEGTEAAYCTSSGM  125



>ref|XP_003574196.1| PREDICTED: methionine gamma-lyase [Brachypodium distachyon]
Length=458

 Score =   140 bits (352),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 70/86 (81%), Positives = 80/86 (93%), Gaps = 1/86 (1%)
 Frame = +2

Query  185  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPD-NDYFIYSRHFN  361
            DPAAALA+ARHEFGEHGGVNMSIEASATFTVMEP+++R++F+GELGPD  D +IYSRHFN
Sbjct  42   DPAAALAAARHEFGEHGGVNMSIEASATFTVMEPDTMRKLFAGELGPDRGDLYIYSRHFN  101

Query  362  PTVLNVSRLMAAMEGTEAAYCTASGM  439
            PTVL + R MAA+EGTEAAYCTASGM
Sbjct  102  PTVLALGRQMAALEGTEAAYCTASGM  127



>dbj|BAK03127.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=461

 Score =   139 bits (351),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 70/86 (81%), Positives = 80/86 (93%), Gaps = 1/86 (1%)
 Frame = +2

Query  185  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPD-NDYFIYSRHFN  361
            DPAAALA+ARHEFGEHGGVNMSIEASATFTVMEP+++RR+F+GELGP+  D +IYSRHFN
Sbjct  44   DPAAALAAARHEFGEHGGVNMSIEASATFTVMEPDTMRRLFTGELGPERGDLYIYSRHFN  103

Query  362  PTVLNVSRLMAAMEGTEAAYCTASGM  439
            PTVL + R MAA+EGTEAAYCTASGM
Sbjct  104  PTVLALGRQMAALEGTEAAYCTASGM  129



>gb|AFW68376.1| hypothetical protein ZEAMMB73_868492 [Zea mays]
Length=476

 Score =   138 bits (348),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 71/87 (82%), Positives = 79/87 (91%), Gaps = 1/87 (1%)
 Frame = +2

Query  182  EDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPD-NDYFIYSRHF  358
            EDPAAALA+ARHEFGEHGGVNMSIEASATFTVMEPE++RR+F+GELGPD    +IYSRHF
Sbjct  46   EDPAAALAAARHEFGEHGGVNMSIEASATFTVMEPETMRRLFAGELGPDRGGMYIYSRHF  105

Query  359  NPTVLNVSRLMAAMEGTEAAYCTASGM  439
            NPTV  + R MAA+EGTEAAYCTASGM
Sbjct  106  NPTVQALGRQMAALEGTEAAYCTASGM  132



>ref|NP_001152224.1| O-succinylhomoserine sulfhydrylase [Zea mays]
 gb|ACG46481.1| O-succinylhomoserine sulfhydrylase [Zea mays]
Length=473

 Score =   138 bits (348),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 94/130 (72%), Gaps = 3/130 (2%)
 Frame = +2

Query  59   MAETIHQNVNVSNKRRP-GSEEWERDDMMKAKKGGKPAVQMWEDPAAALASA-RHEFGEH  232
            MA+T+     ++  +RP G++ +       +  G KP  +  E   AA  +A RHEFGEH
Sbjct  1    MAQTLSAASELATLKRPFGNDGFGDGSNNGSATGEKPKARRREADPAAAMAAARHEFGEH  60

Query  233  GGVNMSIEASATFTVMEPESLRRMFSGELGPD-NDYFIYSRHFNPTVLNVSRLMAAMEGT  409
            GGVNMSIEASATFTVMEP+++RR+F+GELGPD  D +IYSRHFNPTVL + R MAA+EGT
Sbjct  61   GGVNMSIEASATFTVMEPDTMRRLFAGELGPDRGDMYIYSRHFNPTVLALGRQMAALEGT  120

Query  410  EAAYCTASGM  439
            EA YCTASGM
Sbjct  121  EAGYCTASGM  130



>tpg|DAA49293.1| TPA: O-succinylhomoserine sulfhydrylase [Zea mays]
Length=473

 Score =   138 bits (348),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 94/130 (72%), Gaps = 3/130 (2%)
 Frame = +2

Query  59   MAETIHQNVNVSNKRRP-GSEEWERDDMMKAKKGGKPAVQMWEDPAAALASA-RHEFGEH  232
            MA+T+     ++  +RP G++ +       +  G KP  +  E   AA  +A RHEFGEH
Sbjct  1    MAQTLSAASELATLKRPFGNDGFGDGSNNGSATGEKPKARRREADPAAALAAARHEFGEH  60

Query  233  GGVNMSIEASATFTVMEPESLRRMFSGELGPD-NDYFIYSRHFNPTVLNVSRLMAAMEGT  409
            GGVNMSIEASATFTVMEP+++RR+F+GELGPD  D +IYSRHFNPTVL + R MAA+EGT
Sbjct  61   GGVNMSIEASATFTVMEPDTMRRLFAGELGPDRGDMYIYSRHFNPTVLALGRQMAALEGT  120

Query  410  EAAYCTASGM  439
            EA YCTASGM
Sbjct  121  EAGYCTASGM  130



>ref|XP_008646566.1| PREDICTED: methionine gamma-lyase-like [Zea mays]
Length=471

 Score =   138 bits (348),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 71/87 (82%), Positives = 79/87 (91%), Gaps = 1/87 (1%)
 Frame = +2

Query  182  EDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPD-NDYFIYSRHF  358
            EDPAAALA+ARHEFGEHGGVNMSIEASATFTVMEPE++RR+F+GELGPD    +IYSRHF
Sbjct  41   EDPAAALAAARHEFGEHGGVNMSIEASATFTVMEPETMRRLFAGELGPDRGGMYIYSRHF  100

Query  359  NPTVLNVSRLMAAMEGTEAAYCTASGM  439
            NPTV  + R MAA+EGTEAAYCTASGM
Sbjct  101  NPTVQALGRQMAALEGTEAAYCTASGM  127



>ref|XP_002464368.1| hypothetical protein SORBIDRAFT_01g017060 [Sorghum bicolor]
 gb|EER91366.1| hypothetical protein SORBIDRAFT_01g017060 [Sorghum bicolor]
Length=477

 Score =   137 bits (346),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/77 (82%), Positives = 71/77 (92%), Gaps = 1/77 (1%)
 Frame = +2

Query  212  RHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPD-NDYFIYSRHFNPTVLNVSRL  388
            RHEFGEHGGVNMSIEASATFTVMEP+++RR+F+GELGPD  D +IYSRHFNPTVL + R 
Sbjct  56   RHEFGEHGGVNMSIEASATFTVMEPDTMRRLFAGELGPDRGDMYIYSRHFNPTVLALGRQ  115

Query  389  MAAMEGTEAAYCTASGM  439
            MAA+EGTEAAYCTASGM
Sbjct  116  MAALEGTEAAYCTASGM  132



>ref|NP_001065069.1| Os10g0517500 [Oryza sativa Japonica Group]
 gb|AAK39571.1|AC025296_6 putative gamma-lyase [Oryza sativa Japonica Group]
 gb|AAP54634.1| Cys/Met metabolism PLP-dependent enzyme family protein, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF26983.1| Os10g0517500 [Oryza sativa Japonica Group]
 dbj|BAG94621.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE51269.1| hypothetical protein OsJ_32167 [Oryza sativa Japonica Group]
Length=464

 Score =   137 bits (344),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 72/115 (63%), Positives = 85/115 (74%), Gaps = 2/115 (2%)
 Frame = +2

Query  101  RRPGSEEWERDDMMKAKKGGKPAVQMWEDPAAALASA-RHEFGEHGGVNMSIEASATFTV  277
            +RP   + +          GKP  +  E   AA  +A RHEFGEHGGVNMSIEASATFTV
Sbjct  16   KRPFQNDDDNSSNGNGNADGKPKARRREADPAAALAAARHEFGEHGGVNMSIEASATFTV  75

Query  278  MEPESLRRMFSGELGPD-NDYFIYSRHFNPTVLNVSRLMAAMEGTEAAYCTASGM  439
            MEP+++RR+FSGELGP+  D +IYSRHFNPTVL + R MAA+EGTEAAYCTASGM
Sbjct  76   MEPDTMRRLFSGELGPERGDLYIYSRHFNPTVLALGRQMAALEGTEAAYCTASGM  130



>gb|EAY79213.1| hypothetical protein OsI_34329 [Oryza sativa Indica Group]
Length=469

 Score =   135 bits (340),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/77 (81%), Positives = 71/77 (92%), Gaps = 1/77 (1%)
 Frame = +2

Query  212  RHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPD-NDYFIYSRHFNPTVLNVSRL  388
            RHEFGEHGGVNMSIEASATFTVMEP+++RR+F+GELGP+  D +IYSRHFNPTVL + R 
Sbjct  54   RHEFGEHGGVNMSIEASATFTVMEPDTMRRLFAGELGPERGDLYIYSRHFNPTVLALGRQ  113

Query  389  MAAMEGTEAAYCTASGM  439
            MAA+EGTEAAYCTASGM
Sbjct  114  MAALEGTEAAYCTASGM  130



>ref|XP_004982603.1| PREDICTED: methionine gamma-lyase-like [Setaria italica]
Length=480

 Score =   135 bits (340),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/77 (81%), Positives = 70/77 (91%), Gaps = 1/77 (1%)
 Frame = +2

Query  212  RHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPD-NDYFIYSRHFNPTVLNVSRL  388
            RHEFGEHGGVNMSIEASATFTVMEP+++RR+F+GELGPD  D +IYSRHFNPTVL + R 
Sbjct  59   RHEFGEHGGVNMSIEASATFTVMEPDTMRRLFAGELGPDRGDMYIYSRHFNPTVLALGRQ  118

Query  389  MAAMEGTEAAYCTASGM  439
            MAA+E TEAAYCTASGM
Sbjct  119  MAALEATEAAYCTASGM  135



>ref|XP_001759514.1| predicted protein [Physcomitrella patens]
 gb|EDQ75816.1| predicted protein [Physcomitrella patens]
Length=424

 Score =   126 bits (317),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 54/92 (59%), Positives = 74/92 (80%), Gaps = 0/92 (0%)
 Frame = +2

Query  164  PAVQMWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFI  343
            PA++ + DP   LA+     G+HGGVN++IEAS+TF ++EP++L ++FSGELG D+  ++
Sbjct  6    PAIKKFPDPVQTLANVHQGLGQHGGVNVAIEASSTFAIVEPQTLNKLFSGELGTDHGLYL  65

Query  344  YSRHFNPTVLNVSRLMAAMEGTEAAYCTASGM  439
            YSRHFNPTVL++ R MAA+E TEAAYCTASGM
Sbjct  66   YSRHFNPTVLSLGRKMAALEDTEAAYCTASGM  97



>ref|XP_011020545.1| PREDICTED: methionine gamma-lyase-like [Populus euphratica]
Length=417

 Score =   122 bits (305),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 67/86 (78%), Gaps = 0/86 (0%)
 Frame = +2

Query  182  EDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFN  361
            E PA ALA+ARH+ GEH G+NMSIEAS TFT  + +++ R F GE+GP    +IYSRH N
Sbjct  15   EVPAEALAAARHQLGEHNGINMSIEASNTFTFKDSDAMNRAFLGEVGPKTGIYIYSRHLN  74

Query  362  PTVLNVSRLMAAMEGTEAAYCTASGM  439
            PT+LN+ R +AAMEGTE AYCTASGM
Sbjct  75   PTILNLGRQIAAMEGTETAYCTASGM  100



>ref|XP_002304835.2| hypothetical protein POPTR_0003s18600g [Populus trichocarpa]
 gb|EEE79814.2| hypothetical protein POPTR_0003s18600g [Populus trichocarpa]
Length=417

 Score =   122 bits (305),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 67/86 (78%), Gaps = 0/86 (0%)
 Frame = +2

Query  182  EDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFN  361
            E PA ALA+ARH+ GEH G+NMSIEAS TFT  + +++ R F GE+GP    +IYSRH N
Sbjct  15   EVPAEALAAARHKLGEHNGINMSIEASNTFTFKDSDAMNRAFLGEVGPKTGIYIYSRHLN  74

Query  362  PTVLNVSRLMAAMEGTEAAYCTASGM  439
            PT+LN+ R +AAMEGTE AYCTASGM
Sbjct  75   PTILNLGRQIAAMEGTETAYCTASGM  100



>ref|XP_002304836.2| hypothetical protein POPTR_0003s18590g [Populus trichocarpa]
 gb|EEE79815.2| hypothetical protein POPTR_0003s18590g [Populus trichocarpa]
Length=433

 Score =   119 bits (297),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 70/96 (73%), Gaps = 0/96 (0%)
 Frame = +2

Query  149  KKGGKPAVQMWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPD  328
            KK     ++  + PA ALA+ARHE GEH G+NMSIEAS+TFT  + +++ R F GE+GP 
Sbjct  3    KKTVNVEIESKKVPAEALAAARHELGEHNGINMSIEASSTFTFKDSDAMNRAFLGEVGPK  62

Query  329  NDYFIYSRHFNPTVLNVSRLMAAMEGTEAAYCTASG  436
               +IYSRH NPT LN+ R +AA+EGTE AYCTASG
Sbjct  63   TGIYIYSRHLNPTTLNLGRQIAAIEGTETAYCTASG  98



>gb|AFT91998.1| cystathionine gamma-synthase [Populus alba x Populus glandulosa]
 gb|AFT92010.1| cystathionine gamma-synthase [Populus alba x Populus glandulosa]
Length=420

 Score =   117 bits (293),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 74/112 (66%), Gaps = 14/112 (13%)
 Frame = +2

Query  107  PGSEEWERDDMMKAKKGGKPAVQMWED-PAAALASARHEFGEHGGVNMSIEASATFTVME  283
            PG+EE E             +++  ED P   LA+ARHE GEH GVNMSIE S TF    
Sbjct  3    PGNEELE-------------SIEPREDLPTERLANARHELGEHNGVNMSIEVSDTFVFKN  49

Query  284  PESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEGTEAAYCTASGM  439
            PE++ + F GE+GP+   +IYSRH+NPTVLN S  +AA+EGTE AYCT+SGM
Sbjct  50   PENMGKAFLGEVGPETGTYIYSRHYNPTVLNFSHQLAAIEGTETAYCTSSGM  101



>gb|AFT91997.1| cystathionine gamma-synthase [Populus tomentosa]
 gb|AFT92009.1| cystathionine gamma-synthase [Populus tomentosa]
Length=420

 Score =   117 bits (292),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 73/112 (65%), Gaps = 14/112 (13%)
 Frame = +2

Query  107  PGSEEWERDDMMKAKKGGKPAVQMWED-PAAALASARHEFGEHGGVNMSIEASATFTVME  283
            PG+EE E              ++  ED P   LA+ARHE GEH GVNMSIE S TF    
Sbjct  3    PGNEELEN-------------IEPREDLPTERLANARHELGEHNGVNMSIEVSDTFVFKN  49

Query  284  PESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEGTEAAYCTASGM  439
            PE++ + F GE+GP+   +IYSRH+NPTVLN S  +AA+EGTE AYCT+SGM
Sbjct  50   PENMGKAFLGEVGPETGTYIYSRHYNPTVLNFSHQLAAIEGTETAYCTSSGM  101



>ref|XP_006388026.1| hypothetical protein POPTR_0393s00210g [Populus trichocarpa]
 gb|ERP46940.1| hypothetical protein POPTR_0393s00210g [Populus trichocarpa]
Length=420

 Score =   115 bits (288),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 63/84 (75%), Gaps = 0/84 (0%)
 Frame = +2

Query  188  PAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPT  367
            P   LA+ARHE GEH GVNMSIE S TF    PE++ + F GE+GP+   +IYSRH+NPT
Sbjct  18   PTERLANARHELGEHNGVNMSIEVSDTFVFKNPENMGKAFLGEIGPETGTYIYSRHYNPT  77

Query  368  VLNVSRLMAAMEGTEAAYCTASGM  439
            VLN S  +AA+EGTE AYCT+SGM
Sbjct  78   VLNFSHQLAAIEGTETAYCTSSGM  101



>ref|XP_001756897.1| predicted protein [Physcomitrella patens]
 gb|EDQ78128.1| predicted protein [Physcomitrella patens]
Length=395

 Score =   110 bits (274),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 49/92 (53%), Positives = 67/92 (73%), Gaps = 0/92 (0%)
 Frame = +2

Query  164  PAVQMWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFI  343
            PA++ + +P   LA ARH  G++GGVN +IEAS+TF ++ P+ L ++FSGELG D   ++
Sbjct  8    PAIKKFPNPVQNLAGARHGLGQYGGVNGAIEASSTFAIILPQRLNKLFSGELGTDQGLYL  67

Query  344  YSRHFNPTVLNVSRLMAAMEGTEAAYCTASGM  439
            YSRHFNPT+ ++ R MA  E  EAAYCT SGM
Sbjct  68   YSRHFNPTMRSLGRKMAVDEDMEAAYCTMSGM  99



>ref|WP_022667695.1| cystathionine beta-lyase [Desulfospira joergensenii]
Length=406

 Score =   107 bits (268),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 63/86 (73%), Gaps = 1/86 (1%)
 Frame = +2

Query  185  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDN-DYFIYSRHFN  361
            +P  AL  AR EFGEHGGV  SI  SATFTVM P ++  +FSG  GP+    F+YSRHFN
Sbjct  5    NPEQALLKARREFGEHGGVAPSISRSATFTVMHPRTMPEIFSGLKGPEQGGCFLYSRHFN  64

Query  362  PTVLNVSRLMAAMEGTEAAYCTASGM  439
            PTV  +SR +AAMEGTEAA CTASGM
Sbjct  65   PTVDVLSRYLAAMEGTEAAICTASGM  90



>gb|KHN47224.1| Cystathionine gamma-lyase [Glycine soja]
Length=278

 Score =   106 bits (264),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 54/88 (61%), Positives = 64/88 (73%), Gaps = 4/88 (5%)
 Frame = +2

Query  89   VSNKRRPGSEEWERDDMMKAKKGGKPAVQMWEDPAAALASARHEFGEHGGVNMSIEASAT  268
            V+N++R   +    D + +  +  K  V    DPA ALA  RHEFGEHGGVNMSIEASAT
Sbjct  6    VTNRKRSSGD----DAVSENDRKRKNMVARNMDPAEALALTRHEFGEHGGVNMSIEASAT  61

Query  269  FTVMEPESLRRMFSGELGPDNDYFIYSR  352
            FTVMEPE+L RMF+GELGPD D+FIYSR
Sbjct  62   FTVMEPETLCRMFAGELGPDRDFFIYSR  89



>ref|WP_024333343.1| cystathionine beta-lyase [Desulfotignum balticum]
Length=406

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 64/86 (74%), Gaps = 1/86 (1%)
 Frame = +2

Query  185  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDND-YFIYSRHFN  361
            +P  AL +AR EFGEHGGV  SI  SATFTVM P ++  +F+G  GP+    F+YSRHFN
Sbjct  5    NPEKALLNARREFGEHGGVVPSISRSATFTVMHPGTMPEIFNGLKGPEQGGCFLYSRHFN  64

Query  362  PTVLNVSRLMAAMEGTEAAYCTASGM  439
            PTV  ++R +AAMEGTEAA CTASGM
Sbjct  65   PTVDVLARYLAAMEGTEAAVCTASGM  90



>ref|WP_006964281.1| cystathionine gamma-lyase CysA [Desulfotignum phosphitoxidans]
 gb|EMS81534.1| cystathionine gamma-lyase CysA [Desulfotignum phosphitoxidans 
DSM 13687]
Length=406

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 64/86 (74%), Gaps = 1/86 (1%)
 Frame = +2

Query  185  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDND-YFIYSRHFN  361
            +P  AL +AR EFGEHGGV  SI  SATFTVM P ++  +F+G  GP+    F+YSRHFN
Sbjct  5    NPEKALLNARREFGEHGGVVPSISRSATFTVMHPGTMPEIFNGLKGPEQGGCFLYSRHFN  64

Query  362  PTVLNVSRLMAAMEGTEAAYCTASGM  439
            PTV  ++R +AAMEGTEAA CTASGM
Sbjct  65   PTVDVLARYLAAMEGTEAAVCTASGM  90



>ref|XP_005848305.1| hypothetical protein CHLNCDRAFT_35132 [Chlorella variabilis]
 gb|EFN56203.1| hypothetical protein CHLNCDRAFT_35132 [Chlorella variabilis]
Length=569

 Score =   104 bits (260),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 62/86 (72%), Gaps = 0/86 (0%)
 Frame = +2

Query  182  EDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFN  361
            EDPAA LA +R EFGE GGVN  IE S TFTV+E ++L ++F+GE GP    ++Y R FN
Sbjct  17   EDPAARLADSRREFGEWGGVNAGIEVSTTFTVLEADTLPQIFAGEKGPSGGCYLYGRSFN  76

Query  362  PTVLNVSRLMAAMEGTEAAYCTASGM  439
            PTV  + R +AA+EG  A+YC ASGM
Sbjct  77   PTVRYLGRQLAALEGAAASYCCASGM  102



>ref|WP_027709412.1| cystathionine beta-lyase [Zooshikella ganghwensis]
Length=409

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/81 (63%), Positives = 65/81 (80%), Gaps = 1/81 (1%)
 Frame = +2

Query  200  LASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDY-FIYSRHFNPTVLN  376
            LA A+HEFGEHGGVNMSIEAS+TFTVME  +L  +F G+ GP     ++Y RHFNPTV N
Sbjct  11   LADAKHEFGEHGGVNMSIEASSTFTVMEANTLPEIFQGQKGPQQGGCYLYGRHFNPTVYN  70

Query  377  VSRLMAAMEGTEAAYCTASGM  439
            +++ +A +EG+E+AYCTASGM
Sbjct  71   LAQQLACIEGSESAYCTASGM  91



>ref|XP_006385806.1| hypothetical protein POPTR_0003s14660g [Populus trichocarpa]
 gb|ERP63603.1| hypothetical protein POPTR_0003s14660g [Populus trichocarpa]
Length=200

 Score = 98.2 bits (243),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 59/80 (74%), Gaps = 3/80 (4%)
 Frame = +2

Query  92   SNKRRPGSEEWERDDMMKAKKGGKPAVQM---WEDPAAALASARHEFGEHGGVNMSIEAS  262
            + K+R  + +   DD + A K    +  M   WEDPAAALA++RHEFGEHGGVNMS EAS
Sbjct  8    AGKKRSSTGQDGDDDCIVANKKAMLSTGMPSTWEDPAAALATSRHEFGEHGGVNMSTEAS  67

Query  263  ATFTVMEPESLRRMFSGELG  322
            ATFTVMEPE++RRMFS ELG
Sbjct  68   ATFTVMEPETMRRMFSSELG  87



>ref|XP_002955875.1| hypothetical protein VOLCADRAFT_66358 [Volvox carteri f. nagariensis]
 gb|EFJ43076.1| hypothetical protein VOLCADRAFT_66358 [Volvox carteri f. nagariensis]
Length=412

 Score = 97.1 bits (240),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 63/89 (71%), Gaps = 1/89 (1%)
 Frame = +2

Query  176  MWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPD-NDYFIYSR  352
            +  DP   L S + EFGE GGVN S+E S TFTV+E ++L  +FSGE+GP+    ++Y R
Sbjct  4    LQADPLDRLVSGKREFGEFGGVNASVEISTTFTVLEADTLPAIFSGEVGPEKGGCYVYGR  63

Query  353  HFNPTVLNVSRLMAAMEGTEAAYCTASGM  439
             FNPTV ++ RL+AA+EG EAAY  +SGM
Sbjct  64   AFNPTVRHLGRLLAALEGCEAAYPCSSGM  92



>ref|XP_010497416.1| PREDICTED: methionine gamma-lyase-like [Camelina sativa]
Length=197

 Score = 92.0 bits (227),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 38/46 (83%), Positives = 45/46 (98%), Gaps = 0/46 (0%)
 Frame = +2

Query  302  MFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAMEGTEAAYCTASGM  439
            MF+GELGPDND+F+YSRHFNPTVLN+SR MAA+EGT+AAYCT+SGM
Sbjct  1    MFAGELGPDNDFFVYSRHFNPTVLNLSRQMAALEGTQAAYCTSSGM  46



>ref|XP_005651025.1| cystathionine gamma-synthase [Coccomyxa subellipsoidea C-169]
 gb|EIE26481.1| cystathionine gamma-synthase [Coccomyxa subellipsoidea C-169]
Length=430

 Score = 84.0 bits (206),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 57/86 (66%), Gaps = 1/86 (1%)
 Frame = +2

Query  185  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDY-FIYSRHFN  361
            +P  +L+  + EFGE GGVN SIE+S TFTV+    + ++F G L P+    ++Y R FN
Sbjct  10   EPTVSLSRHKKEFGEFGGVNASIESSTTFTVLHAGDMPQIFEGTLNPEKGACYLYGRSFN  69

Query  362  PTVLNVSRLMAAMEGTEAAYCTASGM  439
            PTV  + R +AA+EGTEA Y  +SG+
Sbjct  70   PTVRYLGRQLAALEGTEAGYAVSSGL  95



>ref|XP_006662513.1| PREDICTED: LOW QUALITY PROTEIN: methionine gamma-lyase-like [Oryza 
brachyantha]
Length=312

 Score = 79.3 bits (194),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 43/47 (91%), Gaps = 1/47 (2%)
 Frame = +2

Query  212  RHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPD-NDYFIYS  349
            RHEFGEHGGVNMSIEASATFTVMEP+++RR+F+GELGP+  D  ++S
Sbjct  45   RHEFGEHGGVNMSIEASATFTVMEPDTMRRLFAGELGPERGDLVVHS  91



>ref|WP_038562571.1| cystathionine beta-lyase [Draconibacterium orientale]
Length=393

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 57/88 (65%), Gaps = 4/88 (5%)
 Frame = +2

Query  176  MWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRH  355
            M  DPA  +   + +FGE GGVN SI  S+T+T +E E++   F G +      F+YSRH
Sbjct  1    MNSDPAKRIFDIQ-QFGEFGGVNPSITDSSTYTFLEGETMEETFLGHM---EGCFLYSRH  56

Query  356  FNPTVLNVSRLMAAMEGTEAAYCTASGM  439
            +NP+   ++  +AAMEGTE+A+ T+SGM
Sbjct  57   WNPSNKYLADALAAMEGTESAWITSSGM  84



>gb|KJF42319.1| cystathionine beta-lyase [Draconibacterium sp. JN14CK-3]
Length=393

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 57/88 (65%), Gaps = 4/88 (5%)
 Frame = +2

Query  176  MWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRH  355
            M  DPA  +   + +FGE GGVN SI  S+T+T +E E++   F G +      F+YSRH
Sbjct  1    MNSDPAKRIFDIQ-QFGEFGGVNPSITDSSTYTFLEGETMEETFLGHM---EGCFLYSRH  56

Query  356  FNPTVLNVSRLMAAMEGTEAAYCTASGM  439
            +NP+   ++  +AAMEGTE+A+ T+SGM
Sbjct  57   WNPSNKFLADALAAMEGTESAWITSSGM  84



>ref|WP_025865695.1| cystathionine beta-lyase [Prolixibacter bellariivorans]
Length=402

 Score = 69.7 bits (169),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 53/85 (62%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNP  364
            DPA  +    + FGE GGVN SI  S+TFT M+ +++   F GE       F+YSRH+NP
Sbjct  7    DPATRIQRLEN-FGEFGGVNPSITDSSTFTFMDAKTMLDTFHGE---TEGCFLYSRHWNP  62

Query  365  TVLNVSRLMAAMEGTEAAYCTASGM  439
            +   +S  +AAMEGTE A+ T SGM
Sbjct  63   SNKALSDAIAAMEGTEGAWVTGSGM  87



>ref|WP_028584498.1| cystathionine beta-lyase [Desulfobulbus mediterraneus]
Length=404

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 55/87 (63%), Gaps = 3/87 (3%)
 Frame = +2

Query  179  WEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHF  358
            + +P  AL       GEHGGV  SI  S+TF V +PES+  +FSGE     D F+YSR F
Sbjct  3    FHNPEQALEQCSRTLGEHGGVAPSISRSSTFVVDDPESMAALFSGE---REDGFLYSRSF  59

Query  359  NPTVLNVSRLMAAMEGTEAAYCTASGM  439
            NPTV  + R +AA+E TEAA  TASGM
Sbjct  60   NPTVNVLCRSLAALEATEAAMGTASGM  86



>ref|WP_014561543.1| cystathionine beta-lyase [Ignavibacterium album]
 gb|AFH50402.1| Methionine-gamma-lyase [Ignavibacterium album JCM 16511]
Length=401

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 49/73 (67%), Gaps = 3/73 (4%)
 Frame = +2

Query  221  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  400
            FGE+G VN SI  S+T+T + P++++ +F  E+      F+YSRH+NPT   ++  +A +
Sbjct  16   FGEYGDVNPSITDSSTYTFLNPKTMKELFEHEI---EGCFLYSRHWNPTNKYLAEALAKL  72

Query  401  EGTEAAYCTASGM  439
            E TEAA  T+SGM
Sbjct  73   EDTEAAIVTSSGM  85



>ref|WP_027075614.1| cystathionine beta-lyase [Maribacter antarcticus]
Length=407

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 52/88 (59%), Gaps = 4/88 (5%)
 Frame = +2

Query  176  MWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRH  355
            M +  A  L   +H FGE+GGVN SI  S+T+T +   S + MF    G     ++YSRH
Sbjct  1    MSKKAANDLQDLQH-FGEYGGVNPSISDSSTYTFL---SAKTMFDTFEGNTEGCYLYSRH  56

Query  356  FNPTVLNVSRLMAAMEGTEAAYCTASGM  439
              P+ L +   +AA+EGTEAA  TASGM
Sbjct  57   STPSNLYLGEALAALEGTEAANVTASGM  84



>ref|WP_035664548.1| cystathionine beta-lyase, partial [Flavobacterium sp. ACAM 123]
Length=390

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 47/73 (64%), Gaps = 3/73 (4%)
 Frame = +2

Query  221  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  400
            FGE GGVN SI  S+T+T +  +++   F G +      ++YSRH +P+ L + R MAAM
Sbjct  15   FGEFGGVNPSISDSSTYTFLSAKTMFDTFEGNM---EGCYLYSRHSSPSNLYLDRAMAAM  71

Query  401  EGTEAAYCTASGM  439
            EGTE A  +ASGM
Sbjct  72   EGTETANVSASGM  84



>ref|WP_027311134.1| cystathionine beta-lyase [Bacteroidetes bacterium SCGC AAA027-N21]
Length=400

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 52/84 (62%), Gaps = 4/84 (5%)
 Frame = +2

Query  188  PAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPT  367
            PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH +P+
Sbjct  6    PANNIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNAEGCYLYSRHSSPS  61

Query  368  VLNVSRLMAAMEGTEAAYCTASGM  439
             L + + MAAMEGTEAA  +ASGM
Sbjct  62   NLYLDKAMAAMEGTEAANVSASGM  85



>ref|WP_007138646.1| cystathionine beta-lyase [Flavobacterium frigoris]
 gb|EIA08747.1| O-acetylhomoserine sulfhydrylase / O-succinylhomoserine sulfhydrylase 
[Flavobacterium frigoris PS1]
Length=399

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 54/88 (61%), Gaps = 4/88 (5%)
 Frame = +2

Query  176  MWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRH  355
            M  +PA  +   ++ FGE GGVN SI  S+T+T +  +++   F G +      ++YSRH
Sbjct  1    MKFNPADNIQDLQY-FGEFGGVNPSISDSSTYTFLSAKTMFDTFEGNM---EGCYLYSRH  56

Query  356  FNPTVLNVSRLMAAMEGTEAAYCTASGM  439
             +P+ L + + MAAMEGTE A  +ASGM
Sbjct  57   SSPSNLYLDKAMAAMEGTETANVSASGM  84



>ref|WP_015480967.1| cystathionine beta-lyase [Polaribacter sp. MED152]
 gb|EAQ42254.1| Cys/Met metabolism PLP-dependent enzyme [Polaribacter sp. MED152]
Length=399

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 52/88 (59%), Gaps = 4/88 (5%)
 Frame = +2

Query  176  MWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRH  355
            M  +PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G  +  ++YSRH
Sbjct  1    MSYNPADKIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNADGCYLYSRH  56

Query  356  FNPTVLNVSRLMAAMEGTEAAYCTASGM  439
              P+ L +   +AAMEGTE A  TASGM
Sbjct  57   STPSNLYLGEALAAMEGTETANVTASGM  84



>ref|WP_008615133.1| cystathionine beta-lyase [Joostella marina]
 gb|EIJ40669.1| cystathionine beta-lyase/cystathionine gamma-synthase [Joostella 
marina DSM 19592]
Length=400

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 53/88 (60%), Gaps = 4/88 (5%)
 Frame = +2

Query  176  MWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRH  355
            M  +PA A+   ++ FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH
Sbjct  1    MKFNPADAIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNTEGCYLYSRH  56

Query  356  FNPTVLNVSRLMAAMEGTEAAYCTASGM  439
             +P+ L +   +AA+EGTE A  TASGM
Sbjct  57   SSPSNLYLGEALAALEGTETANVTASGM  84



>ref|WP_019669934.1| cystathionine beta-lyase [Eudoraea adriatica]
Length=408

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 46/75 (61%), Gaps = 3/75 (4%)
 Frame = +2

Query  215  HEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMA  394
            H FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH +P+ L +   +A
Sbjct  13   HNFGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNTEGCYLYSRHSSPSNLYLGEALA  69

Query  395  AMEGTEAAYCTASGM  439
            A+EGTE A  TASGM
Sbjct  70   ALEGTETANVTASGM  84



>ref|WP_027126595.1| cystathionine beta-lyase [Gelidibacter mesophilus]
Length=399

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 51/84 (61%), Gaps = 4/84 (5%)
 Frame = +2

Query  188  PAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPT  367
            PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G  +  ++YSRH  P+
Sbjct  5    PANNIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNADGCYLYSRHSTPS  60

Query  368  VLNVSRLMAAMEGTEAAYCTASGM  439
             L + + +AAMEGTE A  TASGM
Sbjct  61   NLYLGKALAAMEGTETATVTASGM  84



>ref|WP_026992162.1| cystathionine beta-lyase [Flavobacterium subsaxonicum]
 gb|KGO94782.1| cystathionine beta-lyase [Flavobacterium subsaxonicum WB 4.1-42 
= DSM 21790]
Length=407

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 53/85 (62%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNP  364
            +PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH +P
Sbjct  5    NPADNIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNAEGCYLYSRHSSP  60

Query  365  TVLNVSRLMAAMEGTEAAYCTASGM  439
            + L +S+ +AAMEGTEAA   ASGM
Sbjct  61   SNLYLSQALAAMEGTEAANVAASGM  85



>ref|WP_039118922.1| cystathionine beta-lyase [Flavobacterium sp. JRM]
 gb|KIC01293.1| cystathionine beta-lyase [Flavobacterium sp. JRM]
Length=407

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 52/84 (62%), Gaps = 4/84 (5%)
 Frame = +2

Query  188  PAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPT  367
            PA  +   ++ FGE GGVN SI  S+T+T +  +++   F G +      ++YSRH +P+
Sbjct  6    PANCIQDLQY-FGEFGGVNPSISDSSTYTFLSAKTMSDTFEGNI---EGCYLYSRHSSPS  61

Query  368  VLNVSRLMAAMEGTEAAYCTASGM  439
             L + + +AAMEGTE A  +ASGM
Sbjct  62   NLYLDQALAAMEGTETANVSASGM  85



>ref|WP_039113897.1| cystathionine beta-lyase [Flavobacterium sp. KMS]
 gb|KIA97550.1| cystathionine beta-lyase [Flavobacterium sp. KMS]
Length=407

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 52/84 (62%), Gaps = 4/84 (5%)
 Frame = +2

Query  188  PAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPT  367
            PA  +   ++ FGE GGVN SI  S+T+T +  +++   F G +      ++YSRH +P+
Sbjct  6    PANCIQDLQY-FGEFGGVNPSISDSSTYTFLSAKTMSDTFEGNI---EGCYLYSRHSSPS  61

Query  368  VLNVSRLMAAMEGTEAAYCTASGM  439
             L + + +AAMEGTE A  +ASGM
Sbjct  62   NLYLDQALAAMEGTETANVSASGM  85



>ref|WP_020214240.1| cystathionine beta-lyase [Flavobacterium rivuli]
 gb|KGO86542.1| cystathionine beta-lyase [Flavobacterium rivuli WB 3.3-2 = DSM 
21788]
Length=408

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 53/85 (62%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNP  364
            +PA  +   ++ FGE GGVN SI  S+T+T +  +++   F G     +  ++YSRH +P
Sbjct  5    NPADNIQDLQY-FGEFGGVNPSISDSSTYTFLSAKTMFDTFEGN---ADGCYLYSRHSSP  60

Query  365  TVLNVSRLMAAMEGTEAAYCTASGM  439
            + L + + +AAMEGTE A  TASGM
Sbjct  61   SNLYLGQALAAMEGTETANVTASGM  85



>ref|WP_035626372.1| cystathionine beta-lyase [Flavobacterium hydatis]
 gb|KFF11245.1| cystathionine beta-lyase [Flavobacterium hydatis]
Length=407

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 52/84 (62%), Gaps = 4/84 (5%)
 Frame = +2

Query  188  PAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPT  367
            PA  +   ++ FGE GGVN SI  S+T+T +  +++   F G +      ++YSRH +P+
Sbjct  6    PANCIQDLQY-FGEFGGVNPSISDSSTYTFLSAKTMSDTFEGNM---EGCYLYSRHSSPS  61

Query  368  VLNVSRLMAAMEGTEAAYCTASGM  439
             L + + +AAMEGTE A  +ASGM
Sbjct  62   NLYLDQALAAMEGTETANVSASGM  85



>ref|WP_044048288.1| cystathionine beta-lyase, partial [Flavobacterium johnsoniae]
Length=400

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 53/85 (62%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNP  364
            +PA  +   ++ FGE GGVN SI  S+T+T +  +++   F G +      ++YSRH +P
Sbjct  5    NPADKIQDLQY-FGEFGGVNPSISDSSTYTFLSAKTMFDTFEGNM---EGCYLYSRHSSP  60

Query  365  TVLNVSRLMAAMEGTEAAYCTASGM  439
            + L + + +AAMEGTE A  +ASGM
Sbjct  61   SNLYLDQALAAMEGTETANVSASGM  85



>ref|WP_026775536.1| cystathionine beta-lyase [Polaribacter sp. Hel_I_88]
Length=399

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 52/88 (59%), Gaps = 4/88 (5%)
 Frame = +2

Query  176  MWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRH  355
            M  +PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G  +  ++YSRH
Sbjct  1    MKFNPADNIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNADGCYLYSRH  56

Query  356  FNPTVLNVSRLMAAMEGTEAAYCTASGM  439
              P+ L +   +AAMEGTE A  TASGM
Sbjct  57   STPSNLYLGEALAAMEGTETANVTASGM  84



>gb|ABQ05159.1| Cystathionine gamma-synthase [Flavobacterium johnsoniae UW101]
Length=414

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 53/85 (62%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNP  364
            +PA  +   ++ FGE GGVN SI  S+T+T +  +++   F G +      ++YSRH +P
Sbjct  5    NPADKIQDLQY-FGEFGGVNPSISDSSTYTFLSAKTMFDTFEGNM---EGCYLYSRHSSP  60

Query  365  TVLNVSRLMAAMEGTEAAYCTASGM  439
            + L + + +AAMEGTE A  +ASGM
Sbjct  61   SNLYLDQALAAMEGTETANVSASGM  85



>ref|WP_017495491.1| cystathionine beta-lyase [Flavobacterium sp. WG21]
Length=408

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 53/85 (62%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNP  364
            +PA  +   ++ FGE GGVN SI  S+T+T +  +++   F G +      ++YSRH +P
Sbjct  5    NPADKIQDLQY-FGEFGGVNPSISDSSTYTFLSAKTMFDTFEGNM---EGCYLYSRHSSP  60

Query  365  TVLNVSRLMAAMEGTEAAYCTASGM  439
            + L + + +AAMEGTE A  +ASGM
Sbjct  61   SNLYLDQALAAMEGTETANVSASGM  85



>ref|WP_039107807.1| cystathionine beta-lyase [Flavobacterium sp. AED]
 gb|KIA86450.1| cystathionine beta-lyase [Flavobacterium sp. AED]
Length=408

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 53/85 (62%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNP  364
            +PA  +   ++ FGE GGVN SI  S+T+T +  +++   F G +      ++YSRH +P
Sbjct  5    NPADNIQDLQY-FGEFGGVNPSISDSSTYTFLSAKTMFDTFEGNM---EGCYLYSRHSSP  60

Query  365  TVLNVSRLMAAMEGTEAAYCTASGM  439
            + L + + +AAMEGTE A  +ASGM
Sbjct  61   SNLYLDKALAAMEGTETANVSASGM  85



>ref|WP_026728807.1| cystathionine beta-lyase [Flavobacterium denitrificans]
Length=414

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 53/85 (62%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNP  364
            +PA  +   ++ FGE GGVN SI  S+T+T +  +++   F G +      ++YSRH +P
Sbjct  5    NPADKIQDLQY-FGEFGGVNPSISDSSTYTFLSAKTMFDTFEGNM---EGCYLYSRHSSP  60

Query  365  TVLNVSRLMAAMEGTEAAYCTASGM  439
            + L + + +AAMEGTE A  +ASGM
Sbjct  61   SNLYLDQALAAMEGTETANVSASGM  85



>ref|WP_031453699.1| cystathionine beta-lyase [Flavobacterium chungangense]
Length=400

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 53/85 (62%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNP  364
            +PA  +   ++ FGE GGVN SI  S+T+T +  +++   F G +      ++YSRH +P
Sbjct  5    NPADKIQDLQY-FGEFGGVNPSISDSSTYTFLSAKTMFDTFEGNM---EGCYLYSRHSSP  60

Query  365  TVLNVSRLMAAMEGTEAAYCTASGM  439
            + L + + +AAMEGTE A  +ASGM
Sbjct  61   SNLYLDQALAAMEGTETANVSASGM  85



>ref|WP_041519168.1| cystathionine beta-lyase [Flavobacterium hibernum]
 gb|KIO51666.1| cystathionine beta-lyase [Flavobacterium hibernum]
Length=400

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 53/85 (62%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNP  364
            +PA  +   ++ FGE GGVN SI  S+T+T +  +++   F G +      ++YSRH +P
Sbjct  5    NPADKIQDLQY-FGEFGGVNPSISDSSTYTFLSAKTMFDTFEGNM---EGCYLYSRHSSP  60

Query  365  TVLNVSRLMAAMEGTEAAYCTASGM  439
            + L + + +AAMEGTE A  +ASGM
Sbjct  61   SNLYLDQALAAMEGTETANVSASGM  85



>ref|WP_035671447.1| cystathionine beta-lyase [Flavobacterium sp. 83]
Length=401

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 53/85 (62%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNP  364
            +PA  +   ++ FGE GGVN SI  S+T+T +  +++   F G +      ++YSRH +P
Sbjct  5    NPADNIQDLQY-FGEFGGVNPSISDSSTYTFLSAKTMFDTFEGNM---EGCYLYSRHSSP  60

Query  365  TVLNVSRLMAAMEGTEAAYCTASGM  439
            + L + + +AAMEGTE A  +ASGM
Sbjct  61   SNLYLDKALAAMEGTETANVSASGM  85



>ref|WP_024980967.1| cystathionine beta-lyase [Flavobacterium succinicans]
Length=400

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 53/85 (62%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNP  364
            +PA  +   ++ FGE GGVN SI  S+T+T +  +++   F G +      ++YSRH +P
Sbjct  5    NPADNIQDLQY-FGEFGGVNPSISDSSTYTFLSAKTMFDTFEGNM---EGCYLYSRHSSP  60

Query  365  TVLNVSRLMAAMEGTEAAYCTASGM  439
            + L + + +AAMEGTEAA   ASGM
Sbjct  61   SNLYLDQAIAAMEGTEAANVAASGM  85



>ref|WP_035666777.1| cystathionine beta-lyase, partial [Flavobacterium sp. KJJ]
Length=400

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 53/85 (62%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNP  364
            +PA  +   ++ FGE GGVN SI  S+T+T +  +++   F G +      ++YSRH +P
Sbjct  5    NPADKIQDLQY-FGEFGGVNPSISDSSTYTFLSAKTMFDTFEGNM---EGCYLYSRHSSP  60

Query  365  TVLNVSRLMAAMEGTEAAYCTASGM  439
            + L + + +AAMEGTE A  +ASGM
Sbjct  61   SNLYLDQALAAMEGTETANVSASGM  85



>ref|WP_036123108.1| cystathionine beta-lyase [Mangrovimonas yunxiaonensis]
 gb|KFB00994.1| cystathionine beta-lyase [Mangrovimonas yunxiaonensis]
Length=401

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 46/73 (63%), Gaps = 3/73 (4%)
 Frame = +2

Query  221  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  400
            FGE GGVN SI  S+T+T +   S + MF    G  +  ++YSRH +P+ L +   +AAM
Sbjct  15   FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNADGCYLYSRHSSPSNLYLGEALAAM  71

Query  401  EGTEAAYCTASGM  439
            EGTE A  TASGM
Sbjct  72   EGTETATVTASGM  84



>ref|WP_026985975.1| cystathionine beta-lyase [Flavobacterium sp. URHB0058]
Length=400

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 53/85 (62%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNP  364
            +PA  +   ++ FGE GGVN SI  S+T+T +  +++   F G +      ++YSRH +P
Sbjct  5    NPADKIQDLQY-FGEFGGVNPSISDSSTYTFLSAKTMFDTFEGNM---EGCYLYSRHSSP  60

Query  365  TVLNVSRLMAAMEGTEAAYCTASGM  439
            + L + + +AAMEGTE A  +ASGM
Sbjct  61   SNLYLDQALAAMEGTETANVSASGM  85



>ref|WP_035649238.1| cystathionine beta-lyase [Flavobacterium sp. Fl]
Length=414

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 53/85 (62%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNP  364
            +PA  +   ++ FGE GGVN SI  S+T+T +  +++   F G +      ++YSRH +P
Sbjct  5    NPADKIQDLQY-FGEFGGVNPSISDSSTYTFLSAKTMFDTFEGNM---EGCYLYSRHSSP  60

Query  365  TVLNVSRLMAAMEGTEAAYCTASGM  439
            + L + + +AAMEGTE A  +ASGM
Sbjct  61   SNLYLDQALAAMEGTETANVSASGM  85



>ref|WP_026708059.1| cystathionine beta-lyase [Flavobacterium frigidarium]
Length=400

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 53/85 (62%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNP  364
            +PA  +   ++ FGE GGVN SI  S+T+T +  +++   F G +      ++YSRH +P
Sbjct  5    NPADNIQDLQY-FGEFGGVNPSISDSSTYTFLSAKTMFDTFEGNM---EGCYLYSRHSSP  60

Query  365  TVLNVSRLMAAMEGTEAAYCTASGM  439
            + L + + +AAMEGTE A  +ASGM
Sbjct  61   SNLYLDKALAAMEGTETANVSASGM  85



>gb|KIX21419.1| cystathionine beta-lyase [Flavobacterium sp. 316]
Length=400

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 53/85 (62%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNP  364
            +PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH +P
Sbjct  5    NPADKIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNAEGCYLYSRHSSP  60

Query  365  TVLNVSRLMAAMEGTEAAYCTASGM  439
            + L + + +AAMEGTE+A  +ASGM
Sbjct  61   SNLYLDKALAAMEGTESANVSASGM  85



>ref|WP_035684485.1| cystathionine beta-lyase [Flavobacterium reichenbachii]
 gb|KFF06281.1| cystathionine beta-lyase [Flavobacterium reichenbachii]
Length=407

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 53/85 (62%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNP  364
            +PA  +   ++ FGE GGVN SI  S+T+T +  +++   F G +      ++YSRH +P
Sbjct  5    NPADKIQDLQY-FGEFGGVNPSISDSSTYTFLSAKTMFDTFEGNM---EGCYLYSRHSSP  60

Query  365  TVLNVSRLMAAMEGTEAAYCTASGM  439
            + L + + +AAMEGTE A  +ASGM
Sbjct  61   SNLYLDQALAAMEGTETANVSASGM  85



>ref|WP_008272189.1| cystathionine beta-lyase [Flavobacteriales bacterium ALC-1]
 gb|EDP69802.1| methionine gamma-lyase [Flavobacteriales bacterium ALC-1]
Length=404

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 46/73 (63%), Gaps = 3/73 (4%)
 Frame = +2

Query  221  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  400
            FGE GGVN SI  S+T+T +   S + MF    G  +  ++YSRH +P+ L +   +AAM
Sbjct  15   FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNADGCYLYSRHSSPSNLYLGEALAAM  71

Query  401  EGTEAAYCTASGM  439
            EGTE A  TASGM
Sbjct  72   EGTETATVTASGM  84



>ref|WP_042566587.1| cystathionine beta-lyase [Flavobacterium sp. MEB061]
 gb|KIQ16425.1| cystathionine beta-lyase [Flavobacterium sp. MEB061]
Length=405

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 53/85 (62%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNP  364
            +PA  +   ++ FGE GGVN SI  S+T+T +  +++   F G +      ++YSRH +P
Sbjct  5    NPADKIQDLQY-FGEFGGVNPSISDSSTYTFLSAKTMFDTFEGNM---EGCYLYSRHSSP  60

Query  365  TVLNVSRLMAAMEGTEAAYCTASGM  439
            + L + + +AAMEGTE A  +ASGM
Sbjct  61   SNLYLDQALAAMEGTETANVSASGM  85



>ref|WP_011963843.1| cystathionine beta-lyase [Flavobacterium psychrophilum]
 ref|YP_001296607.1| Cys/Met metabolism PLP-dependent enzyme [Flavobacterium psychrophilum 
JIP02/86]
 emb|CAL43800.1| Cys/Met metabolism PLP-dependent enzyme [Flavobacterium psychrophilum 
JIP02/86]
 gb|AIG30489.1| cystathionine beta-lyase [Flavobacterium psychrophilum]
 gb|AIG32764.1| cystathionine beta-lyase [Flavobacterium psychrophilum]
 gb|AIG34919.1| cystathionine beta-lyase [Flavobacterium psychrophilum]
 gb|AIG37284.1| cystathionine beta-lyase [Flavobacterium psychrophilum]
 gb|AIG39548.1| cystathionine beta-lyase [Flavobacterium psychrophilum]
 gb|AIG41813.1| cystathionine beta-lyase [Flavobacterium psychrophilum]
 gb|AIJ37567.1| Cystathionine gamma-synthase [Flavobacterium psychrophilum]
 gb|AIN71380.1| cystathionine beta-lyase [Flavobacterium psychrophilum FPG101]
 gb|AIN74490.1| cystathionine beta-lyase [Flavobacterium psychrophilum FPG3]
 gb|AIT65918.1| cystathionine beta-lyase [Flavobacterium psychrophilum]
Length=400

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 52/85 (61%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNP  364
            +PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH +P
Sbjct  5    NPADKIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNAEGCYLYSRHSSP  60

Query  365  TVLNVSRLMAAMEGTEAAYCTASGM  439
            + L + R +AAMEGTE+A   ASGM
Sbjct  61   SNLYLDRALAAMEGTESANVAASGM  85



>ref|WP_008239835.1| cystathionine beta-lyase [Imtechella halotolerans]
 gb|EID74031.1| cystathionine beta-lyase [Imtechella halotolerans K1]
Length=399

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 52/88 (59%), Gaps = 4/88 (5%)
 Frame = +2

Query  176  MWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRH  355
            M  +PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH
Sbjct  1    MKFNPANHIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNTEGCYLYSRH  56

Query  356  FNPTVLNVSRLMAAMEGTEAAYCTASGM  439
             +P+ L +   +AAMEGTE A  TASGM
Sbjct  57   SSPSNLYLGEALAAMEGTETANVTASGM  84



>dbj|BAO77673.1| O-acetylhomoserine sulfhydrylase [Winogradskyella sp. PG-2]
Length=405

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 46/73 (63%), Gaps = 3/73 (4%)
 Frame = +2

Query  221  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  400
            FGE GGVN SI  S+T+T +   S + MF    G  +  ++YSRH +P+ L +   +AAM
Sbjct  15   FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNADGCYLYSRHSSPSNLYLGEALAAM  71

Query  401  EGTEAAYCTASGM  439
            EGTE A  TASGM
Sbjct  72   EGTETATVTASGM  84



>ref|WP_026716030.1| cystathionine beta-lyase [Flavobacterium gelidilacus]
Length=400

 Score = 60.8 bits (146),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 51/85 (60%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNP  364
            +PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH +P
Sbjct  5    NPADNIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNAEGCYLYSRHSSP  60

Query  365  TVLNVSRLMAAMEGTEAAYCTASGM  439
            + L + R +AAMEGTE A   ASGM
Sbjct  61   SNLYLDRALAAMEGTETANVAASGM  85



>ref|WP_036827174.1| cystathionine beta-lyase [Polaribacter sp. Hel1_85]
 gb|KGL58828.1| O-acetylhomoserine sulfhydrylase / O-succinylhomoserine sulfhydrylase 
[Polaribacter sp. Hel1_85]
Length=399

 Score = 60.8 bits (146),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 53/88 (60%), Gaps = 4/88 (5%)
 Frame = +2

Query  176  MWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRH  355
            M  +PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G  +  ++YSRH
Sbjct  1    MKFNPADKIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNADGCYLYSRH  56

Query  356  FNPTVLNVSRLMAAMEGTEAAYCTASGM  439
              P+ L++   +AAMEGTE A  +ASGM
Sbjct  57   STPSNLHLGEALAAMEGTETANVSASGM  84



>ref|WP_008634437.1| cystathionine beta-lyase [Bizionia argentinensis]
 gb|EGV44880.1| cys/Met metabolism PLP-dependent enzyme family protein [Bizionia 
argentinensis JUB59]
Length=399

 Score = 60.8 bits (146),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 45/73 (62%), Gaps = 3/73 (4%)
 Frame = +2

Query  221  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  400
            FGE GGVN SI  S+T+T +   S + MF    G  +  ++YSRH  P+ L +   +AAM
Sbjct  15   FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNADGCYLYSRHSTPSNLYLGEALAAM  71

Query  401  EGTEAAYCTASGM  439
            EGTE A  TASGM
Sbjct  72   EGTETATVTASGM  84



>ref|WP_038264494.1| cystathionine beta-lyase [Zhouia amylolytica]
 gb|ETN95824.1| cystathionine beta-lyase [Zhouia amylolytica AD3]
Length=399

 Score = 60.8 bits (146),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 50/84 (60%), Gaps = 4/84 (5%)
 Frame = +2

Query  188  PAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPT  367
            PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH +P+
Sbjct  5    PADKIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNTEGCYLYSRHSSPS  60

Query  368  VLNVSRLMAAMEGTEAAYCTASGM  439
             L +   +AAMEGTE A  TASGM
Sbjct  61   NLYLGEALAAMEGTETANVTASGM  84



>ref|WP_007804337.1| cystathionine beta-lyase [Flavobacterium sp. CF136]
 gb|EJL66563.1| cystathionine beta-lyase/cystathionine gamma-synthase [Flavobacterium 
sp. CF136]
Length=400

 Score = 60.8 bits (146),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 53/85 (62%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNP  364
            +PA  +   ++ FGE GGVN SI  S+T+T +  +++   F G +      ++YSRH +P
Sbjct  5    NPADNIQDLQY-FGEFGGVNPSISDSSTYTFLSAKTMFDTFEGNI---EGCYLYSRHSSP  60

Query  365  TVLNVSRLMAAMEGTEAAYCTASGM  439
            + L + + +AAMEGTE A  +ASGM
Sbjct  61   SNLYLDQALAAMEGTETANVSASGM  85



>ref|WP_028290818.1| cystathionine beta-lyase [Olleya sp. VCSA23]
Length=399

 Score = 60.8 bits (146),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 51/88 (58%), Gaps = 4/88 (5%)
 Frame = +2

Query  176  MWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRH  355
            M   PA  +   ++ FGE GGVN SI  S+T+T +  +++   F G     +  ++YSRH
Sbjct  1    MTFKPANNIQDLQY-FGEFGGVNPSISDSSTYTFLSAKTMFDTFEGN---ADGCYLYSRH  56

Query  356  FNPTVLNVSRLMAAMEGTEAAYCTASGM  439
              P+ L +   +AAMEGTE A  TASGM
Sbjct  57   STPSNLYLGEALAAMEGTETANVTASGM  84



>ref|WP_044633542.1| cystathionine beta-lyase [Tamlana sedimentorum]
 gb|KJD34247.1| cystathionine beta-lyase [Tamlana sedimentorum]
Length=402

 Score = 60.8 bits (146),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 46/73 (63%), Gaps = 3/73 (4%)
 Frame = +2

Query  221  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  400
            FGE GGVN SI  S+T+T +   S + MF    G  +  ++YSRH +P+ L +   +AAM
Sbjct  15   FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNADGCYLYSRHSSPSNLYLGEALAAM  71

Query  401  EGTEAAYCTASGM  439
            EGTE A  TASGM
Sbjct  72   EGTETANVTASGM  84



>ref|WP_027878816.1| cystathionine beta-lyase [Mesoflavibacter zeaxanthinifaciens]
Length=399

 Score = 60.8 bits (146),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 51/84 (61%), Gaps = 4/84 (5%)
 Frame = +2

Query  188  PAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPT  367
            PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G  +  ++YSRH +P+
Sbjct  5    PANNIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNADGCYLYSRHSSPS  60

Query  368  VLNVSRLMAAMEGTEAAYCTASGM  439
             L +   +AAMEGTE A  TASGM
Sbjct  61   NLYLGEALAAMEGTETANVTASGM  84



>ref|WP_026976217.1| cystathionine beta-lyase [Flavobacterium tegetincola]
Length=400

 Score = 60.8 bits (146),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 51/85 (60%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNP  364
            +PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH +P
Sbjct  5    NPADNIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNAEGCYLYSRHSSP  60

Query  365  TVLNVSRLMAAMEGTEAAYCTASGM  439
            + L + R +AAMEGTE A   ASGM
Sbjct  61   SNLYLDRALAAMEGTETANVAASGM  85



>ref|WP_020897041.1| O-acetylhomoserine sulfhydrylase [Winogradskyella psychrotolerans]
 gb|EPR74512.1| O-acetylhomoserine sulfhydrylase [Winogradskyella psychrotolerans 
RS-3]
Length=399

 Score = 60.8 bits (146),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 52/88 (59%), Gaps = 4/88 (5%)
 Frame = +2

Query  176  MWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRH  355
            M   PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G  +  ++YSRH
Sbjct  1    MTFKPANNIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNADGCYLYSRH  56

Query  356  FNPTVLNVSRLMAAMEGTEAAYCTASGM  439
             +P+ L +   +AAMEGTE A  TASGM
Sbjct  57   SSPSNLYLGEALAAMEGTETATVTASGM  84



>ref|WP_039353474.1| cystathionine beta-lyase [Chryseobacterium jeonii]
 gb|KIA88204.1| cystathionine beta-lyase [Chryseobacterium jeonii]
Length=400

 Score = 60.8 bits (146),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 45/73 (62%), Gaps = 3/73 (4%)
 Frame = +2

Query  221  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  400
            FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH  P+ L +S  +A M
Sbjct  16   FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNTEGCYLYSRHSTPSNLYLSEALAQM  72

Query  401  EGTEAAYCTASGM  439
            EGTE+A  TASGM
Sbjct  73   EGTESANVTASGM  85



>ref|WP_028606171.1| cystathionine beta-lyase [Olleya sp. VCSM12]
Length=399

 Score = 60.8 bits (146),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 51/88 (58%), Gaps = 4/88 (5%)
 Frame = +2

Query  176  MWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRH  355
            M   PA  +   ++ FGE GGVN SI  S+T+T +  +++   F G     +  ++YSRH
Sbjct  1    MTFKPANNIQDLQY-FGEFGGVNPSISDSSTYTFLSAKTMFDTFEGN---ADGCYLYSRH  56

Query  356  FNPTVLNVSRLMAAMEGTEAAYCTASGM  439
              P+ L +   +AAMEGTE A  TASGM
Sbjct  57   STPSNLYLGEALAAMEGTETANVTASGM  84



>ref|WP_026451516.1| cystathionine beta-lyase [Aequorivita capsosiphonis]
Length=399

 Score = 60.8 bits (146),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 52/88 (59%), Gaps = 4/88 (5%)
 Frame = +2

Query  176  MWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRH  355
            M   PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G  +  ++YSRH
Sbjct  1    MAFKPADKIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNADGCYLYSRH  56

Query  356  FNPTVLNVSRLMAAMEGTEAAYCTASGM  439
              P+ L++ + +AAMEGTE A   ASGM
Sbjct  57   STPSNLHLGQALAAMEGTETANVAASGM  84



>ref|WP_026704856.1| cystathionine beta-lyase [Flavobacterium soli]
Length=405

 Score = 60.8 bits (146),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 53/85 (62%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNP  364
            +PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH +P
Sbjct  5    NPADNIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNAEGCYLYSRHSSP  60

Query  365  TVLNVSRLMAAMEGTEAAYCTASGM  439
            + L + + +AAMEGTE+A  +ASGM
Sbjct  61   SNLYLDKALAAMEGTESANVSASGM  85



>ref|WP_034719601.1| cystathionine beta-lyase [Chryseobacterium antarcticum]
 gb|KEY18928.1| cystathionine beta-lyase [Chryseobacterium antarcticum]
Length=400

 Score = 60.8 bits (146),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 45/73 (62%), Gaps = 3/73 (4%)
 Frame = +2

Query  221  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  400
            FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH  P+ L +S  +A M
Sbjct  16   FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNTEGCYLYSRHSTPSNLYLSEALAQM  72

Query  401  EGTEAAYCTASGM  439
            EGTE+A  TASGM
Sbjct  73   EGTESANVTASGM  85



>ref|WP_008257661.1| cystathionine beta-lyase [Flavobacteria bacterium BAL38]
 gb|EAZ94840.1| cystathionine beta-lyase [Flavobacteria bacterium BAL38]
Length=400

 Score = 60.8 bits (146),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 52/84 (62%), Gaps = 4/84 (5%)
 Frame = +2

Query  188  PAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPT  367
            PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH +P+
Sbjct  6    PADKIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNTEGCYLYSRHSSPS  61

Query  368  VLNVSRLMAAMEGTEAAYCTASGM  439
             L + + +AAMEGTE+A  +ASGM
Sbjct  62   NLYLDKALAAMEGTESANVSASGM  85



>ref|WP_007646642.1| O-acetylhomoserine sulfhydrylase [Formosa sp. AK20]
 gb|EMQ96487.1| O-acetylhomoserine sulfhydrylase [Formosa sp. AK20]
Length=399

 Score = 60.5 bits (145),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 46/73 (63%), Gaps = 3/73 (4%)
 Frame = +2

Query  221  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  400
            FGE GGVN SI  S+T+T +   S + MF    G  +  ++YSRH +P+ L +   +AAM
Sbjct  15   FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNADGCYLYSRHSSPSNLYLGEALAAM  71

Query  401  EGTEAAYCTASGM  439
            EGTE A  TASGM
Sbjct  72   EGTETANVTASGM  84



>ref|WP_022827196.1| cystathionine beta-lyase [Flavobacterium antarcticum]
Length=400

 Score = 60.5 bits (145),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 51/85 (60%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNP  364
            +PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH +P
Sbjct  5    NPADNIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNAEGCYLYSRHSSP  60

Query  365  TVLNVSRLMAAMEGTEAAYCTASGM  439
            + L + R +AAMEGTE A   ASGM
Sbjct  61   SNLYLDRALAAMEGTETANVAASGM  85



>ref|WP_031444038.1| cystathionine beta-lyase [Arenibacter algicola]
Length=406

 Score = 60.5 bits (145),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 46/73 (63%), Gaps = 3/73 (4%)
 Frame = +2

Query  221  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  400
            FGE+GGVN SI  S+T+T +   S + MF    G     ++YSRH +P+ L +   +AA+
Sbjct  15   FGEYGGVNPSISDSSTYTFL---SAKTMFDTFEGNTEGCYLYSRHSSPSNLYLGEALAAL  71

Query  401  EGTEAAYCTASGM  439
            EGTE A  TASGM
Sbjct  72   EGTETANVTASGM  84



>ref|WP_004569139.1| cystathionine beta-lyase [Polaribacter irgensii]
 gb|EAR13342.1| methionine gamma-lyase [Polaribacter irgensii 23-P]
Length=399

 Score = 60.5 bits (145),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 50/88 (57%), Gaps = 4/88 (5%)
 Frame = +2

Query  176  MWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRH  355
            M  +PA  +   ++ FGE GGVN SI  S+T+T M   ++R  F G     +   +Y+RH
Sbjct  1    MKFNPADNIQDVQY-FGEFGGVNPSISDSSTYTFMSANTMRDTFEGN---TDGCHLYARH  56

Query  356  FNPTVLNVSRLMAAMEGTEAAYCTASGM  439
              P+ L +   +AAMEGTE A   ASGM
Sbjct  57   TTPSNLYLGAALAAMEGTETANVAASGM  84



>ref|WP_013870851.1| cystathionine beta-lyase [Lacinutrix sp. 5H-3-7-4]
 gb|AEH02072.1| Cys/Met metabolism pyridoxal-phosphate-dependent protein [Lacinutrix 
sp. 5H-3-7-4]
Length=404

 Score = 60.5 bits (145),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 45/73 (62%), Gaps = 3/73 (4%)
 Frame = +2

Query  221  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  400
            FGE GGVN SI  S+T+T +   S + MF    G  +  ++YSRH  P+ L +   +AAM
Sbjct  15   FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNADGCYLYSRHSTPSNLYLGEALAAM  71

Query  401  EGTEAAYCTASGM  439
            EGTE A  TASGM
Sbjct  72   EGTETANVTASGM  84



>ref|WP_023572328.1| cystathionine beta-lyase [Flavobacterium enshiense]
 gb|ESU24722.1| cystathionine beta-lyase [Flavobacterium enshiense DK69]
 gb|KGO96820.1| cystathionine beta-lyase [Flavobacterium enshiense DK69]
Length=409

 Score = 60.5 bits (145),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 52/85 (61%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNP  364
            +PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH +P
Sbjct  5    NPADKIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNAEGCYLYSRHSSP  60

Query  365  TVLNVSRLMAAMEGTEAAYCTASGM  439
            + L + + +AAMEGTE+A   ASGM
Sbjct  61   SNLYLDKALAAMEGTESANVAASGM  85



>ref|WP_027066687.1| cystathionine beta-lyase [Maribacter sp. Hel_I_7]
Length=406

 Score = 60.5 bits (145),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 47/73 (64%), Gaps = 3/73 (4%)
 Frame = +2

Query  221  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  400
            FGE+GGVN SI  S+T+T +   S + MF    G     ++YSRH +P+ L +   +AA+
Sbjct  15   FGEYGGVNPSISDSSTYTFI---SAKTMFDTFEGNTEGCYLYSRHSSPSNLYLGEALAAL  71

Query  401  EGTEAAYCTASGM  439
            EGTE+A  TASGM
Sbjct  72   EGTESANVTASGM  84



>ref|WP_037324572.1| cystathionine beta-lyase [Salinimicrobium terrae]
Length=407

 Score = 60.5 bits (145),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 51/84 (61%), Gaps = 4/84 (5%)
 Frame = +2

Query  188  PAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPT  367
            PA  +   ++ FGE GGVN SI  S+T+T +  +++   F G+       ++YSRH +P+
Sbjct  5    PANKIQDLQY-FGEFGGVNPSISDSSTYTFLSAKTMFDTFEGDA---EGCYLYSRHSSPS  60

Query  368  VLNVSRLMAAMEGTEAAYCTASGM  439
             L +   +AAMEGTEAA   ASGM
Sbjct  61   NLYLGEALAAMEGTEAANVAASGM  84



>ref|WP_026981459.1| cystathionine beta-lyase [Flavobacterium suncheonense]
 gb|KGO87149.1| cystathionine beta-lyase [Flavobacterium suncheonense GH29-5 
= DSM 17707]
Length=401

 Score = 60.5 bits (145),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 52/85 (61%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNP  364
            +PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH +P
Sbjct  5    NPADKIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNAEGCYLYSRHSSP  60

Query  365  TVLNVSRLMAAMEGTEAAYCTASGM  439
            + L + + +AAMEGTE+A   ASGM
Sbjct  61   SNLYLDKALAAMEGTESANVAASGM  85



>ref|WP_036153848.1| cystathionine beta-lyase [Maribacter forsetii]
Length=406

 Score = 60.5 bits (145),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 47/73 (64%), Gaps = 3/73 (4%)
 Frame = +2

Query  221  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  400
            FGE+GGVN SI  S+T+T +   S + MF    G     ++YSRH +P+ L +   +AA+
Sbjct  15   FGEYGGVNPSISDSSTYTFI---SAKTMFDTFEGNTEGCYLYSRHSSPSNLYLGEALAAL  71

Query  401  EGTEAAYCTASGM  439
            EGTE+A  TASGM
Sbjct  72   EGTESANVTASGM  84



>ref|WP_014387952.1| cystathionine beta-lyase [Flavobacterium indicum]
 emb|CCG52810.1| Cys/Met metabolism PLP-dependent enzyme [Flavobacterium indicum 
GPTSA100-9 = DSM 17447]
Length=400

 Score = 60.1 bits (144),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 51/85 (60%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNP  364
            +PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH +P
Sbjct  5    NPADKIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNAEGCYLYSRHSSP  60

Query  365  TVLNVSRLMAAMEGTEAAYCTASGM  439
              L + + +AAMEGTEAA   ASGM
Sbjct  61   MNLYLGQALAAMEGTEAANVAASGM  85



>ref|WP_035130855.1| cystathionine beta-lyase [Flavobacterium beibuense]
 gb|KGO83455.1| cystathionine beta-lyase [Flavobacterium beibuense F44-8]
Length=399

 Score = 60.1 bits (144),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 53/88 (60%), Gaps = 4/88 (5%)
 Frame = +2

Query  176  MWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRH  355
            M  +PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G  +  ++YSRH
Sbjct  1    MKFNPADNIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNADGCYLYSRH  56

Query  356  FNPTVLNVSRLMAAMEGTEAAYCTASGM  439
             +P+ L + + +AAMEGTE A   ASGM
Sbjct  57   SSPSNLYLGQALAAMEGTETANVAASGM  84



>ref|WP_007093497.1| cystathionine beta-lyase [Kordia algicida]
 gb|EDP94427.1| methionine gamma-lyase [Kordia algicida OT-1]
Length=404

 Score = 60.1 bits (144),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 53/88 (60%), Gaps = 4/88 (5%)
 Frame = +2

Query  176  MWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRH  355
            M  +PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G  +  ++YSRH
Sbjct  1    MKFNPANNIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNADGCYLYSRH  56

Query  356  FNPTVLNVSRLMAAMEGTEAAYCTASGM  439
             +P+ L +   +AAMEGTE A  +ASGM
Sbjct  57   SSPSNLYLGEALAAMEGTETANVSASGM  84



>ref|WP_023576634.1| cystathionine beta-lyase [Flavobacterium saliperosum]
 gb|ESU25382.1| cystathionine beta-lyase [Flavobacterium saliperosum S13]
Length=401

 Score = 60.1 bits (144),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 52/85 (61%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNP  364
            +PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH +P
Sbjct  5    NPADRIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNAEGCYLYSRHSSP  60

Query  365  TVLNVSRLMAAMEGTEAAYCTASGM  439
            + L + + +AAMEGTE+A   ASGM
Sbjct  61   SNLYLDKALAAMEGTESANVAASGM  85



>ref|WP_023579261.1| cystathionine beta-lyase [Flavobacterium limnosediminis]
 gb|ESU28278.1| cystathionine beta-lyase [Flavobacterium limnosediminis JC2902]
Length=407

 Score = 60.1 bits (144),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 52/85 (61%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNP  364
            +PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH +P
Sbjct  5    NPADRIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNAEGCYLYSRHSSP  60

Query  365  TVLNVSRLMAAMEGTEAAYCTASGM  439
            + L + + +AAMEGTE+A   ASGM
Sbjct  61   SNLYLDKALAAMEGTESANVAASGM  85



>emb|CCF99963.1| methionine gamma-lyase [uncultured Flavobacteriia bacterium]
Length=399

 Score = 60.1 bits (144),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 52/88 (59%), Gaps = 4/88 (5%)
 Frame = +2

Query  176  MWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRH  355
            M  +PA  +   ++ FGE GGVN SI  S+T+T +  +++   F G     +  ++YSRH
Sbjct  1    MKFNPANNIQDLQY-FGEFGGVNPSISDSSTYTFISAKTMLDTFEGN---TDGCYLYSRH  56

Query  356  FNPTVLNVSRLMAAMEGTEAAYCTASGM  439
              P+ L +   +AAMEGTEAA   +SGM
Sbjct  57   STPSNLYLGEALAAMEGTEAANVASSGM  84



>ref|WP_034939616.1| cystathionine beta-lyase [Candidatus Accumulibacter sp. SK-12]
 gb|EXI66373.1| Methionine gamma-lyase [Candidatus Accumulibacter sp. SK-12]
Length=406

 Score = 60.1 bits (144),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 43/73 (59%), Gaps = 3/73 (4%)
 Frame = +2

Query  221  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  400
            FGE G VN SI  S+T+T + PE +  +F  E+      F+YSRHFNPT   ++  +  M
Sbjct  15   FGEFGDVNPSITDSSTYTFLSPERMEELFEHEI---EGCFLYSRHFNPTNKYLASALVRM  71

Query  401  EGTEAAYCTASGM  439
            E  EAA   ASGM
Sbjct  72   EDGEAAQVMASGM  84



>ref|WP_014783742.1| cystathionine beta-lyase [Aequorivita sublithincola]
 gb|AFL82493.1| cystathionine beta-lyase/cystathionine gamma-synthase [Aequorivita 
sublithincola DSM 14238]
Length=399

 Score = 59.7 bits (143),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 45/73 (62%), Gaps = 3/73 (4%)
 Frame = +2

Query  221  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  400
            FGE GGVN SI  S+T+T +   S + MF    G  +  ++YSRH  P+ L + + +AAM
Sbjct  15   FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNADGCYLYSRHSTPSNLYLGKALAAM  71

Query  401  EGTEAAYCTASGM  439
            EGTE A   ASGM
Sbjct  72   EGTETANVAASGM  84



>ref|WP_013307125.1| cystathionine beta-lyase [Maribacter sp. HTCC2170]
 gb|EAR00240.1| cystathionine beta-lyase [Maribacter sp. HTCC2170]
Length=406

 Score = 59.7 bits (143),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 46/73 (63%), Gaps = 3/73 (4%)
 Frame = +2

Query  221  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  400
            FGE+GGVN SI  S+T+T +   S + MF    G     ++Y+RH +P+ L +   +AA+
Sbjct  15   FGEYGGVNPSISDSSTYTFL---SAKTMFDTFEGNTEGCYLYTRHSSPSNLYLGEALAAL  71

Query  401  EGTEAAYCTASGM  439
            EGTE A  TASGM
Sbjct  72   EGTETANVTASGM  84



>ref|WP_035128700.1| cystathionine beta-lyase [Flavobacterium aquatile]
 gb|KGD66842.1| cystathionine beta-lyase [Flavobacterium aquatile LMG 4008]
Length=405

 Score = 59.7 bits (143),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 52/85 (61%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNP  364
            +PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH +P
Sbjct  5    NPADKIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNAEGCYLYSRHSSP  60

Query  365  TVLNVSRLMAAMEGTEAAYCTASGM  439
            + L + + +AAMEGTE A  +ASGM
Sbjct  61   SNLYLDQALAAMEGTETANVSASGM  85



>ref|WP_026839051.1| cystathionine beta-lyase [Gillisia sp. JM1]
Length=405

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 50/88 (57%), Gaps = 4/88 (5%)
 Frame = +2

Query  176  MWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRH  355
            M   PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G  +  ++YSRH
Sbjct  1    MKYKPANHIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNQDGCYLYSRH  56

Query  356  FNPTVLNVSRLMAAMEGTEAAYCTASGM  439
              P+ L +   +AAMEGTE A   ASGM
Sbjct  57   STPSNLYLGEALAAMEGTETANVAASGM  84



>ref|WP_034920606.1| cystathionine beta-lyase [Gillisia sp. CAL575]
Length=405

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 50/88 (57%), Gaps = 4/88 (5%)
 Frame = +2

Query  176  MWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRH  355
            M   PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G  +  ++YSRH
Sbjct  1    MKYKPANHIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNQDGCYLYSRH  56

Query  356  FNPTVLNVSRLMAAMEGTEAAYCTASGM  439
              P+ L +   +AAMEGTE A   ASGM
Sbjct  57   STPSNLYLGEALAAMEGTETANVAASGM  84



>ref|WP_027137507.1| cystathionine beta-lyase [Gaetbulibacter saemankumensis]
Length=406

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 52/88 (59%), Gaps = 4/88 (5%)
 Frame = +2

Query  176  MWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRH  355
            M   PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G  +  ++YSRH
Sbjct  1    MAFKPANNIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNADGCYLYSRH  56

Query  356  FNPTVLNVSRLMAAMEGTEAAYCTASGM  439
             +P+ L +   +AAMEGTE A  +ASGM
Sbjct  57   SSPSNLYLGEALAAMEGTETANVSASGM  84



>ref|WP_026726694.1| cystathionine beta-lyase [Flavobacterium sasangense]
Length=400

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 52/85 (61%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNP  364
            +PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH +P
Sbjct  5    NPADRIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNAEGCYLYSRHSSP  60

Query  365  TVLNVSRLMAAMEGTEAAYCTASGM  439
            + L + + +AAMEGTE+A   ASGM
Sbjct  61   SNLYLDKALAAMEGTESANVAASGM  85



>ref|WP_010231094.1| cystathionine beta-lyase [Gillisia marina]
Length=405

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 50/88 (57%), Gaps = 4/88 (5%)
 Frame = +2

Query  176  MWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRH  355
            M   PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G  +  ++YSRH
Sbjct  1    MKYKPANHIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNQDGCYLYSRH  56

Query  356  FNPTVLNVSRLMAAMEGTEAAYCTASGM  439
              P+ L +   +AAMEGTE A   ASGM
Sbjct  57   STPSNLYLGEALAAMEGTETANVAASGM  84



>ref|WP_044639103.1| cystathionine beta-lyase [Siansivirga zeaxanthinifaciens]
 gb|AJR04387.1| cystathionine beta-lyase [Siansivirga zeaxanthinifaciens CC-SAMT-1]
Length=400

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 51/84 (61%), Gaps = 4/84 (5%)
 Frame = +2

Query  188  PAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPT  367
            PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G  +  ++YSRH +P+
Sbjct  6    PANKIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNADGCYLYSRHSSPS  61

Query  368  VLNVSRLMAAMEGTEAAYCTASGM  439
             L +   +AAMEGTE A  +ASGM
Sbjct  62   NLYLGEALAAMEGTETANVSASGM  85



>ref|WP_041327761.1| cystathionine beta-lyase [Robiginitalea biformata]
Length=407

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 46/73 (63%), Gaps = 3/73 (4%)
 Frame = +2

Query  221  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  400
            FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH +P+ L +   +AA+
Sbjct  16   FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNTEGCYLYSRHSSPSNLYLGEALAAL  72

Query  401  EGTEAAYCTASGM  439
            EGTE+A  TASGM
Sbjct  73   EGTESANVTASGM  85



>gb|EAR15507.1| cystathionine beta-lyase [Robiginitalea biformata HTCC2501]
Length=417

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 46/73 (63%), Gaps = 3/73 (4%)
 Frame = +2

Query  221  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  400
            FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH +P+ L +   +AA+
Sbjct  26   FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNTEGCYLYSRHSSPSNLYLGEALAAL  82

Query  401  EGTEAAYCTASGM  439
            EGTE+A  TASGM
Sbjct  83   EGTESANVTASGM  95



>ref|WP_029035905.1| cystathionine beta-lyase [Salinimicrobium xinjiangense]
Length=407

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 45/73 (62%), Gaps = 3/73 (4%)
 Frame = +2

Query  221  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  400
            FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH +P+ L +   +AAM
Sbjct  15   FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNAEGCYLYSRHSSPSNLYLGEALAAM  71

Query  401  EGTEAAYCTASGM  439
            EGTEAA   ASGM
Sbjct  72   EGTEAANVAASGM  84



>ref|WP_023571459.1| cystathionine beta-lyase [Flavobacterium cauense]
 gb|ESU18943.1| cystathionine beta-lyase [Flavobacterium cauense R2A-7]
 gb|KGO82423.1| cystathionine beta-lyase [Flavobacterium cauense R2A-7]
Length=401

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 51/85 (60%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNP  364
            +PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH +P
Sbjct  5    NPADRIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNAEGCYLYSRHSSP  60

Query  365  TVLNVSRLMAAMEGTEAAYCTASGM  439
            + L + + +AAMEGTE A   ASGM
Sbjct  61   SNLYLDKALAAMEGTETANVAASGM  85



>dbj|GAL77579.1| O-acetylhomoserine sulfhydrylase [Algibacter lectus]
Length=370

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 46/73 (63%), Gaps = 3/73 (4%)
 Frame = +2

Query  221  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  400
            FGE GGVN SI  S+T+T +   S + MF    G  +  ++YSRH +P+ L +   +AAM
Sbjct  15   FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNADGCYLYSRHSSPSNLYLGEALAAM  71

Query  401  EGTEAAYCTASGM  439
            EGTE A  +ASGM
Sbjct  72   EGTETANVSASGM  84



>ref|WP_036783245.1| cystathionine beta-lyase [Polaribacter sp. Hel1_33_49]
 gb|KGL59526.1| Cys/Met metabolism PLP-dependent enzyme [Polaribacter sp. Hel1_33_49]
Length=399

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 51/88 (58%), Gaps = 4/88 (5%)
 Frame = +2

Query  176  MWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRH  355
            M  +PA  +   ++ FGE GGVN SI  S+T+T +  +++   F G     +  ++YSRH
Sbjct  1    MKFNPADNIQDLQY-FGEFGGVNPSISDSSTYTFLSAKTMVDTFEGN---TDGCYLYSRH  56

Query  356  FNPTVLNVSRLMAAMEGTEAAYCTASGM  439
              P+ L +   +AAMEGTE A   ASGM
Sbjct  57   STPSNLYLGEALAAMEGTETANVAASGM  84



>ref|WP_034059175.1| cystathionine beta-lyase [Lacinutrix sp. PAMC 27137]
Length=404

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 46/73 (63%), Gaps = 3/73 (4%)
 Frame = +2

Query  221  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  400
            FGE+GGVN SI  S+T+T ++ +++   F G     +  ++YSRH +P+ L +   +AAM
Sbjct  15   FGENGGVNPSISDSSTYTFLKAKTMLDTFEGN---TDGCYLYSRHTSPSNLYLGEALAAM  71

Query  401  EGTEAAYCTASGM  439
            EGTE A    SGM
Sbjct  72   EGTETANVAGSGM  84



>ref|WP_040253833.1| cystathionine beta-lyase [Psychroserpens mesophilus]
Length=404

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 46/73 (63%), Gaps = 3/73 (4%)
 Frame = +2

Query  221  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  400
            FGE GGVN SI  S+T+T +   S + MF    G  +  ++YSRH +P+ L +   +AAM
Sbjct  15   FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNADGCYLYSRHSSPSNLYLGEALAAM  71

Query  401  EGTEAAYCTASGM  439
            EGTE A  +ASGM
Sbjct  72   EGTETANVSASGM  84



>ref|WP_019387558.1| cystathionine beta-lyase [Arenitalea lutea]
Length=400

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 52/88 (59%), Gaps = 4/88 (5%)
 Frame = +2

Query  176  MWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRH  355
            M   PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G  +  ++YSRH
Sbjct  1    MAFKPANNIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNADGCYLYSRH  56

Query  356  FNPTVLNVSRLMAAMEGTEAAYCTASGM  439
             +P+ L +   +AAMEGTE A  +ASGM
Sbjct  57   SSPSNLYLGEALAAMEGTETANVSASGM  84



>ref|WP_042506508.1| cystathionine beta-lyase [Algibacter lectus]
 dbj|GAL64703.1| O-acetylhomoserine sulfhydrylase [Algibacter lectus]
Length=400

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 46/73 (63%), Gaps = 3/73 (4%)
 Frame = +2

Query  221  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  400
            FGE GGVN SI  S+T+T +   S + MF    G  +  ++YSRH +P+ L +   +AAM
Sbjct  15   FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNADGCYLYSRHSSPSNLYLGEALAAM  71

Query  401  EGTEAAYCTASGM  439
            EGTE A  +ASGM
Sbjct  72   EGTETANVSASGM  84



>ref|WP_034045025.1| cystathionine beta-lyase [Flaviramulus ichthyoenteri]
Length=400

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 52/88 (59%), Gaps = 4/88 (5%)
 Frame = +2

Query  176  MWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRH  355
            M   PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G  +  ++YSRH
Sbjct  1    MAFKPANNIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNADGCYLYSRH  56

Query  356  FNPTVLNVSRLMAAMEGTEAAYCTASGM  439
             +P+ L +   +AAMEGTE A  +ASGM
Sbjct  57   SSPSNLYLGEALAAMEGTETANVSASGM  84



>gb|EHQ04475.1| Cys/Met metabolism pyridoxal-phosphate-dependent protein [Gillisia 
limnaea DSM 15749]
Length=422

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 52/90 (58%), Gaps = 4/90 (4%)
 Frame = +2

Query  170  VQMWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYS  349
            + M   PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G  +  ++YS
Sbjct  17   IIMKYKPADHIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNADGCYLYS  72

Query  350  RHFNPTVLNVSRLMAAMEGTEAAYCTASGM  439
            RH +P+ L +   +AAMEGTE A   ASGM
Sbjct  73   RHSSPSNLYLGEALAAMEGTETANVAASGM  102



>ref|WP_038530974.1| cystathionine beta-lyase [Formosa agariphila]
 emb|CDF80147.1| Cys/Met metabolism PLP-dependent enzyme [Formosa agariphila KMM 
3901]
Length=400

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 52/88 (59%), Gaps = 4/88 (5%)
 Frame = +2

Query  176  MWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRH  355
            M   PA ++   ++ FGE GGVN SI  S+T+T +   S + MF    G  +  ++YSRH
Sbjct  1    MAFKPANSIQDLQY-FGEFGGVNPSISDSSTYTFI---SAKTMFDTFEGNTDGCYLYSRH  56

Query  356  FNPTVLNVSRLMAAMEGTEAAYCTASGM  439
             +P+ L +   +AAMEGTE A   ASGM
Sbjct  57   SSPSNLYLGEALAAMEGTETANVYASGM  84



>ref|WP_028887221.1| cystathionine beta-lyase [Tenacibaculum ovolyticum]
Length=404

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 47/73 (64%), Gaps = 3/73 (4%)
 Frame = +2

Query  221  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  400
            FGE GGVN SI  S+T+T ++ +++   F G     +  ++YSRH +P+ L +S  +AAM
Sbjct  15   FGEFGGVNPSISDSSTYTFIKAKTMFDTFEGN---TDGCYLYSRHTSPSNLYLSEALAAM  71

Query  401  EGTEAAYCTASGM  439
            EGTE A  + +GM
Sbjct  72   EGTETANVSGTGM  84



>ref|WP_037320529.1| cystathionine beta-lyase [Salegentibacter sp. Hel_I_6]
Length=404

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 50/88 (57%), Gaps = 4/88 (5%)
 Frame = +2

Query  176  MWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRH  355
            M   PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH
Sbjct  1    MKYKPADNIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNSEGCYLYSRH  56

Query  356  FNPTVLNVSRLMAAMEGTEAAYCTASGM  439
             +P+ L +   +AAMEGTE A   ASGM
Sbjct  57   SSPSNLYLGEALAAMEGTETANVAASGM  84



>ref|WP_040280051.1| cystathionine beta-lyase [Psychroserpens damuponensis]
Length=408

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 51/88 (58%), Gaps = 4/88 (5%)
 Frame = +2

Query  176  MWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRH  355
            M   PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G  +  ++YSRH
Sbjct  1    MAFKPANNIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNADGCYLYSRH  56

Query  356  FNPTVLNVSRLMAAMEGTEAAYCTASGM  439
              P+ L +   +AAMEGTE A  +ASGM
Sbjct  57   STPSNLYLGEALAAMEGTETANVSASGM  84



>ref|WP_040506325.1| cystathionine beta-lyase [Gillisia limnaea]
Length=404

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 51/88 (58%), Gaps = 4/88 (5%)
 Frame = +2

Query  176  MWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRH  355
            M   PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G  +  ++YSRH
Sbjct  1    MKYKPADHIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNADGCYLYSRH  56

Query  356  FNPTVLNVSRLMAAMEGTEAAYCTASGM  439
             +P+ L +   +AAMEGTE A   ASGM
Sbjct  57   SSPSNLYLGEALAAMEGTETANVAASGM  84



>ref|WP_034893309.1| cystathionine beta-lyase, partial [Candidatus Accumulibacter 
sp. SK-11]
Length=343

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 43/73 (59%), Gaps = 3/73 (4%)
 Frame = +2

Query  221  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  400
            FGE G VN SI  S+T+T + PE +  +F  E+      F+YSRHFNPT   ++  +  M
Sbjct  15   FGEFGDVNPSITDSSTYTFLSPERMEELFEHEI---EGCFLYSRHFNPTNKYLASALERM  71

Query  401  EGTEAAYCTASGM  439
            E  EAA   ASGM
Sbjct  72   EDGEAAQVMASGM  84



>ref|WP_027377153.1| cystathionine beta-lyase [Chryseobacterium palustre]
Length=400

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 45/73 (62%), Gaps = 3/73 (4%)
 Frame = +2

Query  221  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  400
            FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH +P+ L +   +A M
Sbjct  16   FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNTEGCYLYSRHSSPSNLYLGEALAQM  72

Query  401  EGTEAAYCTASGM  439
            EGTE+A  TASGM
Sbjct  73   EGTESANVTASGM  85



>ref|WP_039346486.1| cystathionine beta-lyase [Chryseobacterium solincola]
 gb|KIA82384.1| cystathionine beta-lyase [Chryseobacterium solincola]
Length=409

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 45/73 (62%), Gaps = 3/73 (4%)
 Frame = +2

Query  221  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  400
            FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH +P+ L +   +A M
Sbjct  16   FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNTEGCYLYSRHSSPSNLYLGEALAQM  72

Query  401  EGTEAAYCTASGM  439
            EGTE+A  TASGM
Sbjct  73   EGTESANVTASGM  85



>ref|WP_011710043.1| cystathionine beta-lyase [Gramella forsetii]
 emb|CAL67140.1| methionine gamma-lyase [Gramella forsetii KT0803]
Length=404

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 51/88 (58%), Gaps = 4/88 (5%)
 Frame = +2

Query  176  MWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRH  355
            M   PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH
Sbjct  1    MKYKPADRIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNAEGCYLYSRH  56

Query  356  FNPTVLNVSRLMAAMEGTEAAYCTASGM  439
             +P+ L +   +AAMEGTE A  +ASGM
Sbjct  57   SSPSNLYLGEALAAMEGTETANVSASGM  84



>ref|WP_026815273.1| cystathionine beta-lyase [Arenibacter certesii]
Length=399

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 45/73 (62%), Gaps = 3/73 (4%)
 Frame = +2

Query  221  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  400
            FGE+GGVN SI  S+T+T +   S + MF    G     ++YSRH +P+ L +   +AA+
Sbjct  15   FGEYGGVNPSISDSSTYTFL---SAKTMFDTFEGNTEGCYLYSRHSSPSNLYLGEALAAL  71

Query  401  EGTEAAYCTASGM  439
            EGTE A  T SGM
Sbjct  72   EGTETANVTGSGM  84



>ref|WP_034891363.1| cystathionine beta-lyase [Gillisia sp. Hel_I_29]
Length=404

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 51/88 (58%), Gaps = 4/88 (5%)
 Frame = +2

Query  176  MWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRH  355
            M   PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G  +  ++YSRH
Sbjct  1    MKYKPADHIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNADGCYLYSRH  56

Query  356  FNPTVLNVSRLMAAMEGTEAAYCTASGM  439
             +P+ L +   +AAMEGTE A   ASGM
Sbjct  57   SSPSNLYLGEALAAMEGTETANVAASGM  84



>ref|WP_028891291.1| cystathionine beta-lyase [Tenacibaculum sp. 47A_GOM-205m]
Length=399

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 51/84 (61%), Gaps = 4/84 (5%)
 Frame = +2

Query  188  PAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPT  367
            PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G  +  ++YSRH +P+
Sbjct  5    PANNIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNTDGCYLYSRHSSPS  60

Query  368  VLNVSRLMAAMEGTEAAYCTASGM  439
             L ++  +AAMEGTE A   A+GM
Sbjct  61   NLYLAEALAAMEGTETANVAATGM  84



>ref|WP_034945820.1| cystathionine beta-lyase [Candidatus Accumulibacter sp. SK-02]
 gb|KFB77870.1| Methionine gamma-lyase [Candidatus Accumulibacter sp. SK-02]
Length=402

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 43/73 (59%), Gaps = 3/73 (4%)
 Frame = +2

Query  221  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  400
            FGE G VN SI  S+T+T + PE +  +F  E+      F+YSRHFNPT   ++  +  M
Sbjct  15   FGEFGDVNPSITDSSTYTFLSPERMAELFEHEI---EGCFLYSRHFNPTNKYLASALERM  71

Query  401  EGTEAAYCTASGM  439
            E  EAA   ASGM
Sbjct  72   EDGEAAQVMASGM  84



>gb|EDM43122.1| probable Methionine gamma-lyase [unidentified eubacterium SCB49]
Length=412

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 44/73 (60%), Gaps = 3/73 (4%)
 Frame = +2

Query  221  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  400
            FGE GGVN SI  S+T+T +   S + MF    G  +  ++YSRH  P+ L +   +AAM
Sbjct  28   FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNADGCYLYSRHSTPSNLYLGEALAAM  84

Query  401  EGTEAAYCTASGM  439
            EGTE A   ASGM
Sbjct  85   EGTETANVAASGM  97



>ref|WP_026915592.1| cystathionine beta-lyase [Gramella portivictoriae]
Length=404

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 51/88 (58%), Gaps = 4/88 (5%)
 Frame = +2

Query  176  MWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRH  355
            M   PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH
Sbjct  1    MKYKPADRIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNAEGCYLYSRH  56

Query  356  FNPTVLNVSRLMAAMEGTEAAYCTASGM  439
             +P+ L +   +AAMEGTE+A   ASGM
Sbjct  57   SSPSNLYLGEALAAMEGTESANVAASGM  84



>ref|WP_034929922.1| cystathionine beta-lyase [Candidatus Accumulibacter sp. SK-01]
 gb|KFB66626.1| Methionine gamma-lyase [Candidatus Accumulibacter sp. SK-01]
Length=402

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 43/73 (59%), Gaps = 3/73 (4%)
 Frame = +2

Query  221  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  400
            FGE G VN SI  S+T+T + PE +  +F  E+      F+YSRHFNPT   ++  +  M
Sbjct  15   FGEFGDVNPSITDSSTYTFLSPERMAELFEHEI---EGCFLYSRHFNPTNKYLASALERM  71

Query  401  EGTEAAYCTASGM  439
            E  EAA   ASGM
Sbjct  72   EDGEAAQVMASGM  84



>ref|WP_028281947.1| cystathionine beta-lyase [Olleya marilimosa]
Length=404

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 45/73 (62%), Gaps = 3/73 (4%)
 Frame = +2

Query  221  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  400
            FGE GGVN SI  S+T+T ++ +++   F G     +  ++YSRH  P+ L +   +AAM
Sbjct  15   FGEFGGVNPSISDSSTYTFLKAKTMFDTFEGN---TDGCYLYSRHSTPSNLYLGEALAAM  71

Query  401  EGTEAAYCTASGM  439
            EGTE+A    SGM
Sbjct  72   EGTESANVAGSGM  84



>ref|WP_042336387.1| cystathionine beta-lyase [Candidatus Accumulibacter sp. BA-92]
 gb|EXI76995.1| Methionine gamma-lyase [Candidatus Accumulibacter sp. BA-92]
Length=411

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 43/73 (59%), Gaps = 3/73 (4%)
 Frame = +2

Query  221  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  400
            FGE G VN SI  S+T+T + PE +  +F  E+      F+YSRHFNPT   ++  +  M
Sbjct  15   FGEFGDVNPSITDSSTYTFLSPERMEELFEHEI---EGCFLYSRHFNPTNKYLASALQRM  71

Query  401  EGTEAAYCTASGM  439
            E  E+A   ASGM
Sbjct  72   EDGESAQVMASGM  84



>ref|WP_041496344.1| cystathionine beta-lyase [Nonlabens marinus]
 dbj|BAO55811.1| O-acetylhomoserine sulfhydrylase [Nonlabens marinus S1-08]
Length=401

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 44/73 (60%), Gaps = 3/73 (4%)
 Frame = +2

Query  221  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  400
            FGE GGVN SI  S+T+T +   S + MF    G  +  ++YSRH  P+ L +   +AAM
Sbjct  18   FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNADGCYLYSRHSTPSNLYLGEALAAM  74

Query  401  EGTEAAYCTASGM  439
            EGTE A   ASGM
Sbjct  75   EGTETANVAASGM  87



>ref|WP_026711287.1| cystathionine beta-lyase [Flavobacterium filum]
Length=402

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 50/85 (59%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNP  364
            +PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH +P
Sbjct  7    NPADKIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNAEGCYLYSRHSSP  62

Query  365  TVLNVSRLMAAMEGTEAAYCTASGM  439
              L +   +AAMEGTE+A   ASGM
Sbjct  63   MNLYLGEALAAMEGTESANVAASGM  87



>ref|WP_034257843.1| cystathionine beta-lyase [Altibacter lentus]
Length=402

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 49/88 (56%), Gaps = 4/88 (5%)
 Frame = +2

Query  176  MWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRH  355
            M   PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH
Sbjct  1    MAFKPADKIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNAEGCYLYSRH  56

Query  356  FNPTVLNVSRLMAAMEGTEAAYCTASGM  439
              P+ L +   +AAMEGTE A   ASGM
Sbjct  57   TTPSNLYLGEALAAMEGTETANVAASGM  84



>ref|WP_043567506.1| cystathionine beta-lyase [Candidatus Accumulibacter sp. BA-93]
 gb|EXI87427.1| Methionine gamma-lyase [Candidatus Accumulibacter sp. BA-93]
Length=402

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 43/73 (59%), Gaps = 3/73 (4%)
 Frame = +2

Query  221  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  400
            FGE G VN SI  S+T+T + PE +  +F  E+      F+YSRHFNPT   ++  +  M
Sbjct  15   FGEFGDVNPSITDSSTYTFLSPERMEELFEHEI---EGCFLYSRHFNPTNKYLASALERM  71

Query  401  EGTEAAYCTASGM  439
            E  E+A   ASGM
Sbjct  72   EDGESAQVMASGM  84



>ref|WP_008991878.1| cystathionine beta-lyase [Galbibacter marinus]
 gb|EKF54929.1| cystathionine beta-lyase [Galbibacter marinus]
Length=399

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 50/88 (57%), Gaps = 4/88 (5%)
 Frame = +2

Query  176  MWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRH  355
            M   PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH
Sbjct  1    MKFKPANNIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNTEGCYLYSRH  56

Query  356  FNPTVLNVSRLMAAMEGTEAAYCTASGM  439
             +P+ L +   +AAME TE A  TASGM
Sbjct  57   SSPSNLYLGEALAAMENTETANVTASGM  84



>ref|WP_008462050.1| cystathionine beta-lyase [Flavobacterium sp. F52]
 gb|EJG03383.1| cystathionine gamma-synthase [Flavobacterium sp. F52]
Length=416

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 52/85 (61%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNP  364
            +PA  +   ++ FGE GGVN SI  S+T+T +  +++   F G +      ++YSRH +P
Sbjct  5    NPADKIQDLQY-FGEFGGVNPSISDSSTYTFLSAKTMFDTFEGNM---EGCYLYSRHSSP  60

Query  365  TVLNVSRLMAAMEGTEAAYCTASGM  439
            + L + + +AAME TE A  +ASGM
Sbjct  61   SNLYLDQALAAMEETETANVSASGM  85



>ref|WP_029294450.1| cystathionine beta-lyase [Chryseobacterium hispalense]
Length=408

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 46/73 (63%), Gaps = 3/73 (4%)
 Frame = +2

Query  221  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  400
            FGE GGVN SI  S+T+T +   S + MF    G  +  ++YSRH +P  L +S+ +A +
Sbjct  16   FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNADGCYLYSRHSSPMNLYLSQALAKL  72

Query  401  EGTEAAYCTASGM  439
            E TEAA  TASGM
Sbjct  73   ENTEAANVTASGM  85



>ref|WP_021778620.1| Cys/Met metabolism PLP-dependent enzyme [Dokdonia sp. MED134]
 gb|EAQ38280.1| Cys/Met metabolism PLP-dependent enzyme [Dokdonia sp. MED134]
Length=404

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 44/73 (60%), Gaps = 3/73 (4%)
 Frame = +2

Query  221  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  400
            FGE GGVN SI  S+T+T +   S + MF    G  +  ++YSRH  P+ L +   +AAM
Sbjct  15   FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNADGCYLYSRHSTPSNLYLGAALAAM  71

Query  401  EGTEAAYCTASGM  439
            EGTE A   ASGM
Sbjct  72   EGTETANVAASGM  84



>ref|WP_026811643.1| cystathionine beta-lyase [Arenibacter latericius]
Length=399

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 44/73 (60%), Gaps = 3/73 (4%)
 Frame = +2

Query  221  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  400
            FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH +P+ L +   +AA+
Sbjct  15   FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNTEGCYLYSRHSSPSNLYLGEALAAL  71

Query  401  EGTEAAYCTASGM  439
            EGTE A  T SGM
Sbjct  72   EGTETANVTGSGM  84



>ref|WP_035334044.1| cystathionine beta-lyase [Dokdonia sp. PRO95]
Length=404

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 44/73 (60%), Gaps = 3/73 (4%)
 Frame = +2

Query  221  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  400
            FGE GGVN SI  S+T+T +   S + MF    G  +  ++YSRH  P+ L +   +AAM
Sbjct  15   FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNADGCYLYSRHSTPSNLYLGAALAAM  71

Query  401  EGTEAAYCTASGM  439
            EGTE A   ASGM
Sbjct  72   EGTETANVAASGM  84



>ref|WP_035325087.1| cystathionine beta-lyase [Dokdonia donghaensis]
 gb|KGO06072.1| cystathionine beta-lyase [Dokdonia donghaensis DSW-1]
Length=404

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 44/73 (60%), Gaps = 3/73 (4%)
 Frame = +2

Query  221  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  400
            FGE GGVN SI  S+T+T +   S + MF    G  +  ++YSRH  P+ L +   +AAM
Sbjct  15   FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNADGCYLYSRHSTPSNLYLGAALAAM  71

Query  401  EGTEAAYCTASGM  439
            EGTE A   ASGM
Sbjct  72   EGTETANVAASGM  84



>ref|WP_044624939.1| cystathionine beta-lyase [Tamlana nanhaiensis]
 gb|KJD34554.1| cystathionine beta-lyase [Tamlana nanhaiensis]
Length=399

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 45/73 (62%), Gaps = 3/73 (4%)
 Frame = +2

Query  221  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  400
            FGE GGVN SI  S+T+T +   S + MF    G  +  ++YSRH +P+ L +   +AAM
Sbjct  15   FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNADGCYLYSRHSSPSNLYLGEALAAM  71

Query  401  EGTEAAYCTASGM  439
            E TE A  TASGM
Sbjct  72   EDTETANVTASGM  84



>ref|WP_013749695.1| cystathionine beta-lyase [Dokdonia sp. 4H-3-7-5]
 gb|AEE18187.1| Cys/Met metabolism pyridoxal-phosphate-dependent protein [Dokdonia 
sp. 4H-3-7-5]
Length=404

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 44/73 (60%), Gaps = 3/73 (4%)
 Frame = +2

Query  221  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  400
            FGE GGVN SI  S+T+T +   S + MF    G  +  ++YSRH  P+ L +   +AAM
Sbjct  15   FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNADGCYLYSRHSTPSNLYLGAALAAM  71

Query  401  EGTEAAYCTASGM  439
            EGTE A   ASGM
Sbjct  72   EGTETANVAASGM  84



>ref|WP_027386160.1| cystathionine beta-lyase [Chryseobacterium gregarium]
Length=408

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 44/73 (60%), Gaps = 3/73 (4%)
 Frame = +2

Query  221  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  400
            FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH +P  L +S  +A M
Sbjct  16   FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNAEGCYLYSRHSSPMNLYLSEALAKM  72

Query  401  EGTEAAYCTASGM  439
            E TEAA  TASGM
Sbjct  73   ENTEAANVTASGM  85



>ref|WP_042719927.1| cystathionine beta-lyase [Flavobacterium sp. B17]
Length=408

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 45/73 (62%), Gaps = 3/73 (4%)
 Frame = +2

Query  221  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  400
            FGE GGVN SI  S+T+T +   S + MF    G  +  ++YSRH +P  L +S+ +A M
Sbjct  16   FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNADGCYLYSRHSSPMNLYLSQALAKM  72

Query  401  EGTEAAYCTASGM  439
            E TE A  TASGM
Sbjct  73   ENTETANVTASGM  85



>ref|WP_042244621.1| cystathionine beta-lyase [Jejuia pallidilutea]
 dbj|GAL67901.1| O-acetylhomoserine sulfhydrylase [Jejuia pallidilutea]
 dbj|GAL73160.1| O-acetylhomoserine sulfhydrylase [Jejuia pallidilutea]
 dbj|GAL89345.1| O-acetylhomoserine sulfhydrylase [Jejuia pallidilutea]
Length=401

 Score = 57.8 bits (138),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 52/88 (59%), Gaps = 4/88 (5%)
 Frame = +2

Query  176  MWEDPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRH  355
            M   PA ++   ++ FGE GGVN SI  S+T+T +   S + MF    G  +  ++YSRH
Sbjct  1    MSFKPANSIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNADGCYLYSRH  56

Query  356  FNPTVLNVSRLMAAMEGTEAAYCTASGM  439
             +P+ L +   +AAME TE A  TASGM
Sbjct  57   SSPSNLYLGAALAAMEHTETANVTASGM  84



>ref|WP_034678770.1| cystathionine beta-lyase [Chryseobacterium formosense]
 gb|KFE98207.1| cystathionine beta-lyase [Chryseobacterium formosense]
Length=409

 Score = 57.8 bits (138),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 45/73 (62%), Gaps = 3/73 (4%)
 Frame = +2

Query  221  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  400
            FGE GGVN SI  S+T+T +   S + MF    G  +  ++YSRH +P  L +S+ +A M
Sbjct  16   FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNADGCYLYSRHSSPMNLYLSQALAKM  72

Query  401  EGTEAAYCTASGM  439
            E TE A  TASGM
Sbjct  73   ENTETANVTASGM  85



>ref|WP_039366244.1| cystathionine beta-lyase [Chryseobacterium taiwanense]
 gb|KIC64313.1| cystathionine beta-lyase [Chryseobacterium taiwanense]
Length=408

 Score = 57.4 bits (137),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 45/73 (62%), Gaps = 3/73 (4%)
 Frame = +2

Query  221  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  400
            FGE GGVN SI  S+T+T +   S + MF    G  +  ++YSRH +P  L +S+ +A M
Sbjct  16   FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNADGCYLYSRHSSPMNLYLSQALAKM  72

Query  401  EGTEAAYCTASGM  439
            E TE A  TASGM
Sbjct  73   ENTETANVTASGM  85



>ref|WP_012806995.1| cystathionine beta-lyase [Candidatus Accumulibacter phosphatis]
 gb|ACV33544.1| Cystathionine gamma-synthase [Candidatus Accumulibacter phosphatis 
clade IIA str. UW-1]
Length=406

 Score = 57.4 bits (137),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 43/73 (59%), Gaps = 3/73 (4%)
 Frame = +2

Query  221  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  400
            FGE G VN SI  S+T+T + PE +  +F  E+      F+YSRHFNPT   ++  +  M
Sbjct  15   FGEFGDVNPSITDSSTYTFLSPERMAELFEHEI---EGCFLYSRHFNPTNKYLASALERM  71

Query  401  EGTEAAYCTASGM  439
            E  E+A   ASGM
Sbjct  72   EDGESAQVMASGM  84



>ref|WP_034916156.1| cystathionine beta-lyase [Candidatus Accumulibacter sp. BA-91]
 gb|KFB71714.1| Methionine gamma-lyase [Candidatus Accumulibacter sp. BA-91]
Length=406

 Score = 57.4 bits (137),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 43/73 (59%), Gaps = 3/73 (4%)
 Frame = +2

Query  221  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  400
            FGE G VN SI  S+T+T + PE +  +F  E+      F+YSRHFNPT   ++  +  M
Sbjct  15   FGEFGDVNPSITDSSTYTFLSPERMAELFEHEI---EGCFLYSRHFNPTNKYLASALERM  71

Query  401  EGTEAAYCTASGM  439
            E  E+A   ASGM
Sbjct  72   EDGESAQVMASGM  84



>ref|WP_013188250.1| cystathionine beta-lyase [Croceibacter atlanticus]
 gb|EAP86869.1| Cys/Met metabolism lyase (PLP-dependent) [Croceibacter atlanticus 
HTCC2559]
Length=399

 Score = 57.4 bits (137),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 49/85 (58%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DPAAALASARHEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNP  364
            +PA  +   ++ FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH  P
Sbjct  4    NPADRIQDLQY-FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNAEGCYLYSRHSTP  59

Query  365  TVLNVSRLMAAMEGTEAAYCTASGM  439
            + L +   +AAMEGTE A   A+GM
Sbjct  60   SNLYLGEALAAMEGTETANVAATGM  84



>gb|EXI92773.1| Methionine gamma-lyase [Candidatus Accumulibacter sp. BA-94]
Length=406

 Score = 57.0 bits (136),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 43/73 (59%), Gaps = 3/73 (4%)
 Frame = +2

Query  221  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  400
            FGE G VN SI  S+T+T + PE +  +F  E+      F+YSRHFNPT   ++  +  M
Sbjct  15   FGEFGDVNPSITDSSTYTFLSPERMEELFEHEI---EGCFLYSRHFNPTNKYLASALERM  71

Query  401  EGTEAAYCTASGM  439
            E  ++A   ASGM
Sbjct  72   EDGQSAQVMASGM  84



>ref|WP_034743007.1| cystathionine beta-lyase [Chryseobacterium vrystaatense]
 gb|KFF26183.1| cystathionine beta-lyase [Chryseobacterium vrystaatense]
Length=408

 Score = 57.0 bits (136),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 45/73 (62%), Gaps = 3/73 (4%)
 Frame = +2

Query  221  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  400
            FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH +P  L +++ +A M
Sbjct  16   FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNAEGCYLYSRHSSPMNLYLAQALAKM  72

Query  401  EGTEAAYCTASGM  439
            E TEAA  TASGM
Sbjct  73   ENTEAANVTASGM  85



>ref|WP_034726484.1| cystathionine beta-lyase [Chryseobacterium sp. JM1]
 gb|KFF20948.1| cystathionine beta-lyase [Chryseobacterium sp. JM1]
Length=408

 Score = 57.0 bits (136),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 45/73 (62%), Gaps = 3/73 (4%)
 Frame = +2

Query  221  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  400
            FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH +P  L +++ +A M
Sbjct  16   FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNAEGCYLYSRHSSPMNLYLAQALAKM  72

Query  401  EGTEAAYCTASGM  439
            E TEAA  TASGM
Sbjct  73   ENTEAANVTASGM  85



>ref|WP_034704868.1| cystathionine beta-lyase [Chryseobacterium luteum]
 gb|KFF03604.1| cystathionine beta-lyase [Chryseobacterium luteum]
Length=408

 Score = 57.0 bits (136),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 45/73 (62%), Gaps = 3/73 (4%)
 Frame = +2

Query  221  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  400
            FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH +P  L +++ +A M
Sbjct  16   FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNAEGCYLYSRHSSPMNLYLAQALAKM  72

Query  401  EGTEAAYCTASGM  439
            E TEAA  TASGM
Sbjct  73   ENTEAANVTASGM  85



>ref|WP_040995836.1| cystathionine beta-lyase [Chryseobacterium oranimense]
 emb|CEJ69807.1| Cystathionine gamma-lyase [Chryseobacterium oranimense G311]
Length=408

 Score = 57.0 bits (136),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 45/73 (62%), Gaps = 3/73 (4%)
 Frame = +2

Query  221  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  400
            FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH +P  L +++ +A M
Sbjct  16   FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNAEGCYLYSRHSSPMNLYLAQALAKM  72

Query  401  EGTEAAYCTASGM  439
            E TEAA  TASGM
Sbjct  73   ENTEAANVTASGM  85



>ref|WP_034711020.1| cystathionine beta-lyase [Chryseobacterium soli]
 gb|KFF13169.1| cystathionine beta-lyase [Chryseobacterium soli]
Length=409

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 45/73 (62%), Gaps = 3/73 (4%)
 Frame = +2

Query  221  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  400
            FGE GGVN SI  S+T+T +   S + MF    G  +  ++YSRH +P  L +S+ +A +
Sbjct  16   FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNADGCYLYSRHSSPMNLYLSQALAKL  72

Query  401  EGTEAAYCTASGM  439
            E TE A  TASGM
Sbjct  73   ENTETANVTASGM  85



>ref|WP_041802134.1| cystathionine beta-lyase [Muricauda ruestringensis]
Length=406

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 44/73 (60%), Gaps = 3/73 (4%)
 Frame = +2

Query  221  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  400
            FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH +P+ L +   MA +
Sbjct  15   FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNTEGCYLYSRHSSPSNLYLGEAMAQL  71

Query  401  EGTEAAYCTASGM  439
            EGTE+A   ASGM
Sbjct  72   EGTESANVYASGM  84



>ref|WP_010516575.1| cystathionine beta-lyase [Mesoflavibacter zeaxanthinifaciens]
Length=406

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 45/75 (60%), Gaps = 3/75 (4%)
 Frame = +2

Query  215  HEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMA  394
            H FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH +P+ L +   +A
Sbjct  13   HYFGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNTEGCYLYSRHSSPSNLYLGEALA  69

Query  395  AMEGTEAAYCTASGM  439
            A+E TE+A   ASGM
Sbjct  70   ALEQTESANVYASGM  84



>ref|WP_007842611.1| MULTISPECIES: cystathionine beta-lyase [Chryseobacterium]
 gb|EJL72973.1| cystathionine beta-lyase/cystathionine gamma-synthase [Chryseobacterium 
sp. CF314]
Length=408

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 45/73 (62%), Gaps = 3/73 (4%)
 Frame = +2

Query  221  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  400
            FGE GGVN SI  S+T+T +   S + MF    G  +  ++YSRH +P  L +S+ +A +
Sbjct  16   FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNADGCYLYSRHSSPMNLYLSQALAKL  72

Query  401  EGTEAAYCTASGM  439
            E TE A  TASGM
Sbjct  73   ENTETANVTASGM  85



>ref|WP_020081610.1| cystathionine beta-lyase [Flavobacterium sp. SCGC AAA160-P02]
Length=404

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 44/75 (59%), Gaps = 3/75 (4%)
 Frame = +2

Query  215  HEFGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMA  394
              FGE GGVN SI  S+T+T +  +++   F G     +   +YSRH  P+ + +   +A
Sbjct  13   QNFGEFGGVNPSISDSSTYTFLSAKTMADTFEGN---TDGCHLYSRHTTPSNMFLGEALA  69

Query  395  AMEGTEAAYCTASGM  439
            AMEGTE A  +ASGM
Sbjct  70   AMEGTETANVSASGM  84



>gb|KFF74221.1| cystathionine beta-lyase [Chryseobacterium sp. P1-3]
Length=408

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 45/73 (62%), Gaps = 3/73 (4%)
 Frame = +2

Query  221  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  400
            FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH +P  L +++ +A M
Sbjct  16   FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNAEGCYLYSRHSSPMNLYLAQALAKM  72

Query  401  EGTEAAYCTASGM  439
            E TE+A  TASGM
Sbjct  73   ENTESANVTASGM  85



>gb|AEM72292.1| Cystathionine gamma-lyase [Muricauda ruestringensis DSM 13258]
Length=432

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 44/73 (60%), Gaps = 3/73 (4%)
 Frame = +2

Query  221  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  400
            FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH +P+ L +   MA +
Sbjct  41   FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNTEGCYLYSRHSSPSNLYLGEAMAQL  97

Query  401  EGTEAAYCTASGM  439
            EGTE+A   ASGM
Sbjct  98   EGTESANVYASGM  110



>dbj|BAP30620.1| putative methionine gamma-lyase [Chryseobacterium sp. StRB126]
Length=410

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 45/73 (62%), Gaps = 3/73 (4%)
 Frame = +2

Query  221  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  400
            FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH +P  L +++ +A M
Sbjct  18   FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNAEGCYLYSRHSSPMNLYLAQALAKM  74

Query  401  EGTEAAYCTASGM  439
            E TE+A  TASGM
Sbjct  75   ENTESANVTASGM  87



>ref|WP_002980746.1| cystathionine beta-lyase [Chryseobacterium gleum]
 gb|EFK35586.1| Cys/Met metabolism PLP-dependent enzyme [Chryseobacterium gleum 
ATCC 35910]
Length=409

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 45/73 (62%), Gaps = 3/73 (4%)
 Frame = +2

Query  221  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  400
            FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH +P  L +++ +A M
Sbjct  16   FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNAEGCYLYSRHSSPMNLYLAQALAKM  72

Query  401  EGTEAAYCTASGM  439
            E TE+A  TASGM
Sbjct  73   ENTESANVTASGM  85



>ref|WP_034695275.1| cystathionine beta-lyase [Chryseobacterium sp. CF365]
Length=409

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 45/73 (62%), Gaps = 3/73 (4%)
 Frame = +2

Query  221  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  400
            FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH +P  L +++ +A M
Sbjct  16   FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNAEGCYLYSRHSSPMNLYLAQALAKM  72

Query  401  EGTEAAYCTASGM  439
            E TE+A  TASGM
Sbjct  73   ENTESANVTASGM  85



>ref|WP_034685460.1| cystathionine beta-lyase [Chryseobacterium piperi]
 gb|KFF25604.1| cystathionine beta-lyase [Chryseobacterium piperi]
Length=408

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 45/73 (62%), Gaps = 3/73 (4%)
 Frame = +2

Query  221  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  400
            FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH +P  L +++ +A +
Sbjct  16   FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNAEGCYLYSRHSSPMNLYLAQALAKL  72

Query  401  EGTEAAYCTASGM  439
            E TEAA  TASGM
Sbjct  73   ENTEAANVTASGM  85



>ref|WP_027373193.1| cystathionine beta-lyase [Chryseobacterium sp. UNC8MFCol]
Length=408

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 45/73 (62%), Gaps = 3/73 (4%)
 Frame = +2

Query  221  FGEHGGVNMSIEASATFTVMEPESLRRMFSGELGPDNDYFIYSRHFNPTVLNVSRLMAAM  400
            FGE GGVN SI  S+T+T +   S + MF    G     ++YSRH +P  L +++ +A M
Sbjct  16   FGEFGGVNPSISDSSTYTFL---SAKTMFDTFEGNAEGCYLYSRHSSPMNLYLAQALAKM  72

Query  401  EGTEAAYCTASGM  439
            E TE+A  TASGM
Sbjct  73   ENTESANVTASGM  85



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 560109397860