BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002A12

Length=358
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KCW74122.1|  hypothetical protein EUGRSUZ_E027582                  45.8    3e-04   Eucalyptus grandis [rose gum]
ref|XP_008383618.1|  PREDICTED: CBL-interacting serine/threonine-...  48.5    4e-04   
ref|XP_009352757.1|  PREDICTED: CBL-interacting serine/threonine-...  48.1    5e-04   Pyrus x bretschneideri [bai li]
ref|XP_008383619.1|  PREDICTED: CBL-interacting serine/threonine-...  47.8    6e-04   
ref|XP_009352756.1|  PREDICTED: CBL-interacting serine/threonine-...  47.8    7e-04   Pyrus x bretschneideri [bai li]
ref|XP_008345915.1|  PREDICTED: CBL-interacting protein kinase 5-...  47.8    8e-04   
ref|XP_008371484.1|  PREDICTED: LOW QUALITY PROTEIN: CBL-interact...  47.8    8e-04   
ref|NP_001148053.1|  CBL-interacting serine/threonine-protein kin...  47.4    9e-04   Zea mays [maize]



>gb|KCW74122.1| hypothetical protein EUGRSUZ_E027582, partial [Eucalyptus grandis]
Length=77

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 18/26 (69%), Positives = 22/26 (85%), Gaps = 0/26 (0%)
 Frame = +1

Query  280  EKGAMLMHKYQIGRFLGQGMFAKVYH  357
            +KG  LMH+Y++GR LGQG FAKVYH
Sbjct  3    KKGVTLMHRYEVGRLLGQGTFAKVYH  28



>ref|XP_008383618.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 20-like 
isoform X1 [Malus domestica]
Length=470

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  256  SDTMAAKMEKGAMLMHKYQIGRFLGQGMFAKVYH  357
            S+  + +M+KG +LMHKY++GR LG+G FAKVYH
Sbjct  6    SEEKSMEMKKGNILMHKYELGRLLGKGTFAKVYH  39



>ref|XP_009352757.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 20-like 
isoform X2 [Pyrus x bretschneideri]
Length=461

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 19/27 (70%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  277  MEKGAMLMHKYQIGRFLGQGMFAKVYH  357
            M+KG +LMHKY++GR LG+G FAKVYH
Sbjct  1    MKKGNILMHKYELGRLLGKGTFAKVYH  27



>ref|XP_008383619.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 20-like 
isoform X2 [Malus domestica]
Length=458

 Score = 47.8 bits (112),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 19/27 (70%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  277  MEKGAMLMHKYQIGRFLGQGMFAKVYH  357
            M+KG +LMHKY++GR LG+G FAKVYH
Sbjct  1    MKKGNILMHKYELGRLLGKGTFAKVYH  27



>ref|XP_009352756.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 20-like 
isoform X1 [Pyrus x bretschneideri]
Length=473

 Score = 47.8 bits (112),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +1

Query  256  SDTMAAKMEKGAMLMHKYQIGRFLGQGMFAKVYH  357
            S+    +M+KG +LMHKY++GR LG+G FAKVYH
Sbjct  6    SEEKGMEMKKGNILMHKYELGRLLGKGTFAKVYH  39



>ref|XP_008345915.1| PREDICTED: CBL-interacting protein kinase 5-like [Malus domestica]
Length=463

 Score = 47.8 bits (112),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 18/28 (64%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +1

Query  274  KMEKGAMLMHKYQIGRFLGQGMFAKVYH  357
            +++KG +LMHKY++GR LG+G FAKVYH
Sbjct  2    EVKKGNILMHKYEVGRLLGKGTFAKVYH  29



>ref|XP_008371484.1| PREDICTED: LOW QUALITY PROTEIN: CBL-interacting protein kinase 
5 [Malus domestica]
Length=463

 Score = 47.8 bits (112),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 18/28 (64%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +1

Query  274  KMEKGAMLMHKYQIGRFLGQGMFAKVYH  357
            +++KG +LMHKY++GR LG+G FAKVYH
Sbjct  2    EVKKGNILMHKYEVGRLLGKGTFAKVYH  29



>ref|NP_001148053.1| CBL-interacting serine/threonine-protein kinase 15 [Zea mays]
 ref|XP_008667940.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 15 
isoform X1 [Zea mays]
 gb|ACG29598.1| CBL-interacting serine/threonine-protein kinase 15 [Zea mays]
 tpg|DAA41758.1| TPA: putative CBL-interacting protein kinase family protein isoform 
1 [Zea mays]
 tpg|DAA41759.1| TPA: putative CBL-interacting protein kinase family protein isoform 
2 [Zea mays]
Length=463

 Score = 47.4 bits (111),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 19/31 (61%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +1

Query  265  MAAKMEKGAMLMHKYQIGRFLGQGMFAKVYH  357
            MA   ++  +LMHKY++GR LGQG FAKVYH
Sbjct  7    MAGHNKRNIILMHKYEMGRLLGQGTFAKVYH  37



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 565659253830