BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002A09

Length=383
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_003551292.2|  PREDICTED: histone H4-like                         164   1e-48   
ref|XP_007027068.1|  Histone superfamily protein isoform 2              160   4e-47   
ref|XP_004294578.1|  PREDICTED: histone H4-like                         160   4e-47   Fragaria vesca subsp. vesca
gb|KJB21638.1|  hypothetical protein B456_004G005600                    160   4e-47   Gossypium raimondii
gb|AFW80115.1|  hypothetical protein ZEAMMB73_313798                    161   9e-47   
gb|EMT31824.1|  Histone H4                                              159   9e-47   
gb|ACG30677.1|  histone H4                                              159   1e-46   Zea mays [maize]
dbj|BAJ94028.1|  predicted protein                                      157   1e-46   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB18225.1|  hypothetical protein B456_003G040200                    159   1e-46   Gossypium raimondii
gb|KCW52694.1|  hypothetical protein EUGRSUZ_J02062                     157   1e-46   Eucalyptus grandis [rose gum]
gb|ACG31455.1|  histone H4                                              157   1e-46   Zea mays [maize]
gb|AFW82272.1|  histone H4.3                                            157   1e-46   
ref|XP_002862282.1|  hypothetical protein ARALYDRAFT_497532             157   1e-46   
gb|ACG30835.1|  histone H4                                              157   1e-46   Zea mays [maize]
ref|XP_007133241.1|  hypothetical protein PHAVU_011G163600g             157   1e-46   Phaseolus vulgaris [French bean]
gb|KJB20142.1|  hypothetical protein B456_003G134900                    157   2e-46   Gossypium raimondii
ref|XP_007009617.1|  Histone superfamily protein                        157   2e-46   
gb|ACG31208.1|  histone H4                                              157   2e-46   Zea mays [maize]
ref|XP_010913656.1|  PREDICTED: histone H4-like                         157   2e-46   Elaeis guineensis
ref|NP_180441.1|  histone H4                                            157   2e-46   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB71814.1|  histone H4                                             157   2e-46   Citrus jambhiri [citronelle]
ref|XP_008371481.1|  PREDICTED: histone H4                              157   2e-46   Malus domestica [apple tree]
gb|ACG45974.1|  histone H4                                              157   2e-46   Zea mays [maize]
gb|ACG31067.1|  histone H4                                              157   2e-46   Zea mays [maize]
gb|ACG30729.1|  histone H4                                              157   2e-46   Zea mays [maize]
gb|ABD62753.1|  histone 4                                               157   2e-46   Elaeis guineensis
gb|AAT08725.1|  histone H4                                              157   2e-46   Hyacinthus orientalis [common hyacinth]
gb|ACX50406.1|  histone H4                                              157   2e-46   Eriobotrya japonica [loquat]
sp|P62786.2|H42_WHEAT  RecName: Full=Histone H4 variant TH091           157   2e-46   Triticum aestivum [Canadian hard winter wheat]
gb|KDP44162.1|  hypothetical protein JCGZ_05629                         157   2e-46   Jatropha curcas
ref|XP_006388511.1|  hypothetical protein POPTR_0168s00200g             159   2e-46   
gb|EMT13182.1|  Histone H4                                              157   2e-46   
prf||1101277A  histone H4                                               157   2e-46
gb|ACG31293.1|  histone H4                                              157   2e-46   Zea mays [maize]
gb|KDO73016.1|  hypothetical protein CISIN_1g047769mg                   158   2e-46   Citrus sinensis [apfelsine]
gb|ACD76815.1|  histone 4                                               157   2e-46   Capsella bursa-pastoris
gb|EYU41919.1|  hypothetical protein MIMGU_mgv1a024124mg                157   2e-46   Erythranthe guttata [common monkey flower]
ref|XP_004970498.1|  PREDICTED: histone H4-like isoform X2              157   2e-46   
gb|KJB83786.1|  hypothetical protein B456_013G264400                    159   2e-46   Gossypium raimondii
gb|ACG31227.1|  histone H4                                              157   2e-46   Zea mays [maize]
ref|WP_039311122.1|  hypothetical protein                               156   2e-46   
ref|XP_011087009.1|  PREDICTED: histone H4-like                         157   2e-46   
ref|XP_007133245.1|  hypothetical protein PHAVU_011G164000g             157   2e-46   Phaseolus vulgaris [French bean]
gb|AHV84766.1|  histone 4                                               156   2e-46   Codiaeum variegatum [garden croton]
ref|WP_033581588.1|  hypothetical protein                               156   2e-46   Dickeya zeae
tpg|DAA40122.1|  TPA: histone H4.3                                      161   3e-46   
gb|ACG36136.1|  histone H4                                              157   3e-46   Zea mays [maize]
gb|EMS66043.1|  Histone H4                                              157   3e-46   Triticum urartu
gb|AHL19852.1|  histone 4                                               157   3e-46   Plantago lanceolata [ribgrass]
ref|XP_001416024.1|  predicted protein                                  156   3e-46   Ostreococcus lucimarinus CCE9901
ref|XP_006604532.1|  PREDICTED: histone H4-like                         158   3e-46   Glycine max [soybeans]
ref|XP_005354994.1|  PREDICTED: histone H4-like isoform X1              157   3e-46   
sp|P82888.2|H4_OLILU  RecName: Full=Histone H4                          156   3e-46   Olisthodiscus luteus
ref|XP_008385199.1|  PREDICTED: histone H4-like                         156   3e-46   Malus domestica [apple tree]
ref|XP_004251290.1|  PREDICTED: histone H4-like                         156   3e-46   Solanum lycopersicum
ref|XP_004336819.1|  histone H4, putative                               156   4e-46   Acanthamoeba castellanii str. Neff
gb|KHN23497.1|  Histone H4                                              158   4e-46   Glycine soja [wild soybean]
gb|KIY91537.1|  Histone H4                                              156   4e-46   Monoraphidium neglectum
ref|XP_008394212.1|  PREDICTED: histone H4-like                         157   4e-46   
ref|XP_004019372.1|  PREDICTED: histone H4-like                         157   4e-46   
ref|XP_010186634.1|  PREDICTED: histone H4-like isoform X2              156   4e-46   Mesitornis unicolor
emb|CAF87814.1|  unnamed protein product                                156   4e-46   Tetraodon nigroviridis
gb|ACG25493.1|  histone H4                                              156   4e-46   Zea mays [maize]
gb|EFB21580.1|  hypothetical protein PANDA_016833                       156   4e-46   Ailuropoda melanoleuca
ref|XP_010093858.1|  Histone H4                                         157   4e-46   
gb|ACG36021.1|  histone H4                                              156   4e-46   Zea mays [maize]
gb|EOB06757.1|  Histone H4                                              156   4e-46   Anas platyrhynchos [duck]
ref|XP_006292004.1|  hypothetical protein CARUB_v10018191mg             157   4e-46   
gb|EMC86813.1|  Histone H4                                              156   5e-46   
ref|XP_002928591.1|  PREDICTED: histone H4-like                         156   5e-46   
gb|EMC89188.1|  Histone H4                                              156   5e-46   
emb|CAB01913.1|  Histone H4 homologue                                   156   5e-46   Sesbania rostrata
ref|NP_001234118.1|  histone H4                                         156   5e-46   Solanum lycopersicum
gb|EMS59070.1|  Histone H4                                              156   5e-46   Triticum urartu
ref|XP_009600594.1|  PREDICTED: histone H4-like                         156   5e-46   Nicotiana tomentosiformis
ref|XP_008055796.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    162   5e-46   Carlito syrichta
ref|XP_010854387.1|  PREDICTED: histone H4-like                         156   5e-46   Bison bison bison
gb|EFB20853.1|  hypothetical protein PANDA_018545                       156   5e-46   Ailuropoda melanoleuca
gb|EMC89184.1|  Histone H4                                              156   5e-46   
dbj|BAD27407.1|  histone H4                                             155   5e-46   Lactuca sativa [cultivated lettuce]
ref|XP_011234700.1|  PREDICTED: histone H4-like                         156   5e-46   
ref|XP_008262729.1|  PREDICTED: histone H4-like                         155   5e-46   
ref|XP_010829397.1|  PREDICTED: histone H4-like                         156   5e-46   Bison bison bison
gb|EHB12217.1|  Histone H4                                              155   5e-46   Heterocephalus glaber [naked mole rat]
emb|CAF93557.1|  unnamed protein product                                155   5e-46   Tetraodon nigroviridis
ref|XP_006733830.1|  PREDICTED: histone H4-like isoform X2              156   6e-46   Leptonychotes weddellii
gb|EOB06745.1|  Histone H4                                              155   6e-46   Anas platyrhynchos [duck]
emb|CBJ33198.1|  histone H4                                             155   6e-46   Ectocarpus siliculosus
ref|XP_008691182.1|  PREDICTED: histone H4-like                         156   6e-46   Ursus maritimus [white bear]
ref|XP_003422329.2|  PREDICTED: histone H4-like                         156   6e-46   
ref|XP_009556893.1|  PREDICTED: histone H4-like                         155   6e-46   Cuculus canorus
gb|KHN02424.1|  Histone H4                                              155   6e-46   Glycine soja [wild soybean]
ref|XP_004899300.1|  PREDICTED: histone H4-like                         156   6e-46   
gb|EMT17606.1|  Histone H4                                              155   6e-46   
ref|XP_006162773.1|  PREDICTED: histone H4-like                         155   6e-46   Tupaia chinensis
ref|XP_010357626.1|  PREDICTED: histone H4-like                         155   6e-46   Rhinopithecus roxellana
gb|EFB20867.1|  hypothetical protein PANDA_018564                       155   6e-46   Ailuropoda melanoleuca
gb|EFB20862.1|  hypothetical protein PANDA_018556                       155   6e-46   Ailuropoda melanoleuca
gb|ELV13477.1|  Histone H4                                              155   6e-46   Tupaia chinensis
gb|EFB20846.1|  hypothetical protein PANDA_018537                       155   6e-46   Ailuropoda melanoleuca
pdb|3A6N|B  Chain B, The Nucleosome Containing A Testis-Specific ...    155   6e-46   Homo sapiens [man]
pdb|1KX3|B  Chain B, X-Ray Structure Of The Nucleosome Core Parti...    155   6e-46   Xenopus laevis [clawed frog]
gb|AAX36141.1|  histone 2 H4                                            155   7e-46   synthetic construct
ref|XP_010856115.1|  PREDICTED: histone H4-like                         155   7e-46   Bison bison bison
ref|NP_001099176.1|  histone 1, H4, like                                155   7e-46   
ref|XP_006888736.1|  PREDICTED: histone H4-like                         156   7e-46   Elephantulus edwardii [Cape long-eared elephant shrew]
gb|ACR38890.1|  histone H4                                              155   7e-46   Apopellia endiviifolia (species B)
ref|XP_010032258.1|  PREDICTED: histone H4-like                         159   7e-46   Eucalyptus grandis [rose gum]
sp|Q9U7D0.3|H4_MASBA  RecName: Full=Histone H4                          155   7e-46   Mastigamoeba balamuthi
ref|XP_006162705.1|  PREDICTED: histone H4-like                         155   7e-46   
gb|AAI15450.1|  Hist2h4 protein                                         155   7e-46   Mus musculus [mouse]
ref|XP_007107816.1|  PREDICTED: histone H4-like isoform X1              155   7e-46   
emb|CDS27542.1|  histone H4                                             155   7e-46   Hymenolepis microstoma
ref|XP_005197380.2|  PREDICTED: histone H4                              155   7e-46   
gb|ACO14931.1|  Histone H4                                              155   7e-46   Caligus clemensi
ref|XP_001657280.1|  AAEL003863-PA                                      155   7e-46   
ref|XP_003967846.1|  PREDICTED: histone H4-like                         155   7e-46   
pdb|3C1B|B  Chain B, The Effect Of H3 K79 Dimethylation And H4 K2...    155   7e-46   Xenopus laevis [clawed frog]
emb|CAF88836.1|  unnamed protein product                                155   7e-46   Tetraodon nigroviridis
ref|XP_009017686.1|  hypothetical protein HELRODRAFT_172808             156   7e-46   Helobdella robusta
ref|XP_008401317.1|  PREDICTED: histone H4-like                         156   7e-46   Poecilia reticulata
gb|EDL32536.1|  mCG17007                                                155   7e-46   Mus musculus [mouse]
ref|XP_002999295.1|  histone H4                                         155   7e-46   Phytophthora infestans T30-4
ref|NP_003529.1|  histone H4                                            155   7e-46   Homo sapiens [man]
ref|XP_007509432.1|  histone H4                                         155   7e-46   Bathycoccus prasinos
ref|XP_003972557.1|  PREDICTED: histone H4-like                         157   7e-46   
gb|EMS63411.1|  Histone H4                                              156   7e-46   Triticum urartu
ref|XP_002965743.1|  hypothetical protein SELMODRAFT_167497             155   7e-46   Selaginella moellendorffii
ref|XP_003768761.1|  PREDICTED: histone H4-like                         156   8e-46   
gb|AAG25601.1|AF297469_1  histone H4                                    155   8e-46   Schistosoma mansoni
gb|KJB61885.1|  hypothetical protein B456_009G393400                    157   8e-46   Gossypium raimondii
gb|EHJ66726.1|  putative germinal histone H4 protein                    157   8e-46   
ref|XP_001865168.1|  histone 1                                          156   8e-46   Culex quinquefasciatus
ref|XP_009929443.1|  PREDICTED: LOW QUALITY PROTEIN: histone H4-like    156   8e-46   Opisthocomus hoazin [hoatzin]
ref|XP_004599995.1|  PREDICTED: histone H4-like                         155   8e-46   Ochotona princeps [southern American pika]
gb|KFZ49305.1|  Histone H4                                              155   8e-46   Antrostomus carolinensis
ref|XP_004778831.1|  PREDICTED: histone H4-like                         156   8e-46   
pdb|2HUE|C  Chain C, Structure Of The H3-h4 Chaperone Asf1 Bound ...    155   8e-46   Xenopus laevis [clawed frog]
ref|XP_005447443.1|  PREDICTED: histone H4-like                         155   8e-46   
ref|XP_010174840.1|  PREDICTED: histone H4-like                         155   8e-46   Antrostomus carolinensis
ref|XP_002045951.1|  GM19606                                            155   8e-46   Drosophila sechellia
tpg|DAA23827.1|  TPA: histone cluster 1, H4j-like                       157   8e-46   Bos taurus [bovine]
dbj|BAE97420.1|  histone H4                                             155   8e-46   Cucumis sativus [cucumbers]
ref|XP_009638184.1|  PREDICTED: histone H4-like                         155   8e-46   Egretta garzetta
gb|EFB20879.1|  hypothetical protein PANDA_018576                       155   8e-46   Ailuropoda melanoleuca
ref|NP_524352.1|  histone H4 replacement, isoform C                     155   8e-46   Drosophila melanogaster
pdb|3AZL|B  Chain B, Crystal Structure Of Human Nucleosome Core P...    155   8e-46   Homo sapiens [man]
ref|XP_009288417.1|  PREDICTED: histone H4-like                         157   8e-46   
gb|EUB54305.1|  Histone H4                                              157   8e-46   Echinococcus granulosus
ref|XP_009081497.1|  PREDICTED: histone H4                              155   8e-46   Acanthisitta chloris
ref|XP_005039664.1|  PREDICTED: histone H4-like                         157   8e-46   
ref|XP_001865499.1|  histone 4                                          155   8e-46   Culex quinquefasciatus
ref|XP_005809247.1|  PREDICTED: histone H4-like                         155   8e-46   
ref|XP_007575252.1|  PREDICTED: histone H4-like                         156   8e-46   Poecilia formosa
ref|XP_003942034.2|  PREDICTED: histone H4                              156   8e-46   Saimiri boliviensis boliviensis
gb|AIC55397.1|  HIST1H4H                                                155   8e-46   synthetic construct
gb|EHH18017.1|  Histone H4                                              155   8e-46   Macaca mulatta [rhesus macaque]
pdb|2PYO|B  Chain B, Drosophila Nucleosome Core                         155   8e-46   Drosophila melanogaster
gb|EFB21587.1|  hypothetical protein PANDA_016840                       155   8e-46   Ailuropoda melanoleuca
gb|ABV25909.1|  histone H4                                              155   8e-46   Ruditapes philippinarum [Japanese littleneck]
gb|AFY26254.1|  histone H4                                              155   8e-46   Plectorhinchus mediterraneus
ref|XP_005515123.1|  PREDICTED: histone H4-like                         155   8e-46   
ref|XP_005431671.1|  PREDICTED: histone H4-like                         155   9e-46   Geospiza fortis
pdb|3W99|B  Chain B, Crystal Structure Of Human Nucleosome Core P...    155   9e-46   Homo sapiens [man]
emb|CCA15305.1|  AlNc14C10G1266                                         155   9e-46   Albugo laibachii Nc14
gb|AAI15447.1|  Hist1h4f protein                                        155   9e-46   Mus musculus [mouse]
ref|XP_004088801.1|  PREDICTED: histone H4-like                         156   9e-46   
gb|ACG30828.1|  histone H4                                              155   9e-46   Zea mays [maize]
ref|XP_006890704.1|  PREDICTED: histone H4-like                         154   9e-46   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_004085100.1|  PREDICTED: histone H4-like                         155   9e-46   
gb|ELR58906.1|  hypothetical protein M91_11360                          156   9e-46   Bos mutus
ref|XP_004406590.1|  PREDICTED: histone H4-like                         156   9e-46   
ref|XP_003770487.1|  PREDICTED: histone H4-like                         155   9e-46   
emb|CBM82432.1|  histone H4-I protein                                   155   9e-46   Rhabdopleura compacta
pdb|3KWQ|B  Chain B, Structural Characterization Of H3k56q Nucleo...    154   9e-46   Xenopus laevis [clawed frog]
ref|XP_004670884.1|  PREDICTED: histone H4-like isoform X2              155   9e-46   
ref|XP_008653038.1|  PREDICTED: histone H4-like                         158   9e-46   
ref|XP_005553930.1|  PREDICTED: histone H4-like                         156   9e-46   
gb|KFR08207.1|  Histone H4                                              155   9e-46   Nipponia nippon
gb|KFO74449.1|  Histone H4                                              155   9e-46   Cuculus canorus
sp|Q6WV74.3|H4_MYTCH  RecName: Full=Histone H4                          155   9e-46   Mytilus chilensis
ref|XP_008830098.1|  PREDICTED: histone H4-like                         156   9e-46   Nannospalax galili
ref|XP_001997928.1|  GH12997                                            155   1e-45   Drosophila grimshawi
ref|NP_001288381.1|  histone H4                                         155   1e-45   Zea mays [maize]
ref|XP_004500224.1|  PREDICTED: histone H4-like                         155   1e-45   
pdb|2NQB|B  Chain B, Drosophila Nucleosome Structure                    155   1e-45   Drosophila melanogaster
ref|XP_002045379.1|  GM19760                                            155   1e-45   Drosophila sechellia
gb|ACO14889.1|  Histone H4                                              155   1e-45   Caligus clemensi
ref|XP_009976860.1|  PREDICTED: histone H4-like                         155   1e-45   Tauraco erythrolophus
ref|XP_002045100.1|  GM19733                                            154   1e-45   Drosophila sechellia
ref|XP_001619043.1|  hypothetical protein NEMVEDRAFT_v1g227759          155   1e-45   Nematostella vectensis
gb|AAI28106.1|  HIST2H4B protein                                        155   1e-45   Homo sapiens [man]
ref|XP_007971592.1|  PREDICTED: histone H4-like                         156   1e-45   Chlorocebus sabaeus
ref|XP_006872834.1|  PREDICTED: histone H4-like                         155   1e-45   Chrysochloris asiatica
ref|XP_003581994.2|  PREDICTED: histone H4                              157   1e-45   
ref|XP_009150050.1|  PREDICTED: histone H4                              155   1e-45   Brassica rapa
ref|XP_005905833.1|  PREDICTED: histone H4-like                         155   1e-45   Bos mutus
gb|KFM02258.1|  Histone H4                                              155   1e-45   Aptenodytes forsteri
gb|EPQ09434.1|  Histone H4                                              155   1e-45   Myotis brandtii
gb|KFW77911.1|  Histone H4                                              154   1e-45   Manacus vitellinus
ref|XP_010409233.1|  PREDICTED: histone H4-like                         155   1e-45   Corvus cornix cornix
ref|XP_009638177.1|  PREDICTED: histone H4-like                         155   1e-45   Egretta garzetta
ref|XP_003746295.1|  PREDICTED: uncharacterized protein LOC100903522    160   1e-45   
ref|XP_009927541.1|  PREDICTED: histone H4                              154   1e-45   Haliaeetus albicilla
ref|XP_002430908.1|  histone H4, putative                               155   1e-45   Pediculus humanus corporis [human body lice]
gb|EFB20858.1|  hypothetical protein PANDA_018552                       155   1e-45   Ailuropoda melanoleuca
ref|XP_003770632.1|  PREDICTED: histone H4-like                         156   1e-45   
ref|XP_006810721.1|  PREDICTED: histone H4-like                         155   1e-45   Neolamprologus brichardi [lyretail cichlid]
gb|AAS17527.1|  histone H4.1                                            155   1e-45   Bos grunniens [yak]
gb|KFU99743.1|  Histone H4                                              155   1e-45   Tauraco erythrolophus
ref|XP_004043433.1|  PREDICTED: histone H4-like                         155   1e-45   
ref|XP_006872873.1|  PREDICTED: histone H4-like isoform X2              155   1e-45   Chrysochloris asiatica
ref|XP_006648942.1|  PREDICTED: histone H4 variant TH011-like           157   1e-45   Oryza brachyantha
ref|XP_010483643.1|  PREDICTED: histone H4-like                         155   1e-45   Camelina sativa [gold-of-pleasure]
ref|XP_002045915.1|  GM13181                                            155   1e-45   Drosophila sechellia
gb|AGS78022.1|  histone H4                                              154   1e-45   Schmidtea mediterranea [freshwater planarian]
ref|XP_001865498.1|  Histone H4                                         155   1e-45   Culex quinquefasciatus
ref|XP_008808353.1|  PREDICTED: histone H4-like                         157   1e-45   Phoenix dactylifera
ref|XP_001498258.2|  PREDICTED: histone H4-like                         157   1e-45   
ref|XP_001997886.1|  GH24367                                            154   1e-45   Drosophila grimshawi
gb|ACG36906.1|  histone H4                                              155   1e-45   Zea mays [maize]
emb|CAA56154.1|  histone H4                                             155   1e-45   Lolium temulentum
ref|XP_006125956.1|  PREDICTED: histone H4-like isoform X1              155   1e-45   
gb|EAW55528.1|  histone 1, H4c                                          155   1e-45   Homo sapiens [man]
ref|XP_002422631.1|  histone H4, putative                               155   1e-45   Pediculus humanus corporis [human body lice]
gb|EFB21599.1|  hypothetical protein PANDA_016906                       155   1e-45   Ailuropoda melanoleuca
gb|KFP16829.1|  Histone H4                                              155   1e-45   Egretta garzetta
ref|XP_011278078.1|  PREDICTED: histone H4-like                         154   1e-45   
ref|XP_009892680.1|  PREDICTED: histone H4-like                         155   1e-45   Charadrius vociferus
pdb|1P3P|B  Chain B, Crystallographic Studies Of Nucleosome Core ...    155   1e-45   Xenopus laevis [clawed frog]
ref|XP_001983122.1|  GG21374                                            155   1e-45   
ref|XP_006650981.1|  PREDICTED: histone H4 variant TH011-like           157   1e-45   
ref|XP_009126676.1|  PREDICTED: histone H4                              155   1e-45   Brassica rapa
ref|XP_010093859.1|  Histone H4                                         155   1e-45   Morus notabilis
ref|XP_006988975.1|  PREDICTED: histone H4-like                         154   1e-45   
ref|XP_008668988.1|  PREDICTED: histone H4-like                         157   1e-45   
ref|XP_005773457.1|  hypothetical protein EMIHUDRAFT_435795             157   1e-45   Emiliania huxleyi CCMP1516
pdb|1AOI|B  Chain B, Complex Between Nucleosome Core Particle (H3...    154   1e-45   Xenopus laevis [clawed frog]
ref|XP_006817031.1|  PREDICTED: histone H4-like                         155   1e-45   Saccoglossus kowalevskii
ref|XP_001618258.1|  hypothetical protein NEMVEDRAFT_v1g155159          155   1e-45   Nematostella vectensis
ref|XP_006872940.1|  PREDICTED: histone H4-like                         155   1e-45   Chrysochloris asiatica
ref|XP_009590447.1|  PREDICTED: uncharacterized protein LOC104087621    158   1e-45   
gb|AHV84765.1|  histone 4                                               154   1e-45   Tecoma stans
ref|XP_009017682.1|  hypothetical protein HELRODRAFT_172804             155   1e-45   Helobdella robusta
ref|XP_009638182.1|  PREDICTED: histone H4-like                         155   1e-45   Egretta garzetta
gb|ABK23845.1|  unknown                                                 155   1e-45   Picea sitchensis
ref|XP_010841748.1|  PREDICTED: uncharacterized protein LOC104991099    162   1e-45   Bison bison bison
ref|XP_007133251.1|  hypothetical protein PHAVU_011G164600g             159   1e-45   Phaseolus vulgaris [French bean]
ref|XP_003542580.2|  PREDICTED: histone H4-like                         156   1e-45   
ref|XP_003979641.1|  PREDICTED: uncharacterized protein LOC101077311    161   1e-45   
ref|XP_001967748.1|  GF18983                                            155   1e-45   
ref|XP_002430913.1|  histone H4, putative                               155   1e-45   Pediculus humanus corporis [human body lice]
ref|XP_007634698.1|  PREDICTED: LOW QUALITY PROTEIN: histone H4 i...    155   2e-45   
ref|XP_008918500.1|  PREDICTED: histone H4-like                         155   2e-45   
gb|EMS67926.1|  Histone H4                                              155   2e-45   Triticum urartu
ref|XP_007132135.1|  hypothetical protein PHAVU_011G069500g             157   2e-45   Phaseolus vulgaris [French bean]
ref|XP_008359709.1|  PREDICTED: LOW QUALITY PROTEIN: histone H4-like    157   2e-45   
gb|ACF24577.1|  histone H4                                              154   2e-45   Gymnochlora stellata
sp|Q41811.3|H43_MAIZE  RecName: Full=Histone H4.3; AltName: Full=HM4    154   2e-45   Zea mays [maize]
gb|KFQ77464.1|  Histone H4                                              154   2e-45   Phaethon lepturus
gb|EGV96121.1|  Histone H4                                              157   2e-45   Cricetulus griseus [Chinese hamsters]
ref|XP_004088815.1|  PREDICTED: histone H4-like                         155   2e-45   
gb|EMS47529.1|  Histone H4                                              154   2e-45   Triticum urartu
gb|EMP31839.1|  Histone H4                                              154   2e-45   Chelonia mydas [green seaturtle]
gb|AHV84767.1|  histone 4                                               154   2e-45   Bauhinia purpurea
ref|XP_006048075.1|  PREDICTED: histone H4-like                         155   2e-45   
ref|XP_009612961.1|  PREDICTED: uncharacterized protein LOC104106174    159   2e-45   Nicotiana tomentosiformis
ref|XP_010287879.1|  PREDICTED: histone H4-like                         154   2e-45   Phaethon lepturus
emb|CAP53873.1|  histone H4                                             154   2e-45   Xenoturbella bocki
gb|AAT94446.1|  RE42129p                                                154   2e-45   Drosophila melanogaster
ref|XP_002595673.1|  hypothetical protein BRAFLDRAFT_200829             154   2e-45   Branchiostoma floridae
ref|XP_009288418.1|  PREDICTED: histone H4-like                         155   2e-45   Aptenodytes forsteri
pdb|3AZN|B  Chain B, Crystal Structure Of Human Nucleosome Core P...    154   2e-45   Homo sapiens [man]
pdb|3AZK|B  Chain B, Crystal Structure Of Human Nucleosome Core P...    154   2e-45   Homo sapiens [man]
pdb|3AZJ|B  Chain B, Crystal Structure Of Human Nucleosome Core P...    154   2e-45   Homo sapiens [man]
pdb|3AZI|B  Chain B, Crystal Structure Of Human Nucleosome Core P...    154   2e-45   Homo sapiens [man]
ref|XP_004899301.1|  PREDICTED: histone H4-like                         155   2e-45   
ref|XP_007074535.1|  PREDICTED: histone H4 variant TH091-like           154   2e-45   
gb|ACG30734.1|  histone H4                                              154   2e-45   Zea mays [maize]
ref|XP_003458510.1|  PREDICTED: histone H4-like                         154   2e-45   
ref|XP_002422633.1|  histone H4, putative                               155   2e-45   
ref|XP_004413720.1|  PREDICTED: histone H4-like                         155   2e-45   
gb|ACO11175.1|  Histone H4                                              154   2e-45   
gb|ACO13070.1|  Histone H4                                              154   2e-45   
ref|XP_008691199.1|  PREDICTED: histone H4-like isoform X2              154   2e-45   
ref|XP_005466488.1|  PREDICTED: histone H4-like                         154   2e-45   
ref|XP_002179286.1|  histone H4 isoform 1b                              154   2e-45   
ref|XP_003405712.1|  PREDICTED: histone H4                              154   2e-45   
gb|ELU03397.1|  hypothetical protein CAPTEDRAFT_219998                  157   2e-45   
ref|XP_009062584.1|  hypothetical protein LOTGIDRAFT_175997             158   2e-45   
ref|XP_001782846.1|  histone H4                                         154   2e-45   
gb|KFO33707.1|  Histone H4                                              155   2e-45   
ref|XP_003502244.1|  PREDICTED: histone H4                              155   2e-45   
gb|KFV65831.1|  Histone H4                                              154   2e-45   
gb|AAH67496.1|  HIST1H4I protein                                        154   2e-45   
ref|XP_004919337.1|  PREDICTED: histone H4-like                         155   2e-45   
ref|XP_009675854.1|  PREDICTED: histone H4                              154   2e-45   
ref|XP_010746486.1|  PREDICTED: uncharacterized protein LOC104932860    159   2e-45   
ref|XP_002816625.2|  PREDICTED: histone H3.1-like                       158   2e-45   
pdb|1P3O|B  Chain B, Crystallographic Studies Of Nucleosome Core ...    154   2e-45   
ref|XP_004534128.1|  PREDICTED: histone H4-like                         154   2e-45   
ref|XP_005553868.1|  PREDICTED: histone H4-like                         155   2e-45   
ref|XP_010978495.1|  PREDICTED: histone H3.1-like                       158   2e-45   
ref|XP_002045696.1|  GM13180                                            154   2e-45   
ref|XP_007885030.1|  PREDICTED: histone H4-like                         154   2e-45   
ref|XP_005515116.1|  PREDICTED: histone H4-like                         154   2e-45   
ref|XP_001967756.1|  GF20391                                            157   2e-45   
ref|XP_002045681.1|  GM16395                                            154   2e-45   
ref|XP_002044750.1|  GM19702                                            154   2e-45   
ref|XP_004788234.1|  PREDICTED: histone H4-like                         154   2e-45   
gb|ACD37542.1|  histone H4                                              154   2e-45   
ref|XP_007965931.1|  PREDICTED: histone H4                              155   2e-45   
ref|XP_003788935.1|  PREDICTED: histone H4-like                         155   2e-45   
gb|EMT30911.1|  Histone H4                                              154   2e-45   
ref|XP_003906095.2|  PREDICTED: histone H4                              155   2e-45   
ref|XP_010322955.1|  PREDICTED: uncharacterized protein LOC101252889    159   2e-45   
ref|XP_005603695.1|  PREDICTED: histone H2A type 1-like                 159   2e-45   
gb|EMS57394.1|  Histone H4                                              154   2e-45   
ref|XP_005570272.1|  PREDICTED: histone H4-like                         155   2e-45   
gb|EJK72475.1|  hypothetical protein THAOC_05990                        154   2e-45   
ref|XP_003746293.1|  PREDICTED: histone H2B.3-like                      158   2e-45   
ref|XP_005337138.1|  PREDICTED: histone H2A type 1-like                 159   2e-45   
ref|XP_010836838.1|  PREDICTED: histone H4-like                         154   3e-45   
ref|NP_001093194.1|  histone H4-like                                    154   3e-45   
ref|XP_005515138.1|  PREDICTED: histone H4-like                         154   3e-45   
ref|XP_005869063.1|  PREDICTED: histone H2A type 1-like                 159   3e-45   
ref|XP_003801940.1|  PREDICTED: histone H4-like                         155   3e-45   
gb|EMT16803.1|  Histone H4                                              155   3e-45   
ref|XP_004621999.1|  PREDICTED: histone H4-like                         154   3e-45   
ref|XP_005643645.1|  histone-fold-containing protein                    154   3e-45   
ref|NP_001070217.1|  uncharacterized protein LOC767782                  154   3e-45   
ref|XP_004432099.1|  PREDICTED: histone H2B type 1-B-like               158   3e-45   
ref|XP_003746444.1|  PREDICTED: histone H2B.3-like                      158   3e-45   
ref|XP_005828578.1|  hypothetical protein GUITHDRAFT_95940              154   3e-45   
ref|XP_004043450.1|  PREDICTED: histone H4-like                         155   3e-45   
gb|EAW55544.1|  histone 1, H4e                                          155   3e-45   
ref|XP_004441813.1|  PREDICTED: histone H2B type 1-like                 158   3e-45   
ref|XP_004898163.1|  PREDICTED: histone H4-like isoform X1              155   3e-45   
ref|XP_004900737.1|  PREDICTED: histone H4-like isoform X1              155   3e-45   
ref|XP_002069353.1|  GK18711                                            154   3e-45   
ref|XP_005189164.1|  PREDICTED: histone H4-like                         154   3e-45   
ref|XP_009777515.1|  PREDICTED: uncharacterized protein LOC104227084    158   3e-45   
ref|XP_006660951.1|  PREDICTED: histone H4 variant TH011-like           154   3e-45   
ref|XP_545430.3|  PREDICTED: histone H2A type 1-E-like                  159   3e-45   
ref|XP_007971661.1|  PREDICTED: histone H4-like                         155   3e-45   
emb|CAD38840.1|  histone h4                                             154   3e-45   
ref|XP_003580388.2|  PREDICTED: uncharacterized protein LOC100841093    159   3e-45   
gb|ELU00307.1|  hypothetical protein CAPTEDRAFT_20749                   157   3e-45   
ref|XP_004670888.1|  PREDICTED: histone H4-like                         154   3e-45   
ref|XP_004441815.1|  PREDICTED: histone H2B type 1-O-like               158   3e-45   
gb|AFY26253.1|  histone H4                                              154   3e-45   
ref|XP_005863142.1|  PREDICTED: histone H2A type 1-like                 158   3e-45   
gb|EWM24676.1|  histone h4                                              154   3e-45   
ref|NP_001157165.1|  histone h4                                         154   3e-45   
gb|KFW77906.1|  Histone H4                                              154   3e-45   
ref|XP_005824936.1|  hypothetical protein GUITHDRAFT_144637             154   4e-45   
ref|XP_010621026.1|  PREDICTED: histone H4-like                         155   4e-45   
ref|NP_001027352.1|  histone H4                                         154   4e-45   
ref|XP_004934045.1|  PREDICTED: histone H4-like                         154   4e-45   
ref|XP_004670960.1|  PREDICTED: histone H3.3 type c-like                157   4e-45   
gb|EMC89193.1|  Histone H4                                              153   4e-45   
ref|XP_003725104.1|  PREDICTED: histone H4-like                         154   4e-45   
gb|KDO17679.1|  histone H4                                              154   4e-45   
ref|XP_008614758.1|  histone H4                                         154   4e-45   
gb|EWM29620.1|  histone h4                                              154   4e-45   
ref|XP_008811314.1|  PREDICTED: uncharacterized protein LOC103722506    157   4e-45   
gb|KFV65824.1|  Histone H4                                              154   4e-45   
ref|XP_006045700.1|  PREDICTED: histone H2A type 1-D-like               158   4e-45   
ref|XP_011292812.1|  PREDICTED: LOW QUALITY PROTEIN: histone H4-like    154   4e-45   
ref|XP_005891241.1|  PREDICTED: histone H4-like                         153   4e-45   
ref|XP_010834692.1|  PREDICTED: histone H4-like                         154   4e-45   
ref|XP_006988932.1|  PREDICTED: histone H3.1-like                       157   4e-45   
ref|XP_009046208.1|  hypothetical protein LOTGIDRAFT_177025             154   4e-45   
emb|CBM82505.1|  histone H4 protein                                     154   4e-45   
ref|XP_009062427.1|  hypothetical protein LOTGIDRAFT_148108             153   4e-45   
gb|KFU93235.1|  Histone H4                                              153   4e-45   
ref|XP_011401494.1|  Histone H4                                         153   4e-45   
pdb|1P3G|B  Chain B, Crystallographic Studies Of Nucleosome Core ...    153   4e-45   
ref|XP_002687319.1|  PREDICTED: histone H4                              153   4e-45   
emb|CAF98839.1|  unnamed protein product                                157   4e-45   
ref|XP_005843696.1|  hypothetical protein CHLNCDRAFT_139973             153   4e-45   
ref|XP_003746459.1|  PREDICTED: histone H2B.3-like                      157   4e-45   
ref|XP_007074534.1|  PREDICTED: histone H4-like                         153   4e-45   
ref|XP_003801937.1|  PREDICTED: histone H4-like                         155   4e-45   
pdb|3AZM|B  Chain B, Crystal Structure Of Human Nucleosome Core P...    154   4e-45   
ref|XP_002586360.1|  hypothetical protein BRAFLDRAFT_116571             153   5e-45   
ref|XP_006024241.1|  PREDICTED: histone H4-like                         153   5e-45   
ref|XP_004781578.1|  PREDICTED: histone H4-like                         153   5e-45   
prf||0901261A  histone H4                                               153   5e-45
ref|XP_010861326.1|  PREDICTED: histone H4-like                         153   5e-45   
ref|XP_002928586.1|  PREDICTED: histone H4-like                         153   5e-45   
pdb|1P3I|B  Chain B, Crystallographic Studies Of Nucleosome Core ...    153   5e-45   
gb|EFX78453.1|  hypothetical protein DAPPUDRAFT_128674                  153   5e-45   
ref|XP_604220.1|  PREDICTED: histone H4                                 153   5e-45   
ref|XP_005892275.1|  PREDICTED: histone H4-like                         153   5e-45   
dbj|BAB26692.1|  unnamed protein product                                153   5e-45   
emb|CAG46986.1|  HIST1H4F                                               153   5e-45   
ref|XP_006820302.1|  PREDICTED: histone H2A-like                        157   5e-45   
gb|EFB29320.1|  hypothetical protein PANDA_021729                       153   5e-45   
ref|XP_009084852.1|  PREDICTED: histone H3-like                         157   5e-45   
dbj|BAG68513.1|  histone 4                                              153   5e-45   
ref|XP_006162725.1|  PREDICTED: histone H4-like                         153   5e-45   
ref|XP_004900743.1|  PREDICTED: histone H4-like                         156   5e-45   
dbj|BAB27698.1|  unnamed protein product                                153   5e-45   
gb|EUB54489.1|  Histone H4                                              155   5e-45   
ref|NP_492641.1|  Protein HIS-67                                        153   5e-45   
ref|XP_002045483.1|  GM18834                                            153   5e-45   
ref|XP_010634569.1|  PREDICTED: histone H3-like 2 isoform X2            157   5e-45   
ref|XP_001178441.2|  PREDICTED: histone H4-like                         154   5e-45   
ref|XP_006662013.1|  PREDICTED: histone H4 variant TH011-like           154   5e-45   
ref|XP_002889654.1|  hypothetical protein ARALYDRAFT_470793             153   5e-45   
ref|XP_001768205.1|  histone H4                                         153   5e-45   
ref|XP_002044760.1|  GM19698                                            153   5e-45   
ref|XP_005441363.1|  PREDICTED: histone H4-like                         153   5e-45   
ref|XP_001632579.1|  predicted protein                                  157   6e-45   
ref|XP_008781898.1|  PREDICTED: histone H4-like                         153   6e-45   
ref|XP_006128697.1|  PREDICTED: histone H4-like                         153   6e-45   
pir||S68537  histone H4 - starfish (Asterina pectinifera)               153   6e-45
ref|XP_005892269.1|  PREDICTED: histone H2A type 1-like                 158   6e-45   
ref|XP_008513086.1|  PREDICTED: histone H4                              155   6e-45   
ref|XP_005285084.1|  PREDICTED: histone H4-like                         153   6e-45   
gb|EMS68063.1|  Histone H4                                              153   6e-45   
ref|NP_001083038.1|  uncharacterized protein LOC100038789               153   6e-45   
pdb|1P3B|B  Chain B, Crystallographic Studies Of Nucleosome Core ...    153   6e-45   
ref|XP_005355176.1|  PREDICTED: histone H4-like                         155   6e-45   
gb|ELU05285.1|  hypothetical protein CAPTEDRAFT_205827                  157   6e-45   
ref|XP_010828619.1|  PREDICTED: histone H4-like                         156   6e-45   
gb|ACG31072.1|  histone H4                                              153   6e-45   
gb|ACF83748.1|  unknown                                                 153   6e-45   
ref|XP_005951415.1|  PREDICTED: histone H4-like                         153   6e-45   
ref|XP_001249845.3|  PREDICTED: histone H4 isoform X1                   153   6e-45   
ref|XP_003478905.2|  PREDICTED: histone H4-like                         155   6e-45   
ref|XP_005906208.1|  PREDICTED: histone H2A type 1-D-like isoform X1    157   6e-45   
ref|XP_004349093.1|  histone H4                                         153   7e-45   
ref|XP_010754582.1|  PREDICTED: uncharacterized protein LOC104939729    156   7e-45   
ref|XP_001176956.2|  PREDICTED: histone H4-like                         153   7e-45   
ref|XP_001506366.2|  PREDICTED: histone H3-like                         157   7e-45   
gb|ELT87491.1|  hypothetical protein CAPTEDRAFT_198869                  157   7e-45   
ref|XP_003074685.1|  Histone H4 (ISS)                                   159   7e-45   
ref|XP_007128671.1|  PREDICTED: histone H3.1-like isoform X1            157   7e-45   
ref|XP_001177078.2|  PREDICTED: histone H4-like                         154   7e-45   
ref|XP_006902701.1|  PREDICTED: histone H3.1-like                       157   7e-45   
ref|XP_009169046.1|  hypothetical protein T265_05709                    155   7e-45   
ref|XP_003729444.1|  PREDICTED: histone H4-like                         154   7e-45   
gb|ELV13502.1|  Histone H2B type 1-M                                    158   7e-45   
ref|XP_008071695.1|  PREDICTED: histone H3.1-like                       157   7e-45   
ref|XP_008199050.1|  PREDICTED: LOW QUALITY PROTEIN: histone H4-like    154   7e-45   
emb|CAA76306.1|  histone H4                                             153   7e-45   
emb|CAA31622.1|  unnamed protein product                                153   7e-45   
ref|XP_003746294.1|  PREDICTED: uncharacterized protein LOC100903377    157   7e-45   
ref|XP_008566074.1|  PREDICTED: histone H3.1-like                       157   7e-45   
ref|XP_007179134.1|  PREDICTED: histone H3.1-like                       156   7e-45   
ref|XP_008992033.1|  PREDICTED: histone H4-like                         155   7e-45   
ref|XP_005892262.1|  PREDICTED: histone H2A type 1-like                 157   7e-45   
emb|CAA62811.1|  histone H4                                             153   8e-45   
ref|XP_006220144.1|  PREDICTED: histone H4-like                         152   8e-45   
ref|XP_006105753.1|  PREDICTED: histone H2A type 1-like                 157   8e-45   
ref|XP_003505643.2|  PREDICTED: histone H3.1-like                       156   8e-45   
ref|XP_010147646.1|  PREDICTED: histone H4                              155   8e-45   
ref|XP_001964822.1|  GF22604                                            153   8e-45   
ref|XP_004712552.1|  PREDICTED: histone H4-like                         153   8e-45   
ref|XP_010363217.1|  PREDICTED: histone H3.1-like                       156   8e-45   
ref|XP_008326621.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    157   8e-45   
ref|XP_003927330.2|  PREDICTED: histone H3.1-like                       156   8e-45   
ref|XP_545384.2|  PREDICTED: histone H2A type 1-E-like                  157   8e-45   
ref|XP_008172414.1|  PREDICTED: histone H3 type 3-like                  156   8e-45   
ref|XP_010093860.1|  Histone H4                                         153   8e-45   
ref|XP_004365625.1|  histone H4                                         153   8e-45   
ref|XP_010614646.1|  PREDICTED: histone H4                              153   8e-45   
ref|XP_006215436.1|  PREDICTED: histone H2A type 1-like                 157   8e-45   
ref|XP_005665717.1|  PREDICTED: histone H2A type 1-F-like               157   8e-45   
ref|XP_006105908.1|  PREDICTED: histone H2A type 1-like                 157   9e-45   
ref|XP_003744738.1|  PREDICTED: uncharacterized protein LOC100900270    157   9e-45   
ref|XP_005863144.1|  PREDICTED: histone H2A type 1-like                 157   9e-45   
ref|XP_010567527.1|  PREDICTED: histone H3 isoform X2                   157   9e-45   
ref|XP_002052271.1|  GJ17461                                            156   9e-45   
gb|EMS67261.1|  Histone H4                                              154   9e-45   
ref|XP_007442741.1|  PREDICTED: histone H4-like                         152   9e-45   
ref|XP_001862654.1|  H4 histone protein                                 153   9e-45   
ref|XP_006872880.1|  PREDICTED: histone H3.1-like                       156   9e-45   
ref|XP_005701749.1|  PREDICTED: histone H2A type 1-D-like               157   9e-45   
gb|EHB13139.1|  Histone H3                                              156   9e-45   
dbj|BAF79671.1|  histone H4                                             152   9e-45   
ref|XP_008580158.1|  PREDICTED: histone H3.1-like                       156   9e-45   
ref|XP_008526337.1|  PREDICTED: histone H3.1 isoform X2                 156   9e-45   
ref|XP_003829732.2|  PREDICTED: histone H3.1-like                       156   1e-44   
ref|XP_003502210.2|  PREDICTED: histone H3 isoform X1                   156   1e-44   
gb|AAX92701.1|  histone 4                                               152   1e-44   
ref|XP_002746194.2|  PREDICTED: histone H3.1-like                       156   1e-44   
ref|XP_002927134.2|  PREDICTED: histone H3.1-like                       156   1e-44   
ref|XP_005403350.1|  PREDICTED: histone H2A type 1-like                 157   1e-44   
ref|XP_007971679.1|  PREDICTED: histone H3.1-like                       156   1e-44   
ref|XP_005337113.1|  PREDICTED: histone H2A type 1-like                 157   1e-44   
ref|XP_005960034.1|  PREDICTED: histone H2A type 1-D-like               157   1e-44   
ref|XP_007637951.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    156   1e-44   
ref|XP_010152577.1|  PREDICTED: LOW QUALITY PROTEIN: histone H4-like    152   1e-44   
ref|XP_003967900.1|  PREDICTED: histone H4-like                         153   1e-44   
ref|XP_002816614.2|  PREDICTED: histone H3.1-like                       156   1e-44   
ref|XP_004933312.1|  PREDICTED: histone H2A-like isoform X3             152   1e-44   
ref|XP_003416475.2|  PREDICTED: histone H3.1-like                       156   1e-44   



>ref|XP_003551292.2| PREDICTED: histone H4-like [Glycine max]
Length=142

 Score =   164 bits (414),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 110/134 (82%), Positives = 115/134 (86%), Gaps = 7/134 (5%)
 Frame = +1

Query  1    TSKSKSTCPIYLSLHQFKT----LDFFFLS---AKMSgrgkggkglgkggakrhrkVLRD  159
            TS+     PI  ++ +FK+    L F FL     KMSGRGKGGKGLGKGGAKRHRKVLRD
Sbjct  5    TSEDSLPAPINTAISKFKSKSQILKFDFLPISLEKMSGRGKGGKGLGKGGAKRHRKVLRD  64

Query  160  NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAM  339
            NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAM
Sbjct  65   NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAM  124

Query  340  DVVYALKRQGRTLY  381
            DVVYALKRQGRTLY
Sbjct  125  DVVYALKRQGRTLY  138



>ref|XP_007027068.1| Histone superfamily protein isoform 2, partial [Theobroma cacao]
 gb|EOY07570.1| Histone superfamily protein isoform 2, partial [Theobroma cacao]
Length=145

 Score =   160 bits (404),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 108/126 (86%), Gaps = 4/126 (3%)
 Frame = +1

Query  16   STCPIYLSLHQFKTLDFFFLSA----KMSgrgkggkglgkggakrhrkVLRDNIQGITKP  183
             T P  L+  Q    DF  L      KMSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKP
Sbjct  16   PTPPNSLNSKQKPLSDFQPLETNFHKKMSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKP  75

Query  184  AIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKR  363
            AIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKR
Sbjct  76   AIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKR  135

Query  364  QGRTLY  381
            QGRTLY
Sbjct  136  QGRTLY  141



>ref|XP_004294578.1| PREDICTED: histone H4-like [Fragaria vesca subsp. vesca]
Length=150

 Score =   160 bits (405),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 104/115 (90%), Positives = 107/115 (93%), Gaps = 2/115 (2%)
 Frame = +1

Query  37   SLHQFKTLDFFFLSAKMSgrgkggkglgkggakrhrkVLRDNIQGITKPAIRRLARRGGV  216
            ++ QF +   F   AKMSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGV
Sbjct  34   AIRQFISSQNF--PAKMSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGV  91

Query  217  KRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLY  381
            KRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLY
Sbjct  92   KRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLY  146



>gb|KJB21638.1| hypothetical protein B456_004G005600 [Gossypium raimondii]
Length=166

 Score =   160 bits (406),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 108/119 (91%), Positives = 110/119 (92%), Gaps = 2/119 (2%)
 Frame = +1

Query  25   PIYLSLHQFKTLDFFFLSAKMSgrgkggkglgkggakrhrkVLRDNIQGITKPAIRRLAR  204
            PI L    FK L+F  +S KMSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLAR
Sbjct  46   PISL-FKSFKFLNFHSIS-KMSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLAR  103

Query  205  RGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLY  381
            RGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLY
Sbjct  104  RGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLY  162



>gb|AFW80115.1| hypothetical protein ZEAMMB73_313798 [Zea mays]
Length=221

 Score =   161 bits (408),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 78/78 (100%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT
Sbjct  140  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  199

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  200  VTAMDVVYALKRQGRTLY  217



>gb|EMT31824.1| Histone H4 [Aegilops tauschii]
Length=158

 Score =   159 bits (403),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 78/78 (100%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT
Sbjct  77   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  136

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  137  VTAMDVVYALKRQGRTLY  154



>gb|ACG30677.1| histone H4 [Zea mays]
Length=149

 Score =   159 bits (402),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 78/78 (100%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>dbj|BAJ94028.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=103

 Score =   157 bits (398),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 78/78 (100%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>gb|KJB18225.1| hypothetical protein B456_003G040200 [Gossypium raimondii]
Length=162

 Score =   159 bits (403),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 103/112 (92%), Positives = 104/112 (93%), Gaps = 0/112 (0%)
 Frame = +1

Query  46   QFKTLDFFFLSAKMSgrgkggkglgkggakrhrkVLRDNIQGITKPAIRRLARRGGVKRI  225
            QF      F  +KMSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRI
Sbjct  47   QFSVTKELFDFSKMSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRI  106

Query  226  SGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLY  381
            SGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLY
Sbjct  107  SGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLY  158



>gb|KCW52694.1| hypothetical protein EUGRSUZ_J02062, partial [Eucalyptus grandis]
Length=106

 Score =   157 bits (398),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 78/78 (100%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT
Sbjct  25   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  84

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  85   VTAMDVVYALKRQGRTLY  102



>gb|ACG31455.1| histone H4 [Zea mays]
Length=103

 Score =   157 bits (397),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 78/78 (100%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>gb|AFW82272.1| histone H4.3 [Zea mays]
Length=116

 Score =   157 bits (398),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 78/78 (100%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT
Sbjct  35   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  94

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  95   VTAMDVVYALKRQGRTLY  112



>ref|XP_002862282.1| hypothetical protein ARALYDRAFT_497532 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_002866359.1| hypothetical protein ARALYDRAFT_496134 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH38540.1| hypothetical protein ARALYDRAFT_497532 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42618.1| hypothetical protein ARALYDRAFT_496134 [Arabidopsis lyrata subsp. 
lyrata]
Length=100

 Score =   157 bits (397),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 78/78 (100%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>gb|ACG30835.1| histone H4 [Zea mays]
Length=103

 Score =   157 bits (397),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 78/78 (100%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>ref|XP_007133241.1| hypothetical protein PHAVU_011G163600g, partial [Phaseolus vulgaris]
 gb|ESW05235.1| hypothetical protein PHAVU_011G163600g, partial [Phaseolus vulgaris]
Length=106

 Score =   157 bits (397),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 78/78 (100%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT
Sbjct  25   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  84

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  85   VTAMDVVYALKRQGRTLY  102



>gb|KJB20142.1| hypothetical protein B456_003G134900 [Gossypium raimondii]
Length=114

 Score =   157 bits (398),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/78 (100%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>ref|XP_007009617.1| Histone superfamily protein [Theobroma cacao]
 gb|EOY18427.1| Histone superfamily protein [Theobroma cacao]
Length=107

 Score =   157 bits (397),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/78 (100%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>gb|ACG31208.1| histone H4 [Zea mays]
Length=103

 Score =   157 bits (397),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/78 (100%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>ref|XP_010913656.1| PREDICTED: histone H4-like [Elaeis guineensis]
Length=103

 Score =   157 bits (397),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/78 (100%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>ref|NP_180441.1| histone H4 [Arabidopsis thaliana]
 ref|NP_190179.1| histone H4 [Arabidopsis thaliana]
 ref|NP_190941.1| histone H4 [Arabidopsis thaliana]
 ref|NP_563793.1| histone H4 [Arabidopsis thaliana]
 ref|NP_563797.1| histone H4 [Arabidopsis thaliana]
 ref|NP_568911.1| histone H4 [Arabidopsis thaliana]
 ref|NP_568918.1| histone H4 [Arabidopsis thaliana]
 ref|NP_850939.1| histone H4 [Arabidopsis thaliana]
 ref|NP_850660.1| histone H4 [Arabidopsis thaliana]
 ref|NP_001047762.1| Os02g0684500 [Oryza sativa Japonica Group]
 ref|NP_001048783.1| Os03g0119900 [Oryza sativa Japonica Group]
 ref|NP_001053664.1| Os04g0583600 [Oryza sativa Japonica Group]
 ref|NP_001055769.1| Os05g0462700 [Oryza sativa Japonica Group]
 ref|NP_001055786.1| Os05g0466600 [Oryza sativa Japonica Group]
 ref|NP_001063245.1| Os09g0433600 [Oryza sativa Japonica Group]
 ref|NP_001063878.1| Os09g0553100 [Oryza sativa Japonica Group]
 ref|NP_001065179.1| Os10g0539500 [Oryza sativa Japonica Group]
 ref|NP_001131585.1| histone H4 [Zea mays]
 ref|NP_001044729.2| Os01g0835900 [Oryza sativa Japonica Group]
 ref|NP_001175250.1| Os07g0549900 [Oryza sativa Japonica Group]
 ref|NP_001237495.1| histone H4 [Glycine max]
 ref|NP_001278493.1| uncharacterized protein LOC100278340 [Zea mays]
 ref|NP_001281194.1| LOC100282268 [Zea mays]
 ref|XP_001751729.1| histone H4 [Physcomitrella patens]
 ref|XP_001766349.1| histone H4 [Physcomitrella patens]
 ref|XP_001768203.1| histone H4 [Physcomitrella patens]
 ref|XP_001769691.1| histone H4 [Physcomitrella patens]
 ref|XP_001771124.1| histone H4 [Physcomitrella patens]
 ref|XP_001773584.1| histone H4 [Physcomitrella patens]
 ref|XP_001775783.1| histone H4 [Physcomitrella patens]
 ref|XP_001779524.1| predicted protein [Physcomitrella patens]
 ref|XP_001779981.1| histone H4 [Physcomitrella patens]
 ref|XP_001780443.1| histone H4 [Physcomitrella patens]
 ref|XP_001783818.1| histone H4 [Physcomitrella patens]
 ref|XP_002310853.1| histone H4 family protein [Populus trichocarpa]
 ref|XP_002310855.1| hypothetical protein POPTR_0007s14020g [Populus trichocarpa]
 ref|XP_002310859.1| histone H4 family protein [Populus trichocarpa]
 ref|XP_002311129.1| histone H4 family protein [Populus trichocarpa]
 ref|XP_002316326.1| hypothetical protein POPTR_0010s22090g [Populus trichocarpa]
 ref|XP_002324472.1| histone H4 family protein [Populus trichocarpa]
 ref|XP_002324474.1| histone H4 family protein [Populus trichocarpa]
 ref|XP_002325056.1| hypothetical protein POPTR_0018s10040g [Populus trichocarpa]
 ref|XP_002284158.1| PREDICTED: histone H4 [Vitis vinifera]
 ref|XP_002284564.1| PREDICTED: histone H4 [Vitis vinifera]
 ref|XP_002262845.1| PREDICTED: histone H4 [Vitis vinifera]
 ref|XP_002281789.1| PREDICTED: histone H4 [Vitis vinifera]
 ref|XP_002283894.1| PREDICTED: histone H4 [Vitis vinifera]
 ref|XP_002465012.1| hypothetical protein SORBIDRAFT_01g030460 [Sorghum bicolor]
 ref|XP_002468624.1| hypothetical protein SORBIDRAFT_01g049250 [Sorghum bicolor]
 ref|XP_002460250.1| hypothetical protein SORBIDRAFT_02g025440 [Sorghum bicolor]
 ref|XP_002462803.1| hypothetical protein SORBIDRAFT_02g032240 [Sorghum bicolor]
 ref|XP_002455130.1| hypothetical protein SORBIDRAFT_03g004840 [Sorghum bicolor]
 ref|XP_002455131.1| hypothetical protein SORBIDRAFT_03g004870 [Sorghum bicolor]
 ref|XP_002456596.1| hypothetical protein SORBIDRAFT_03g039090 [Sorghum bicolor]
 ref|XP_002457286.1| hypothetical protein SORBIDRAFT_03g004890 [Sorghum bicolor]
 ref|XP_002452743.1| hypothetical protein SORBIDRAFT_04g031620 [Sorghum bicolor]
 ref|XP_002448395.1| hypothetical protein SORBIDRAFT_06g026490 [Sorghum bicolor]
 ref|XP_002439932.1| hypothetical protein SORBIDRAFT_09g022920 [Sorghum bicolor]
 ref|XP_002509686.1| histone h4, putative [Ricinus communis]
 ref|XP_002518940.1| histone h4, putative [Ricinus communis]
 ref|XP_002525073.1| histone h4, putative [Ricinus communis]
 ref|XP_002531654.1| histone h4, putative [Ricinus communis]
 ref|XP_002531656.1| histone h4, putative [Ricinus communis]
 ref|XP_002532808.1| histone h4, putative [Ricinus communis]
 ref|XP_002864647.1| hypothetical protein ARALYDRAFT_496101 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_002875757.1| hypothetical protein ARALYDRAFT_484971 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_002877481.1| hypothetical protein ARALYDRAFT_485010 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_002877938.1| hypothetical protein ARALYDRAFT_485763 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_002881006.1| hypothetical protein ARALYDRAFT_481787 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_003521335.1| PREDICTED: histone H4-like [Glycine max]
 ref|XP_003535987.1| PREDICTED: histone H4-like [Glycine max]
 ref|XP_003538030.1| PREDICTED: histone H4-like [Glycine max]
 ref|XP_003538258.1| PREDICTED: histone H4-like [Glycine max]
 ref|XP_003538259.1| PREDICTED: histone H4-like [Glycine max]
 ref|XP_003538260.1| PREDICTED: histone H4-like [Glycine max]
 ref|XP_003539748.1| PREDICTED: histone H4-like isoform 1 [Glycine max]
 ref|XP_003544868.1| PREDICTED: histone H4-like [Glycine max]
 ref|XP_003549448.1| PREDICTED: histone H4-like [Glycine max]
 ref|XP_003555742.1| PREDICTED: histone H4-like [Glycine max]
 ref|XP_003557745.1| PREDICTED: histone H4 [Brachypodium distachyon]
 ref|XP_003557764.1| PREDICTED: histone H4 [Brachypodium distachyon]
 ref|XP_003558370.1| PREDICTED: histone H4 [Brachypodium distachyon]
 ref|XP_003558954.1| PREDICTED: histone H4 [Brachypodium distachyon]
 ref|XP_003578155.1| PREDICTED: histone H4 [Brachypodium distachyon]
 ref|XP_003578603.1| PREDICTED: histone H4 [Brachypodium distachyon]
 ref|XP_003597302.1| Histone H4 [Medicago truncatula]
 ref|XP_003600460.1| Histone H4 [Medicago truncatula]
 ref|XP_003600922.1| Histone H4 [Medicago truncatula]
 ref|XP_003606566.1| Histone H4 [Medicago truncatula]
 ref|XP_003615092.1| Histone H4 [Medicago truncatula]
 ref|XP_003625481.1| Histone H4 [Medicago truncatula]
 ref|XP_003627802.1| Histone H4 [Medicago truncatula]
 ref|XP_004138399.1| PREDICTED: histone H4-like [Cucumis sativus]
 ref|XP_004143094.1| PREDICTED: histone H4-like [Cucumis sativus]
 ref|XP_004143095.1| PREDICTED: histone H4-like isoform 1 [Cucumis sativus]
 ref|XP_004143096.1| PREDICTED: histone H4-like isoform 2 [Cucumis sativus]
 ref|XP_004143098.1| PREDICTED: histone H4-like isoform 2 [Cucumis sativus]
 ref|XP_004143099.1| PREDICTED: histone H4-like [Cucumis sativus]
 ref|XP_004143100.1| PREDICTED: histone H4-like [Cucumis sativus]
 ref|XP_004148773.1| PREDICTED: histone H4-like [Cucumis sativus]
 ref|XP_004160197.1| PREDICTED: histone H4-like [Cucumis sativus]
 ref|XP_004160738.1| PREDICTED: histone H4-like [Cucumis sativus]
 ref|XP_004164681.1| PREDICTED: histone H4-like [Cucumis sativus]
 ref|XP_004164682.1| PREDICTED: histone H4-like [Cucumis sativus]
 ref|XP_004166547.1| PREDICTED: histone H4-like [Cucumis sativus]
 ref|XP_004170352.1| PREDICTED: histone H4-like [Cucumis sativus]
 ref|XP_004294590.1| PREDICTED: histone H4 [Fragaria vesca subsp. vesca]
 ref|XP_004294591.1| PREDICTED: histone H4 [Fragaria vesca subsp. vesca]
 ref|XP_004294592.1| PREDICTED: histone H4 [Fragaria vesca subsp. vesca]
 ref|XP_004294628.1| PREDICTED: histone H4 [Fragaria vesca subsp. vesca]
 ref|XP_004302787.1| PREDICTED: histone H4 [Fragaria vesca subsp. vesca]
 ref|XP_004307447.1| PREDICTED: histone H4 [Fragaria vesca subsp. vesca]
 ref|XP_004487047.1| PREDICTED: histone H4-like [Cicer arietinum]
 ref|XP_004500222.1| PREDICTED: histone H4-like [Cicer arietinum]
 ref|XP_004500223.1| PREDICTED: histone H4-like [Cicer arietinum]
 ref|XP_004505922.1| PREDICTED: histone H4-like [Cicer arietinum]
 ref|XP_004507853.1| PREDICTED: histone H4-like [Cicer arietinum]
 ref|XP_004511025.1| PREDICTED: histone H4-like [Cicer arietinum]
 ref|XP_004513931.1| PREDICTED: histone H4-like [Cicer arietinum]
 ref|XP_004516180.1| PREDICTED: histone H4-like [Cicer arietinum]
 ref|XP_004953471.1| PREDICTED: histone H4-like [Setaria italica]
 ref|XP_004956919.1| PREDICTED: histone H4-like [Setaria italica]
 ref|XP_004957584.1| PREDICTED: histone H4-like [Setaria italica]
 ref|XP_004961797.1| PREDICTED: histone H4-like [Setaria italica]
 ref|XP_004970497.1| PREDICTED: histone H4-like isoform X1 [Setaria italica]
 ref|XP_004973289.1| PREDICTED: histone H4-like [Setaria italica]
 ref|XP_004976597.1| PREDICTED: histone H4-like [Setaria italica]
 ref|XP_004983800.1| PREDICTED: histone H4-like [Setaria italica]
 ref|XP_004985949.1| PREDICTED: histone H4-like [Setaria italica]
 ref|XP_006349012.1| PREDICTED: histone H4-like [Solanum tuberosum]
 ref|XP_006279505.1| hypothetical protein CARUB_v10027423mg [Capsella rubella]
 ref|XP_006292098.1| hypothetical protein CARUB_v10018293mg [Capsella rubella]
 ref|XP_006292099.1| hypothetical protein CARUB_v10018294mg [Capsella rubella]
 ref|XP_006295294.1| hypothetical protein CARUB_v10024384mg [Capsella rubella]
 ref|XP_006303455.1| hypothetical protein CARUB_v10010716mg [Capsella rubella]
 ref|XP_006303457.1| hypothetical protein CARUB_v10010719mg [Capsella rubella]
 ref|XP_006383119.1| hypothetical protein POPTR_0005s11740g [Populus trichocarpa]
 ref|XP_006383122.1| histone H4 family protein [Populus trichocarpa]
 ref|XP_006381806.1| hypothetical protein POPTR_0006s18360g [Populus trichocarpa]
 ref|XP_002316375.2| hypothetical protein POPTR_0010s22080g [Populus trichocarpa]
 ref|XP_006417762.1| hypothetical protein EUTSA_v10009172mg [Eutrema salsugineum]
 ref|XP_006418920.1| hypothetical protein EUTSA_v10002735mg [Eutrema salsugineum]
 ref|XP_006418982.1| hypothetical protein EUTSA_v10002736mg [Eutrema salsugineum]
 ref|XP_006400894.1| hypothetical protein EUTSA_v10016102mg [Eutrema salsugineum]
 ref|XP_006400928.1| hypothetical protein EUTSA_v10015098mg [Eutrema salsugineum]
 ref|XP_006403660.1| hypothetical protein EUTSA_v10010851mg [Eutrema salsugineum]
 ref|XP_006409907.1| hypothetical protein EUTSA_v10017468mg [Eutrema salsugineum]
 ref|XP_006410944.1| hypothetical protein EUTSA_v10017467mg [Eutrema salsugineum]
 ref|XP_006424714.1| hypothetical protein CICLE_v10029643mg [Citrus clementina]
 ref|XP_006424715.1| hypothetical protein CICLE_v10029643mg [Citrus clementina]
 ref|XP_006424783.1| hypothetical protein CICLE_v10029640mg [Citrus clementina]
 ref|XP_006429035.1| hypothetical protein CICLE_v10013183mg [Citrus clementina]
 ref|XP_006453377.1| hypothetical protein CICLE_v10009994mg [Citrus clementina]
 ref|XP_006474179.1| PREDICTED: histone H4-like [Citrus sinensis]
 ref|XP_006480778.1| PREDICTED: histone H4-like [Citrus sinensis]
 ref|XP_006488229.1| PREDICTED: histone H4-like [Citrus sinensis]
 ref|XP_006488285.1| PREDICTED: histone H4-like [Citrus sinensis]
 ref|XP_006597302.1| PREDICTED: histone H4-like [Glycine max]
 ref|XP_006644971.1| PREDICTED: histone H4 variant TH011-like [Oryza brachyantha]
 ref|XP_006652696.1| PREDICTED: histone H4 variant TH011-like [Oryza brachyantha]
 ref|XP_006829196.1| hypothetical protein AMTR_s00001p00271490 [Amborella trichopoda]
 ref|XP_006841590.1| hypothetical protein AMTR_s00003p00201000 [Amborella trichopoda]
 ref|XP_006841719.1| hypothetical protein AMTR_s00003p00256370 [Amborella trichopoda]
 ref|XP_006843665.1| hypothetical protein AMTR_s00007p00186150 [Amborella trichopoda]
 ref|XP_006845633.1| hypothetical protein AMTR_s00019p00220160 [Amborella trichopoda]
 ref|XP_006845635.1| hypothetical protein AMTR_s00019p00220720 [Amborella trichopoda]
 ref|XP_006845637.1| hypothetical protein AMTR_s00019p00221780 [Amborella trichopoda]
 ref|XP_006853335.1| hypothetical protein AMTR_s00032p00078840 [Amborella trichopoda]
 ref|XP_006856158.1| hypothetical protein AMTR_s00059p00172830 [Amborella trichopoda]
 ref|XP_007009385.1| Histone superfamily protein [Theobroma cacao]
 ref|XP_007014216.1| Histone superfamily protein [Theobroma cacao]
 ref|XP_007016483.1| Histone superfamily protein [Theobroma cacao]
 ref|XP_007016577.1| Histone superfamily protein [Theobroma cacao]
 ref|XP_007024825.1| Histone superfamily protein [Theobroma cacao]
 ref|XP_007027067.1| Histone superfamily protein isoform 1 [Theobroma cacao]
 ref|XP_007027069.1| Histone superfamily protein [Theobroma cacao]
 ref|XP_007132137.1| hypothetical protein PHAVU_011G069700g [Phaseolus vulgaris]
 ref|XP_007142236.1| hypothetical protein PHAVU_008G263800g [Phaseolus vulgaris]
 ref|XP_007146746.1| hypothetical protein PHAVU_006G066300g [Phaseolus vulgaris]
 ref|XP_007146747.1| hypothetical protein PHAVU_006G066400g [Phaseolus vulgaris]
 ref|XP_007146748.1| hypothetical protein PHAVU_006G066400g [Phaseolus vulgaris]
 ref|XP_007150264.1| hypothetical protein PHAVU_005G139600g [Phaseolus vulgaris]
 ref|XP_007154766.1| hypothetical protein PHAVU_003G145900g [Phaseolus vulgaris]
 ref|XP_007162656.1| hypothetical protein PHAVU_001G169200g [Phaseolus vulgaris]
 ref|XP_007202793.1| hypothetical protein PRUPE_ppa013787mg [Prunus persica]
 ref|XP_007206175.1| hypothetical protein PRUPE_ppa013781mg [Prunus persica]
 ref|XP_007206176.1| hypothetical protein PRUPE_ppa013792mg [Prunus persica]
 ref|XP_007210543.1| hypothetical protein PRUPE_ppa013776mg [Prunus persica]
 ref|XP_007220484.1| hypothetical protein PRUPE_ppa013779mg [Prunus persica]
 ref|XP_007220485.1| hypothetical protein PRUPE_ppa013782mg [Prunus persica]
 ref|XP_008223213.1| PREDICTED: histone H4 [Prunus mume]
 ref|XP_008241245.1| PREDICTED: histone H4 [Prunus mume]
 ref|XP_008233523.1| PREDICTED: histone H4 [Prunus mume]
 ref|XP_008233524.1| PREDICTED: histone H4 [Prunus mume]
 ref|XP_008233596.1| PREDICTED: histone H4 [Prunus mume]
 ref|XP_008245808.1| PREDICTED: histone H4 [Prunus mume]
 ref|XP_008343545.1| PREDICTED: histone H4 [Malus domestica]
 ref|XP_008463901.1| PREDICTED: histone H4 [Cucumis melo]
 ref|XP_008448389.1| PREDICTED: histone H4 [Cucumis melo]
 ref|XP_008448390.1| PREDICTED: histone H4 [Cucumis melo]
 ref|XP_008448391.1| PREDICTED: histone H4 [Cucumis melo]
 ref|XP_008448392.1| PREDICTED: histone H4 [Cucumis melo]
 ref|XP_008456764.1| PREDICTED: histone H4 [Cucumis melo]
 ref|XP_008456765.1| PREDICTED: histone H4 [Cucumis melo]
 ref|XP_008650256.1| PREDICTED: histone H4 [Zea mays]
 ref|XP_008668985.1| PREDICTED: histone H4 [Zea mays]
 ref|XP_008673673.1| PREDICTED: histone H4 [Zea mays]
 ref|XP_008674854.1| PREDICTED: histone H4 [Zea mays]
 ref|XP_008655661.1| PREDICTED: histone H4 [Zea mays]
 ref|XP_008656378.1| PREDICTED: histone H4 [Zea mays]
 ref|XP_008657088.1| PREDICTED: histone H4 [Zea mays]
 ref|XP_008804861.1| PREDICTED: histone H4 [Phoenix dactylifera]
 ref|XP_008812450.1| PREDICTED: histone H4 [Phoenix dactylifera]
 ref|XP_008781903.1| PREDICTED: histone H4 [Phoenix dactylifera]
 ref|XP_009131981.1| PREDICTED: histone H4 [Brassica rapa]
 ref|XP_009133863.1| PREDICTED: histone H4 [Brassica rapa]
 ref|XP_009140937.1| PREDICTED: histone H4 [Brassica rapa]
 ref|XP_009141673.1| PREDICTED: histone H4 [Brassica rapa]
 ref|XP_009143480.1| PREDICTED: histone H4 [Brassica rapa]
 ref|XP_009148015.1| PREDICTED: histone H4 [Brassica rapa]
 ref|XP_009116068.1| PREDICTED: histone H4 [Brassica rapa]
 ref|XP_009118417.1| PREDICTED: histone H4 [Brassica rapa]
 ref|XP_009337602.1| PREDICTED: histone H4 [Pyrus x bretschneideri]
 ref|XP_009394094.1| PREDICTED: histone H4 [Musa acuminata subsp. malaccensis]
 ref|XP_009394189.1| PREDICTED: histone H4 [Musa acuminata subsp. malaccensis]
 ref|XP_009401269.1| PREDICTED: histone H4 [Musa acuminata subsp. malaccensis]
 ref|XP_009390508.1| PREDICTED: histone H4 [Musa acuminata subsp. malaccensis]
 ref|XP_009394577.1| PREDICTED: histone H4 [Musa acuminata subsp. malaccensis]
 ref|XP_009406967.1| PREDICTED: histone H4 [Musa acuminata subsp. malaccensis]
 ref|XP_009409540.1| PREDICTED: histone H4 [Musa acuminata subsp. malaccensis]
 ref|XP_009414300.1| PREDICTED: histone H4 [Musa acuminata subsp. malaccensis]
 ref|XP_009416257.1| PREDICTED: histone H4 [Musa acuminata subsp. malaccensis]
 ref|XP_009420019.1| PREDICTED: histone H4 [Musa acuminata subsp. malaccensis]
 ref|XP_009420833.1| PREDICTED: histone H4 [Musa acuminata subsp. malaccensis]
 ref|XP_009380760.1| PREDICTED: histone H4 [Musa acuminata subsp. malaccensis]
 ref|XP_009382750.1| PREDICTED: histone H4 [Musa acuminata subsp. malaccensis]
 ref|XP_009384902.1| PREDICTED: histone H4 [Musa acuminata subsp. malaccensis]
 ref|XP_009607922.1| PREDICTED: histone H4 [Nicotiana tomentosiformis]
 ref|XP_009609514.1| PREDICTED: histone H4 [Nicotiana tomentosiformis]
 ref|XP_009591402.1| PREDICTED: histone H4 [Nicotiana tomentosiformis]
 ref|XP_009600261.1| PREDICTED: histone H4 [Nicotiana tomentosiformis]
 ref|XP_009791880.1| PREDICTED: histone H4 [Nicotiana sylvestris]
 ref|XP_009794491.1| PREDICTED: histone H4 [Nicotiana sylvestris]
 ref|XP_009798388.1| PREDICTED: histone H4 [Nicotiana sylvestris]
 ref|XP_009757026.1| PREDICTED: histone H4 [Nicotiana sylvestris]
 ref|XP_009767266.1| PREDICTED: histone H4 [Nicotiana sylvestris]
 ref|XP_009777185.1| PREDICTED: histone H4 [Nicotiana sylvestris]
 ref|XP_010030574.1| PREDICTED: histone H4 [Eucalyptus grandis]
 ref|XP_010053044.1| PREDICTED: histone H4 [Eucalyptus grandis]
 ref|XP_010056038.1| PREDICTED: histone H4 [Eucalyptus grandis]
 ref|XP_010033143.1| PREDICTED: histone H4 [Eucalyptus grandis]
 ref|XP_010037716.1| PREDICTED: histone H4 [Eucalyptus grandis]
 ref|XP_010037848.1| PREDICTED: histone H4 [Eucalyptus grandis]
 ref|XP_010092782.1| Histone H4 [Morus notabilis]
 ref|XP_010093009.1| Histone H4 [Morus notabilis]
 ref|XP_010104910.1| Histone H4 [Morus notabilis]
 ref|XP_010263120.1| PREDICTED: histone H4 [Nelumbo nucifera]
 ref|XP_010264531.1| PREDICTED: histone H4 [Nelumbo nucifera]
 ref|XP_010264574.1| PREDICTED: histone H4 [Nelumbo nucifera]
 ref|XP_010262272.1| PREDICTED: histone H4 [Nelumbo nucifera]
 ref|XP_010262273.1| PREDICTED: histone H4 [Nelumbo nucifera]
 ref|XP_010262275.1| PREDICTED: histone H4 [Nelumbo nucifera]
 ref|XP_010262276.1| PREDICTED: histone H4 [Nelumbo nucifera]
 ref|XP_010246201.1| PREDICTED: histone H4 [Nelumbo nucifera]
 ref|XP_010246202.1| PREDICTED: histone H4 [Nelumbo nucifera]
 ref|XP_010246203.1| PREDICTED: histone H4 [Nelumbo nucifera]
 ref|XP_010231275.1| PREDICTED: histone H4 [Brachypodium distachyon]
 ref|XP_010313299.1| PREDICTED: histone H4 [Solanum lycopersicum]
 ref|XP_010455395.1| PREDICTED: histone H4 [Camelina sativa]
 ref|XP_010455780.1| PREDICTED: histone H4 [Camelina sativa]
 ref|XP_010487799.1| PREDICTED: histone H4 [Camelina sativa]
 ref|XP_010488030.1| PREDICTED: histone H4 [Camelina sativa]
 ref|XP_010503204.1| PREDICTED: histone H4 [Camelina sativa]
 ref|XP_010503249.1| PREDICTED: histone H4 [Camelina sativa]
 ref|XP_010504143.1| PREDICTED: histone H4 [Camelina sativa]
 ref|XP_010510587.1| PREDICTED: histone H4 [Camelina sativa]
 ref|XP_010514915.1| PREDICTED: histone H4 [Camelina sativa]
 ref|XP_010514961.1| PREDICTED: histone H4 [Camelina sativa]
 ref|XP_010515874.1| PREDICTED: histone H4 [Camelina sativa]
 ref|XP_010426021.1| PREDICTED: histone H4 [Camelina sativa]
 ref|XP_010426070.1| PREDICTED: histone H4 [Camelina sativa]
 ref|XP_010427032.1| PREDICTED: histone H4 [Camelina sativa]
 ref|XP_010443740.1| PREDICTED: histone H4 [Camelina sativa]
 ref|XP_010443785.1| PREDICTED: histone H4 [Camelina sativa]
 ref|XP_010457960.1| PREDICTED: histone H4 [Camelina sativa]
 ref|XP_010457961.1| PREDICTED: histone H4 [Camelina sativa]
 ref|XP_010457987.1| PREDICTED: histone H4 isoform X1 [Camelina sativa]
 ref|XP_010457988.1| PREDICTED: histone H4 isoform X2 [Camelina sativa]
 ref|XP_010475534.1| PREDICTED: histone H4 [Camelina sativa]
 ref|XP_010475535.1| PREDICTED: histone H4 [Camelina sativa]
 ref|XP_010475557.1| PREDICTED: histone H4 [Camelina sativa]
 ref|XP_010483612.1| PREDICTED: histone H4 [Camelina sativa]
 ref|XP_010541393.1| PREDICTED: histone H4 [Tarenaya hassleriana]
 ref|XP_010542611.1| PREDICTED: histone H4 [Tarenaya hassleriana]
 ref|XP_010542654.1| PREDICTED: histone H4 [Tarenaya hassleriana]
 ref|XP_010557281.1| PREDICTED: histone H4 [Tarenaya hassleriana]
 ref|XP_010557296.1| PREDICTED: histone H4 [Tarenaya hassleriana]
 ref|XP_010520287.1| PREDICTED: histone H4 [Tarenaya hassleriana]
 ref|XP_010520288.1| PREDICTED: histone H4 [Tarenaya hassleriana]
 ref|XP_010521821.1| PREDICTED: histone H4 [Tarenaya hassleriana]
 ref|XP_010521900.1| PREDICTED: histone H4 [Tarenaya hassleriana]
 ref|XP_010680743.1| PREDICTED: histone H4 [Beta vulgaris subsp. vulgaris]
 ref|XP_010672778.1| PREDICTED: histone H4 [Beta vulgaris subsp. vulgaris]
 ref|XP_010685810.1| PREDICTED: histone H4 [Beta vulgaris subsp. vulgaris]
 ref|XP_010693814.1| PREDICTED: histone H4 [Beta vulgaris subsp. vulgaris]
 ref|XP_010695592.1| PREDICTED: histone H4 [Beta vulgaris subsp. vulgaris]
 ref|XP_010695593.1| PREDICTED: histone H4 [Beta vulgaris subsp. vulgaris]
 ref|XP_010695599.1| PREDICTED: histone H4 [Beta vulgaris subsp. vulgaris]
 ref|XP_010913659.1| PREDICTED: histone H4 [Elaeis guineensis]
 ref|XP_010914145.1| PREDICTED: histone H4 [Elaeis guineensis]
 ref|XP_011018258.1| PREDICTED: histone H4 [Populus euphratica]
 ref|XP_011018338.1| PREDICTED: histone H4 [Populus euphratica]
 ref|XP_010920757.1| PREDICTED: histone H4 [Elaeis guineensis]
 ref|XP_010928661.1| PREDICTED: histone H4 [Elaeis guineensis]
 ref|XP_010935331.1| PREDICTED: histone H4 [Elaeis guineensis]
 ref|XP_011025936.1| PREDICTED: histone H4 [Populus euphratica]
 ref|XP_011025939.1| PREDICTED: histone H4 [Populus euphratica]
 ref|XP_011025955.1| PREDICTED: histone H4 [Populus euphratica]
 ref|XP_010937748.1| PREDICTED: histone H4 [Elaeis guineensis]
 ref|XP_011027073.1| PREDICTED: histone H4 [Populus euphratica]
 ref|XP_010940230.1| PREDICTED: histone H4 [Elaeis guineensis]
 ref|XP_010907491.1| PREDICTED: histone H4 [Elaeis guineensis]
 ref|XP_011043210.1| PREDICTED: histone H4 [Populus euphratica]
 ref|XP_011043213.1| PREDICTED: histone H4 [Populus euphratica]
 ref|XP_011043969.1| PREDICTED: histone H4 [Populus euphratica]
 ref|XP_011043970.1| PREDICTED: histone H4 isoform X1 [Populus euphratica]
 ref|XP_011043971.1| PREDICTED: histone H4 isoform X2 [Populus euphratica]
 ref|XP_011043972.1| PREDICTED: histone H4 isoform X3 [Populus euphratica]
 ref|XP_011009519.1| PREDICTED: histone H4 [Populus euphratica]
 ref|XP_011013668.1| PREDICTED: histone H4 [Populus euphratica]
 ref|XP_011013671.1| PREDICTED: histone H4 [Populus euphratica]
 ref|XP_011076639.1| PREDICTED: histone H4 [Sesamum indicum]
 ref|XP_011077456.1| PREDICTED: histone H4 [Sesamum indicum]
 ref|XP_011077544.1| PREDICTED: histone H4 [Sesamum indicum]
 ref|XP_011084861.1| PREDICTED: histone H4 [Sesamum indicum]
 ref|XP_011085966.1| PREDICTED: histone H4 [Sesamum indicum]
 ref|XP_011089394.1| PREDICTED: histone H4 [Sesamum indicum]
 ref|XP_011094841.1| PREDICTED: histone H4 [Sesamum indicum]
 ref|XP_011095029.1| PREDICTED: histone H4 [Sesamum indicum]
 ref|XP_011095589.1| PREDICTED: histone H4 [Sesamum indicum]
 ref|XP_011097720.1| PREDICTED: histone H4 [Sesamum indicum]
 ref|XP_011101872.1| PREDICTED: histone H4 [Sesamum indicum]
 ref|XP_011469720.1| PREDICTED: histone H4 [Fragaria vesca subsp. vesca]
 ref|XP_011469723.1| PREDICTED: histone H4 [Fragaria vesca subsp. vesca]
 sp|P59259.2|H4_ARATH RecName: Full=Histone H4 [Arabidopsis thaliana]
 sp|Q6LAF3.3|H4_FLATR RecName: Full=Histone H4 [Flaveria trinervia]
 sp|Q6PMI5.3|H4_CHEMJ RecName: Full=Histone H4 [Chelidonium majus]
 sp|Q6WZ83.3|H4_EUCGL RecName: Full=Histone H4 [Eucalyptus globulus]
 sp|Q76H85.3|H4_SILLA RecName: Full=Histone H4 [Silene latifolia]
 sp|P62788.2|H4_PEA RecName: Full=Histone H4 [Pisum sativum]
 sp|P62787.2|H4_MAIZE RecName: Full=Histone H4 [Zea mays]
 sp|P62887.2|H4_LOLTE RecName: Full=Histone H4 [Lolium temulentum]
 sp|P62785.2|H41_WHEAT RecName: Full=Histone H4 variant TH011 [Triticum aestivum]
 sp|P0CG89.1|H4_SOYBN RecName: Full=Histone H4 [Glycine max]
 gb|AAF75072.1|AC007583_8 Identical to histone H4 from Arabidopsis thaliana gi|S06904 [Arabidopsis 
thaliana]
 gb|AAF75089.1|AC007583_25 Identical to histone H4 from Arabidopsis thaliana gi|S06904 [Arabidopsis 
thaliana]
 gb|AAG40410.1|AF325058_1 AT5g59690 [Arabidopsis thaliana]
 gb|AAG46106.1|AC073166_4 histone H4 [Oryza sativa Japonica Group]
 gb|AAG50107.1|AF334729_1 putative histone H4 protein [Arabidopsis thaliana]
 emb|CAA24924.1| unnamed protein product [Triticum aestivum]
 gb|AAA32810.1| histone H4 [Arabidopsis thaliana]
 gb|AAA32811.1| histone H4 [Arabidopsis thaliana]
 gb|AAA33474.1| histone H4 (H4C13) [Zea mays]
 gb|AAA33475.1| histone H4 [Zea mays]
 gb|AAA33476.1| histone H4 [Zea mays]
 gb|AAA86948.1| histone H4 homolog [Pisum sativum]
 emb|CAB01914.1| histone H4 homologue [Sesbania rostrata]
 gb|AAC79580.1| histone H4 [Arabidopsis thaliana]
 dbj|BAA85120.1| histone H4-like protein [Solanum melongena]
 emb|CAB62023.1| histone H4-like protein [Arabidopsis thaliana]
 emb|CAB82817.1| Histone H4-like protein [Arabidopsis thaliana]
 emb|CAB88335.1| histone H4-like protein [Arabidopsis thaliana]
 dbj|BAB08365.1| histone H4 [Arabidopsis thaliana]
 dbj|BAB09507.1| histone H4 [Arabidopsis thaliana]
 emb|CAC34411.1| histone H4 [Flaveria trinervia]
 gb|AAL14404.1| AT5g59690/mth12_90 [Arabidopsis thaliana]
 gb|AAL32795.1| histone H4-like protein [Arabidopsis thaliana]
 gb|AAL36213.1| putative histone H4 protein [Arabidopsis thaliana]
 dbj|BAB89744.1| histone H4 [Oryza sativa Japonica Group]
 gb|AAM15445.1| histone H4 [Arabidopsis thaliana]
 gb|AAM13352.1| histone H4-like protein [Arabidopsis thaliana]
 gb|AAM20526.1| histone H4-like protein [Arabidopsis thaliana]
 gb|AAM61726.1| histone H4-like protein [Arabidopsis thaliana]
 gb|AAM62721.1| histone H4-like protein [Arabidopsis thaliana]
 gb|AAM63175.1| histone H4-like protein [Arabidopsis thaliana]
 gb|AAM63839.1| histone H4-like protein [Arabidopsis thaliana]
 gb|AAM64264.1| histone H4-like protein [Arabidopsis thaliana]
 gb|AAM64622.1| histone H4-like protein [Arabidopsis thaliana]
 gb|AAM64744.1| histone H4-like protein [Arabidopsis thaliana]
 gb|AAM70545.1| AT5g59690/mth12_90 [Arabidopsis thaliana]
 gb|AAM91255.1| histone H4-like protein [Arabidopsis thaliana]
 gb|AAM93740.1| histone H4 [Oryza sativa Japonica Group]
 gb|AAN13189.1| putative histone H4 protein [Arabidopsis thaliana]
 gb|AAO15293.1| Unknown protein [Oryza sativa Japonica Group]
 dbj|BAC56852.1| histone H4 [Silene latifolia]
 gb|AAO41978.1| putative histone H4 protein [Arabidopsis thaliana]
 gb|AAO44010.1| At1g07820 [Arabidopsis thaliana]
 dbj|BAC57734.1| histone H4 [Oryza sativa Japonica Group]
 gb|AAO50503.1| putative histone H4 protein [Arabidopsis thaliana]
 gb|AAP33088.1| histone H4 [Eucalyptus globulus]
 gb|AAP54838.1| Histone H4, putative, expressed [Oryza sativa Japonica Group]
 emb|CAD41377.2| OSJNBa0088A01.17 [Oryza sativa Japonica Group]
 dbj|BAD07563.1| histone H4 [Oryza sativa Japonica Group]
 gb|AAT01924.1| histone H4 [Chelidonium majus]
 gb|AAT39190.1| putative histone H4 [Oryza sativa Japonica Group]
 gb|AAT58763.1| histone H4 [Oryza sativa Japonica Group]
 gb|AAT58785.1| histone H4 [Oryza sativa Japonica Group]
 dbj|BAD27874.1| histone H4 [Oryza sativa Japonica Group]
 dbj|BAD33556.1| histone H4 [Oryza sativa Japonica Group]
 dbj|BAD43276.1| histone H4 [Arabidopsis thaliana]
 dbj|BAD43606.1| histone H4 [Arabidopsis thaliana]
 dbj|BAD43910.1| histone H4 [Arabidopsis thaliana]
 gb|AAU90170.1| histone H4 [Oryza sativa Japonica Group]
 dbj|BAD82897.1| histone H4 [Fragaria x ananassa]
 gb|AAX92702.1| histone 4 [Picea abies]
 gb|ABD28289.1| histone H4-like protein [Glycine max]
 gb|ABD38885.1| At3g45930 [Arabidopsis thaliana]
 gb|ABE87620.1| Histone core [Medicago truncatula]
 gb|ABF93682.1| Histone H4, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF01106.1| Histone H4 - like protein [Arabidopsis thaliana]
 dbj|BAF00179.1| histone H4 [Arabidopsis thaliana]
 dbj|BAF09676.1| Os02g0684500 [Oryza sativa Japonica Group]
 dbj|BAF10697.1| Os03g0119900 [Oryza sativa Japonica Group]
 dbj|BAF15578.1| Os04g0583600 [Oryza sativa Japonica Group]
 dbj|BAF17683.1| Os05g0462700 [Oryza sativa Japonica Group]
 dbj|BAF17700.1| Os05g0466600 [Oryza sativa Japonica Group]
 dbj|BAF25159.1| Os09g0433600 [Oryza sativa Japonica Group]
 dbj|BAF25792.1| Os09g0553100 [Oryza sativa Japonica Group]
 dbj|BAF27093.1| Os10g0539500 [Oryza sativa Japonica Group]
 gb|ABK20879.1| unknown [Picea sitchensis]
 gb|ABK22619.1| unknown [Picea sitchensis]
 gb|ABK24738.1| unknown [Picea sitchensis]
 gb|ABK26777.1| unknown [Picea sitchensis]
 gb|ABK93286.1| unknown [Populus trichocarpa]
 gb|ABK94246.1| unknown [Populus trichocarpa]
 gb|ABK94634.1| unknown [Populus trichocarpa]
 gb|ABN08909.1| Histone core [Medicago truncatula]
 gb|EAY76410.1| hypothetical protein OsI_04340 [Oryza sativa Indica Group]
 gb|EAY79363.1| hypothetical protein OsI_34491 [Oryza sativa Indica Group]
 gb|EAY87099.1| hypothetical protein OsI_08497 [Oryza sativa Indica Group]
 gb|EAY88304.1| hypothetical protein OsI_09762 [Oryza sativa Indica Group]
 gb|EAY95298.1| hypothetical protein OsI_17123 [Oryza sativa Indica Group]
 gb|EAY98337.1| hypothetical protein OsI_20247 [Oryza sativa Indica Group]
 gb|EAY98358.1| hypothetical protein OsI_20269 [Oryza sativa Indica Group]
 gb|EAZ04270.1| hypothetical protein OsI_26413 [Oryza sativa Indica Group]
 gb|EAZ09209.1| hypothetical protein OsI_31484 [Oryza sativa Indica Group]
 gb|EAZ10018.1| hypothetical protein OsI_32321 [Oryza sativa Indica Group]
 gb|EAZ14069.1| hypothetical protein OsJ_03994 [Oryza sativa Japonica Group]
 gb|EAZ16833.1| hypothetical protein OsJ_32304 [Oryza sativa Japonica Group]
 gb|EAZ24208.1| hypothetical protein OsJ_07955 [Oryza sativa Japonica Group]
 gb|EAZ25381.1| hypothetical protein OsJ_09199 [Oryza sativa Japonica Group]
 gb|EAZ31763.1| hypothetical protein OsJ_15915 [Oryza sativa Japonica Group]
 gb|EAZ40221.1| hypothetical protein OsJ_24666 [Oryza sativa Japonica Group]
 gb|EAZ45602.1| hypothetical protein OsJ_30268 [Oryza sativa Japonica Group]
 gb|ABQ32303.1| putative histone H4-like protein [Artemisia annua]
 emb|CAN64268.1| hypothetical protein VITISV_036365 [Vitis vinifera]
 emb|CAN59705.1| hypothetical protein VITISV_010247 [Vitis vinifera]
 emb|CAN59706.1| hypothetical protein VITISV_010248 [Vitis vinifera]
 emb|CAN68239.1| hypothetical protein VITISV_006985 [Vitis vinifera]
 emb|CAN63143.1| hypothetical protein VITISV_034577 [Vitis vinifera]
 emb|CAN79580.1| hypothetical protein VITISV_002271 [Vitis vinifera]
 emb|CAN79581.1| hypothetical protein VITISV_002272 [Vitis vinifera]
 emb|CAN79612.1| hypothetical protein VITISV_035467 [Vitis vinifera]
 emb|CAN79680.1| hypothetical protein VITISV_034640 [Vitis vinifera]
 emb|CAN83554.1| hypothetical protein VITISV_030356 [Vitis vinifera]
 gb|ABW81095.1| H4his18 [Cleome spinosa]
 gb|EDQ51358.1| histone H4 [Physcomitrella patens]
 gb|EDQ54733.1| histone H4 [Physcomitrella patens]
 gb|EDQ55190.1| histone H4 [Physcomitrella patens]
 gb|EDQ55700.1| predicted protein [Physcomitrella patens]
 gb|EDQ59322.1| histone H4 [Physcomitrella patens]
 gb|EDQ61622.1| histone H4 [Physcomitrella patens]
 gb|EDQ64125.1| histone H4 [Physcomitrella patens]
 gb|EDQ65492.1| histone H4 [Physcomitrella patens]
 gb|EDQ67076.1| histone H4 [Physcomitrella patens]
 gb|EDQ68981.1| histone H4 [Physcomitrella patens]
 gb|EDQ83164.1| histone H4 [Physcomitrella patens]
 gb|ACF80052.1| unknown [Zea mays]
 gb|ACF80828.1| unknown [Zea mays]
 gb|ACF82225.1| unknown [Zea mays]
 gb|ACF82288.1| unknown [Zea mays]
 gb|ACF83229.1| unknown [Zea mays]
 gb|ACF83575.1| unknown [Zea mays]
 gb|ACF83765.1| unknown [Zea mays]
 gb|ACF84258.1| unknown [Zea mays]
 gb|ACF86280.1| unknown [Zea mays]
 gb|ACF87214.1| unknown [Zea mays]
 gb|ACF88257.1| unknown [Zea mays]
 gb|ACG24613.1| histone H4 [Zea mays]
 gb|ACG24646.1| histone H4 [Zea mays]
 gb|ACG24650.1| histone H4 [Zea mays]
 gb|ACG24821.1| histone H4 [Zea mays]
 gb|ACG25074.1| histone H4 [Zea mays]
 gb|ACG25156.1| histone H4 [Zea mays]
 gb|ACG25337.1| histone H4 [Zea mays]
 gb|ACG25500.1| histone H4 [Zea mays]
 gb|ACG30422.1| histone H4 [Zea mays]
 gb|ACG30452.1| histone H4 [Zea mays]
 gb|ACG30684.1| histone H4 [Zea mays]
 gb|ACG30745.1| histone H4 [Zea mays]
 gb|ACG30750.1| histone H4 [Zea mays]
 gb|ACG30751.1| histone H4 [Zea mays]
 gb|ACG30770.1| histone H4 [Zea mays]
 gb|ACG30834.1| histone H4 [Zea mays]
 gb|ACG30836.1| histone H4 [Zea mays]
 gb|ACG30868.1| histone H4 [Zea mays]
 gb|ACG30869.1| histone H4 [Zea mays]
 gb|ACG30873.1| histone H4 [Zea mays]
 gb|ACG30917.1| histone H4 [Zea mays]
 gb|ACG30996.1| histone H4 [Zea mays]
 gb|ACG31045.1| histone H4 [Zea mays]
 gb|ACG31057.1| histone H4 [Zea mays]
 gb|ACG31229.1| histone H4 [Zea mays]
 gb|ACG31230.1| histone H4 [Zea mays]
 gb|ACG31234.1| histone H4 [Zea mays]
 gb|ACG31300.1| histone H4 [Zea mays]
 gb|ACG31315.1| histone H4 [Zea mays]
 gb|ACG31919.1| histone H4 [Zea mays]
 gb|ACG32609.1| histone H4 [Zea mays]
 gb|ACG33427.1| histone H4 [Zea mays]
 gb|ACG34413.1| histone H4 [Zea mays]
 gb|ACG34866.1| histone H4 [Zea mays]
 gb|ACG35951.1| histone H4 [Zea mays]
 gb|ACG35976.1| histone H4 [Zea mays]
 gb|ACG36015.1| histone H4 [Zea mays]
 gb|ACG36304.1| histone H4 [Zea mays]
 gb|ACG36622.1| histone H4 [Zea mays]
 gb|ACG37000.1| histone H4 [Zea mays]
 gb|ACG37250.1| histone H4 [Zea mays]
 gb|ACG37605.1| histone H4 [Zea mays]
 gb|ACG37825.1| histone H4 [Zea mays]
 gb|ACG38812.1| histone H4 [Zea mays]
 gb|ACG39221.1| histone H4 [Zea mays]
 gb|ACG48479.1| histone H4 [Zea mays]
 gb|ACG48490.1| histone H4 [Zea mays]
 gb|ACG48509.1| histone H4 [Zea mays]
 gb|ACG48644.1| histone H4 [Zea mays]
 gb|ACG48693.1| histone H4 [Zea mays]
 gb|ACG49121.1| histone H4 [Zea mays]
 dbj|BAG97383.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG86775.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG86791.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG86871.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG86892.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99598.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99753.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH19766.1| AT1G07820 [Arabidopsis thaliana]
 gb|EEE64000.1| hypothetical protein OsJ_18829 [Oryza sativa Japonica Group]
 gb|EEE69764.1| hypothetical protein OsJ_29473 [Oryza sativa Japonica Group]
 gb|EEE88496.1| histone H4 family protein [Populus trichocarpa]
 gb|EEE91303.1| histone H4 family protein [Populus trichocarpa]
 gb|EEE91305.1| hypothetical protein POPTR_0007s14020g [Populus trichocarpa]
 gb|EEE91309.1| histone H4 family protein [Populus trichocarpa]
 gb|EEF02497.1| hypothetical protein POPTR_0010s22090g [Populus trichocarpa]
 gb|EEF03037.1| histone H4 family protein [Populus trichocarpa]
 gb|EEF03039.1| histone H4 family protein [Populus trichocarpa]
 gb|EEF03621.1| hypothetical protein POPTR_0018s10040g [Populus trichocarpa]
 gb|EEF29565.1| histone h4, putative [Ricinus communis]
 gb|EEF30724.1| histone h4, putative [Ricinus communis]
 gb|EEF30726.1| histone h4, putative [Ricinus communis]
 gb|EEF37320.1| histone h4, putative [Ricinus communis]
 gb|EEF43473.1| histone h4, putative [Ricinus communis]
 gb|EEF51073.1| histone h4, putative [Ricinus communis]
 gb|ACN35499.1| unknown [Zea mays]
 gb|ACN40254.1| unknown [Picea sitchensis]
 gb|ACR36979.1| unknown [Zea mays]
 gb|ACR37190.1| unknown [Zea mays]
 gb|ACR38106.1| unknown [Zea mays]
 gb|ACR38167.1| unknown [Zea mays]
 gb|ACR38202.1| unknown [Zea mays]
 gb|ACR38482.1| unknown [Zea mays]
 gb|EER92010.1| hypothetical protein SORBIDRAFT_01g030460 [Sorghum bicolor]
 gb|EER95622.1| hypothetical protein SORBIDRAFT_01g049250 [Sorghum bicolor]
 gb|EER96771.1| hypothetical protein SORBIDRAFT_02g025440 [Sorghum bicolor]
 gb|EER99324.1| hypothetical protein SORBIDRAFT_02g032240 [Sorghum bicolor]
 gb|EES00250.1| hypothetical protein SORBIDRAFT_03g004840 [Sorghum bicolor]
 gb|EES00251.1| hypothetical protein SORBIDRAFT_03g004870 [Sorghum bicolor]
 gb|EES01716.1| hypothetical protein SORBIDRAFT_03g039090 [Sorghum bicolor]
 gb|EES02406.1| hypothetical protein SORBIDRAFT_03g004890 [Sorghum bicolor]
 gb|EES05719.1| hypothetical protein SORBIDRAFT_04g031620 [Sorghum bicolor]
 gb|EES12723.1| hypothetical protein SORBIDRAFT_06g026490 [Sorghum bicolor]
 gb|EES18362.1| hypothetical protein SORBIDRAFT_09g022920 [Sorghum bicolor]
 gb|ACU13340.1| unknown [Glycine max]
 dbj|BAF06643.2| Os01g0835900 [Oryza sativa Japonica Group]
 dbj|BAH93978.1| Os07g0549900 [Oryza sativa Japonica Group]
 gb|EFH40906.1| hypothetical protein ARALYDRAFT_496101 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52016.1| hypothetical protein ARALYDRAFT_484971 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53740.1| hypothetical protein ARALYDRAFT_485010 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54197.1| hypothetical protein ARALYDRAFT_485763 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57265.1| hypothetical protein ARALYDRAFT_481787 [Arabidopsis lyrata subsp. 
lyrata]
 dbj|BAJ89933.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK01803.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ94137.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK02226.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ98718.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK06265.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK02764.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91174.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91200.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86564.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86578.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK04181.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88750.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK04343.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK04649.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK08280.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK05058.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK05158.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93645.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|AEC08165.1| histone H4 [Arabidopsis thaliana]
 gb|AEC10949.1| histone H4 [Camellia sinensis]
 gb|AED97220.1| histone H4 [Arabidopsis thaliana]
 gb|AED97260.1| histone H4 [Arabidopsis thaliana]
 gb|AEE28158.1| histone H4 [Arabidopsis thaliana]
 gb|AEE28187.1| histone H4 [Arabidopsis thaliana]
 gb|AEE28188.1| histone H4 [Arabidopsis thaliana]
 gb|AEE78091.1| histone H4 [Arabidopsis thaliana]
 gb|AEE78146.1| histone H4 [Arabidopsis thaliana]
 gb|AEE79133.1| histone H4 [Arabidopsis thaliana]
 dbj|BAK64064.1| histone H4 [Physcomitrella patens]
 gb|AES67553.1| histone H4 domain protein [Medicago truncatula]
 gb|AES70711.1| histone H4 domain protein [Medicago truncatula]
 gb|AES71173.1| histone H4 domain protein [Medicago truncatula]
 gb|AES81699.1| histone H4 domain protein [Medicago truncatula]
 gb|AES88763.1| histone H4 domain protein [Medicago truncatula]
 gb|AES98050.1| histone H4 domain protein [Medicago truncatula]
 gb|AET02278.1| histone H4 domain protein [Medicago truncatula]
 gb|AEW08074.1| hypothetical protein 0_18315_01 [Pinus radiata]
 gb|AFG63669.1| hypothetical protein 0_18315_01 [Pinus taeda]
 gb|AFG63670.1| hypothetical protein 0_18315_01 [Pinus taeda]
 gb|AFG63671.1| hypothetical protein 0_18315_01 [Pinus taeda]
 gb|AFG63672.1| hypothetical protein 0_18315_01 [Pinus taeda]
 gb|AFG63673.1| hypothetical protein 0_18315_01 [Pinus taeda]
 gb|AFG63674.1| hypothetical protein 0_18315_01 [Pinus taeda]
 gb|AFG63675.1| hypothetical protein 0_18315_01 [Pinus taeda]
 gb|AFG63676.1| hypothetical protein 0_18315_01 [Pinus taeda]
 gb|AFG63677.1| hypothetical protein 0_18315_01 [Pinus taeda]
 gb|AFG63678.1| hypothetical protein 0_18315_01 [Pinus taeda]
 gb|AFG63679.1| hypothetical protein 0_18315_01 [Pinus taeda]
 gb|AFG63680.1| hypothetical protein 0_18315_01 [Pinus taeda]
 gb|AFG63681.1| hypothetical protein 0_18315_01 [Pinus taeda]
 gb|AFG63682.1| hypothetical protein 0_18315_01 [Pinus taeda]
 gb|AFG63683.1| hypothetical protein 0_18315_01 [Pinus taeda]
 gb|AFG63684.1| hypothetical protein 0_18315_01 [Pinus taeda]
 gb|AFG63685.1| hypothetical protein 0_18315_01 [Pinus taeda]
 gb|AFK36911.1| unknown [Lotus japonicus]
 gb|AFK40229.1| unknown [Medicago truncatula]
 gb|AFK40827.1| unknown [Medicago truncatula]
 gb|AFK42163.1| unknown [Lotus japonicus]
 gb|AFK43817.1| unknown [Lotus japonicus]
 gb|AFK47341.1| unknown [Medicago truncatula]
 gb|AFW59074.1| histone H4.3 [Zea mays]
 gb|AFW63397.1| histone H4.3 [Zea mays]
 gb|AFW82275.1| histone H4.3 [Zea mays]
 gb|AFW84655.1| histone H4.3 isoform 1 [Zea mays]
 gb|AFW84656.1| histone H4.3 isoform 2 [Zea mays]
 gb|AFW84657.1| histone H4.3 isoform 3 [Zea mays]
 tpg|DAA36306.1| TPA: histone H4.3 [Zea mays]
 tpg|DAA36315.1| TPA: histone H4.3 [Zea mays]
 tpg|DAA40125.1| TPA: histone H4.3 [Zea mays]
 tpg|DAA42980.1| TPA: histone H4.3 [Zea mays]
 tpg|DAA53331.1| TPA: histone H4.3 isoform 1 [Zea mays]
 tpg|DAA53332.1| TPA: histone H4.3 isoform 2 [Zea mays]
 tpg|DAA56945.1| TPA: histone H4.3 isoform 1 [Zea mays]
 tpg|DAA56946.1| TPA: histone H4.3 isoform 2 [Zea mays]
 tpg|DAA61600.1| TPA: histone H4.3 [Zea mays]
 tpg|DAA61604.1| TPA: histone H4.3 [Zea mays]
 tpg|DAA62621.1| TPA: hypothetical protein ZEAMMB73_475038 [Zea mays]
 tpg|DAA62682.1| TPA: hypothetical protein ZEAMMB73_285478 [Zea mays]
 emb|CCI55324.1| PH01B001I13.20 [Phyllostachys edulis]
 gb|EMJ03992.1| hypothetical protein PRUPE_ppa013787mg [Prunus persica]
 gb|EMJ07374.1| hypothetical protein PRUPE_ppa013781mg [Prunus persica]
 gb|EMJ07375.1| hypothetical protein PRUPE_ppa013792mg [Prunus persica]
 gb|EMJ11742.1| hypothetical protein PRUPE_ppa013776mg [Prunus persica]
 gb|EMJ21683.1| hypothetical protein PRUPE_ppa013779mg [Prunus persica]
 gb|EMJ21684.1| hypothetical protein PRUPE_ppa013782mg [Prunus persica]
 gb|EMS51036.1| Histone H4 [Triticum urartu]
 gb|EMS54800.1| Histone H4 [Triticum urartu]
 gb|EMS57442.1| Histone H4 [Triticum urartu]
 gb|EMS58789.1| Histone H4 [Triticum urartu]
 gb|EMS59432.1| Histone H4 [Triticum urartu]
 gb|EMS61471.1| Histone H4 [Triticum urartu]
 gb|EMS63901.1| Histone H4 [Triticum urartu]
 gb|EMS64239.1| Histone H4 [Triticum urartu]
 gb|EMS66687.1| Histone H4 [Triticum urartu]
 gb|EMS67260.1| Histone H4 [Triticum urartu]
 gb|EMT05081.1| Histone H4 [Aegilops tauschii]
 gb|EMT05082.1| Histone H4 [Aegilops tauschii]
 gb|EMT09198.1| Histone H4 [Aegilops tauschii]
 gb|EMT11852.1| Histone H4 [Aegilops tauschii]
 gb|EMT14600.1| Histone H4 [Aegilops tauschii]
 gb|EMT25001.1| Histone H4 [Aegilops tauschii]
 gb|EMT29099.1| Histone H4 [Aegilops tauschii]
 gb|EMT29315.1| Histone H4 [Aegilops tauschii]
 gb|EMT29698.1| Histone H4 [Aegilops tauschii]
 gb|EMT31166.1| Histone H4 [Aegilops tauschii]
 gb|EMT33034.1| Histone H4 [Aegilops tauschii]
 gb|EOA12403.1| hypothetical protein CARUB_v10027423mg [Capsella rubella]
 gb|EOA24996.1| hypothetical protein CARUB_v10018293mg [Capsella rubella]
 gb|EOA24997.1| hypothetical protein CARUB_v10018294mg [Capsella rubella]
 gb|EOA28192.1| hypothetical protein CARUB_v10024384mg [Capsella rubella]
 gb|EOA36353.1| hypothetical protein CARUB_v10010716mg [Capsella rubella]
 gb|EOA36355.1| hypothetical protein CARUB_v10010719mg [Capsella rubella]
 gb|EOY07569.1| Histone superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY07571.1| Histone superfamily protein [Theobroma cacao]
 gb|EOY18195.1| Histone superfamily protein [Theobroma cacao]
 gb|EOY27447.1| Histone superfamily protein [Theobroma cacao]
 gb|EOY31835.1| Histone superfamily protein [Theobroma cacao]
 gb|EOY34102.1| Histone superfamily protein [Theobroma cacao]
 gb|EOY34196.1| Histone superfamily protein [Theobroma cacao]
 gb|EPS60847.1| hypothetical protein M569_13955 [Genlisea aurea]
 gb|EPS69507.1| hypothetical protein M569_05259 [Genlisea aurea]
 gb|EPS69742.1| hypothetical protein M569_05024 [Genlisea aurea]
 gb|EPS72649.1| hypothetical protein M569_02106 [Genlisea aurea]
 gb|ERM96612.1| hypothetical protein AMTR_s00001p00271490 [Amborella trichopoda]
 gb|ERN03265.1| hypothetical protein AMTR_s00003p00201000 [Amborella trichopoda]
 gb|ERN03394.1| hypothetical protein AMTR_s00003p00256370 [Amborella trichopoda]
 gb|ERN05340.1| hypothetical protein AMTR_s00007p00186150 [Amborella trichopoda]
 gb|ERN07308.1| hypothetical protein AMTR_s00019p00220160 [Amborella trichopoda]
 gb|ERN07310.1| hypothetical protein AMTR_s00019p00220720 [Amborella trichopoda]
 gb|ERN07312.1| hypothetical protein AMTR_s00019p00221780 [Amborella trichopoda]
 gb|ERN14802.1| hypothetical protein AMTR_s00032p00078840 [Amborella trichopoda]
 gb|ERN17625.1| hypothetical protein AMTR_s00059p00172830 [Amborella trichopoda]
 gb|EEF02546.2| hypothetical protein POPTR_0010s22080g [Populus trichocarpa]
 gb|ERP59603.1| hypothetical protein POPTR_0006s18360g [Populus trichocarpa]
 gb|ERP60916.1| hypothetical protein POPTR_0005s11740g [Populus trichocarpa]
 gb|ERP60919.1| histone H4 family protein [Populus trichocarpa]
 gb|ESQ36115.1| hypothetical protein EUTSA_v10009172mg [Eutrema salsugineum]
 gb|ESQ37356.1| hypothetical protein EUTSA_v10002735mg [Eutrema salsugineum]
 gb|ESQ37418.1| hypothetical protein EUTSA_v10002736mg [Eutrema salsugineum]
 gb|ESQ42347.1| hypothetical protein EUTSA_v10016102mg [Eutrema salsugineum]
 gb|ESQ42381.1| hypothetical protein EUTSA_v10015098mg [Eutrema salsugineum]
 gb|ESQ45113.1| hypothetical protein EUTSA_v10010851mg [Eutrema salsugineum]
 gb|ESQ51360.1| hypothetical protein EUTSA_v10017468mg [Eutrema salsugineum]
 gb|ESQ52397.1| hypothetical protein EUTSA_v10017467mg [Eutrema salsugineum]
 gb|ESR37954.1| hypothetical protein CICLE_v10029643mg [Citrus clementina]
 gb|ESR37955.1| hypothetical protein CICLE_v10029643mg [Citrus clementina]
 gb|ESR38023.1| hypothetical protein CICLE_v10029640mg [Citrus clementina]
 gb|ESR42275.1| hypothetical protein CICLE_v10013183mg [Citrus clementina]
 gb|ESR66617.1| hypothetical protein CICLE_v10009994mg [Citrus clementina]
 gb|ESW04131.1| hypothetical protein PHAVU_011G069700g [Phaseolus vulgaris]
 gb|ESW14230.1| hypothetical protein PHAVU_008G263800g [Phaseolus vulgaris]
 gb|ESW18740.1| hypothetical protein PHAVU_006G066300g [Phaseolus vulgaris]
 gb|ESW18741.1| hypothetical protein PHAVU_006G066400g [Phaseolus vulgaris]
 gb|ESW18742.1| hypothetical protein PHAVU_006G066400g [Phaseolus vulgaris]
 gb|ESW22258.1| hypothetical protein PHAVU_005G139600g [Phaseolus vulgaris]
 gb|ESW26760.1| hypothetical protein PHAVU_003G145900g [Phaseolus vulgaris]
 gb|ESW34650.1| hypothetical protein PHAVU_001G169200g [Phaseolus vulgaris]
 gb|EXB52247.1| Histone H4 [Morus notabilis]
 gb|EXB53247.1| Histone H4 [Morus notabilis]
 gb|EXC02146.1| Histone H4 [Morus notabilis]
 gb|EYU18905.1| hypothetical protein MIMGU_mgv1a016881mg [Erythranthe guttata]
 gb|EYU20074.1| hypothetical protein MIMGU_mgv1a016888mg [Erythranthe guttata]
 gb|EYU26577.1| hypothetical protein MIMGU_mgv1a023067mg [Erythranthe guttata]
 gb|EYU26674.1| hypothetical protein MIMGU_mgv1a016867mg [Erythranthe guttata]
 gb|EYU27473.1| hypothetical protein MIMGU_mgv1a023717mg [Erythranthe guttata]
 gb|EYU33728.1| hypothetical protein MIMGU_mgv1a018239mg [Erythranthe guttata]
 gb|EYU41706.1| hypothetical protein MIMGU_mgv1a016883mg [Erythranthe guttata]
 gb|KCW49468.1| hypothetical protein EUGRSUZ_K02990 [Eucalyptus grandis]
 gb|KCW49627.1| hypothetical protein EUGRSUZ_K03149 [Eucalyptus grandis]
 gb|KCW51668.1| hypothetical protein EUGRSUZ_J01149 [Eucalyptus grandis]
 gb|KCW72615.1| hypothetical protein EUGRSUZ_E01075 [Eucalyptus grandis]
 gb|KCW77293.1| hypothetical protein EUGRSUZ_D01652 [Eucalyptus grandis]
 gb|KCW88114.1| hypothetical protein EUGRSUZ_A00511 [Eucalyptus grandis]
 gb|KDO43694.1| hypothetical protein CISIN_1g034139mg [Citrus sinensis]
 gb|KDO46501.1| hypothetical protein CISIN_1g034144mg [Citrus sinensis]
 gb|KDO72916.1| hypothetical protein CISIN_1g034133mg [Citrus sinensis]
 gb|KDO73017.1| hypothetical protein CISIN_1g034148mg [Citrus sinensis]
 gb|KDP25531.1| hypothetical protein JCGZ_20687 [Jatropha curcas]
 gb|KDP25545.1| hypothetical protein JCGZ_20701 [Jatropha curcas]
 gb|KDP36400.1| hypothetical protein JCGZ_08669 [Jatropha curcas]
 gb|KDP44211.1| hypothetical protein JCGZ_05678 [Jatropha curcas]
 gb|KEH22067.1| histone H4 domain protein [Medicago truncatula]
 gb|KEH30080.1| histone H4 domain protein [Medicago truncatula]
 gb|KEH33936.1| histone H4 domain protein [Medicago truncatula]
 gb|KEH34158.1| histone H4 domain protein [Medicago truncatula]
 gb|KEH34159.1| histone H4 domain protein [Medicago truncatula]
 gb|KEH34165.1| histone H4 domain protein [Medicago truncatula]
 gb|KEH34182.1| histone H4 domain protein [Medicago truncatula]
 emb|CDP08969.1| unnamed protein product [Coffea canephora]
 emb|CDP09020.1| unnamed protein product [Coffea canephora]
 emb|CDP06635.1| unnamed protein product [Coffea canephora]
 emb|CDP00010.1| unnamed protein product [Coffea canephora]
 emb|CDP00068.1| unnamed protein product [Coffea canephora]
 emb|CDM82261.1| unnamed protein product [Triticum aestivum]
 emb|CDM84803.1| unnamed protein product [Triticum aestivum]
 gb|KFK27507.1| hypothetical protein AALP_AA8G392100 [Arabis alpina]
 gb|KFK27535.1| hypothetical protein AALP_AA8G395900 [Arabis alpina]
 gb|KFK33956.1| histone h4 [Arabis alpina]
 gb|KFK33958.1| hypothetical protein AALP_AA5G083900 [Arabis alpina]
 gb|KFK34624.1| hypothetical protein AALP_AA5G170000 [Arabis alpina]
 gb|KFK36645.1| hypothetical protein AALP_AA4G151600 [Arabis alpina]
 gb|KFK43086.1| hypothetical protein AALP_AA1G077500 [Arabis alpina]
 emb|CDY70247.1| BnaCnng67420D [Brassica napus]
 emb|CDY60565.1| BnaA02g06910D [Brassica napus]
 emb|CDY58832.1| BnaAnng15490D [Brassica napus]
 emb|CDY56098.1| BnaC02g44320D [Brassica napus]
 emb|CDY32809.1| BnaC08g02310D [Brassica napus]
 emb|CDY31726.1| BnaA04g16620D [Brassica napus]
 emb|CDY22719.1| BnaC08g43530D [Brassica napus]
 emb|CDY18434.1| BnaA04g21530D [Brassica napus]
 emb|CDY15777.1| BnaC04g15470D [Brassica napus]
 emb|CDY07783.1| BnaA03g17280D [Brassica napus]
 emb|CDY06280.1| BnaA09g49230D [Brassica napus]
 emb|CDY04583.1| BnaA07g14090D [Brassica napus]
 emb|CDX99135.1| BnaA06g18260D [Brassica napus]
 emb|CDX95760.1| BnaC03g26410D [Brassica napus]
 emb|CDX95121.1| BnaC05g05500D [Brassica napus]
 emb|CDX93616.1| BnaA06g04320D [Brassica napus]
 emb|CDX93630.1| BnaA06g04180D [Brassica napus]
 emb|CDX88717.1| BnaA03g09320D [Brassica napus]
 emb|CDX88290.1| BnaC06g37340D [Brassica napus]
 emb|CDX86050.1| BnaC03g55650D [Brassica napus]
 emb|CDX83302.1| BnaA03g22040D [Brassica napus]
 emb|CDX79740.1| BnaC03g20760D [Brassica napus]
 emb|CDX78198.1| BnaA09g33930D [Brassica napus]
 emb|CDX77204.1| BnaC04g39990D [Brassica napus]
 emb|CDX74951.1| BnaA05g06970D [Brassica napus]
 emb|CDX71081.1| BnaC03g11650D [Brassica napus]
 gb|KGN45824.1| Histone H4 [Cucumis sativus]
 gb|KGN47169.1| Histone H4 [Cucumis sativus]
 gb|KGN47170.1| hypothetical protein Csa_6G191580 [Cucumis sativus]
 gb|KGN47171.1| hypothetical protein Csa_6G192080 [Cucumis sativus]
 gb|KGN47172.1| Histone H4 [Cucumis sativus]
 gb|KGN47173.1| Histone H4 [Cucumis sativus]
 gb|KGN64733.1| hypothetical protein Csa_1G084320 [Cucumis sativus]
 gb|AIZ04727.1| histone 4 [Elettaria cardamomum]
 gb|AIZ04728.1| histone 4 [Nicotiana benthamiana]
 gb|KHN05358.1| Histone H4 [Glycine soja]
 gb|KHN05694.1| Histone H4 [Glycine soja]
 gb|KHN06242.1| Histone H4 [Glycine soja]
 gb|KHN09422.1| Histone H4 [Glycine soja]
 gb|KHN12566.1| Histone H4 [Glycine soja]
 gb|KHN12567.1| Histone H4 [Glycine soja]
 gb|KHN12568.1| Histone H4 [Glycine soja]
 gb|KHN22012.1| Histone H4 [Glycine soja]
 gb|KHN33428.1| Histone H4 [Glycine soja]
 gb|KHN40041.1| Histone H4 [Glycine soja]
 gb|KHN41537.1| Histone H4 [Glycine soja]
 gb|KHN48230.1| Histone H4 [Glycine soja]
 dbj|BAQ19379.1| histone H4 [Sarracenia purpurea]
 gb|KJB16932.1| hypothetical protein B456_002G255200 [Gossypium raimondii]
 gb|KJB20200.1| hypothetical protein B456_003G138000 [Gossypium raimondii]
 gb|KJB21608.1| hypothetical protein B456_004G002700 [Gossypium raimondii]
 gb|KJB21611.1| hypothetical protein B456_004G003000 [Gossypium raimondii]
 gb|KJB21620.1| hypothetical protein B456_004G004600 [Gossypium raimondii]
 gb|KJB21641.1| hypothetical protein B456_004G005900 [Gossypium raimondii]
 gb|KJB55990.1| hypothetical protein B456_009G102900 [Gossypium raimondii]
 gb|KJB70009.1| hypothetical protein B456_011G053000 [Gossypium raimondii]
 gb|KJB76718.1| hypothetical protein B456_012G102800 [Gossypium raimondii]
 gb|KJB83811.1| hypothetical protein B456_013G265800 [Gossypium raimondii]
 prf||1314298A histone H4
Length=103

 Score =   157 bits (397),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/78 (100%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>dbj|BAB71814.1| histone H4 [Citrus jambhiri]
Length=102

 Score =   157 bits (397),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/78 (100%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>ref|XP_008371481.1| PREDICTED: histone H4 [Malus domestica]
 ref|XP_008357955.1| PREDICTED: histone H4 [Malus domestica]
 ref|XP_008369869.1| PREDICTED: histone H4 [Malus domestica]
 ref|XP_008374142.1| PREDICTED: histone H4 [Malus domestica]
 ref|XP_008392655.1| PREDICTED: histone H4 [Malus domestica]
 ref|XP_008345826.1| PREDICTED: histone H4-like [Malus domestica]
 ref|XP_008352072.1| PREDICTED: histone H4-like [Malus domestica]
 ref|XP_008366332.1| PREDICTED: histone H4 [Malus domestica]
 ref|XP_008366723.1| PREDICTED: histone H4 [Malus domestica]
 ref|XP_009353713.1| PREDICTED: histone H4-like [Pyrus x bretschneideri]
 ref|XP_009357629.1| PREDICTED: histone H4-like [Pyrus x bretschneideri]
 ref|XP_009357701.1| PREDICTED: histone H4-like [Pyrus x bretschneideri]
 ref|XP_009358291.1| PREDICTED: histone H4-like [Pyrus x bretschneideri]
 ref|XP_009358344.1| PREDICTED: histone H4-like [Pyrus x bretschneideri]
 ref|XP_009360213.1| PREDICTED: histone H4-like [Pyrus x bretschneideri]
 ref|XP_009374675.1| PREDICTED: histone H4-like [Pyrus x bretschneideri]
 ref|XP_009379533.1| PREDICTED: histone H4-like [Pyrus x bretschneideri]
 ref|XP_009335939.1| PREDICTED: histone H4-like [Pyrus x bretschneideri]
 ref|XP_009338767.1| PREDICTED: histone H4-like [Pyrus x bretschneideri]
 ref|XP_009348695.1| PREDICTED: histone H4-like [Pyrus x bretschneideri]
 ref|XP_009350738.1| PREDICTED: histone H4-like [Pyrus x bretschneideri]
 gb|ADL36649.1| C3HL domain class transcription factor [Malus domestica]
 gb|ADL36654.1| C3HL domain class transcription factor [Malus domestica]
Length=103

 Score =   157 bits (397),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/78 (100%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>gb|ACG45974.1| histone H4 [Zea mays]
Length=103

 Score =   157 bits (397),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/78 (100%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>gb|ACG31067.1| histone H4 [Zea mays]
Length=103

 Score =   157 bits (397),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/78 (100%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>gb|ACG30729.1| histone H4 [Zea mays]
Length=103

 Score =   157 bits (397),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/78 (100%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>gb|ABD62753.1| histone 4 [Elaeis guineensis]
Length=103

 Score =   157 bits (397),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/78 (100%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>gb|AAT08725.1| histone H4 [Hyacinthus orientalis]
Length=103

 Score =   157 bits (397),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/78 (100%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>gb|ACX50406.1| histone H4 [Eriobotrya japonica]
Length=103

 Score =   157 bits (397),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/78 (100%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>sp|P62786.2|H42_WHEAT RecName: Full=Histone H4 variant TH091 [Triticum aestivum]
 gb|AAA34292.1| histone H4 [Triticum aestivum]
Length=103

 Score =   157 bits (397),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/78 (100%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>gb|KDP44162.1| hypothetical protein JCGZ_05629 [Jatropha curcas]
Length=103

 Score =   157 bits (396),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/78 (100%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>ref|XP_006388511.1| hypothetical protein POPTR_0168s00200g [Populus trichocarpa]
 gb|ERP47425.1| hypothetical protein POPTR_0168s00200g [Populus trichocarpa]
Length=155

 Score =   159 bits (401),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 106/127 (83%), Positives = 111/127 (87%), Gaps = 3/127 (2%)
 Frame = +1

Query  1    TSKSKSTCPIYLSLHQFKTLDFFFLSAKMSgrgkggkglgkggakrhrkVLRDNIQGITK  180
            T+   ST    ++L+Q   L    +  KMSGRGKGGKGLGKGGAKRHRKVLRDNIQGITK
Sbjct  28   TNSPNSTSSNQITLNQKTKLK---VCKKMSGRGKGGKGLGKGGAKRHRKVLRDNIQGITK  84

Query  181  PAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALK  360
            PAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALK
Sbjct  85   PAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALK  144

Query  361  RQGRTLY  381
            RQGRTLY
Sbjct  145  RQGRTLY  151



>gb|EMT13182.1| Histone H4 [Aegilops tauschii]
Length=96

 Score =   157 bits (396),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/78 (100%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT
Sbjct  15   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  74

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  75   VTAMDVVYALKRQGRTLY  92



>prf||1101277A histone H4
Length=102

 Score =   157 bits (396),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/78 (100%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT
Sbjct  21   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  80

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  81   VTAMDVVYALKRQGRTLY  98



>gb|ACG31293.1| histone H4 [Zea mays]
 gb|ACG40342.1| histone H4 [Zea mays]
Length=96

 Score =   157 bits (396),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/78 (100%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT
Sbjct  15   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  74

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  75   VTAMDVVYALKRQGRTLY  92



>gb|KDO73016.1| hypothetical protein CISIN_1g047769mg, partial [Citrus sinensis]
Length=131

 Score =   158 bits (399),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/78 (100%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT
Sbjct  50   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  109

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  110  VTAMDVVYALKRQGRTLY  127



>gb|ACD76815.1| histone 4 [Capsella bursa-pastoris]
Length=96

 Score =   157 bits (396),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/78 (100%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT
Sbjct  15   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  74

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  75   VTAMDVVYALKRQGRTLY  92



>gb|EYU41919.1| hypothetical protein MIMGU_mgv1a024124mg, partial [Erythranthe 
guttata]
Length=100

 Score =   157 bits (396),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/78 (100%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT
Sbjct  19   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  78

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  79   VTAMDVVYALKRQGRTLY  96



>ref|XP_004970498.1| PREDICTED: histone H4-like isoform X2 [Setaria italica]
Length=122

 Score =   157 bits (398),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/78 (100%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT
Sbjct  41   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  100

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  101  VTAMDVVYALKRQGRTLY  118



>gb|KJB83786.1| hypothetical protein B456_013G264400, partial [Gossypium raimondii]
Length=190

 Score =   159 bits (403),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 102/103 (99%), Positives = 103/103 (100%), Gaps = 0/103 (0%)
 Frame = +1

Query  73   LSAKMSgrgkggkglgkggakrhrkVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETR  252
            LS+KMSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETR
Sbjct  84   LSSKMSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETR  143

Query  253  GVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLY  381
            GVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLY
Sbjct  144  GVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLY  186



>gb|ACG31227.1| histone H4 [Zea mays]
Length=103

 Score =   157 bits (396),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/78 (100%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>ref|WP_039311122.1| hypothetical protein [Paenibacillus sp. IHB B 3415]
 gb|KHL91120.1| hypothetical protein QW71_36530 [Paenibacillus sp. IHB B 3415]
 gb|KHL91143.1| hypothetical protein QW71_36360 [Paenibacillus sp. IHB B 3415]
Length=93

 Score =   156 bits (395),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/78 (100%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT
Sbjct  12   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  71

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  72   VTAMDVVYALKRQGRTLY  89



>ref|XP_011087009.1| PREDICTED: histone H4-like, partial [Sesamum indicum]
Length=103

 Score =   157 bits (396),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/78 (100%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>ref|XP_007133245.1| hypothetical protein PHAVU_011G164000g [Phaseolus vulgaris]
 gb|ESW05239.1| hypothetical protein PHAVU_011G164000g [Phaseolus vulgaris]
Length=126

 Score =   157 bits (398),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/78 (100%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT
Sbjct  45   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  104

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  105  VTAMDVVYALKRQGRTLY  122



>gb|AHV84766.1| histone 4, partial [Codiaeum variegatum]
Length=82

 Score =   156 bits (394),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/78 (100%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT
Sbjct  1    VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  60

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  61   VTAMDVVYALKRQGRTLY  78



>ref|WP_033581588.1| hypothetical protein, partial [Dickeya zeae]
Length=89

 Score =   156 bits (394),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/78 (100%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT
Sbjct  9    VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  68

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  69   VTAMDVVYALKRQGRTLY  86



>tpg|DAA40122.1| TPA: histone H4.3 [Zea mays]
Length=248

 Score =   161 bits (407),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 78/78 (100%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT
Sbjct  167  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  226

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  227  VTAMDVVYALKRQGRTLY  244



>gb|ACG36136.1| histone H4 [Zea mays]
Length=111

 Score =   157 bits (396),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 78/78 (100%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>gb|EMS66043.1| Histone H4 [Triticum urartu]
Length=117

 Score =   157 bits (397),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 78/78 (100%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT
Sbjct  36   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  95

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  96   VTAMDVVYALKRQGRTLY  113



>gb|AHL19852.1| histone 4, partial [Plantago lanceolata]
Length=105

 Score =   157 bits (396),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 77/78 (99%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT
Sbjct  24   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  83

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTL+
Sbjct  84   VTAMDVVYALKRQGRTLW  101



>ref|XP_001416024.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 ref|XP_001420335.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 ref|XP_002502232.1| predicted protein [Micromonas sp. RCC299]
 ref|XP_003059520.1| predicted protein [Micromonas pusilla CCMP1545]
 ref|XP_003061514.1| histone H4 [Micromonas pusilla CCMP1545]
 ref|XP_003061756.1| predicted protein [Micromonas pusilla CCMP1545]
 ref|XP_003063038.1| predicted protein [Micromonas pusilla CCMP1545]
 ref|XP_005756361.1| putative histone H4 [Emiliania huxleyi CCMP1516]
 ref|XP_005759352.1| hypothetical protein EMIHUDRAFT_218631 [Emiliania huxleyi CCMP1516]
 ref|XP_005767506.1| hypothetical protein EMIHUDRAFT_246130 [Emiliania huxleyi CCMP1516]
 ref|XP_005775384.1| putative histone H4 [Emiliania huxleyi CCMP1516]
 ref|XP_005775448.1| putative histone H4 [Emiliania huxleyi CCMP1516]
 ref|XP_005787978.1| putative histone H4 [Emiliania huxleyi CCMP1516]
 ref|XP_008793894.1| PREDICTED: histone H4-like [Phoenix dactylifera]
 ref|XP_008789668.1| PREDICTED: histone H4-like [Phoenix dactylifera]
 ref|XP_008789671.1| PREDICTED: histone H4-like [Phoenix dactylifera]
 ref|XP_008794210.1| PREDICTED: histone H4-like [Phoenix dactylifera]
 ref|XP_008810510.1| PREDICTED: histone H4 [Phoenix dactylifera]
 ref|XP_008811309.1| PREDICTED: histone H4-like [Phoenix dactylifera]
 ref|XP_010914143.1| PREDICTED: histone H4-like [Elaeis guineensis]
 gb|ABO94316.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO98628.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|EEH52977.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH54144.1| histone H4 [Micromonas pusilla CCMP1545]
 gb|EEH54386.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH56652.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|ACO63490.1| predicted protein [Micromonas sp. RCC299]
 gb|AFK45965.1| unknown [Medicago truncatula]
 gb|EOD03932.1| putative histone H4 [Emiliania huxleyi CCMP1516]
 gb|EOD06923.1| hypothetical protein EMIHUDRAFT_218631 [Emiliania huxleyi CCMP1516]
 gb|EOD15077.1| hypothetical protein EMIHUDRAFT_246130 [Emiliania huxleyi CCMP1516]
 gb|EOD22955.1| putative histone H4 [Emiliania huxleyi CCMP1516]
 gb|EOD23019.1| putative histone H4 [Emiliania huxleyi CCMP1516]
 gb|EOD35549.1| putative histone H4 [Emiliania huxleyi CCMP1516]
 emb|CEF99670.1| Histone H4 [Ostreococcus tauri]
 emb|CEF96917.1| Histone H4 [Ostreococcus tauri]
 emb|CEF96918.1| Histone H4 [Ostreococcus tauri]
Length=103

 Score =   156 bits (395),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 77/78 (99%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHARRKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHARRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>ref|XP_006604532.1| PREDICTED: histone H4-like [Glycine max]
Length=156

 Score =   158 bits (400),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 101/101 (100%), Positives = 101/101 (100%), Gaps = 0/101 (0%)
 Frame = +1

Query  79   AKMSgrgkggkglgkggakrhrkVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGV  258
            AKMSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGV
Sbjct  52   AKMSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGV  111

Query  259  LKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLY  381
            LKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLY
Sbjct  112  LKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLY  152



>ref|XP_005354994.1| PREDICTED: histone H4-like isoform X1 [Microtus ochrogaster]
Length=113

 Score =   157 bits (396),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  32   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  91

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  92   VTAMDVVYALKRQGRTLY  109



>sp|P82888.2|H4_OLILU RecName: Full=Histone H4 [Olisthodiscus luteus]
Length=103

 Score =   156 bits (395),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 77/78 (99%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHARRKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHARRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>ref|XP_008385199.1| PREDICTED: histone H4-like [Malus domestica]
 ref|XP_008385200.1| PREDICTED: histone H4-like [Malus domestica]
 ref|XP_009354538.1| PREDICTED: histone H4 [Pyrus x bretschneideri]
Length=103

 Score =   156 bits (395),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 77/78 (99%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            +LRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT
Sbjct  22   ILRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>ref|XP_004251290.1| PREDICTED: histone H4-like [Solanum lycopersicum]
 ref|XP_010313539.1| PREDICTED: histone H4-like [Solanum lycopersicum]
Length=103

 Score =   156 bits (395),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 77/78 (99%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRD+VTYTEHARRKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDSVTYTEHARRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>ref|XP_004336819.1| histone H4, putative [Acanthamoeba castellanii str. Neff]
 ref|XP_004341447.1| histone H4, putative [Acanthamoeba castellanii str. Neff]
 ref|XP_004353724.1| Histone H4, putative [Acanthamoeba castellanii str. Neff]
 gb|ELR14806.1| histone H4, putative [Acanthamoeba castellanii str. Neff]
 gb|ELR19362.1| histone H4, putative [Acanthamoeba castellanii str. Neff]
 gb|ELR24196.1| Histone H4, putative [Acanthamoeba castellanii str. Neff]
Length=110

 Score =   156 bits (395),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISG+IYEETRGVLK+FLENVIRDAVTYTEHARRKT
Sbjct  29   VLRDNIQGITKPAIRRLARRGGVKRISGMIYEETRGVLKVFLENVIRDAVTYTEHARRKT  88

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  89   VTAMDVVYALKRQGRTLY  106



>gb|KHN23497.1| Histone H4 [Glycine soja]
Length=171

 Score =   158 bits (400),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 78/78 (100%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT
Sbjct  90   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  149

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  150  VTAMDVVYALKRQGRTLY  167


 Score = 75.1 bits (183),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGV  258
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRG+
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGL  58



>gb|KIY91537.1| Histone H4 [Monoraphidium neglectum]
 gb|KIY92178.1| Histone H4 [Monoraphidium neglectum]
 gb|KIY95417.1| Histone H4 [Monoraphidium neglectum]
 gb|KIY98573.1| Histone H4 [Monoraphidium neglectum]
 gb|KIY99856.1| Histone H4 [Monoraphidium neglectum]
 gb|KIZ00863.1| Histone H4 [Monoraphidium neglectum]
 gb|KIZ03645.1| Histone H4 [Monoraphidium neglectum]
Length=103

 Score =   156 bits (395),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENV+RDAVTYTEHARRKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVVRDAVTYTEHARRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>ref|XP_008394212.1| PREDICTED: histone H4-like [Malus domestica]
Length=122

 Score =   157 bits (396),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 78/78 (100%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>ref|XP_004019372.1| PREDICTED: histone H4-like [Ovis aries]
Length=151

 Score =   157 bits (398),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  70   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  129

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  130  VTAMDVVYALKRQGRTLY  147



>ref|XP_010186634.1| PREDICTED: histone H4-like isoform X2 [Mesitornis unicolor]
Length=110

 Score =   156 bits (395),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  29   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  88

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  89   VTAMDVVYALKRQGRTLY  106



>emb|CAF87814.1| unnamed protein product [Tetraodon nigroviridis]
Length=102

 Score =   156 bits (394),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  21   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  80

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  81   VTAMDVVYALKRQGRTLY  98



>gb|ACG25493.1| histone H4 [Zea mays]
 gb|ACG31232.1| histone H4 [Zea mays]
 gb|ACG36629.1| histone H4 [Zea mays]
Length=103

 Score =   156 bits (394),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 77/78 (99%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEE+RGVLKIFLENVIRDAVTYTEHARRKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEESRGVLKIFLENVIRDAVTYTEHARRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>gb|EFB21580.1| hypothetical protein PANDA_016833 [Ailuropoda melanoleuca]
Length=106

 Score =   156 bits (394),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 99/101 (98%), Positives = 101/101 (100%), Gaps = 0/101 (0%)
 Frame = +1

Query  79   AKMSgrgkggkglgkggakrhrkVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGV  258
            AKMSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGV
Sbjct  2    AKMSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGV  61

Query  259  LKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLY  381
            LK+FLENVIRDAVTYTEHA+RKTVTAMDVVYALKRQGRTLY
Sbjct  62   LKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLY  102



>ref|XP_010093858.1| Histone H4 [Morus notabilis]
 gb|EXB54746.1| Histone H4 [Morus notabilis]
Length=136

 Score =   157 bits (397),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 78/78 (100%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>gb|ACG36021.1| histone H4 [Zea mays]
Length=103

 Score =   156 bits (394),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 77/78 (99%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMD+VYALKRQGRTLY
Sbjct  82   VTAMDLVYALKRQGRTLY  99



>gb|EOB06757.1| Histone H4, partial [Anas platyrhynchos]
Length=107

 Score =   156 bits (394),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  26   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  85

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  86   VTAMDVVYALKRQGRTLY  103



>ref|XP_006292004.1| hypothetical protein CARUB_v10018191mg [Capsella rubella]
 gb|EOA24902.1| hypothetical protein CARUB_v10018191mg [Capsella rubella]
Length=149

 Score =   157 bits (398),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 78/78 (100%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT
Sbjct  68   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  127

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  128  VTAMDVVYALKRQGRTLY  145



>gb|EMC86813.1| Histone H4, partial [Columba livia]
Length=108

 Score =   156 bits (394),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  27   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  86

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  87   VTAMDVVYALKRQGRTLY  104



>ref|XP_002928591.1| PREDICTED: histone H4-like [Ailuropoda melanoleuca]
Length=107

 Score =   156 bits (394),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  26   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  85

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  86   VTAMDVVYALKRQGRTLY  103



>gb|EMC89188.1| Histone H4, partial [Columba livia]
Length=108

 Score =   156 bits (394),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  27   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  86

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  87   VTAMDVVYALKRQGRTLY  104



>emb|CAB01913.1| Histone H4 homologue [Sesbania rostrata]
Length=103

 Score =   156 bits (394),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 77/78 (99%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLA+RGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT
Sbjct  22   VLRDNIQGITKPAIRRLAKRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>ref|NP_001234118.1| histone H4 [Solanum lycopersicum]
 ref|NP_001234121.1| histone H4 [Solanum lycopersicum]
 ref|XP_004239779.1| PREDICTED: histone H4 [Solanum lycopersicum]
 ref|XP_004241478.1| PREDICTED: histone H4 [Solanum lycopersicum]
 ref|XP_004251292.1| PREDICTED: histone H4 [Solanum lycopersicum]
 ref|XP_006340089.1| PREDICTED: histone H4-like [Solanum tuberosum]
 ref|XP_006345944.1| PREDICTED: histone H4-like [Solanum tuberosum]
 ref|XP_006345945.1| PREDICTED: histone H4-like [Solanum tuberosum]
 ref|XP_006350753.1| PREDICTED: histone H4-like [Solanum tuberosum]
 ref|XP_006350754.1| PREDICTED: histone H4-like [Solanum tuberosum]
 ref|XP_006350755.1| PREDICTED: histone H4-like [Solanum tuberosum]
 ref|XP_006361210.1| PREDICTED: histone H4-like [Solanum tuberosum]
 ref|XP_006361211.1| PREDICTED: histone H4-like [Solanum tuberosum]
 ref|XP_006363342.1| PREDICTED: histone H4-like [Solanum tuberosum]
 ref|XP_006365711.1| PREDICTED: histone H4-like [Solanum tuberosum]
 sp|P35057.2|H4_SOLLC RecName: Full=Histone H4 [Solanum lycopersicum]
 sp|Q6V9I2.3|H4_SOLCH RecName: Full=Histone H4 [Solanum chacoense]
 sp|Q71V09.3|H4_CAPAN RecName: Full=Histone H4; AltName: Full=CaH4 [Capsicum annuum]
 emb|CAA48923.1| histone H4 [Solanum lycopersicum]
 emb|CAA48924.1| histone H4 [Solanum lycopersicum]
 gb|AAB94924.1| histone H4 [Capsicum annuum]
 gb|AAQ24536.1| histone H4 [Solanum chacoense]
Length=103

 Score =   156 bits (394),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 77/78 (99%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRD+VTYTEHARRKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDSVTYTEHARRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>gb|EMS59070.1| Histone H4 [Triticum urartu]
Length=103

 Score =   156 bits (394),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 77/78 (99%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VT+MDVVYALKRQGRTLY
Sbjct  82   VTSMDVVYALKRQGRTLY  99



>ref|XP_009600594.1| PREDICTED: histone H4-like [Nicotiana tomentosiformis]
 ref|XP_009794327.1| PREDICTED: histone H4-like [Nicotiana sylvestris]
 ref|XP_009794328.1| PREDICTED: histone H4-like [Nicotiana sylvestris]
 gb|ABK21562.1| unknown [Picea sitchensis]
 gb|ABK25293.1| unknown [Picea sitchensis]
 dbj|BAF36442.1| histone H4 [Nicotiana tabacum]
 gb|ABR18013.1| unknown [Picea sitchensis]
 gb|ACN41223.1| unknown [Picea sitchensis]
 gb|ADE76767.1| unknown [Picea sitchensis]
Length=103

 Score =   156 bits (394),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 77/78 (99%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVY+LKRQGRTLY
Sbjct  82   VTAMDVVYSLKRQGRTLY  99



>ref|XP_008055796.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103259955 
[Tarsius syrichta]
Length=324

 Score =   162 bits (411),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 106/123 (86%), Positives = 112/123 (91%), Gaps = 2/123 (2%)
 Frame = +1

Query  13   KSTCPIYLSLHQFKTLDFFFLSAKMSgrgkggkglgkggakrhrkVLRDNIQGITKPAIR  192
            +  C  YL +  F+  +F FLSA MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIR
Sbjct  200  QEACEAYL-VGLFEDTNFAFLSA-MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIR  257

Query  193  RLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGR  372
            RLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKTVTAMDVVYALKRQGR
Sbjct  258  RLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGR  317

Query  373  TLY  381
            TLY
Sbjct  318  TLY  320


 Score =   153 bits (387),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  81

Query  328  VTAMDVVYALKRQGRTL  378
            VTAMDVVYALKRQGRTL
Sbjct  82   VTAMDVVYALKRQGRTL  98



>ref|XP_010854387.1| PREDICTED: histone H4-like [Bison bison bison]
Length=103

 Score =   156 bits (394),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>gb|EFB20853.1| hypothetical protein PANDA_018545 [Ailuropoda melanoleuca]
Length=108

 Score =   156 bits (394),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  27   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  86

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  87   VTAMDVVYALKRQGRTLY  104



>gb|EMC89184.1| Histone H4, partial [Columba livia]
Length=107

 Score =   156 bits (394),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  26   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  85

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  86   VTAMDVVYALKRQGRTLY  103



>dbj|BAD27407.1| histone H4 [Lactuca sativa]
Length=103

 Score =   155 bits (393),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 77/78 (99%), Positives = 77/78 (99%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAV YTEHARRKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVAYTEHARRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>ref|XP_011234700.1| PREDICTED: histone H4-like [Ailuropoda melanoleuca]
Length=117

 Score =   156 bits (395),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  36   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  95

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  96   VTAMDVVYALKRQGRTLY  113



>ref|XP_008262729.1| PREDICTED: histone H4-like [Oryctolagus cuniculus]
Length=103

 Score =   155 bits (393),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>ref|XP_010829397.1| PREDICTED: histone H4-like [Bison bison bison]
Length=110

 Score =   156 bits (394),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  29   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  88

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  89   VTAMDVVYALKRQGRTLY  106



>gb|EHB12217.1| Histone H4 [Heterocephalus glaber]
Length=98

 Score =   155 bits (393),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  17   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  76

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  77   VTAMDVVYALKRQGRTLY  94



>emb|CAF93557.1| unnamed protein product, partial [Tetraodon nigroviridis]
 emb|CAF88891.1| unnamed protein product, partial [Tetraodon nigroviridis]
 emb|CAF93209.1| unnamed protein product, partial [Tetraodon nigroviridis]
 emb|CAF98789.1| unnamed protein product, partial [Tetraodon nigroviridis]
 gb|ELR56324.1| hypothetical protein M91_06918, partial [Bos mutus]
 gb|ELR57818.1| hypothetical protein M91_00002, partial [Bos mutus]
Length=99

 Score =   155 bits (393),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>ref|XP_006733830.1| PREDICTED: histone H4-like isoform X2 [Leptonychotes weddellii]
Length=123

 Score =   156 bits (395),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  42   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  101

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  102  VTAMDVVYALKRQGRTLY  119



>gb|EOB06745.1| Histone H4, partial [Anas platyrhynchos]
Length=105

 Score =   155 bits (393),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  24   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  83

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  84   VTAMDVVYALKRQGRTLY  101



>emb|CBJ33198.1| histone H4 [Ectocarpus siliculosus]
Length=106

 Score =   155 bits (393),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRD+VTYTEHARRKT
Sbjct  25   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDSVTYTEHARRKT  84

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  85   VTAMDVVYALKRQGRTLY  102



>ref|XP_008691182.1| PREDICTED: histone H4-like [Ursus maritimus]
Length=120

 Score =   156 bits (395),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  39   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  98

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  99   VTAMDVVYALKRQGRTLY  116



>ref|XP_003422329.2| PREDICTED: histone H4-like [Loxodonta africana]
Length=111

 Score =   156 bits (394),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  30   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  89

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  90   VTAMDVVYALKRQGRTLY  107



>ref|XP_009556893.1| PREDICTED: histone H4-like [Cuculus canorus]
Length=107

 Score =   155 bits (393),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  26   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  85

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  86   VTAMDVVYALKRQGRTLY  103



>gb|KHN02424.1| Histone H4 [Glycine soja]
Length=103

 Score =   155 bits (393),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 77/77 (100%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +1

Query  151  LRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTV  330
            LRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTV
Sbjct  23   LRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTV  82

Query  331  TAMDVVYALKRQGRTLY  381
            TAMDVVYALKRQGRTLY
Sbjct  83   TAMDVVYALKRQGRTLY  99



>ref|XP_004899300.1| PREDICTED: histone H4-like [Heterocephalus glaber]
 gb|EHB12216.1| Histone H4 [Heterocephalus glaber]
Length=109

 Score =   156 bits (394),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>gb|EMT17606.1| Histone H4 [Aegilops tauschii]
Length=103

 Score =   155 bits (393),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 77/78 (99%), Positives = 77/78 (99%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGR LY
Sbjct  82   VTAMDVVYALKRQGRALY  99



>ref|XP_006162773.1| PREDICTED: histone H4-like, partial [Tupaia chinensis]
Length=104

 Score =   155 bits (393),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>ref|XP_010357626.1| PREDICTED: histone H4-like, partial [Rhinopithecus roxellana]
 gb|ELU17679.1| hypothetical protein CAPTEDRAFT_60942, partial [Capitella teleta]
Length=100

 Score =   155 bits (393),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>gb|EFB20867.1| hypothetical protein PANDA_018564 [Ailuropoda melanoleuca]
Length=106

 Score =   155 bits (393),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  25   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  84

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  85   VTAMDVVYALKRQGRTLY  102



>gb|EFB20862.1| hypothetical protein PANDA_018556 [Ailuropoda melanoleuca]
Length=104

 Score =   155 bits (393),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  23   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  82

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  83   VTAMDVVYALKRQGRTLY  100



>gb|ELV13477.1| Histone H4, partial [Tupaia chinensis]
Length=104

 Score =   155 bits (393),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  23   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  82

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  83   VTAMDVVYALKRQGRTLY  100



>gb|EFB20846.1| hypothetical protein PANDA_018537 [Ailuropoda melanoleuca]
Length=107

 Score =   155 bits (393),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  26   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  85

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  86   VTAMDVVYALKRQGRTLY  103



>pdb|3A6N|B Chain B, The Nucleosome Containing A Testis-Specific Histone 
Variant, Human H3t
 pdb|3A6N|F Chain F, The Nucleosome Containing A Testis-Specific Histone 
Variant, Human H3t
 pdb|3AFA|B Chain B, The Human Nucleosome Structure
 pdb|3AFA|F Chain F, The Human Nucleosome Structure
 pdb|3AV1|B Chain B, The Human Nucleosome Structure Containing The Histone 
Variant H3.2
 pdb|3AV1|F Chain F, The Human Nucleosome Structure Containing The Histone 
Variant H3.2
 pdb|3AV2|B Chain B, The Human Nucleosome Structure Containing The Histone 
Variant H3.3
 pdb|3AV2|F Chain F, The Human Nucleosome Structure Containing The Histone 
Variant H3.3
 pdb|3AN2|B Chain B, The Structure Of The Centromeric Nucleosome Containing 
Cenp-A
 pdb|3AN2|F Chain F, The Structure Of The Centromeric Nucleosome Containing 
Cenp-A
 pdb|3AYW|B Chain B, Crystal Structure Of Human Nucleosome Core Particle 
Containing H3k56q Mutation
 pdb|3AYW|F Chain F, Crystal Structure Of Human Nucleosome Core Particle 
Containing H3k56q Mutation
 pdb|3AZE|B Chain B, Crystal Structure Of Human Nucleosome Core Particle 
Containing H3k64q Mutation
 pdb|3AZE|F Chain F, Crystal Structure Of Human Nucleosome Core Particle 
Containing H3k64q Mutation
 pdb|3AZF|B Chain B, Crystal Structure Of Human Nucleosome Core Particle 
Containing H3k79q Mutation
 pdb|3AZF|F Chain F, Crystal Structure Of Human Nucleosome Core Particle 
Containing H3k79q Mutation
 pdb|3AZG|B Chain B, Crystal Structure Of Human Nucleosome Core Particle 
Containing H3k115q Mutation
 pdb|3AZG|F Chain F, Crystal Structure Of Human Nucleosome Core Particle 
Containing H3k115q Mutation
 pdb|3AZH|B Chain B, Crystal Structure Of Human Nucleosome Core Particle 
Containing H3k122q Mutation
 pdb|3AZH|F Chain F, Crystal Structure Of Human Nucleosome Core Particle 
Containing H3k122q Mutation
 pdb|3W96|B Chain B, Crystal Structure Of Human Nucleosome Core Particle 
Lacking H2a N- Terminal Region
 pdb|3W96|F Chain F, Crystal Structure Of Human Nucleosome Core Particle 
Lacking H2a N- Terminal Region
 pdb|3W97|B Chain B, Crystal Structure Of Human Nucleosome Core Particle 
Lacking H2b N- Terminal Region
 pdb|3W97|F Chain F, Crystal Structure Of Human Nucleosome Core Particle 
Lacking H2b N- Terminal Region
 pdb|3W98|B Chain B, Crystal Structure Of Human Nucleosome Core Particle 
Lacking H3.1 N- Terminal Region
 pdb|3W98|F Chain F, Crystal Structure Of Human Nucleosome Core Particle 
Lacking H3.1 N- Terminal Region
 pdb|3WA9|B Chain B, The Nucleosome Containing Human H2a.z.1
 pdb|3WA9|F Chain F, The Nucleosome Containing Human H2a.z.1
 pdb|3WAA|B Chain B, The Nucleosome Containing Human H2a.z.2
 pdb|3WAA|F Chain F, The Nucleosome Containing Human H2a.z.2
 pdb|3WKJ|B Chain B, The Nucleosome Containing Human Tsh2b
 pdb|3WKJ|F Chain F, The Nucleosome Containing Human Tsh2b
 pdb|3WTP|B Chain B, Crystal Structure Of The Heterotypic Nucleosome Containing 
Human Cenp- A And H3.3
 pdb|3WTP|F Chain F, Crystal Structure Of The Heterotypic Nucleosome Containing 
Human Cenp- A And H3.3
Length=106

 Score =   155 bits (393),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  25   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  84

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  85   VTAMDVVYALKRQGRTLY  102



>pdb|1KX3|B Chain B, X-Ray Structure Of The Nucleosome Core Particle, Ncp146, 
At 2.0 A Resolution
 pdb|1KX3|F Chain F, X-Ray Structure Of The Nucleosome Core Particle, Ncp146, 
At 2.0 A Resolution
 pdb|1KX4|B Chain B, X-Ray Structure Of The Nucleosome Core Particle, Ncp146b, 
At 2.6 A Resolution
 pdb|1KX4|F Chain F, X-Ray Structure Of The Nucleosome Core Particle, Ncp146b, 
At 2.6 A Resolution
 pdb|1KX5|B Chain B, X-ray Structure Of The Nucleosome Core Particle, Ncp147, 
At 1.9 A Resolution
 pdb|1KX5|F Chain F, X-ray Structure Of The Nucleosome Core Particle, Ncp147, 
At 1.9 A Resolution
 pdb|1M18|B Chain B, Ligand Binding Alters The Structure And Dynamics Of 
Nucleosomal Dna
 pdb|1M18|F Chain F, Ligand Binding Alters The Structure And Dynamics Of 
Nucleosomal Dna
 pdb|1M19|B Chain B, Ligand Binding Alters The Structure And Dynamics Of 
Nucleosomal Dna
 pdb|1M19|F Chain F, Ligand Binding Alters The Structure And Dynamics Of 
Nucleosomal Dna
 pdb|1M1A|B Chain B, Ligand Binding Alters The Structure And Dynamics Of 
Nucleosomal Dna
 pdb|1M1A|F Chain F, Ligand Binding Alters The Structure And Dynamics Of 
Nucleosomal Dna
 pdb|1P34|B Chain B, Crystallographic Studies Of Nucleosome Core Particles 
Containing Histone 'sin' Mutants
 pdb|1P34|F Chain F, Crystallographic Studies Of Nucleosome Core Particles 
Containing Histone 'sin' Mutants
 pdb|1P3A|B Chain B, Crystallographic Studies Of Nucleosome Core Particles 
Containing Histone 'sin' Mutants
 pdb|1P3A|F Chain F, Crystallographic Studies Of Nucleosome Core Particles 
Containing Histone 'sin' Mutants
 pdb|1P3K|B Chain B, Crystallographic Studies Of Nucleosome Core Particles 
Containing Histone 'sin' Mutants
 pdb|1P3K|F Chain F, Crystallographic Studies Of Nucleosome Core Particles 
Containing Histone 'sin' Mutants
 pdb|1P3L|B Chain B, Crystallographic Studies Of Nucleosome Core Particles 
Containing Histone 'sin' Mutants
 pdb|1P3L|F Chain F, Crystallographic Studies Of Nucleosome Core Particles 
Containing Histone 'sin' Mutants
 pdb|1P3M|B Chain B, Crystallographic Studies Of Nucleosome Core Particles 
Containing Histone 'sin' Mutants
 pdb|1P3M|F Chain F, Crystallographic Studies Of Nucleosome Core Particles 
Containing Histone 'sin' Mutants
 pdb|1S32|B Chain B, Molecular Recognition Of The Nucleosomal 'supergroove'
 pdb|1S32|F Chain F, Molecular Recognition Of The Nucleosomal 'supergroove'
 pdb|1ZBB|B Chain B, Structure Of The 4_601_167 Tetranucleosome
 pdb|1ZBB|F Chain F, Structure Of The 4_601_167 Tetranucleosome
 pdb|1ZBB|BB Chain b, Structure Of The 4_601_167 Tetranucleosome
 pdb|1ZBB|FF Chain f, Structure Of The 4_601_167 Tetranucleosome
 pdb|1ZLA|B Chain B, X-Ray Structure Of A Kaposi's Sarcoma Herpesvirus Lana 
Peptide Bound To The Nucleosomal Core
 pdb|1ZLA|F Chain F, X-Ray Structure Of A Kaposi's Sarcoma Herpesvirus Lana 
Peptide Bound To The Nucleosomal Core
 pdb|2FJ7|B Chain B, Crystal Structure Of Nucleosome Core Particle Containing 
A Poly (Da.Dt) Sequence Element
 pdb|2FJ7|F Chain F, Crystal Structure Of Nucleosome Core Particle Containing 
A Poly (Da.Dt) Sequence Element
 pdb|2IO5|C Chain C, Crystal Structure Of The Cia- Histone H3-H4 Complex
 pdb|2NZD|B Chain B, Nucleosome Core Particle Containing 145 Bp Of Dna
 pdb|2NZD|F Chain F, Nucleosome Core Particle Containing 145 Bp Of Dna
 pdb|3B6F|B Chain B, Nucleosome Core Particle Treated With Cisplatin
 pdb|3B6F|F Chain F, Nucleosome Core Particle Treated With Cisplatin
 pdb|3B6G|B Chain B, Nucleosome Core Particle Treated With Oxaliplatin
 pdb|3B6G|F Chain F, Nucleosome Core Particle Treated With Oxaliplatin
 pdb|3C1C|B Chain B, The Effect Of H3 K79 Dimethylation And H4 K20 Trimethylation 
On Nucleosome And Chromatin Structure
 pdb|3C1C|F Chain F, The Effect Of H3 K79 Dimethylation And H4 K20 Trimethylation 
On Nucleosome And Chromatin Structure
 pdb|3C9K|D Chain D, Model Of Histone Octamer Tubular Crystals
 pdb|3C9K|H Chain H, Model Of Histone Octamer Tubular Crystals
 pdb|3KUY|B Chain B, Dna Stretching In The Nucleosome Facilitates Alkylation 
By An Intercalating Antitumor Agent
 pdb|3KUY|F Chain F, Dna Stretching In The Nucleosome Facilitates Alkylation 
By An Intercalating Antitumor Agent
 pdb|3LJA|B Chain B, Using Soft X-rays For A Detailed Picture Of Divalent 
Metal Binding In The Nucleosome
 pdb|3LJA|F Chain F, Using Soft X-rays For A Detailed Picture Of Divalent 
Metal Binding In The Nucleosome
 pdb|3LEL|B Chain B, Structural Insight Into The Sequence-Dependence Of Nucleosom 
Positioning
 pdb|3LEL|F Chain F, Structural Insight Into The Sequence-Dependence Of Nucleosom 
Positioning
 pdb|3LEL|L Chain L, Structural Insight Into The Sequence-Dependence Of Nucleosom 
Positioning
 pdb|3LEL|P Chain P, Structural Insight Into The Sequence-Dependence Of Nucleosom 
Positioning
 pdb|3MGP|B Chain B, Binding Of Cobalt Ions To The Nucleosome Core Particle
 pdb|3MGP|F Chain F, Binding Of Cobalt Ions To The Nucleosome Core Particle
 pdb|3MGQ|B Chain B, Binding Of Nickel Ions To The Nucleosome Core Particle
 pdb|3MGQ|F Chain F, Binding Of Nickel Ions To The Nucleosome Core Particle
 pdb|3MGR|B Chain B, Binding Of Rubidium Ions To The Nucleosome Core Particle
 pdb|3MGR|F Chain F, Binding Of Rubidium Ions To The Nucleosome Core Particle
 pdb|3MGS|B Chain B, Binding Of Cesium Ions To The Nucleosome Core Particle
 pdb|3MGS|F Chain F, Binding Of Cesium Ions To The Nucleosome Core Particle
 pdb|3KXB|B Chain B, Structural Characterization Of H3k56q Nucleosomes And 
Nucleosomal Arrays
 pdb|3KXB|F Chain F, Structural Characterization Of H3k56q Nucleosomes And 
Nucleosomal Arrays
 pdb|3MVD|B Chain B, Crystal Structure Of The Chromatin Factor Rcc1 In Complex 
With The Nucleosome Core Particle
 pdb|3MVD|F Chain F, Crystal Structure Of The Chromatin Factor Rcc1 In Complex 
With The Nucleosome Core Particle
 pdb|3LZ0|B Chain B, Crystal Structure Of Nucleosome Core Particle Composed 
Of The Widom 601 Dna Sequence (Orientation 1)
 pdb|3LZ0|F Chain F, Crystal Structure Of Nucleosome Core Particle Composed 
Of The Widom 601 Dna Sequence (Orientation 1)
 pdb|3LZ1|B Chain B, Crystal Structure Of Nucleosome Core Particle Composed 
Of The Widom 601 Dna Sequence (Orientation 2)
 pdb|3LZ1|F Chain F, Crystal Structure Of Nucleosome Core Particle Composed 
Of The Widom 601 Dna Sequence (Orientation 2)
 pdb|3O62|B Chain B, Nucleosome Core Particle Modified With A Cisplatin 1,3-Cis-{pt(Nh3) 
2}2+-D(Gptpg) Intrastrand Cross-Link
 pdb|3O62|F Chain F, Nucleosome Core Particle Modified With A Cisplatin 1,3-Cis-{pt(Nh3) 
2}2+-D(Gptpg) Intrastrand Cross-Link
 pdb|3MNN|B Chain B, A Ruthenium Antitumour Agent Forms Specific Histone 
Protein Adducts In The Nucleosome Core
 pdb|3MNN|F Chain F, A Ruthenium Antitumour Agent Forms Specific Histone 
Protein Adducts In The Nucleosome Core
 pdb|3TU4|B Chain B, Crystal Structure Of The Sir3 Bah Domain In Complex 
With A Nucleosome Core Particle.
 pdb|3TU4|F Chain F, Crystal Structure Of The Sir3 Bah Domain In Complex 
With A Nucleosome Core Particle.
 pdb|3REH|B Chain B, 2.5 Angstrom Crystal Structure Of The Nucleosome Core 
Particle Assembled With A 145 Bp Alpha-Satellite Dna (Ncp145)
 pdb|3REH|F Chain F, 2.5 Angstrom Crystal Structure Of The Nucleosome Core 
Particle Assembled With A 145 Bp Alpha-Satellite Dna (Ncp145)
 pdb|3REI|B Chain B, 2.65 Angstrom Crystal Structure Of The Nucleosome Core 
Particle Assembled With A 145 Bp Alpha-Satellite Dna (Ncp145) 
Derivatized With Triamminechloroplatinum(Ii) Chloride
 pdb|3REI|F Chain F, 2.65 Angstrom Crystal Structure Of The Nucleosome Core 
Particle Assembled With A 145 Bp Alpha-Satellite Dna (Ncp145) 
Derivatized With Triamminechloroplatinum(Ii) Chloride
 pdb|3REJ|B Chain B, 2.55 Angstrom Crystal Structure Of The Nucleosome Core 
Particle Assembled With A 146 Bp Alpha-Satellite Dna (Ncp146b)
 pdb|3REJ|F Chain F, 2.55 Angstrom Crystal Structure Of The Nucleosome Core 
Particle Assembled With A 146 Bp Alpha-Satellite Dna (Ncp146b)
 pdb|3REK|B Chain B, 2.6 Angstrom Crystal Structure Of The Nucleosome Core 
Particle Assembled With A 146 Bp Alpha-Satellite Dna (Ncp146b) 
Derivatized With Oxaliplatin
 pdb|3REK|F Chain F, 2.6 Angstrom Crystal Structure Of The Nucleosome Core 
Particle Assembled With A 146 Bp Alpha-Satellite Dna (Ncp146b) 
Derivatized With Oxaliplatin
 pdb|3REL|B Chain B, 2.7 Angstrom Crystal Structure Of The Nucleosome Core 
Particle Assembled With A 146 Bp Alpha-Satellite Dna (Ncp146b) 
Derivatized With Triamminechloroplatinum(Ii) Chloride
 pdb|3REL|F Chain F, 2.7 Angstrom Crystal Structure Of The Nucleosome Core 
Particle Assembled With A 146 Bp Alpha-Satellite Dna (Ncp146b) 
Derivatized With Triamminechloroplatinum(Ii) Chloride
 pdb|3UT9|B Chain B, Crystal Structure Of Nucleosome Core Particle Assembled 
With A Palindromic Widom '601' Derivative (ncp-601l)
 pdb|3UT9|F Chain F, Crystal Structure Of Nucleosome Core Particle Assembled 
With A Palindromic Widom '601' Derivative (ncp-601l)
 pdb|3UTA|B Chain B, Crystal Structure Of Nucleosome Core Particle Assembled 
With An Alpha- Satellite Sequence Containing Two Ttaaa Elements 
(ncp-ta2)
 pdb|3UTA|F Chain F, Crystal Structure Of Nucleosome Core Particle Assembled 
With An Alpha- Satellite Sequence Containing Two Ttaaa Elements 
(ncp-ta2)
 pdb|3UTB|B Chain B, Crystal Structure Of Nucleosome Core Particle Assembled 
With The 146b Alpha-satellite Sequence (ncp146b)
 pdb|3UTB|F Chain F, Crystal Structure Of Nucleosome Core Particle Assembled 
With The 146b Alpha-satellite Sequence (ncp146b)
 pdb|4H9N|B Chain B, Complex Structure 1 Of DaxxH3.3(SUB5)H4
 pdb|4H9O|B Chain B, Complex Structure 2 Of DaxxH3.3(SUB5,G90M)H4
 pdb|4H9P|B Chain B, Complex Structure 3 Of DaxxH3.3(SUB5,G90A)H4
 pdb|4H9Q|B Chain B, Complex Structure 4 Of Daxx(E225a)H3.3(SUB5)H4
 pdb|4H9R|B Chain B, Complex Structure 5 Of Daxx(E225a)H3.3(SUB5,G90A)H4
 pdb|4J8U|B Chain B, X-ray Structure Of Ncp145 With Chlorido(eta-6-p-cymene)(n-phenyl-2- 
Pyridinecarbothioamide)osmium(ii)
 pdb|4J8U|F Chain F, X-ray Structure Of Ncp145 With Chlorido(eta-6-p-cymene)(n-phenyl-2- 
Pyridinecarbothioamide)osmium(ii)
 pdb|4J8W|B Chain B, X-ray Structure Of Ncp145 With Chlorido(eta-6-p-cymene)(n- 
Fluorophenyl-2-pyridinecarbothioamide)osmium(ii)
 pdb|4J8W|F Chain F, X-ray Structure Of Ncp145 With Chlorido(eta-6-p-cymene)(n- 
Fluorophenyl-2-pyridinecarbothioamide)osmium(ii)
 pdb|4J8V|B Chain B, X-ray Structure Of Ncp145 With Bound Chlorido(eta-6-p-cymene)(n- 
Phenyl-2-pyridinecarbothioamide)ruthenium(ii)
 pdb|4J8V|F Chain F, X-ray Structure Of Ncp145 With Bound Chlorido(eta-6-p-cymene)(n- 
Phenyl-2-pyridinecarbothioamide)ruthenium(ii)
 pdb|4J8X|B Chain B, X-ray Structure Of Ncp145 With Bound Chlorido(eta-6-p-cymene)(n- 
Fluorophenyl-2-pyridinecarbothioamide)ruthenium(ii)
 pdb|4J8X|F Chain F, X-ray Structure Of Ncp145 With Bound Chlorido(eta-6-p-cymene)(n- 
Fluorophenyl-2-pyridinecarbothioamide)ruthenium(ii)
 pdb|4R8P|B Chain B, Crystal Structure Of The Ring1b/bmi1/ubch5c Prc1 Ubiquitylation 
Module Bound To The Nucleosome Core Particle
 pdb|4R8P|F Chain F, Crystal Structure Of The Ring1b/bmi1/ubch5c Prc1 Ubiquitylation 
Module Bound To The Nucleosome Core Particle
 gb|AAI11814.1| Hist4h4 protein, partial [Mus musculus]
 gb|AAI19612.1| Hist1h4d protein, partial [Mus musculus]
 gb|KFR05902.1| Histone H4, partial [Opisthocomus hoazin]
 gb|KFR05906.1| Histone H4, partial [Opisthocomus hoazin]
Length=102

 Score =   155 bits (393),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  21   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  80

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  81   VTAMDVVYALKRQGRTLY  98



>gb|AAX36141.1| histone 2 H4 [synthetic construct]
Length=104

 Score =   155 bits (393),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>ref|XP_010856115.1| PREDICTED: histone H4-like [Bison bison bison]
Length=103

 Score =   155 bits (393),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>ref|NP_001099176.1| histone 1, H4, like [Danio rerio]
 emb|CAM12247.1| histone h4 [Danio rerio]
Length=103

 Score =   155 bits (393),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>ref|XP_006888736.1| PREDICTED: histone H4-like [Elephantulus edwardii]
Length=114

 Score =   156 bits (394),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>gb|ACR38890.1| histone H4 [Pellia endiviifolia (species B)]
 gb|ACR38899.1| histone H4 [Pellia endiviifolia (species B)]
Length=103

 Score =   155 bits (393),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 77/78 (99%), Positives = 77/78 (99%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            V RDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT
Sbjct  22   VFRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>ref|XP_010032258.1| PREDICTED: histone H4-like [Eucalyptus grandis]
Length=205

 Score =   159 bits (401),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 78/78 (100%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT
Sbjct  124  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  183

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  184  VTAMDVVYALKRQGRTLY  201



>sp|Q9U7D0.3|H4_MASBA RecName: Full=Histone H4 [Mastigamoeba balamuthi]
 gb|AAF00589.1|AF140034_1 histone H4 [Mastigamoeba balamuthi]
Length=108

 Score =   155 bits (393),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRD+VTYTEHARRKT
Sbjct  27   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDSVTYTEHARRKT  86

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  87   VTAMDVVYALKRQGRTLY  104



>ref|XP_006162705.1| PREDICTED: histone H4-like [Tupaia chinensis]
Length=103

 Score =   155 bits (393),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>gb|AAI15450.1| Hist2h4 protein, partial [Mus musculus]
Length=102

 Score =   155 bits (393),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>ref|XP_007107816.1| PREDICTED: histone H4-like isoform X1 [Physeter catodon]
Length=112

 Score =   155 bits (393),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>emb|CDS27542.1| histone H4 [Hymenolepis microstoma]
Length=103

 Score =   155 bits (393),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>ref|XP_005197380.2| PREDICTED: histone H4 [Bos taurus]
 ref|XP_005226918.2| PREDICTED: histone H4 [Bos taurus]
 tpg|DAA13862.1| TPA: histone H4 replacement-like [Bos taurus]
Length=103

 Score =   155 bits (393),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>gb|ACO14931.1| Histone H4 [Caligus clemensi]
Length=103

 Score =   155 bits (393),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>ref|XP_001657280.1| AAEL003863-PA [Aedes aegypti]
 ref|XP_001657284.1| AAEL003833-PA [Aedes aegypti]
 gb|EAT44824.1| AAEL003863-PA [Aedes aegypti]
 gb|EAT44828.1| AAEL003833-PA [Aedes aegypti]
Length=103

 Score =   155 bits (393),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>ref|XP_003967846.1| PREDICTED: histone H4-like [Takifugu rubripes]
Length=113

 Score =   155 bits (393),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  32   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  91

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  92   VTAMDVVYALKRQGRTLY  109



>pdb|3C1B|B Chain B, The Effect Of H3 K79 Dimethylation And H4 K20 Trimethylation 
On Nucleosome And Chromatin Structure
 pdb|3C1B|F Chain F, The Effect Of H3 K79 Dimethylation And H4 K20 Trimethylation 
On Nucleosome And Chromatin Structure
Length=102

 Score =   155 bits (393),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  21   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  80

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  81   VTAMDVVYALKRQGRTLY  98



>emb|CAF88836.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=99

 Score =   155 bits (392),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>ref|XP_009017686.1| hypothetical protein HELRODRAFT_172808 [Helobdella robusta]
 ref|XP_009017690.1| hypothetical protein HELRODRAFT_172812 [Helobdella robusta]
 gb|ESO04417.1| hypothetical protein HELRODRAFT_172808 [Helobdella robusta]
 gb|ESO04421.1| hypothetical protein HELRODRAFT_172812 [Helobdella robusta]
Length=117

 Score =   156 bits (394),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>ref|XP_008401317.1| PREDICTED: histone H4-like [Poecilia reticulata]
Length=126

 Score =   156 bits (394),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  45   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  104

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  105  VTAMDVVYALKRQGRTLY  122



>gb|EDL32536.1| mCG17007 [Mus musculus]
Length=104

 Score =   155 bits (393),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  23   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  82

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  83   VTAMDVVYALKRQGRTLY  100



>ref|XP_002999295.1| histone H4 [Phytophthora infestans T30-4]
 ref|XP_002906018.1| histone H4 [Phytophthora infestans T30-4]
 ref|XP_002906613.1| histone H4 [Phytophthora infestans T30-4]
 ref|XP_008863623.1| histone H4 [Aphanomyces invadans]
 ref|XP_008864893.1| histone H4 [Aphanomyces invadans]
 ref|XP_008868864.1| histone H4 [Aphanomyces invadans]
 ref|XP_008873801.1| histone H4 [Aphanomyces invadans]
 ref|XP_008892385.1| histone H4 [Phytophthora parasitica INRA-310]
 ref|XP_008903637.1| histone H4 [Phytophthora parasitica INRA-310]
 ref|XP_009032689.1| hypothetical protein AURANDRAFT_19438 [Aureococcus anophagefferens]
 ref|XP_009034195.1| hypothetical protein AURANDRAFT_59898 [Aureococcus anophagefferens]
 ref|XP_009034430.1| hypothetical protein AURANDRAFT_21960 [Aureococcus anophagefferens]
 ref|XP_009034585.1| hypothetical protein AURANDRAFT_59915 [Aureococcus anophagefferens]
 ref|XP_009036131.1| hypothetical protein AURANDRAFT_60044 [Aureococcus anophagefferens]
 ref|XP_009041154.1| hypothetical protein AURANDRAFT_60329 [Aureococcus anophagefferens]
 ref|XP_009041608.1| hypothetical protein AURANDRAFT_60352 [Aureococcus anophagefferens]
 ref|XP_009042081.1| hypothetical protein AURANDRAFT_60370 [Aureococcus anophagefferens]
 ref|XP_009515675.1| hypothetical protein PHYSODRAFT_284259 [Phytophthora sojae]
 ref|XP_009520978.1| hypothetical protein PHYSODRAFT_285108 [Phytophthora sojae]
 ref|XP_009825937.1| histone H4 [Aphanomyces astaci]
 ref|XP_009827125.1| histone H4 [Aphanomyces astaci]
 ref|XP_009834845.1| histone H4 [Aphanomyces astaci]
 ref|XP_009845877.1| histone H4 [Aphanomyces astaci]
 gb|EEY66014.1| histone H4 [Phytophthora infestans T30-4]
 gb|EEY67370.1| histone H4 [Phytophthora infestans T30-4]
 gb|EEY69441.1| histone H4 [Phytophthora infestans T30-4]
 emb|CBJ32073.1| histone H4 [Ectocarpus siliculosus]
 emb|CBJ32081.1| histone H4 [Ectocarpus siliculosus]
 emb|CBJ48889.1| histone H4 [Ectocarpus siliculosus]
 emb|CBJ48890.1| histone H4 [Ectocarpus siliculosus]
 emb|CBN77451.1| histone H4 [Ectocarpus siliculosus]
 emb|CBN77456.1| histone H4 [Ectocarpus siliculosus]
 emb|CBN77459.1| histone H4 [Ectocarpus siliculosus]
 gb|EGB03228.1| hypothetical protein AURANDRAFT_60370 [Aureococcus anophagefferens]
 gb|EGB03679.1| hypothetical protein AURANDRAFT_60352 [Aureococcus anophagefferens]
 gb|EGB04168.1| hypothetical protein AURANDRAFT_60329 [Aureococcus anophagefferens]
 gb|EGB09002.1| hypothetical protein AURANDRAFT_60044 [Aureococcus anophagefferens]
 gb|EGB10585.1| hypothetical protein AURANDRAFT_59898 [Aureococcus anophagefferens]
 gb|EGB10851.1| hypothetical protein AURANDRAFT_21960 [Aureococcus anophagefferens]
 gb|EGB11026.1| hypothetical protein AURANDRAFT_59915 [Aureococcus anophagefferens]
 gb|EGB13088.1| hypothetical protein AURANDRAFT_19438 [Aureococcus anophagefferens]
 gb|EGZ25690.1| hypothetical protein PHYSODRAFT_285108 [Phytophthora sojae]
 gb|EGZ28400.1| hypothetical protein PHYSODRAFT_284259 [Phytophthora sojae]
 gb|ETI49039.1| histone H4 [Phytophthora parasitica P1569]
 gb|ETI49434.1| histone H4 [Phytophthora parasitica P1569]
 gb|ETK88907.1| histone H4 [Phytophthora parasitica]
 gb|ETK89312.1| histone H4 [Phytophthora parasitica]
 gb|ETL42305.1| histone H4 [Phytophthora parasitica]
 gb|ETL42766.1| histone H4 [Phytophthora parasitica]
 gb|ETL95479.1| histone H4 [Phytophthora parasitica]
 gb|ETL95915.1| histone H4 [Phytophthora parasitica]
 gb|ETM48678.1| histone H4 [Phytophthora parasitica]
 gb|ETM49079.1| histone H4 [Phytophthora parasitica]
 gb|ETN11155.1| histone H4 [Phytophthora parasitica INRA-310]
 gb|ETN23189.1| histone H4 [Phytophthora parasitica INRA-310]
 gb|ETO77777.1| histone H4 [Phytophthora parasitica P1976]
 gb|ETO78169.1| histone H4 [Phytophthora parasitica P1976]
 gb|ETP18806.1| histone H4 [Phytophthora parasitica CJ01A1]
 gb|ETP19207.1| histone H4 [Phytophthora parasitica CJ01A1]
 gb|ETP46727.1| histone H4 [Phytophthora parasitica P10297]
 gb|ETP47136.1| histone H4 [Phytophthora parasitica P10297]
 gb|ETV64644.1| histone H4 [Aphanomyces astaci]
 gb|ETV75714.1| histone H4 [Aphanomyces astaci]
 gb|ETV83695.1| histone H4 [Aphanomyces astaci]
 gb|ETV84245.1| histone H4 [Aphanomyces astaci]
 gb|ETV97592.1| histone H4 [Aphanomyces invadans]
 gb|ETW02259.1| histone H4 [Aphanomyces invadans]
 gb|ETW06818.1| histone H4 [Aphanomyces invadans]
 gb|ETW07530.1| histone H4 [Aphanomyces invadans]
 emb|CCI44586.1| unnamed protein product [Albugo candida]
 emb|CCI40314.1| unnamed protein product [Albugo candida]
Length=103

 Score =   155 bits (392),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRD+VTYTEHARRKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDSVTYTEHARRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>ref|NP_003529.1| histone H4 [Homo sapiens]
 ref|NP_003530.1| histone H4 [Homo sapiens]
 ref|NP_003531.1| histone H4 [Homo sapiens]
 ref|NP_003532.1| histone H4 [Homo sapiens]
 ref|NP_003533.1| histone H4 [Homo sapiens]
 ref|NP_003534.1| histone H4 [Homo sapiens]
 ref|NP_003535.1| histone H4 [Homo sapiens]
 ref|NP_003536.1| histone H4 [Homo sapiens]
 ref|NP_003537.1| histone H4 [Homo sapiens]
 ref|NP_003486.1| histone H4 [Homo sapiens]
 ref|NP_003539.1| histone H4 [Homo sapiens]
 ref|NP_068803.1| histone H4 [Homo sapiens]
 ref|NP_073177.1| histone H4 [Rattus norvegicus]
 ref|NP_291074.1| histone H4 [Mus musculus]
 ref|NP_694813.1| histone H4 [Mus musculus]
 ref|NP_776305.1| histone H4 [Bos taurus]
 ref|NP_778224.1| histone H4 [Homo sapiens]
 ref|NP_783583.1| histone H4 [Mus musculus]
 ref|NP_835515.1| histone H4 [Mus musculus]
 ref|NP_835582.1| histone H4 [Mus musculus]
 ref|NP_783586.1| histone H4 [Mus musculus]
 ref|NP_835583.1| histone H4 [Mus musculus]
 ref|NP_835499.1| histone H4 [Mus musculus]
 ref|NP_835500.1| histone H4 [Mus musculus]
 ref|NP_783588.1| histone H4 [Mus musculus]
 ref|NP_783585.1| histone H4 [Mus musculus]
 ref|NP_783587.1| histone H4 [Mus musculus]
 ref|NP_001016869.1| histone H4 [Xenopus (Silurana) tropicalis]
 ref|NP_001029249.1| histone H4 [Homo sapiens]
 ref|NP_001032934.1| histone cluster 1, H4-VI, germinal H4 (similar to human histone 
cluster 1, class H4 genes) [Gallus gallus]
 ref|NP_001032932.1| histone H4 [Gallus gallus]
 ref|NP_001087926.1| histone H4 [Xenopus laevis]
 ref|NP_001092231.1| histone cluster 1, H4-like [Danio rerio]
 ref|NP_001116941.1| histone H4 [Rattus norvegicus]
 ref|NP_001128961.1| histone H4 [Pongo abelii]
 ref|NP_001139343.1| germinal histone H4-like [Bos taurus]
 ref|NP_001182350.1| histone H4 [Mus musculus]
 ref|NP_001232835.1| uncharacterized protein LOC100221944 [Taeniopygia guttata]
 ref|NP_001258150.1| histone H4 [Rattus norvegicus]
 ref|NP_001268414.1| histone cluster 1, H4-IV, germinal H4-like 2 (similar to human 
histone cluster 1, class H4 genes) [Gallus gallus]
 ref|XP_513765.1| PREDICTED: histone H4 [Pan troglodytes]
 ref|XP_874074.1| PREDICTED: histone H4 [Bos taurus]
 ref|XP_605163.2| PREDICTED: histone H4 [Bos taurus]
 ref|XP_001083731.1| PREDICTED: histone H4-like [Macaca mulatta]
 ref|XP_001083839.1| PREDICTED: histone H4-like [Macaca mulatta]
 ref|XP_001085940.1| PREDICTED: histone H4-like [Macaca mulatta]
 ref|XP_001086761.1| PREDICTED: histone H4-like [Macaca mulatta]
 ref|XP_001087343.1| PREDICTED: histone H4-like [Macaca mulatta]
 ref|XP_001087948.1| PREDICTED: histone H4-like [Macaca mulatta]
 ref|XP_001088506.1| PREDICTED: histone H4-like [Macaca mulatta]
 ref|XP_001095996.1| PREDICTED: histone H4-like [Macaca mulatta]
 ref|XP_001096216.1| PREDICTED: histone H4-like [Macaca mulatta]
 ref|XP_001097005.1| PREDICTED: histone H4-like [Macaca mulatta]
 ref|XP_001089711.1| PREDICTED: histone H4-like [Macaca mulatta]
 ref|XP_001055696.1| PREDICTED: histone H4 [Rattus norvegicus]
 ref|XP_001172726.1| PREDICTED: histone H4 [Pan troglodytes]
 ref|XP_425458.2| PREDICTED: histone H4-like [Gallus gallus]
 ref|XP_001233095.1| PREDICTED: histone H4-like [Gallus gallus]
 ref|XP_001233180.1| PREDICTED: histone H4-like [Gallus gallus]
 ref|XP_688877.2| PREDICTED: histone H4 [Danio rerio]
 ref|XP_001332711.1| PREDICTED: histone H4 [Danio rerio]
 ref|XP_001362863.1| PREDICTED: histone H4-like [Monodelphis domestica]
 ref|XP_001363291.1| PREDICTED: histone H4-like [Monodelphis domestica]
 ref|XP_001367380.1| PREDICTED: histone H4-like [Monodelphis domestica]
 ref|XP_001367431.1| PREDICTED: histone H4-like [Monodelphis domestica]
 ref|XP_001364265.1| PREDICTED: histone H4-like [Monodelphis domestica]
 ref|XP_001364340.1| PREDICTED: histone H4-like [Monodelphis domestica]
 ref|XP_001364497.1| PREDICTED: histone H4-like [Monodelphis domestica]
 ref|XP_001512868.1| PREDICTED: histone H4 [Ornithorhynchus anatinus]
 ref|XP_001512010.1| PREDICTED: histone H4 [Ornithorhynchus anatinus]
 ref|XP_001509578.1| PREDICTED: histone H4 [Ornithorhynchus anatinus]
 ref|XP_001512921.1| PREDICTED: histone H4 [Ornithorhynchus anatinus]
 ref|XP_001513324.1| PREDICTED: histone H4 [Ornithorhynchus anatinus]
 ref|XP_001513920.1| PREDICTED: histone H4 [Ornithorhynchus anatinus]
 ref|XP_001514186.1| PREDICTED: histone H4 [Ornithorhynchus anatinus]
 ref|XP_001514518.1| PREDICTED: histone H4 [Ornithorhynchus anatinus]
 ref|XP_001514546.1| PREDICTED: histone H4 [Ornithorhynchus anatinus]
 ref|XP_001514697.1| PREDICTED: histone H4 [Ornithorhynchus anatinus]
 ref|XP_001515421.1| PREDICTED: histone H4 [Ornithorhynchus anatinus]
 ref|XP_001507620.1| PREDICTED: histone H4 [Ornithorhynchus anatinus]
 ref|XP_001496752.1| PREDICTED: histone H4-like [Equus caballus]
 ref|XP_001497325.1| PREDICTED: histone H4-like [Equus caballus]
 ref|XP_001488440.1| PREDICTED: histone H4-like [Equus caballus]
 ref|XP_001927985.1| PREDICTED: histone H4-like [Sus scrofa]
 ref|XP_002193771.1| PREDICTED: histone H4-like [Taeniopygia guttata]
 ref|XP_002194028.1| PREDICTED: histone H4-like [Taeniopygia guttata]
 ref|XP_002194069.1| PREDICTED: histone H4-like [Taeniopygia guttata]
 ref|XP_002194225.1| PREDICTED: histone H4-like [Taeniopygia guttata]
 ref|XP_002194484.1| PREDICTED: histone H4-like [Taeniopygia guttata]
 ref|XP_002402623.1| histone H4, putative [Ixodes scapularis]
 ref|XP_002595194.1| hypothetical protein BRAFLDRAFT_129780 [Branchiostoma floridae]
 ref|XP_002595647.1| hypothetical protein BRAFLDRAFT_56954 [Branchiostoma floridae]
 ref|XP_002595664.1| hypothetical protein BRAFLDRAFT_200764 [Branchiostoma floridae]
 ref|XP_002595680.1| hypothetical protein BRAFLDRAFT_200752 [Branchiostoma floridae]
 ref|XP_002595692.1| hypothetical protein BRAFLDRAFT_200683 [Branchiostoma floridae]
 ref|XP_002595712.1| hypothetical protein BRAFLDRAFT_64838 [Branchiostoma floridae]
 ref|XP_002595720.1| hypothetical protein BRAFLDRAFT_64845 [Branchiostoma floridae]
 ref|XP_002613645.1| hypothetical protein BRAFLDRAFT_127106 [Branchiostoma floridae]
 ref|XP_002731240.1| PREDICTED: histone H4-like [Saccoglossus kowalevskii]
 ref|XP_002731862.1| PREDICTED: histone H4-like [Saccoglossus kowalevskii]
 ref|XP_002733165.1| PREDICTED: histone H4-like [Saccoglossus kowalevskii]
 ref|XP_002733243.1| PREDICTED: histone H4-like [Saccoglossus kowalevskii]
 ref|XP_002733412.1| PREDICTED: histone H4-like [Saccoglossus kowalevskii]
 ref|XP_002737706.1| PREDICTED: histone H4-like [Saccoglossus kowalevskii]
 ref|XP_002739628.1| PREDICTED: histone H4-like [Saccoglossus kowalevskii]
 ref|XP_002740598.1| PREDICTED: histone H4-like [Saccoglossus kowalevskii]
 ref|XP_002742217.1| PREDICTED: histone H4-like [Saccoglossus kowalevskii]
 ref|XP_002714252.1| PREDICTED: histone H4 [Oryctolagus cuniculus]
 ref|XP_002714257.1| PREDICTED: histone H4 [Oryctolagus cuniculus]
 ref|XP_002721667.1| PREDICTED: histone H4 [Oryctolagus cuniculus]
 ref|XP_002662243.1| PREDICTED: histone H4 [Danio rerio]
 ref|XP_002666964.1| PREDICTED: histone H4 [Danio rerio]
 ref|XP_002746168.1| PREDICTED: histone H4 [Callithrix jacchus]
 ref|XP_002746201.1| PREDICTED: histone H4 [Callithrix jacchus]
 ref|XP_002684676.1| PREDICTED: histone H4 [Bos taurus]
 ref|XP_002697516.1| PREDICTED: histone H4 [Bos taurus]
 ref|XP_002832997.1| PREDICTED: histone H4 [Pongo abelii]
 ref|XP_002933937.1| PREDICTED: histone H4-like [Xenopus (Silurana) tropicalis]
 ref|XP_002933940.1| PREDICTED: histone H4-like [Xenopus (Silurana) tropicalis]
 ref|XP_002942338.1| PREDICTED: histone H4-like [Xenopus (Silurana) tropicalis]
 ref|XP_002943144.1| PREDICTED: histone H4-like [Xenopus (Silurana) tropicalis]
 ref|XP_002944234.1| PREDICTED: histone H4-like [Xenopus (Silurana) tropicalis]
 ref|XP_002944667.1| PREDICTED: histone H4-like [Xenopus (Silurana) tropicalis]
 ref|XP_002945478.1| PREDICTED: histone H4-like [Xenopus (Silurana) tropicalis]
 ref|XP_002928419.1| PREDICTED: histone H4 [Ailuropoda melanoleuca]
 ref|XP_002928573.1| PREDICTED: histone H4 [Ailuropoda melanoleuca]
 ref|XP_002928574.1| PREDICTED: histone H4 [Ailuropoda melanoleuca]
 ref|XP_002928579.1| PREDICTED: histone H4 [Ailuropoda melanoleuca]
 ref|XP_002928589.1| PREDICTED: histone H4 [Ailuropoda melanoleuca]
 ref|XP_003202248.1| PREDICTED: histone H4 [Meleagris gallopavo]
 ref|XP_003202257.1| PREDICTED: histone H4 [Meleagris gallopavo]
 ref|XP_003224527.1| PREDICTED: histone H4 [Anolis carolinensis]
 ref|XP_003225091.1| PREDICTED: histone H4 [Anolis carolinensis]
 ref|XP_003225094.1| PREDICTED: histone H4 [Anolis carolinensis]
 ref|XP_003226704.1| PREDICTED: histone H4 [Anolis carolinensis]
 ref|XP_003259197.1| PREDICTED: histone H4-like isoform 1 [Nomascus leucogenys]
 ref|XP_003259198.1| PREDICTED: histone H4-like isoform 2 [Nomascus leucogenys]
 ref|XP_003263289.1| PREDICTED: histone H4-like isoform 1 [Nomascus leucogenys]
 ref|XP_003263290.1| PREDICTED: histone H4-like [Nomascus leucogenys]
 ref|XP_003263314.1| PREDICTED: histone H4-like [Nomascus leucogenys]
 ref|XP_003263323.1| PREDICTED: histone H4-like [Nomascus leucogenys]
 ref|XP_003265584.1| PREDICTED: histone H4-like isoform 1 [Nomascus leucogenys]
 ref|XP_003272007.1| PREDICTED: histone H4-like isoform 1 [Nomascus leucogenys]
 ref|XP_003272013.1| PREDICTED: histone H4-like [Nomascus leucogenys]
 ref|XP_003308403.1| PREDICTED: histone H4 [Pan troglodytes]
 ref|XP_518290.3| PREDICTED: histone H4 [Pan troglodytes]
 ref|XP_003313563.1| PREDICTED: histone H4 [Pan troglodytes]
 ref|XP_003355252.1| PREDICTED: histone H4-like [Sus scrofa]
 ref|XP_003363837.1| PREDICTED: histone H4-like [Equus caballus]
 ref|XP_003391251.1| PREDICTED: histone H4 [Amphimedon queenslandica]
 ref|XP_003416451.1| PREDICTED: histone H4 [Loxodonta africana]
 ref|XP_003416454.1| PREDICTED: histone H4 [Loxodonta africana]
 ref|XP_003416468.1| PREDICTED: histone H4 [Loxodonta africana]
 ref|XP_003421151.1| PREDICTED: histone H4 [Loxodonta africana]
 ref|XP_543797.2| PREDICTED: histone H4-like [Canis lupus familiaris]
 ref|XP_003451199.1| PREDICTED: histone H4-like [Oreochromis niloticus]
 ref|XP_003451210.1| PREDICTED: histone H4-like [Oreochromis niloticus]
 ref|XP_003451217.1| PREDICTED: histone H4-like [Oreochromis niloticus]
 ref|XP_003454720.1| PREDICTED: histone H4-like [Oreochromis niloticus]
 ref|XP_003458488.1| PREDICTED: histone H4-like [Oreochromis niloticus]
 ref|XP_003459140.1| PREDICTED: histone H4-like [Oreochromis niloticus]
 ref|XP_003459577.1| PREDICTED: histone H4-like [Oreochromis niloticus]
 ref|XP_003459580.1| PREDICTED: histone H4-like [Oreochromis niloticus]
 ref|XP_003468831.1| PREDICTED: histone H4-like [Cavia porcellus]
 ref|XP_003468832.1| PREDICTED: histone H4-like [Cavia porcellus]
 ref|XP_003468839.1| PREDICTED: histone H4-like [Cavia porcellus]
 ref|XP_003468850.1| PREDICTED: histone H4-like [Cavia porcellus]
 ref|XP_003468852.1| PREDICTED: histone H4-like [Cavia porcellus]
 ref|XP_003468853.1| PREDICTED: histone H4-like [Cavia porcellus]
 ref|XP_003470474.1| PREDICTED: histone H4-like [Cavia porcellus]
 ref|XP_003481515.1| PREDICTED: histone H4-like [Sus scrofa]
 ref|XP_003498672.1| PREDICTED: histone H4 [Cricetulus griseus]
 ref|XP_003502226.1| PREDICTED: histone H4 [Cricetulus griseus]
 ref|XP_003512223.1| PREDICTED: histone H4 isoform X1 [Cricetulus griseus]
 ref|XP_003512227.1| PREDICTED: histone H4 isoform X1 [Cricetulus griseus]
 ref|XP_003639662.1| PREDICTED: histone H4-like [Canis lupus familiaris]
 ref|XP_003640212.1| PREDICTED: histone H4-like [Canis lupus familiaris]
 ref|XP_003640418.1| PREDICTED: histone H4-like [Gallus gallus]
 ref|XP_003703732.1| PREDICTED: histone H4-like [Megachile rotundata]
 ref|XP_003740515.1| PREDICTED: histone H4-like [Metaseiulus occidentalis]
 ref|XP_003746286.1| PREDICTED: histone H4-like [Metaseiulus occidentalis]
 ref|XP_003746421.1| PREDICTED: histone H4-like [Metaseiulus occidentalis]
 ref|XP_003746455.1| PREDICTED: histone H4-like [Metaseiulus occidentalis]
 ref|XP_003753031.1| PREDICTED: histone H4 [Rattus norvegicus]
 ref|XP_002725326.2| PREDICTED: histone H4 [Rattus norvegicus]
 ref|XP_003768749.1| PREDICTED: histone H4-like [Sarcophilus harrisii]
 ref|XP_003769910.1| PREDICTED: histone H4-like [Sarcophilus harrisii]
 ref|XP_003769911.1| PREDICTED: histone H4-like [Sarcophilus harrisii]
 ref|XP_003775634.1| PREDICTED: histone H4 [Pongo abelii]
 ref|XP_003788832.1| PREDICTED: histone H4-like [Otolemur garnettii]
 ref|XP_003788847.1| PREDICTED: histone H4-like [Otolemur garnettii]
 ref|XP_003800469.1| PREDICTED: histone H4-like [Otolemur garnettii]
 ref|XP_003804476.1| PREDICTED: histone H4 [Pan paniscus]
 ref|XP_003804598.1| PREDICTED: histone H4 [Pan paniscus]
 ref|XP_003810986.1| PREDICTED: histone H4 [Pan paniscus]
 ref|XP_003816562.1| PREDICTED: histone H4 [Pan paniscus]
 ref|XP_003897205.1| PREDICTED: histone H4 [Papio anubis]
 ref|XP_003897228.1| PREDICTED: histone H4 [Papio anubis]
 ref|XP_003897266.1| PREDICTED: histone H4 [Papio anubis]
 ref|XP_003944781.1| PREDICTED: histone H4 [Saimiri boliviensis boliviensis]
 ref|XP_003967844.1| PREDICTED: histone H4-like [Takifugu rubripes]
 ref|XP_003967879.1| PREDICTED: histone H4-like [Takifugu rubripes]
 ref|XP_003972551.1| PREDICTED: histone H4-like [Takifugu rubripes]
 ref|XP_003976989.1| PREDICTED: histone H4-like [Takifugu rubripes]
 ref|XP_003979221.1| PREDICTED: histone H4-like [Takifugu rubripes]
 ref|XP_003979769.1| PREDICTED: histone H4-like [Takifugu rubripes]
 ref|XP_003979855.1| PREDICTED: histone H4-like [Takifugu rubripes]
 ref|XP_003979857.1| PREDICTED: histone H4-like [Takifugu rubripes]
 ref|XP_003985732.1| PREDICTED: histone H4 [Felis catus]
 ref|XP_003985737.1| PREDICTED: histone H4 [Felis catus]
 ref|XP_003985738.1| PREDICTED: histone H4 [Felis catus]
 ref|XP_003985779.1| PREDICTED: histone H4 [Felis catus]
 ref|XP_003985815.1| PREDICTED: histone H4 [Felis catus]
 ref|XP_004002475.1| PREDICTED: histone H4-like [Ovis aries]
 ref|XP_004006886.1| PREDICTED: histone H4-like [Ovis aries]
 ref|XP_004019084.1| PREDICTED: histone H4-like [Ovis aries]
 ref|XP_004019094.1| PREDICTED: histone H4-like [Ovis aries]
 ref|XP_004019117.1| PREDICTED: histone H4-like [Ovis aries]
 ref|XP_004019118.1| PREDICTED: histone H4-like [Ovis aries]
 ref|XP_004019121.1| PREDICTED: histone H4-like [Ovis aries]
 ref|XP_004019131.1| PREDICTED: histone H4-like [Ovis aries]
 ref|XP_004019134.1| PREDICTED: histone H4-like [Ovis aries]
 ref|XP_004019376.1| PREDICTED: histone H4-like [Ovis aries]
 ref|XP_004026587.1| PREDICTED: histone H4-like isoform 1 [Gorilla gorilla gorilla]
 ref|XP_004026588.1| PREDICTED: histone H4-like isoform 2 [Gorilla gorilla gorilla]
 ref|XP_004026589.1| PREDICTED: histone H4-like isoform 3 [Gorilla gorilla gorilla]
 ref|XP_004026590.1| PREDICTED: histone H4-like isoform 4 [Gorilla gorilla gorilla]
 ref|XP_004026591.1| PREDICTED: histone H4-like isoform 1 [Gorilla gorilla gorilla]
 ref|XP_004026592.1| PREDICTED: histone H4-like isoform 2 [Gorilla gorilla gorilla]
 ref|XP_004026593.1| PREDICTED: histone H4-like isoform 3 [Gorilla gorilla gorilla]
 ref|XP_004026594.1| PREDICTED: histone H4-like isoform 4 [Gorilla gorilla gorilla]
 ref|XP_004043429.1| PREDICTED: histone H4-like [Gorilla gorilla gorilla]
 ref|XP_004043430.1| PREDICTED: histone H4-like [Gorilla gorilla gorilla]
 ref|XP_004043455.1| PREDICTED: histone H4-like [Gorilla gorilla gorilla]
 ref|XP_004043465.1| PREDICTED: histone H4-like isoform 1 [Gorilla gorilla gorilla]
 ref|XP_004043466.1| PREDICTED: histone H4-like isoform 2 [Gorilla gorilla gorilla]
 ref|XP_004043467.1| PREDICTED: histone H4-like isoform 3 [Gorilla gorilla gorilla]
 ref|XP_004043490.1| PREDICTED: histone H4-like [Gorilla gorilla gorilla]
 ref|XP_004043515.1| PREDICTED: histone H4-like [Gorilla gorilla gorilla]
 ref|XP_004043525.1| PREDICTED: histone H4-like [Gorilla gorilla gorilla]
 ref|XP_004052833.1| PREDICTED: histone H4-like isoform 1 [Gorilla gorilla gorilla]
 ref|XP_004052834.1| PREDICTED: histone H4-like isoform 2 [Gorilla gorilla gorilla]
 ref|XP_004052835.1| PREDICTED: histone H4-like isoform 3 [Gorilla gorilla gorilla]
 ref|XP_004065520.1| PREDICTED: histone H4 [Oryzias latipes]
 ref|XP_004065542.1| PREDICTED: histone H4 [Oryzias latipes]
 ref|XP_004065543.1| PREDICTED: histone H4 [Oryzias latipes]
 ref|XP_004065546.1| PREDICTED: histone H4 [Oryzias latipes]
 ref|XP_004065570.1| PREDICTED: histone H4 [Oryzias latipes]
 ref|XP_004065575.1| PREDICTED: histone H4 [Oryzias latipes]
 ref|XP_004065584.1| PREDICTED: histone H4 [Oryzias latipes]
 ref|XP_004076665.1| PREDICTED: histone H4 [Oryzias latipes]
 ref|XP_004084101.1| PREDICTED: histone H4 [Oryzias latipes]
 ref|XP_004084204.1| PREDICTED: histone H4 [Oryzias latipes]
 ref|XP_004087103.1| PREDICTED: histone H4-like [Nomascus leucogenys]
 ref|XP_004087110.1| PREDICTED: histone H4-like isoform 2 [Nomascus leucogenys]
 ref|XP_004088800.1| PREDICTED: histone H4-like isoform 2 [Nomascus leucogenys]
 ref|XP_004088817.1| PREDICTED: histone H4-like isoform 1 [Nomascus leucogenys]
 ref|XP_004088818.1| PREDICTED: histone H4-like isoform 2 [Nomascus leucogenys]
 ref|XP_004089973.1| PREDICTED: histone H4-like [Nomascus leucogenys]
 ref|XP_004092159.1| PREDICTED: histone H4-like isoform 2 [Nomascus leucogenys]
 ref|XP_004273518.1| PREDICTED: histone H4-like [Orcinus orca]
 ref|XP_004273526.1| PREDICTED: histone H4-like [Orcinus orca]
 ref|XP_004273527.1| PREDICTED: histone H4-like [Orcinus orca]
 ref|XP_004273529.1| PREDICTED: histone H4-like [Orcinus orca]
 ref|XP_004273533.1| PREDICTED: histone H4-like [Orcinus orca]
 ref|XP_004273546.1| PREDICTED: histone H4-like [Orcinus orca]
 ref|XP_004273549.1| PREDICTED: histone H4-like [Orcinus orca]
 ref|XP_004273615.1| PREDICTED: histone H4-like [Orcinus orca]
 ref|XP_004281169.1| PREDICTED: histone H4-like [Orcinus orca]
 ref|XP_004285168.1| PREDICTED: histone H4-like [Orcinus orca]
 ref|XP_004286155.1| PREDICTED: histone H4-like [Orcinus orca]
 ref|XP_004286156.1| PREDICTED: histone H4-like [Orcinus orca]
 ref|XP_004286158.1| PREDICTED: histone H4-like [Orcinus orca]
 ref|XP_004315563.1| PREDICTED: histone H4-like [Tursiops truncatus]
 ref|XP_004316313.1| PREDICTED: histone H4-like [Tursiops truncatus]
 ref|XP_004316318.1| PREDICTED: histone H4-like [Tursiops truncatus]
 ref|XP_004316319.1| PREDICTED: histone H4-like [Tursiops truncatus]
 ref|XP_004316322.1| PREDICTED: histone H4-like [Tursiops truncatus]
 ref|XP_004316328.1| PREDICTED: histone H4-like [Tursiops truncatus]
 ref|XP_004317749.1| PREDICTED: histone H4-like [Tursiops truncatus]
 ref|XP_004317750.1| PREDICTED: histone H4-like [Tursiops truncatus]
 ref|XP_004325607.1| PREDICTED: histone H4-like [Tursiops truncatus]
 ref|XP_004327159.1| PREDICTED: histone H4-like [Tursiops truncatus]
 ref|XP_004329203.1| PREDICTED: histone H4-like [Tursiops truncatus]
 ref|XP_004329205.1| PREDICTED: histone H4-like [Tursiops truncatus]
 ref|XP_004384061.1| PREDICTED: histone H4-like [Trichechus manatus latirostris]
 ref|XP_004384062.1| PREDICTED: histone H4-like [Trichechus manatus latirostris]
 ref|XP_004384067.1| PREDICTED: histone H4-like [Trichechus manatus latirostris]
 ref|XP_004384068.1| PREDICTED: histone H4-like [Trichechus manatus latirostris]
 ref|XP_004384069.1| PREDICTED: histone H4-like [Trichechus manatus latirostris]
 ref|XP_004384082.1| PREDICTED: histone H4-like [Trichechus manatus latirostris]
 ref|XP_004384085.1| PREDICTED: histone H4-like [Trichechus manatus latirostris]
 ref|XP_004384089.1| PREDICTED: histone H4-like [Trichechus manatus latirostris]
 ref|XP_004387129.1| PREDICTED: histone H4-like [Trichechus manatus latirostris]
 ref|XP_004387131.1| PREDICTED: histone H4-like [Trichechus manatus latirostris]
 ref|XP_004387132.1| PREDICTED: histone H4-like [Trichechus manatus latirostris]
 ref|XP_004387137.1| PREDICTED: histone H4-like [Trichechus manatus latirostris]
 ref|XP_004390964.1| PREDICTED: histone H4-like [Trichechus manatus latirostris]
 ref|XP_004406574.1| PREDICTED: histone H4-like [Odobenus rosmarus divergens]
 ref|XP_004406582.1| PREDICTED: histone H4-like [Odobenus rosmarus divergens]
 ref|XP_004407048.1| PREDICTED: histone H4-like [Odobenus rosmarus divergens]
 ref|XP_004413686.1| PREDICTED: histone H4-like [Odobenus rosmarus divergens]
 ref|XP_004413691.1| PREDICTED: histone H4-like [Odobenus rosmarus divergens]
 ref|XP_004413703.1| PREDICTED: histone H4-like [Odobenus rosmarus divergens]
 ref|XP_004413710.1| PREDICTED: histone H4-like [Odobenus rosmarus divergens]
 ref|XP_004413718.1| PREDICTED: histone H4-like [Odobenus rosmarus divergens]
 ref|XP_004432086.1| PREDICTED: histone H4-like [Ceratotherium simum simum]
 ref|XP_004432092.1| PREDICTED: histone H4-like [Ceratotherium simum simum]
 ref|XP_004432093.1| PREDICTED: histone H4-like [Ceratotherium simum simum]
 ref|XP_004432106.1| PREDICTED: histone H4-like [Ceratotherium simum simum]
 ref|XP_004435457.1| PREDICTED: histone H4-like [Ceratotherium simum simum]
 ref|XP_004441824.1| PREDICTED: histone H4-like [Ceratotherium simum simum]
 ref|XP_004443255.1| PREDICTED: histone H4-like [Ceratotherium simum simum]
 ref|XP_004443950.1| PREDICTED: histone H4-like [Ceratotherium simum simum]
 ref|XP_004463549.1| PREDICTED: histone H4-like [Dasypus novemcinctus]
 ref|XP_004463550.1| PREDICTED: histone H4-like [Dasypus novemcinctus]
 ref|XP_004463559.1| PREDICTED: histone H4-like [Dasypus novemcinctus]
 ref|XP_004463567.1| PREDICTED: histone H4-like [Dasypus novemcinctus]
 ref|XP_004463573.1| PREDICTED: histone H4-like [Dasypus novemcinctus]
 ref|XP_004463574.1| PREDICTED: histone H4-like [Dasypus novemcinctus]
 ref|XP_004463580.1| PREDICTED: histone H4-like [Dasypus novemcinctus]
 ref|XP_004477772.1| PREDICTED: histone H4-like [Dasypus novemcinctus]
 ref|XP_004481901.1| PREDICTED: histone H4-like [Dasypus novemcinctus]
 ref|XP_004481908.1| PREDICTED: histone H4-like [Dasypus novemcinctus]
 ref|XP_004481913.1| PREDICTED: histone H4-like [Dasypus novemcinctus]
 ref|XP_004481914.1| PREDICTED: histone H4-like [Dasypus novemcinctus]
 ref|XP_004556919.1| PREDICTED: histone H4-like [Maylandia zebra]
 ref|XP_004564911.1| PREDICTED: histone H4-like [Maylandia zebra]
 ref|XP_004564942.1| PREDICTED: histone H4-like [Maylandia zebra]
 ref|XP_004566501.1| PREDICTED: histone H4-like [Maylandia zebra]
 ref|XP_004588886.1| PREDICTED: histone H4-like [Ochotona princeps]
 ref|XP_004592637.1| PREDICTED: histone H4-like [Ochotona princeps]
 ref|XP_004596564.1| PREDICTED: histone H4-like [Ochotona princeps]
 ref|XP_004598442.1| PREDICTED: histone H4-like [Ochotona princeps]
 ref|XP_004598444.1| PREDICTED: histone H4-like [Ochotona princeps]
 ref|XP_004598445.1| PREDICTED: histone H4-like [Ochotona princeps]
 ref|XP_004598447.1| PREDICTED: histone H4-like [Ochotona princeps]
 ref|XP_004598451.1| PREDICTED: histone H4-like [Ochotona princeps]
 ref|XP_004618106.1| PREDICTED: histone H4-like [Sorex araneus]
 ref|XP_004621943.1| PREDICTED: histone H4-like [Sorex araneus]
 ref|XP_004621946.1| PREDICTED: histone H4-like [Sorex araneus]
 ref|XP_004621949.1| PREDICTED: histone H4-like [Sorex araneus]
 ref|XP_004621990.1| PREDICTED: histone H4-like [Sorex araneus]
 ref|XP_004621993.1| PREDICTED: histone H4-like [Sorex araneus]
 ref|XP_004621994.1| PREDICTED: histone H4-like [Sorex araneus]
 ref|XP_004659161.1| PREDICTED: histone H4-like [Jaculus jaculus]
 ref|XP_004670883.1| PREDICTED: histone H4-like isoform X1 [Jaculus jaculus]
 ref|XP_004670885.1| PREDICTED: histone H4-like [Jaculus jaculus]
 ref|XP_004670890.1| PREDICTED: histone H4-like [Jaculus jaculus]
 ref|XP_004670896.1| PREDICTED: histone H4-like [Jaculus jaculus]
 ref|XP_004670964.1| PREDICTED: histone H4-like [Jaculus jaculus]
 ref|XP_004626144.1| PREDICTED: histone H4-like [Octodon degus]
 ref|XP_004632474.1| PREDICTED: histone H4-like [Octodon degus]
 ref|XP_004640157.1| PREDICTED: histone H4-like [Octodon degus]
 ref|XP_004640162.1| PREDICTED: histone H4-like [Octodon degus]
 ref|XP_004640163.1| PREDICTED: histone H4-like [Octodon degus]
 ref|XP_004640165.1| PREDICTED: histone H4-like [Octodon degus]
 ref|XP_004640170.1| PREDICTED: histone H4-like [Octodon degus]
 ref|XP_004640176.1| PREDICTED: histone H4-like [Octodon degus]
 ref|XP_004640177.1| PREDICTED: histone H4-like [Octodon degus]
 ref|XP_004712542.1| PREDICTED: histone H4-like [Echinops telfairi]
 ref|XP_004717865.1| PREDICTED: histone H4-like [Echinops telfairi]
 ref|XP_004694905.1| PREDICTED: histone H4-like [Condylura cristata]
 ref|XP_004694909.1| PREDICTED: histone H4-like [Condylura cristata]
 ref|XP_004694910.1| PREDICTED: histone H4-like [Condylura cristata]
 ref|XP_004694913.1| PREDICTED: histone H4-like [Condylura cristata]
 ref|XP_004694922.1| PREDICTED: histone H4-like [Condylura cristata]
 ref|XP_004694927.1| PREDICTED: histone H4-like [Condylura cristata]
 ref|XP_004694928.1| PREDICTED: histone H4-like [Condylura cristata]
 ref|XP_004695478.1| PREDICTED: histone H4-like [Condylura cristata]
 ref|XP_004695479.1| PREDICTED: histone H4-like [Condylura cristata]
 ref|XP_004695484.1| PREDICTED: histone H4-like [Condylura cristata]
 ref|XP_004755846.1| PREDICTED: histone H4-like [Mustela putorius furo]
 ref|XP_004778811.1| PREDICTED: histone H4-like [Mustela putorius furo]
 ref|XP_004778836.1| PREDICTED: histone H4-like [Mustela putorius furo]
 ref|XP_004787907.1| PREDICTED: histone H4-like [Mustela putorius furo]
 ref|XP_004787909.1| PREDICTED: histone H4-like [Mustela putorius furo]
 ref|XP_004787913.1| PREDICTED: histone H4-like [Mustela putorius furo]
 ref|XP_004787918.1| PREDICTED: histone H4-like [Mustela putorius furo]
 ref|XP_004787921.1| PREDICTED: histone H4 type VIII-like [Mustela putorius furo]
 ref|XP_004787927.1| PREDICTED: histone H4-like [Mustela putorius furo]
 ref|XP_004787941.1| PREDICTED: histone H4-like [Mustela putorius furo]
 ref|XP_004787958.1| PREDICTED: histone H4-like [Mustela putorius furo]
 ref|XP_004787959.1| PREDICTED: histone H4-like [Mustela putorius furo]
 ref|XP_004803604.1| PREDICTED: histone H4-like [Mustela putorius furo]
 ref|XP_004828270.1| PREDICTED: histone H4-like [Mustela putorius furo]
 ref|XP_004917041.1| PREDICTED: histone H4-like [Xenopus (Silurana) tropicalis]
 ref|XP_004917044.1| PREDICTED: histone H4-like [Xenopus (Silurana) tropicalis]
 ref|XP_004917053.1| PREDICTED: histone H4-like [Xenopus (Silurana) tropicalis]
 ref|XP_004917057.1| PREDICTED: histone H4-like [Xenopus (Silurana) tropicalis]
 ref|XP_004917064.1| PREDICTED: histone H4-like [Xenopus (Silurana) tropicalis]
 ref|XP_004919335.1| PREDICTED: histone H4-like [Xenopus (Silurana) tropicalis]
 ref|XP_004919466.1| PREDICTED: histone H4-like [Xenopus (Silurana) tropicalis]
 ref|XP_004919473.1| PREDICTED: histone H4-like [Xenopus (Silurana) tropicalis]
 ref|XP_004919478.1| PREDICTED: histone H4-like [Xenopus (Silurana) tropicalis]
 ref|XP_004919480.1| PREDICTED: histone H4-like [Xenopus (Silurana) tropicalis]
 ref|XP_004895395.1| PREDICTED: histone H4-like [Heterocephalus glaber]
 ref|XP_004920262.1| PREDICTED: histone H4-like [Xenopus (Silurana) tropicalis]
 ref|XP_004920490.1| PREDICTED: histone H4-like [Xenopus (Silurana) tropicalis]
 ref|XP_004898150.1| PREDICTED: histone H4-like isoform X1 [Heterocephalus glaber]
 ref|XP_004898151.1| PREDICTED: histone H4-like isoform X2 [Heterocephalus glaber]
 ref|XP_004898152.1| PREDICTED: histone H4-like [Heterocephalus glaber]
 ref|XP_004898164.1| PREDICTED: histone H4-like isoform X2 [Heterocephalus glaber]
 ref|XP_004900727.1| PREDICTED: histone H4-like isoform X1 [Heterocephalus glaber]
 ref|XP_004900728.1| PREDICTED: histone H4-like isoform X2 [Heterocephalus glaber]
 ref|XP_004900729.1| PREDICTED: histone H4-like isoform X3 [Heterocephalus glaber]
 ref|XP_004900730.1| PREDICTED: histone H4-like isoform X4 [Heterocephalus glaber]
 ref|XP_004900733.1| PREDICTED: histone H4-like [Heterocephalus glaber]
 ref|XP_004900738.1| PREDICTED: histone H4-like isoform X2 [Heterocephalus glaber]
 ref|XP_004900739.1| PREDICTED: histone H4-like isoform X3 [Heterocephalus glaber]
 ref|XP_004900770.1| PREDICTED: histone H4-like [Heterocephalus glaber]
 ref|XP_004845889.1| PREDICTED: histone H4-like isoform X1 [Heterocephalus glaber]
 ref|XP_004845890.1| PREDICTED: histone H4-like isoform X2 [Heterocephalus glaber]
 ref|XP_004847587.1| PREDICTED: histone H4-like isoform X1 [Heterocephalus glaber]
 ref|XP_004847588.1| PREDICTED: histone H4-like isoform X2 [Heterocephalus glaber]
 ref|XP_004847589.1| PREDICTED: histone H4-like isoform X3 [Heterocephalus glaber]
 ref|XP_004847590.1| PREDICTED: histone H4-like isoform X4 [Heterocephalus glaber]
 ref|XP_004847596.1| PREDICTED: histone H4-like isoform X2 [Heterocephalus glaber]
 ref|XP_004847597.1| PREDICTED: histone H4-like isoform X3 [Heterocephalus glaber]
 ref|XP_004847602.1| PREDICTED: histone H4-like [Heterocephalus glaber]
 ref|XP_004847609.1| PREDICTED: histone H4-like [Heterocephalus glaber]
 ref|XP_004847619.1| PREDICTED: histone H4-like [Heterocephalus glaber]
 ref|XP_004847620.1| PREDICTED: histone H4-like isoform X1 [Heterocephalus glaber]
 ref|XP_004847621.1| PREDICTED: histone H4-like isoform X2 [Heterocephalus glaber]
 ref|XP_004847863.1| PREDICTED: histone H4-like [Heterocephalus glaber]
 ref|XP_004847870.1| PREDICTED: histone H4-like [Heterocephalus glaber]
 ref|XP_004847871.1| PREDICTED: histone H4-like [Heterocephalus glaber]
 ref|XP_004847877.1| PREDICTED: histone H4-like [Heterocephalus glaber]
 ref|XP_004853988.1| PREDICTED: histone H4-like [Heterocephalus glaber]
 ref|XP_004937726.1| PREDICTED: histone H4-like [Gallus gallus]
 ref|XP_005003350.1| PREDICTED: histone H4-like [Cavia porcellus]
 ref|XP_005012212.1| PREDICTED: histone H4-like [Anas platyrhynchos]
 ref|XP_005012215.1| PREDICTED: histone H4-like [Anas platyrhynchos]
 ref|XP_005012217.1| PREDICTED: histone H4-like [Anas platyrhynchos]
 ref|XP_005012221.1| PREDICTED: histone H4-like [Anas platyrhynchos]
 ref|XP_005012223.1| PREDICTED: histone H4-like [Anas platyrhynchos]
 ref|XP_005012226.1| PREDICTED: histone H4-like [Anas platyrhynchos]
 ref|XP_005066519.1| PREDICTED: histone H4-like [Mesocricetus auratus]
 ref|XP_005066525.1| PREDICTED: histone H4-like [Mesocricetus auratus]
 ref|XP_005066528.1| PREDICTED: histone H4-like [Mesocricetus auratus]
 ref|XP_005066531.1| PREDICTED: histone H4-like [Mesocricetus auratus]
 ref|XP_005066535.1| PREDICTED: histone H4-like [Mesocricetus auratus]
 ref|XP_005072948.1| PREDICTED: histone H4-like [Mesocricetus auratus]
 ref|XP_005084300.1| PREDICTED: histone H4-like [Mesocricetus auratus]
 ref|XP_005039647.1| PREDICTED: histone H4-like [Ficedula albicollis]
 ref|XP_005039651.1| PREDICTED: histone H4-like [Ficedula albicollis]
 ref|XP_005039652.1| PREDICTED: histone H4-like [Ficedula albicollis]
 ref|XP_005150320.1| PREDICTED: histone H4-like [Melopsittacus undulatus]
 ref|XP_005150324.1| PREDICTED: histone H4-like [Melopsittacus undulatus]
 ref|XP_005150326.1| PREDICTED: histone H4-like [Melopsittacus undulatus]
 ref|XP_005150331.1| PREDICTED: histone H4-like [Melopsittacus undulatus]
 ref|XP_005150333.1| PREDICTED: histone H4-like [Melopsittacus undulatus]
 ref|XP_005150336.1| PREDICTED: histone H4-like [Melopsittacus undulatus]
 ref|XP_005172452.1| PREDICTED: histone H4 [Danio rerio]
 ref|XP_005172454.1| PREDICTED: histone H4 [Danio rerio]
 ref|XP_005172457.1| PREDICTED: histone H4 [Danio rerio]
 ref|XP_005170788.1| PREDICTED: histone H4 [Danio rerio]
 ref|XP_005163275.1| PREDICTED: histone H4 [Danio rerio]
 ref|XP_005163249.1| PREDICTED: histone H4 [Danio rerio]
 ref|XP_005223853.1| PREDICTED: histone H4 [Bos taurus]
 ref|XP_005223857.1| PREDICTED: histone H4 isoform X3 [Bos taurus]
 ref|XP_005237425.1| PREDICTED: histone H4-like [Falco peregrinus]
 ref|XP_005237427.1| PREDICTED: histone H4-like [Falco peregrinus]
 ref|XP_005237432.1| PREDICTED: histone H4-like [Falco peregrinus]
 ref|XP_005308996.1| PREDICTED: histone H4 [Chrysemys picta bellii]
 ref|XP_005308998.1| PREDICTED: histone H4 [Chrysemys picta bellii]
 ref|XP_005313473.1| PREDICTED: histone H4 [Chrysemys picta bellii]
 ref|XP_005313480.1| PREDICTED: histone H4 [Chrysemys picta bellii]
 ref|XP_005354995.1| PREDICTED: histone H4-like isoform X2 [Microtus ochrogaster]
 ref|XP_005355008.1| PREDICTED: histone H4-like [Microtus ochrogaster]
 ref|XP_005355010.1| PREDICTED: histone H4-like [Microtus ochrogaster]
 ref|XP_005356994.1| PREDICTED: histone H4-like [Microtus ochrogaster]
 ref|XP_005364576.1| PREDICTED: histone H4-like [Microtus ochrogaster]
 ref|XP_005369960.1| PREDICTED: histone H4-like [Microtus ochrogaster]
 ref|XP_005372471.1| PREDICTED: histone H4-like [Microtus ochrogaster]
 ref|XP_005331192.1| PREDICTED: histone H4-like [Ictidomys tridecemlineatus]
 ref|XP_005331947.1| PREDICTED: histone H4-like [Ictidomys tridecemlineatus]
 ref|XP_005337097.1| PREDICTED: histone H4-like [Ictidomys tridecemlineatus]
 ref|XP_005337104.1| PREDICTED: histone H4-like [Ictidomys tridecemlineatus]
 ref|XP_005337110.1| PREDICTED: histone H4-like [Ictidomys tridecemlineatus]
 ref|XP_005337152.1| PREDICTED: histone H4-like [Ictidomys tridecemlineatus]
 ref|XP_005378769.1| PREDICTED: histone H4-like [Chinchilla lanigera]
 ref|XP_005379056.1| PREDICTED: histone H4-like isoform X1 [Chinchilla lanigera]
 ref|XP_005379057.1| PREDICTED: histone H4-like isoform X2 [Chinchilla lanigera]
 ref|XP_005379058.1| PREDICTED: histone H4-like isoform X3 [Chinchilla lanigera]
 ref|XP_005379059.1| PREDICTED: histone H4-like isoform X4 [Chinchilla lanigera]
 ref|XP_005379060.1| PREDICTED: histone H4-like isoform X5 [Chinchilla lanigera]
 ref|XP_005403347.1| PREDICTED: histone H4-like [Chinchilla lanigera]
 ref|XP_005403352.1| PREDICTED: histone H4-like [Chinchilla lanigera]
 ref|XP_005403356.1| PREDICTED: histone H4-like [Chinchilla lanigera]
 ref|XP_005403358.1| PREDICTED: histone H4-like [Chinchilla lanigera]
 ref|XP_005403388.1| PREDICTED: histone H4-like [Chinchilla lanigera]
 ref|XP_005441361.1| PREDICTED: histone H4-like [Falco cherrug]
 ref|XP_005441366.1| PREDICTED: histone H4-like [Falco cherrug]
 ref|XP_005441368.1| PREDICTED: histone H4-like [Falco cherrug]
 ref|XP_005480798.1| PREDICTED: histone H4-like [Zonotrichia albicollis]
 ref|XP_005480800.1| PREDICTED: histone H4-like [Zonotrichia albicollis]
 ref|XP_005475790.1| PREDICTED: histone H4-like [Oreochromis niloticus]
 ref|XP_005455910.1| PREDICTED: histone H4-like [Oreochromis niloticus]
 ref|XP_005455914.1| PREDICTED: histone H4-like [Oreochromis niloticus]
 ref|XP_005462225.1| PREDICTED: histone H4-like [Oreochromis niloticus]
 ref|XP_005465169.1| PREDICTED: histone H4-like [Oreochromis niloticus]
 ref|XP_005466235.1| PREDICTED: histone H4-like [Oreochromis niloticus]
 ref|XP_005421692.1| PREDICTED: histone H4-like [Geospiza fortis]
 ref|XP_005421695.1| PREDICTED: histone H4-like [Geospiza fortis]
 ref|XP_005421696.1| PREDICTED: histone H4-like [Geospiza fortis]
 ref|XP_005421698.1| PREDICTED: histone H4-like [Geospiza fortis]
 ref|XP_005519540.1| PREDICTED: histone H4-like [Pseudopodoces humilis]
 ref|XP_005519543.1| PREDICTED: histone H4-like [Pseudopodoces humilis]
 ref|XP_005519550.1| PREDICTED: histone H4-like [Pseudopodoces humilis]
 ref|XP_005519554.1| PREDICTED: histone H4-like [Pseudopodoces humilis]
 ref|XP_005519555.1| PREDICTED: histone H4-like [Pseudopodoces humilis]
 ref|XP_005519558.1| PREDICTED: histone H4-like [Pseudopodoces humilis]
 ref|XP_005527781.1| PREDICTED: histone H4-like [Pseudopodoces humilis]
 ref|XP_005505471.1| PREDICTED: histone H4-like [Columba livia]
 ref|XP_005515110.1| PREDICTED: histone H4-like [Columba livia]
 ref|XP_005515113.1| PREDICTED: histone H4-like [Columba livia]
 ref|XP_005515118.1| PREDICTED: histone H4-like [Columba livia]
 ref|XP_005553801.1| PREDICTED: histone H4-like [Macaca fascicularis]
 ref|XP_005553865.1| PREDICTED: histone H4-like [Macaca fascicularis]
 ref|XP_005553874.1| PREDICTED: histone H4-like [Macaca fascicularis]
 ref|XP_005553915.1| PREDICTED: histone H4-like [Macaca fascicularis]
 ref|XP_005553916.1| PREDICTED: histone H4-like [Macaca fascicularis]
 ref|XP_005595820.1| PREDICTED: histone H4-like [Macaca fascicularis]
 ref|XP_005595954.1| PREDICTED: histone H4-like [Macaca fascicularis]
 ref|XP_005603680.1| PREDICTED: histone H4-like [Equus caballus]
 ref|XP_005603685.1| PREDICTED: histone H4-like [Equus caballus]
 ref|XP_005611010.1| PREDICTED: histone H4-like [Equus caballus]
 ref|XP_005640157.1| PREDICTED: histone H4-like [Canis lupus familiaris]
 ref|XP_005665718.1| PREDICTED: histone H4-like [Sus scrofa]
 ref|XP_005734221.1| PREDICTED: histone H4-like [Pundamilia nyererei]
 ref|XP_005677765.1| PREDICTED: histone H4-like [Capra hircus]
 ref|XP_005696795.1| PREDICTED: histone H4-like [Capra hircus]
 ref|XP_005696801.1| PREDICTED: histone H4-like [Capra hircus]
 ref|XP_005701750.1| PREDICTED: histone H4-like [Capra hircus]
 ref|XP_005753323.1| PREDICTED: histone H4-like [Pundamilia nyererei]
 ref|XP_005755482.1| PREDICTED: histone H4-like [Pundamilia nyererei]
 ref|XP_005800079.1| PREDICTED: histone H4-like [Xiphophorus maculatus]
 ref|XP_005809227.1| PREDICTED: histone H4-like [Xiphophorus maculatus]
 ref|XP_005811247.1| PREDICTED: histone H4-like [Xiphophorus maculatus]
 ref|XP_005812305.1| PREDICTED: histone H4-like [Xiphophorus maculatus]
 ref|XP_005812307.1| PREDICTED: histone H4-like [Xiphophorus maculatus]
 ref|XP_005812310.1| PREDICTED: histone H4-like [Xiphophorus maculatus]
 ref|XP_005817476.1| PREDICTED: histone H4-like [Xiphophorus maculatus]
 ref|XP_005863145.1| PREDICTED: histone H4-like [Myotis brandtii]
 ref|XP_005863147.1| PREDICTED: histone H4-like [Myotis brandtii]
 ref|XP_005863154.1| PREDICTED: histone H4-like [Myotis brandtii]
 ref|XP_005867476.1| PREDICTED: histone H4-like [Myotis brandtii]
 ref|XP_005921124.1| PREDICTED: histone H4-like [Haplochromis burtoni]
 ref|XP_005937148.1| PREDICTED: histone H4-like [Haplochromis burtoni]
 ref|XP_005891283.1| PREDICTED: histone H4-like [Bos mutus]
 ref|XP_005892266.1| PREDICTED: histone H4-like [Bos mutus]
 ref|XP_005893766.1| PREDICTED: histone H4-like [Bos mutus]
 ref|XP_005896914.1| PREDICTED: histone H4-like [Bos mutus]
 ref|XP_005900936.1| PREDICTED: histone H4-like [Bos mutus]
 ref|XP_005903677.1| PREDICTED: histone H4-like [Bos mutus]
 ref|XP_005906209.1| PREDICTED: histone H2A type 1-D-like isoform X2 [Bos mutus]
 ref|XP_005906214.1| PREDICTED: histone H4-like [Bos mutus]
 ref|XP_005907808.1| PREDICTED: histone H4-like [Bos mutus]
 ref|XP_005910222.1| PREDICTED: histone H4-like [Bos mutus]
 ref|XP_005954921.1| PREDICTED: histone H4-like [Pantholops hodgsonii]
 ref|XP_005959639.1| PREDICTED: histone H4-like [Pantholops hodgsonii]
 ref|XP_005960027.1| PREDICTED: histone H4-like [Pantholops hodgsonii]
 ref|XP_005982803.1| PREDICTED: histone H4-like [Pantholops hodgsonii]
 ref|XP_005982809.1| PREDICTED: histone H4-like [Pantholops hodgsonii]
 ref|XP_006008790.1| PREDICTED: histone H4-like [Latimeria chalumnae]
 ref|XP_006014940.1| PREDICTED: histone H4-like [Alligator sinensis]
 ref|XP_006014945.1| PREDICTED: histone H4-like [Alligator sinensis]
 ref|XP_006024239.1| PREDICTED: histone H4-like [Alligator sinensis]
 ref|XP_006024243.1| PREDICTED: histone H4-like [Alligator sinensis]
 ref|XP_006024245.1| PREDICTED: histone H4-like [Alligator sinensis]
 ref|XP_006024246.1| PREDICTED: histone H4-like [Alligator sinensis]
 ref|XP_006095229.1| PREDICTED: histone H4-like [Myotis lucifugus]
 ref|XP_006095230.1| PREDICTED: histone H4-like [Myotis lucifugus]
 ref|XP_006125962.1| PREDICTED: histone H4-like [Pelodiscus sinensis]
 ref|XP_006125963.1| PREDICTED: histone H4-like [Pelodiscus sinensis]
 ref|XP_006125967.1| PREDICTED: histone H4-like [Pelodiscus sinensis]
 ref|XP_006125968.1| PREDICTED: histone H4-like [Pelodiscus sinensis]
 ref|XP_006125969.1| PREDICTED: histone H4-like [Pelodiscus sinensis]
 ref|XP_006125970.1| PREDICTED: histone H4-like [Pelodiscus sinensis]
 ref|XP_006128689.1| PREDICTED: histone H4-like [Pelodiscus sinensis]
 ref|XP_006128690.1| PREDICTED: histone H4-like [Pelodiscus sinensis]
 ref|XP_006105757.1| PREDICTED: histone H4-like [Myotis lucifugus]
 ref|XP_006105773.1| PREDICTED: histone H4-like [Myotis lucifugus]
 ref|XP_006105774.1| PREDICTED: histone H4-like [Myotis lucifugus]
 ref|XP_006105898.1| PREDICTED: histone H4-like [Myotis lucifugus]
 ref|XP_006182225.1| PREDICTED: histone H4-like [Camelus ferus]
 ref|XP_006195502.1| PREDICTED: histone H4-like [Camelus ferus]
 ref|XP_006195527.1| PREDICTED: histone H4-like [Camelus ferus]
 ref|XP_006194230.1| PREDICTED: histone H4-like [Camelus ferus]
 ref|XP_006215319.1| PREDICTED: histone H4-like [Vicugna pacos]
 ref|XP_006215323.1| PREDICTED: histone H4-like [Vicugna pacos]
 ref|XP_006216973.1| PREDICTED: histone H4-like [Vicugna pacos]
 ref|XP_006218982.1| PREDICTED: histone H4-like [Vicugna pacos]
 ref|XP_006218987.1| PREDICTED: histone H4-like [Vicugna pacos]
 ref|XP_006220086.1| PREDICTED: histone H4-like [Vicugna pacos]
 ref|XP_006162706.1| PREDICTED: histone H4-like [Tupaia chinensis]
 ref|XP_006162716.1| PREDICTED: histone H4-like [Tupaia chinensis]
 ref|XP_006162718.1| PREDICTED: histone H4-like [Tupaia chinensis]
 ref|XP_006162724.1| PREDICTED: histone H4-like [Tupaia chinensis]
 ref|XP_006162731.1| PREDICTED: histone H4-like [Tupaia chinensis]
 ref|XP_006168565.1| PREDICTED: histone H4-like [Tupaia chinensis]
 ref|XP_006170025.1| PREDICTED: histone H4-like [Tupaia chinensis]
 ref|XP_006268100.1| PREDICTED: histone H4-like [Alligator mississippiensis]
 ref|XP_006268104.1| PREDICTED: histone H4-like [Alligator mississippiensis]
 ref|XP_006268106.1| PREDICTED: histone H4-like [Alligator mississippiensis]
 ref|XP_006268107.1| PREDICTED: histone H4-like [Alligator mississippiensis]
 ref|XP_006268108.1| PREDICTED: histone H4-like [Alligator mississippiensis]
 ref|XP_006268897.1| PREDICTED: histone H4-like [Alligator mississippiensis]
 ref|XP_006268901.1| PREDICTED: histone H4-like [Alligator mississippiensis]
 ref|XP_006269556.1| PREDICTED: histone H4-like [Alligator mississippiensis]
 ref|XP_006254044.1| PREDICTED: histone H4 [Rattus norvegicus]
 ref|XP_006544162.1| PREDICTED: histone H4 [Mus musculus]
 ref|XP_006781036.1| PREDICTED: histone H4-like [Neolamprologus brichardi]
 ref|XP_006781087.1| PREDICTED: histone H4-like [Neolamprologus brichardi]
 ref|XP_006781098.1| PREDICTED: histone H4-like [Neolamprologus brichardi]
 ref|XP_006785219.1| PREDICTED: histone H4-like [Neolamprologus brichardi]
 ref|XP_006806874.1| PREDICTED: histone H4-like [Neolamprologus brichardi]
 ref|XP_006806875.1| PREDICTED: histone H4-like [Neolamprologus brichardi]
 ref|XP_006809850.1| PREDICTED: histone H4-like [Neolamprologus brichardi]
 ref|XP_006775653.1| PREDICTED: histone H4-like [Myotis davidii]
 ref|XP_006755675.1| PREDICTED: histone H4-like [Myotis davidii]
 ref|XP_006760037.1| PREDICTED: histone H4-like [Myotis davidii]
 ref|XP_006760044.1| PREDICTED: histone H4-like [Myotis davidii]
 ref|XP_006733829.1| PREDICTED: histone H4-like isoform X1 [Leptonychotes weddellii]
 ref|XP_006735957.1| PREDICTED: histone H4-like [Leptonychotes weddellii]
 ref|XP_006735963.1| PREDICTED: histone H4-like isoform X1 [Leptonychotes weddellii]
 ref|XP_006735964.1| PREDICTED: histone H4-like isoform X2 [Leptonychotes weddellii]
 ref|XP_006735968.1| PREDICTED: histone H4-like [Leptonychotes weddellii]
 ref|XP_006735977.1| PREDICTED: histone H4-like [Leptonychotes weddellii]
 ref|XP_006735981.1| PREDICTED: histone H4-like [Leptonychotes weddellii]
 ref|XP_006736831.1| PREDICTED: histone H4-like [Leptonychotes weddellii]
 ref|XP_006750237.1| PREDICTED: histone H4-like [Leptonychotes weddellii]
 ref|XP_006880153.1| PREDICTED: histone H4-like [Elephantulus edwardii]
 ref|XP_006814524.1| PREDICTED: histone H4-like [Saccoglossus kowalevskii]
 ref|XP_006814802.1| PREDICTED: histone H4-like [Saccoglossus kowalevskii]
 ref|XP_006814804.1| PREDICTED: histone H4-like [Saccoglossus kowalevskii]
 ref|XP_006812122.1| PREDICTED: histone H4-like [Saccoglossus kowalevskii]
 ref|XP_006816988.1| PREDICTED: histone H4-like [Saccoglossus kowalevskii]
 ref|XP_006888689.1| PREDICTED: histone H4-like [Elephantulus edwardii]
 ref|XP_006818183.1| PREDICTED: histone H4-like [Saccoglossus kowalevskii]
 ref|XP_006820570.1| PREDICTED: histone H4-like [Saccoglossus kowalevskii]
 ref|XP_006820573.1| PREDICTED: histone H4-like [Saccoglossus kowalevskii]
 ref|XP_006820576.1| PREDICTED: histone H4-like [Saccoglossus kowalevskii]
 ref|XP_006823987.1| PREDICTED: histone H4-like [Saccoglossus kowalevskii]
 ref|XP_006825353.1| PREDICTED: histone H4-like [Saccoglossus kowalevskii]
 ref|XP_006825355.1| PREDICTED: histone H4-like [Saccoglossus kowalevskii]
 ref|XP_006903434.1| PREDICTED: histone H4-like [Elephantulus edwardii]
 ref|XP_006872852.1| PREDICTED: histone H4-like [Chrysochloris asiatica]
 ref|XP_006872866.1| PREDICTED: histone H4-like [Chrysochloris asiatica]
 ref|XP_006872935.1| PREDICTED: histone H4-like [Chrysochloris asiatica]
 ref|XP_006876126.1| PREDICTED: histone H4-like [Chrysochloris asiatica]
 ref|XP_006919777.1| PREDICTED: histone H4-like [Pteropus alecto]
 ref|XP_006923511.1| PREDICTED: histone H4-like [Pteropus alecto]
 ref|XP_006923521.1| PREDICTED: histone H4-like [Pteropus alecto]
 ref|XP_006923527.1| PREDICTED: histone H4-like [Pteropus alecto]
 ref|XP_006923537.1| PREDICTED: histone H4-like [Pteropus alecto]
 ref|XP_006923542.1| PREDICTED: histone H4-like [Pteropus alecto]
 ref|XP_006923553.1| PREDICTED: histone H4-like [Pteropus alecto]
 ref|XP_006931451.1| PREDICTED: histone H4 [Felis catus]
 ref|XP_006931453.1| PREDICTED: histone H4 [Felis catus]
 ref|XP_006931456.1| PREDICTED: histone H4 [Felis catus]
 ref|XP_006933596.1| PREDICTED: histone H4 [Felis catus]
 ref|XP_006935130.1| PREDICTED: histone H4 [Felis catus]
 ref|XP_006976576.1| PREDICTED: histone H4-like [Peromyscus maniculatus bairdii]
 ref|XP_006988914.1| PREDICTED: histone H4-like [Peromyscus maniculatus bairdii]
 ref|XP_006988926.1| PREDICTED: histone H4-like [Peromyscus maniculatus bairdii]
 ref|XP_006993205.1| PREDICTED: histone H4-like [Peromyscus maniculatus bairdii]
 ref|XP_006993206.1| PREDICTED: histone H4-like [Peromyscus maniculatus bairdii]
 ref|XP_006993213.1| PREDICTED: histone H4-like [Peromyscus maniculatus bairdii]
 ref|XP_006993220.1| PREDICTED: histone H4-like [Peromyscus maniculatus bairdii]
 ref|XP_006993241.1| PREDICTED: histone H4-like [Peromyscus maniculatus bairdii]
 ref|XP_007074498.1| PREDICTED: histone H4-like [Panthera tigris altaica]
 ref|XP_007074499.1| PREDICTED: histone H4-like [Panthera tigris altaica]
 ref|XP_007074527.1| PREDICTED: histone H4-like [Panthera tigris altaica]
 ref|XP_007082828.1| PREDICTED: histone H4-like [Panthera tigris altaica]
 ref|XP_007088094.1| PREDICTED: histone H4-like [Panthera tigris altaica]
 ref|XP_007059789.1| PREDICTED: histone H4-like [Chelonia mydas]
 ref|XP_007064094.1| PREDICTED: histone H4-like [Chelonia mydas]
 ref|XP_007064095.1| PREDICTED: histone H4-like [Chelonia mydas]
 ref|XP_007064096.1| PREDICTED: histone H4-like [Chelonia mydas]
 ref|XP_007064110.1| PREDICTED: histone H4-like [Chelonia mydas]
 ref|XP_007064142.1| PREDICTED: histone H4-like [Chelonia mydas]
 ref|XP_007105890.1| PREDICTED: histone H4-like [Physeter catodon]
 ref|XP_007107817.1| PREDICTED: histone H4-like isoform X2 [Physeter catodon]
 ref|XP_007114492.1| PREDICTED: histone H4-like [Physeter catodon]
 ref|XP_007128640.1| PREDICTED: histone H4-like [Physeter catodon]
 ref|XP_007128663.1| PREDICTED: histone H4-like [Physeter catodon]
 ref|XP_007128668.1| PREDICTED: histone H4-like [Physeter catodon]
 ref|XP_006045704.1| PREDICTED: histone H4-like [Bubalus bubalis]
 ref|XP_006045706.1| PREDICTED: histone H4-like [Bubalus bubalis]
 ref|XP_006048046.1| PREDICTED: histone H4-like [Bubalus bubalis]
 ref|XP_006048077.1| PREDICTED: histone H4-like [Bubalus bubalis]
 ref|XP_006048083.1| PREDICTED: histone H4-like [Bubalus bubalis]
 ref|XP_006048084.1| PREDICTED: histone H4-like [Bubalus bubalis]
 ref|XP_006048100.1| PREDICTED: histone H4-like [Bubalus bubalis]
 ref|XP_006049259.1| PREDICTED: histone H4-like [Bubalus bubalis]
 ref|XP_006055198.1| PREDICTED: histone H4-like isoform X1 [Bubalus bubalis]
 ref|XP_006055199.1| PREDICTED: histone H4-like isoform X2 [Bubalus bubalis]
 ref|XP_006055200.1| PREDICTED: histone H4-like isoform X3 [Bubalus bubalis]
 ref|XP_006055201.1| PREDICTED: histone H4-like isoform X4 [Bubalus bubalis]
 ref|XP_006055202.1| PREDICTED: histone H4-like isoform X5 [Bubalus bubalis]
 ref|XP_007179086.1| PREDICTED: histone H4-like [Balaenoptera acutorostrata scammoni]
 ref|XP_007179092.1| PREDICTED: histone H4-like [Balaenoptera acutorostrata scammoni]
 ref|XP_007179093.1| PREDICTED: histone H4-like [Balaenoptera acutorostrata scammoni]
 ref|XP_007179108.1| PREDICTED: histone H4-like [Balaenoptera acutorostrata scammoni]
 ref|XP_007196100.1| PREDICTED: histone H4-like [Balaenoptera acutorostrata scammoni]
 ref|XP_007238183.1| PREDICTED: histone H4-like [Astyanax mexicanus]
 ref|XP_007427785.1| PREDICTED: histone H4-like [Python bivittatus]
 ref|XP_007429383.1| PREDICTED: histone H4-like [Python bivittatus]
 ref|XP_007445089.1| PREDICTED: histone H4-like [Python bivittatus]
 ref|XP_007445390.1| PREDICTED: histone H4-like [Python bivittatus]
 ref|XP_007441164.1| PREDICTED: histone H4-like [Python bivittatus]
 ref|XP_007454692.1| PREDICTED: histone H4-like isoform X1 [Lipotes vexillifer]
 ref|XP_007454693.1| PREDICTED: histone H4-like isoform X2 [Lipotes vexillifer]
 ref|XP_007463536.1| PREDICTED: histone H4-like [Lipotes vexillifer]
 ref|XP_007471301.1| PREDICTED: histone H4-like [Lipotes vexillifer]
 ref|XP_007471305.1| PREDICTED: histone H4-like [Lipotes vexillifer]
 ref|XP_007471317.1| PREDICTED: histone H4-like [Lipotes vexillifer]
 ref|XP_007471323.1| PREDICTED: histone H4-like [Lipotes vexillifer]
 ref|XP_007483398.1| PREDICTED: histone H4-like isoform X1 [Monodelphis domestica]
 ref|XP_007483399.1| PREDICTED: histone H4-like isoform X2 [Monodelphis domestica]
 ref|XP_007485413.1| PREDICTED: histone H4-like [Monodelphis domestica]
 ref|XP_007555237.1| PREDICTED: histone H4 [Poecilia formosa]
 ref|XP_007561738.1| PREDICTED: histone H4 [Poecilia formosa]
 ref|XP_007561746.1| PREDICTED: histone H4 [Poecilia formosa]
 ref|XP_007541923.1| PREDICTED: histone H4 [Poecilia formosa]
 ref|XP_007545198.1| PREDICTED: histone H4 [Poecilia formosa]
 ref|XP_007531640.1| PREDICTED: histone H4 [Erinaceus europaeus]
 ref|XP_007534627.1| PREDICTED: histone H4 isoform X2 [Erinaceus europaeus]
 ref|XP_007534645.1| PREDICTED: histone H4 [Erinaceus europaeus]
 ref|XP_007640984.1| PREDICTED: histone H4 [Cricetulus griseus]
 ref|XP_007624055.1| PREDICTED: histone H4 [Cricetulus griseus]
 ref|XP_007634642.1| PREDICTED: histone H4 [Cricetulus griseus]
 ref|XP_007634643.1| PREDICTED: histone H4 [Cricetulus griseus]
 ref|XP_007634645.1| PREDICTED: histone H4 [Cricetulus griseus]
 ref|XP_007634650.1| PREDICTED: histone H4 [Cricetulus griseus]
 ref|XP_007634656.1| PREDICTED: histone H4 isoform X2 [Cricetulus griseus]
 ref|XP_007634659.1| PREDICTED: histone H4 [Cricetulus griseus]
 ref|XP_007882955.1| PREDICTED: histone H4 [Callorhinchus milii]
 ref|XP_007883224.1| PREDICTED: histone H4 [Callorhinchus milii]
 ref|XP_007883954.1| PREDICTED: histone H4 [Callorhinchus milii]
 ref|XP_007883983.1| PREDICTED: histone H4 [Callorhinchus milii]
 ref|XP_007948051.1| PREDICTED: histone H4 [Orycteropus afer afer]
 ref|XP_007948074.1| PREDICTED: histone H4 [Orycteropus afer afer]
 ref|XP_007971617.1| PREDICTED: histone H4 [Chlorocebus sabaeus]
 ref|XP_007971654.1| PREDICTED: histone H4 [Chlorocebus sabaeus]
 ref|XP_007971666.1| PREDICTED: histone H4 [Chlorocebus sabaeus]
 ref|XP_007971667.1| PREDICTED: histone H4 [Chlorocebus sabaeus]
 ref|XP_008018012.1| PREDICTED: histone H4 [Chlorocebus sabaeus]
 ref|XP_008018013.1| PREDICTED: histone H4 [Chlorocebus sabaeus]
 ref|XP_008055236.1| PREDICTED: histone H4 [Tarsius syrichta]
 ref|XP_008055785.1| PREDICTED: histone H4 [Tarsius syrichta]
 ref|XP_008055798.1| PREDICTED: histone H4 [Tarsius syrichta]
 ref|XP_008069394.1| PREDICTED: histone H4 [Tarsius syrichta]
 ref|XP_008071694.1| PREDICTED: histone H4 [Tarsius syrichta]
 ref|XP_008145273.1| PREDICTED: histone H4 [Eptesicus fuscus]
 ref|XP_008145274.1| PREDICTED: histone H4 [Eptesicus fuscus]
 ref|XP_008145279.1| PREDICTED: histone H4 [Eptesicus fuscus]
 ref|XP_008154018.1| PREDICTED: histone H4 [Eptesicus fuscus]
 ref|XP_008172416.1| PREDICTED: histone H4 [Chrysemys picta bellii]
 ref|XP_008175324.1| PREDICTED: histone H4 [Chrysemys picta bellii]
 ref|XP_008176482.1| PREDICTED: histone H4 [Chrysemys picta bellii]
 ref|XP_008257822.1| PREDICTED: histone H4 [Oryctolagus cuniculus]
 ref|XP_008260674.1| PREDICTED: histone H4 [Oryctolagus cuniculus]
 ref|XP_008260678.1| PREDICTED: histone H4 [Oryctolagus cuniculus]
 ref|XP_008260679.1| PREDICTED: histone H4 [Oryctolagus cuniculus]
 ref|XP_008246691.1| PREDICTED: histone H4 [Oryctolagus cuniculus]
 ref|XP_008246697.1| PREDICTED: histone H4 [Oryctolagus cuniculus]
 ref|XP_008308955.1| PREDICTED: histone H4 [Cynoglossus semilaevis]
 ref|XP_008311573.1| PREDICTED: histone H4 [Cynoglossus semilaevis]
 ref|XP_008331675.1| PREDICTED: histone H4 [Cynoglossus semilaevis]
 ref|XP_008421210.1| PREDICTED: histone H4 [Poecilia reticulata]
 ref|XP_008420767.1| PREDICTED: histone H4 [Poecilia reticulata]
 ref|XP_008433322.1| PREDICTED: histone H4 [Poecilia reticulata]
 ref|XP_008433324.1| PREDICTED: histone H4 [Poecilia reticulata]
 ref|XP_008433483.1| PREDICTED: histone H4 [Poecilia reticulata]
 ref|XP_008433489.1| PREDICTED: histone H4 [Poecilia reticulata]
 ref|XP_008433494.1| PREDICTED: histone H4 [Poecilia reticulata]
 ref|XP_008399080.1| PREDICTED: histone H4 [Poecilia reticulata]
 ref|XP_008401839.1| PREDICTED: histone H4 [Poecilia reticulata]
 ref|XP_008495030.1| PREDICTED: histone H4 [Calypte anna]
 ref|XP_008495149.1| PREDICTED: histone H4 [Calypte anna]
 ref|XP_008526338.1| PREDICTED: histone H4 [Equus przewalskii]
 ref|XP_008537623.1| PREDICTED: histone H4 [Equus przewalskii]
 ref|XP_008539388.1| PREDICTED: histone H4 [Equus przewalskii]
 ref|XP_008539395.1| PREDICTED: histone H4 [Equus przewalskii]
 ref|XP_008539407.1| PREDICTED: histone H4 [Equus przewalskii]
 ref|XP_008539410.1| PREDICTED: histone H4 [Equus przewalskii]
 ref|XP_008539714.1| PREDICTED: histone H4 [Equus przewalskii]
 ref|XP_008539715.1| PREDICTED: histone H4 [Equus przewalskii]
 ref|XP_008539758.1| PREDICTED: histone H4 [Equus przewalskii]
 ref|XP_008579882.1| PREDICTED: histone H4 [Galeopterus variegatus]
 ref|XP_008579884.1| PREDICTED: histone H4 [Galeopterus variegatus]
 ref|XP_008580590.1| PREDICTED: histone H4 [Galeopterus variegatus]
 ref|XP_008585842.1| PREDICTED: histone H4 [Galeopterus variegatus]
 ref|XP_008585847.1| PREDICTED: histone H4 [Galeopterus variegatus]
 ref|XP_008589681.1| PREDICTED: histone H4 [Galeopterus variegatus]
 ref|XP_008589682.1| PREDICTED: histone H4 [Galeopterus variegatus]
 ref|XP_008634733.1| PREDICTED: histone H4 [Corvus brachyrhynchos]
 ref|XP_008634736.1| PREDICTED: histone H4 [Corvus brachyrhynchos]
 ref|XP_008634738.1| PREDICTED: histone H4 [Corvus brachyrhynchos]
 ref|XP_008691177.1| PREDICTED: histone H4 [Ursus maritimus]
 ref|XP_008691189.1| PREDICTED: histone H4 [Ursus maritimus]
 ref|XP_008691225.1| PREDICTED: histone H4 [Ursus maritimus]
 ref|XP_008693978.1| PREDICTED: histone H4 [Ursus maritimus]
 ref|XP_008705243.1| PREDICTED: histone H4 [Ursus maritimus]
 ref|XP_008705244.1| PREDICTED: histone H4 [Ursus maritimus]
 ref|XP_008705245.1| PREDICTED: histone H4 [Ursus maritimus]
 ref|XP_008705247.1| PREDICTED: histone H4 [Ursus maritimus]
 ref|XP_008705248.1| PREDICTED: histone H4 [Ursus maritimus]
 ref|XP_008772190.1| PREDICTED: histone H4 [Rattus norvegicus]
 ref|XP_008772191.1| PREDICTED: histone H4 [Rattus norvegicus]
 ref|XP_008772194.1| PREDICTED: histone H4 [Rattus norvegicus]
 ref|XP_008772221.1| PREDICTED: histone H2A type 1-E [Rattus norvegicus]
 ref|XP_008772225.1| PREDICTED: histone H4 [Rattus norvegicus]
 ref|XP_008761668.1| PREDICTED: histone H4 [Rattus norvegicus]
 ref|XP_008761670.1| PREDICTED: histone H4 [Rattus norvegicus]
 ref|XP_008769897.1| PREDICTED: histone H4 [Rattus norvegicus]
 ref|XP_008769898.1| PREDICTED: histone H4 [Rattus norvegicus]
 ref|XP_008769992.1| PREDICTED: histone H2A type 1-E [Rattus norvegicus]
 ref|XP_008769995.1| PREDICTED: histone H4 [Rattus norvegicus]
 ref|XP_008824849.1| PREDICTED: histone H4 [Nannospalax galili]
 ref|XP_008824865.1| PREDICTED: histone H4 [Nannospalax galili]
 ref|XP_008830091.1| PREDICTED: histone H4 [Nannospalax galili]
 ref|XP_008830110.1| PREDICTED: histone H4 [Nannospalax galili]
 ref|XP_008854265.1| PREDICTED: histone H4 [Nannospalax galili]
 ref|XP_008992077.1| PREDICTED: histone H4 [Callithrix jacchus]
 ref|XP_009001542.1| PREDICTED: histone H4 [Callithrix jacchus]
 ref|XP_008967800.1| PREDICTED: histone H4 [Pan paniscus]
 ref|XP_008967801.1| PREDICTED: histone H4 [Pan paniscus]
 ref|XP_008953276.1| PREDICTED: histone H4 [Pan paniscus]
 ref|XP_009012267.1| hypothetical protein HELRODRAFT_187742 [Helobdella robusta]
 ref|XP_009018938.1| hypothetical protein HELRODRAFT_92568 [Helobdella robusta]
 ref|XP_009022236.1| hypothetical protein HELRODRAFT_92695 [Helobdella robusta]
 ref|XP_009046156.1| hypothetical protein LOTGIDRAFT_148724 [Lottia gigantea]
 ref|XP_009047427.1| hypothetical protein LOTGIDRAFT_148824 [Lottia gigantea]
 ref|XP_009047566.1| hypothetical protein LOTGIDRAFT_148840 [Lottia gigantea]
 ref|XP_009048211.1| hypothetical protein LOTGIDRAFT_146923 [Lottia gigantea]
 ref|XP_009052120.1| hypothetical protein LOTGIDRAFT_176527 [Lottia gigantea]
 ref|XP_009052549.1| hypothetical protein LOTGIDRAFT_202861 [Lottia gigantea]
 ref|XP_009052737.1| hypothetical protein LOTGIDRAFT_147261 [Lottia gigantea]
 ref|XP_009053070.1| hypothetical protein LOTGIDRAFT_147329 [Lottia gigantea]
 ref|XP_009054643.1| hypothetical protein LOTGIDRAFT_147488 [Lottia gigantea]
 ref|XP_009056374.1| hypothetical protein LOTGIDRAFT_145439 [Lottia gigantea]
 ref|XP_009058901.1| hypothetical protein LOTGIDRAFT_147781 [Lottia gigantea]
 ref|XP_009061370.1| hypothetical protein LOTGIDRAFT_148042 [Lottia gigantea]
 ref|XP_009062586.1| hypothetical protein LOTGIDRAFT_146028 [Lottia gigantea]
 ref|XP_009062588.1| hypothetical protein LOTGIDRAFT_146029 [Lottia gigantea]
 ref|XP_009065732.1| hypothetical protein LOTGIDRAFT_176226 [Lottia gigantea]
 ref|XP_009084845.1| PREDICTED: histone H4 [Serinus canaria]
 ref|XP_009084849.1| PREDICTED: histone H4 [Serinus canaria]
 ref|XP_009084859.1| PREDICTED: histone H4 [Serinus canaria]
 ref|XP_009169225.1| hypothetical protein T265_05840 [Opisthorchis viverrini]
 ref|XP_009178373.1| PREDICTED: histone H4 [Papio anubis]
 ref|XP_009202846.1| PREDICTED: histone H4 [Papio anubis]
 ref|XP_009202873.1| PREDICTED: histone H4 [Papio anubis]
 ref|XP_009197939.1| PREDICTED: histone H4 [Papio anubis]
 ref|XP_009288336.1| PREDICTED: histone H4 [Aptenodytes forsteri]
 ref|XP_009288337.1| PREDICTED: histone H4 [Aptenodytes forsteri]
 ref|XP_009288344.1| PREDICTED: histone H4 [Aptenodytes forsteri]
 ref|XP_009243271.1| PREDICTED: histone H4 [Pongo abelii]
 ref|XP_002816560.3| PREDICTED: histone H4 [Pongo abelii]
 ref|XP_009239774.1| PREDICTED: histone H4 [Pongo abelii]
 ref|XP_002823024.3| PREDICTED: histone H4 [Pongo abelii]
 ref|XP_009301164.1| PREDICTED: histone H4 [Danio rerio]
 ref|XP_009301181.1| PREDICTED: histone H4 [Danio rerio]
 ref|XP_009296456.1| PREDICTED: histone H4 [Danio rerio]
 ref|XP_001339600.3| PREDICTED: histone H4 [Danio rerio]
 ref|XP_009296466.1| PREDICTED: histone H4 [Danio rerio]
 ref|XP_009296489.1| PREDICTED: histone H4 [Danio rerio]
 ref|XP_009318340.1| PREDICTED: histone H4 [Pygoscelis adeliae]
 ref|XP_009320522.1| PREDICTED: histone H4 [Pygoscelis adeliae]
 ref|XP_009462254.1| PREDICTED: histone H4 [Nipponia nippon]
 ref|XP_009472820.1| PREDICTED: histone H4 [Nipponia nippon]
 ref|XP_009473262.1| PREDICTED: histone H4 [Nipponia nippon]
 ref|XP_009428446.1| PREDICTED: histone H4 [Pan troglodytes]
 ref|XP_009448911.1| PREDICTED: histone H4 [Pan troglodytes]
 ref|XP_009448917.1| PREDICTED: histone H4 [Pan troglodytes]
 ref|XP_009448968.1| PREDICTED: histone H4 [Pan troglodytes]
 ref|XP_009448973.1| PREDICTED: histone H4 [Pan troglodytes]
 ref|XP_009423180.1| PREDICTED: histone H4 [Pan troglodytes]
 ref|XP_009423181.1| PREDICTED: histone H4 [Pan troglodytes]
 ref|XP_009423182.1| PREDICTED: histone H4 [Pan troglodytes]
 ref|XP_009423183.1| PREDICTED: histone H4 [Pan troglodytes]
 ref|XP_009423184.1| PREDICTED: histone H4 [Pan troglodytes]
 ref|XP_009423185.1| PREDICTED: histone H4 [Pan troglodytes]
 ref|XP_009423186.1| PREDICTED: histone H4 [Pan troglodytes]
 ref|XP_009511707.1| PREDICTED: histone H4 [Phalacrocorax carbo]
 ref|XP_009556906.1| PREDICTED: histone H4 [Cuculus canorus]
 ref|XP_009675848.1| PREDICTED: histone H4 [Struthio camelus australis]
 ref|XP_009866097.1| PREDICTED: histone H4 [Apaloderma vittatum]
 ref|XP_009892672.1| PREDICTED: histone H4 [Charadrius vociferus]
 ref|XP_009892676.1| PREDICTED: histone H4 [Charadrius vociferus]
 ref|XP_009955444.1| PREDICTED: histone H4 [Leptosomus discolor]
 ref|XP_009952282.1| PREDICTED: histone H4 [Leptosomus discolor]
 ref|XP_009975982.1| PREDICTED: histone H4 [Tauraco erythrolophus]
 ref|XP_009988188.1| PREDICTED: histone H4 [Tauraco erythrolophus]
 ref|XP_010000736.1| PREDICTED: histone H4 [Chaetura pelagica]
 ref|XP_010000744.1| PREDICTED: histone H4 [Chaetura pelagica]
 ref|XP_010132697.1| PREDICTED: histone H4 [Buceros rhinoceros silvestris]
 ref|XP_010178063.1| PREDICTED: histone H4 [Mesitornis unicolor]
 ref|XP_010113760.1| PREDICTED: histone H4 [Chlamydotis macqueenii]
 ref|XP_010207239.1| PREDICTED: histone H4 [Colius striatus]
 ref|XP_010223172.1| PREDICTED: histone H4 [Tinamus guttatus]
 ref|XP_010289459.1| PREDICTED: histone H4 [Phaethon lepturus]
 ref|XP_010310054.1| PREDICTED: histone H4 [Balearica regulorum gibbericeps]
 ref|XP_010362906.1| PREDICTED: histone H4 [Rhinopithecus roxellana]
 ref|XP_010362978.1| PREDICTED: histone H4 [Rhinopithecus roxellana]
 ref|XP_010363144.1| PREDICTED: histone H4 [Rhinopithecus roxellana]
 ref|XP_010366761.1| PREDICTED: histone H4 [Rhinopithecus roxellana]
 ref|XP_010353241.1| PREDICTED: histone H4 [Rhinopithecus roxellana]
 ref|XP_010357659.1| PREDICTED: histone H4 [Rhinopithecus roxellana]
 ref|XP_010343416.1| PREDICTED: histone H4 [Saimiri boliviensis boliviensis]
 ref|XP_010567514.1| PREDICTED: histone H4 [Haliaeetus leucocephalus]
 ref|XP_010567520.1| PREDICTED: histone H4 [Haliaeetus leucocephalus]
 ref|XP_010567524.1| PREDICTED: histone H4 [Haliaeetus leucocephalus]
 ref|XP_010567526.1| PREDICTED: histone H4 isoform X1 [Haliaeetus leucocephalus]
 ref|XP_010578193.1| PREDICTED: histone H4 [Haliaeetus leucocephalus]
 ref|XP_010621017.1| PREDICTED: histone H4 [Fukomys damarensis]
 ref|XP_010621293.1| PREDICTED: histone H4 [Fukomys damarensis]
 ref|XP_010621298.1| PREDICTED: histone H4 [Fukomys damarensis]
 ref|XP_010621315.1| PREDICTED: histone H4 [Fukomys damarensis]
 ref|XP_010636723.1| PREDICTED: histone H4 [Fukomys damarensis]
 ref|XP_010708118.1| PREDICTED: histone H4 [Meleagris gallopavo]
 ref|XP_010725971.1| PREDICTED: histone H4 [Meleagris gallopavo]
 ref|XP_010746469.1| PREDICTED: histone H4 [Larimichthys crocea]
 ref|XP_010746474.1| PREDICTED: histone H4 [Larimichthys crocea]
 ref|XP_010746612.1| PREDICTED: histone H4 [Larimichthys crocea]
 ref|XP_010746617.1| PREDICTED: histone H4 [Larimichthys crocea]
 ref|XP_010790873.1| PREDICTED: histone H4 [Notothenia coriiceps]
 ref|XP_010772376.1| PREDICTED: histone H4 [Notothenia coriiceps]
 ref|XP_010778403.1| PREDICTED: histone H4 [Notothenia coriiceps]
 ref|XP_010792996.1| PREDICTED: histone H4 [Notothenia coriiceps]
 ref|XP_010823707.1| PREDICTED: histone H4 [Bos taurus]
 ref|XP_005196744.2| PREDICTED: histone H4 [Bos taurus]
 ref|XP_010823709.1| PREDICTED: histone H4 [Bos taurus]
 ref|XP_010823713.1| PREDICTED: histone H4 [Bos taurus]
 ref|XP_010823717.1| PREDICTED: histone H4 [Bos taurus]
 ref|XP_010816809.1| PREDICTED: histone H4 [Bos taurus]
 ref|XP_010816812.1| PREDICTED: histone H4 [Bos taurus]
 ref|XP_010816819.1| PREDICTED: histone H4 [Bos taurus]
 ref|XP_010851425.1| PREDICTED: histone H4 [Bison bison bison]
 ref|XP_010832334.1| PREDICTED: histone H4 [Bison bison bison]
 ref|XP_010832335.1| PREDICTED: histone H4 [Bison bison bison]
 ref|XP_010837042.1| PREDICTED: histone H4 [Bison bison bison]
 ref|XP_010841723.1| PREDICTED: histone H4 [Bison bison bison]
 ref|XP_010841726.1| PREDICTED: histone H4 [Bison bison bison]
 ref|XP_010841732.1| PREDICTED: histone H4 [Bison bison bison]
 ref|XP_010841741.1| PREDICTED: histone H4 [Bison bison bison]
 ref|XP_010842995.1| PREDICTED: histone H4 [Bison bison bison]
 ref|XP_010851977.1| PREDICTED: histone H4 [Bison bison bison]
 ref|XP_010857023.1| PREDICTED: histone H4 [Bison bison bison]
 ref|XP_010972455.1| PREDICTED: histone H4 [Camelus bactrianus]
 ref|XP_010972473.1| PREDICTED: histone H4 [Camelus bactrianus]
 ref|XP_010972489.1| PREDICTED: histone H4 [Camelus bactrianus]
 ref|XP_010972496.1| PREDICTED: histone H4 [Camelus bactrianus]
 ref|XP_010972502.1| PREDICTED: histone H4 [Camelus bactrianus]
 ref|XP_010972513.1| PREDICTED: histone H4 [Camelus bactrianus]
 ref|XP_010956829.1| PREDICTED: histone H4 [Camelus bactrianus]
 ref|XP_010973016.1| PREDICTED: histone H4 [Camelus dromedarius]
 ref|XP_010978464.1| PREDICTED: histone H4 [Camelus dromedarius]
 ref|XP_010978470.1| PREDICTED: histone H4 [Camelus dromedarius]
 ref|XP_010994986.1| PREDICTED: histone H4 [Camelus dromedarius]
 ref|XP_011232943.1| PREDICTED: histone H4 [Ailuropoda melanoleuca]
 ref|XP_011232961.1| PREDICTED: histone H4 [Ailuropoda melanoleuca]
 ref|XP_011234696.1| PREDICTED: histone H4 [Ailuropoda melanoleuca]
 ref|XP_011234707.1| PREDICTED: histone H4 [Ailuropoda melanoleuca]
 ref|XP_011216219.1| PREDICTED: histone H4 [Ailuropoda melanoleuca]
 ref|XP_011280374.1| PREDICTED: histone H4 [Felis catus]
 ref|XP_011280375.1| PREDICTED: histone H4 [Felis catus]
 ref|XP_011280379.1| PREDICTED: histone H4 [Felis catus]
 ref|XP_011280387.1| PREDICTED: histone H4 [Felis catus]
 ref|XP_011278010.1| PREDICTED: LOW QUALITY PROTEIN: histone H4-like [Felis catus]
 ref|XP_011364636.1| PREDICTED: histone H4 [Pteropus vampyrus]
 ref|XP_011364640.1| PREDICTED: histone H4 [Pteropus vampyrus]
 ref|XP_011416663.1| PREDICTED: histone H4 [Crassostrea gigas]
 ref|XP_011479048.1| PREDICTED: histone H4 [Oryzias latipes]
 ref|XP_011491738.1| PREDICTED: histone H4 [Oryzias latipes]
 sp|Q6WV72.3|H4_MYTTR RecName: Full=Histone H4 [Mytilus trossulus]
 sp|Q6WV73.3|H4_MYTCA RecName: Full=Histone H4 [Mytilus californianus]
 sp|Q6WV90.3|H4_MYTGA RecName: Full=Histone H4 [Mytilus galloprovincialis]
 sp|Q7K8C0.3|H4_MYTED RecName: Full=Histone H4 [Mytilus edulis]
 sp|Q7KQD1.3|H4_CHAVR RecName: Full=Histone H4 [Chaetopterus variopedatus]
 sp|P62802.2|H4_PIG RecName: Full=Histone H4 [Sus scrofa]
 sp|P62804.2|H4_RAT RecName: Full=Histone H4; Contains: RecName: Full=Osteogenic 
growth peptide; Short=OGP [Rattus norvegicus]
 sp|P62794.2|H4_URECA RecName: Full=Histone H4 [Urechis caupo]
 sp|P62795.2|H4_PLADU RecName: Full=Histone H4 [Platynereis dumerilii]
 sp|P62796.2|H4_ORENI RecName: Full=Histone H4 [Oreochromis niloticus]
 sp|P62797.2|H4_ONCMY RecName: Full=Histone H4 [Oncorhynchus mykiss]
 sp|P62798.2|H4_XENBO RecName: Full=Histone H4 [Xenopus borealis]
 sp|P62799.2|H4_XENLA RecName: Full=Histone H4 [Xenopus laevis]
 sp|P62800.2|H4_CAIMO RecName: Full=Histone H4 [Cairina moschata]
 sp|P62801.2|H4_CHICK RecName: Full=Histone H4 [Gallus gallus]
 sp|P62803.2|H4_BOVIN RecName: Full=Histone H4; AltName: Full=H4.1 [Bos taurus]
 sp|P62805.2|H4_HUMAN RecName: Full=Histone H4 [Homo sapiens]
 sp|P62806.2|H4_MOUSE RecName: Full=Histone H4 [Mus musculus]
 sp|Q5RCS7.1|H4_PONAB RecName: Full=Histone H4 [Pongo abelii]
 sp|Q4R362.1|H4_MACFA RecName: Full=Histone H4 [Macaca fascicularis]
 sp|Q28DR4.1|H4_XENTR RecName: Full=Histone H4 [Xenopus (Silurana) tropicalis]
 pir||S11312 histone H4 - polychaete (Platynereis dumerilii)
 pir||S21367 histone H4 - Nile tilapia
 pir||D56618 histone H4 - spoonworm (Urechis caupo)
 pdb|1EQZ|D Chain D, X-Ray Structure Of The Nucleosome Core Particle At 2.5 
A Resolution
 pdb|1EQZ|H Chain H, X-Ray Structure Of The Nucleosome Core Particle At 2.5 
A Resolution
 pdb|1F66|B Chain B, 2.6 A Crystal Structure Of A Nucleosome Core Particle 
Containing The Variant Histone H2a.Z
 pdb|1F66|F Chain F, 2.6 A Crystal Structure Of A Nucleosome Core Particle 
Containing The Variant Histone H2a.Z
 pdb|1HQ3|D Chain D, Crystal Structure Of The Histone-Core-Octamer In KclPHOSPHATE
 pdb|1HQ3|H Chain H, Crystal Structure Of The Histone-Core-Octamer In KclPHOSPHATE
 pdb|1TZY|D Chain D, Crystal Structure Of The Core-Histone Octamer To 1.90 
Angstrom Resolution
 pdb|1TZY|H Chain H, Crystal Structure Of The Core-Histone Octamer To 1.90 
Angstrom Resolution
 pdb|2CV5|B Chain B, Crystal Structure Of Human Nucleosome Core Particle
 pdb|2CV5|F Chain F, Crystal Structure Of Human Nucleosome Core Particle
 pdb|2ARO|D Chain D, Crystal Structure Of The Native Histone Octamer To 2.1 
Angstrom Resolution, Crystalised In The Presence Of S-nitrosoglutathione
 pdb|2ARO|H Chain H, Crystal Structure Of The Native Histone Octamer To 2.1 
Angstrom Resolution, Crystalised In The Presence Of S-nitrosoglutathione
 pdb|1U35|B Chain B, Crystal Structure Of The Nucleosome Core Particle Containing 
The Histone Domain Of Macroh2a
 pdb|1U35|F Chain F, Crystal Structure Of The Nucleosome Core Particle Containing 
The Histone Domain Of Macroh2a
 pdb|2F8N|B Chain B, 2.9 Angstrom X-Ray Structure Of Hybrid Macroh2a Nucleosomes
 pdb|2F8N|F Chain F, 2.9 Angstrom X-Ray Structure Of Hybrid Macroh2a Nucleosomes
 pdb|3NQU|B Chain B, Crystal Structure Of Partially Trypsinized (Cenp-AH4)2 
HETEROTETRAMER
 pdb|3R45|B Chain B, Structure Of A Cenp-A-Histone H4 Heterodimer In Complex 
With Chaperone Hjurp
 pdb|4HGA|C Chain C, Structure Of The Variant Histone H3.3-h4 Heterodimer 
In Complex With Its Chaperone Daxx
 pdb|4LD9|B Chain B, Crystal Structure Of The N-terminally Acetylated Bah 
Domain Of Sir3 Bound To The Nucleosome Core Particle
 pdb|4LD9|F Chain F, Crystal Structure Of The N-terminally Acetylated Bah 
Domain Of Sir3 Bound To The Nucleosome Core Particle
 pdb|4KGC|B Chain B, Nucleosome Core Particle Containing (eta6-p-cymene)-(1, 
2- Ethylenediamine)-ruthenium
 pdb|4KGC|F Chain F, Nucleosome Core Particle Containing (eta6-p-cymene)-(1, 
2- Ethylenediamine)-ruthenium
 gb|AAM83108.1|AF525682_1 histone H4 [Homo sapiens]
 emb|CAA37414.1| unnamed protein product [Platynereis dumerilii]
 emb|CAA41699.1| H4 histone [Urechis caupo]
 emb|CAA43011.1| H4 histone [Homo sapiens]
 emb|CAA43012.1| H4 histone [Homo sapiens]
 emb|CAA43013.1| H4 histone [Homo sapiens]
 emb|CAA43014.1| H4 histone [Homo sapiens]
 emb|CAA43016.1| H4 histone [Homo sapiens]
 emb|CAA43017.1| H4 histone [Homo sapiens]
 emb|CAA47464.1| histone [Homo sapiens]
 emb|CAA24130.1| unnamed protein product [Mus musculus]
 emb|CAA31621.1| unnamed protein product [Mus musculus]
 emb|CAA31906.1| unnamed protein product [Rattus norvegicus]
 emb|CAA32854.1| unnamed protein product [Cairina moschata]
 emb|CAA32857.1| unnamed protein product [Cairina moschata]
 emb|CAA26137.1| unnamed protein product [Gallus gallus]
 emb|CAA26140.1| unnamed protein product [Gallus gallus]
 emb|CAA26672.1| unnamed protein product [Oncorhynchus mykiss]
 emb|CAA38015.1| histone H4 [Oreochromis niloticus]
 emb|CAA25042.1| H4 histone [Xenopus laevis]
 emb|CAA26809.1| unnamed protein product [Xenopus laevis]
 emb|CAA26814.1| unnamed protein product [Xenopus laevis]
 emb|CAA26819.1| unnamed protein product [Xenopus laevis]
 gb|AAA63188.1| histone H4 [Homo sapiens]
 gb|AAA41306.1| histone H4 [Rattus norvegicus]
 gb|AAA60735.1| histone H4 [Rattus norvegicus]
 gb|AAA73091.1| unnamed protein product [Gallus gallus]
 gb|AAA73092.1| unnamed protein product [Gallus gallus]
 gb|AAA72138.1| unnamed protein product [Xenopus borealis]
 gb|AAA49761.1| histone H4 [Xenopus laevis]
 gb|AAA49766.1| histone H4 [Xenopus laevis]
 gb|AAA49771.1| histone H4 [Xenopus laevis]
 gb|AAA52652.1| histone H4 [Homo sapiens]
 emb|CAA58538.1| histone H4 [Homo sapiens]
 gb|AAB04766.1| histone H4-D [Mus musculus]
 gb|AAC59999.1| histone H4-VI [Gallus gallus]
 gb|AAC60001.1| histone H4-VII [Gallus gallus]
 emb|CAB02549.1| histone H4 [Homo sapiens]
 dbj|BAA19208.1| H4 histone [Homo sapiens]
 emb|CAA72967.1| Histone H4 [Mus musculus]
 gb|AAC15917.1| histone H4 [Chaetopterus variopedatus]
 gb|AAC39176.1| histone H4.1 [Bos taurus]
 dbj|BAB25157.1| unnamed protein product [Mus musculus]
 gb|AAH17361.1| HIST1H4J protein [Homo sapiens]
 gb|AAN01438.1| histone H4 [Homo sapiens]
 gb|AAN01439.1| histone H4 [Homo sapiens]
 gb|AAN01440.1| histone H4 [Homo sapiens]
 gb|AAN01441.1| histone H4 [Homo sapiens]
 gb|AAN01442.1| histone H4 [Homo sapiens]
 gb|AAN01443.1| histone H4 [Homo sapiens]
 gb|AAN01444.1| histone H4 [Homo sapiens]
 gb|AAN01446.1| histone H4 [Homo sapiens]
 gb|AAN01447.1| histone H4 [Homo sapiens]
 gb|AAN01448.1| histone H4 [Homo sapiens]
 gb|AAN01449.1| histone H4 [Homo sapiens]
 gb|AAN01450.1| histone H4 [Homo sapiens]
 emb|CAD37815.1| histone H4 [Mytilus edulis]
 emb|CAD37819.1| histone H4 [Mytilus edulis]
 emb|CAD37823.1| histone H4 [Mytilus edulis]
 gb|AAO06266.1| histone protein Hist1h4j [Mus musculus]
 gb|AAO06267.1| histone protein Hist1h4k [Mus musculus]
 gb|AAO06268.1| histone protein Hist1h4m [Mus musculus]
 gb|AAO06269.1| histone protein Hist1h4i [Mus musculus]
 gb|AAO06270.1| histone protein Hist1h4h [Mus musculus]
 gb|AAO06271.1| histone protein Hist1h4f [Mus musculus]
 gb|AAO06272.1| histone protein Hist1h4d [Mus musculus]
 gb|AAO06273.1| histone protein Hist1h4c [Mus musculus]
 gb|AAO06274.1| histone protein Hist1h4b [Mus musculus]
 gb|AAO06275.1| histone protein Hist1h4a [Mus musculus]
 gb|AAO06276.1| histone protein Hist2h4 [Mus musculus]
 gb|AAO06277.1| histone protein Hist4h4 [Mus musculus]
 emb|CAD89677.1| Xenopus laevis-like histone H4 [Expression vector pET3-H4]
 gb|AAH54014.1| Histone cluster 1, H4c [Homo sapiens]
 gb|AAP94643.1| histone H4 [Mytilus galloprovincialis]
 gb|AAP94669.1| histone H4 [Mytilus galloprovincialis]
 gb|AAP94671.1| histone H4 [Mytilus californianus]
 gb|AAP94672.1| histone H4 [Mytilus trossulus]
 gb|AAP94673.1| histone H4 [Mytilus edulis]
 gb|AAH66249.1| Histone cluster 1, H4a [Homo sapiens]
 gb|AAH66250.1| Histone cluster 1, H4i [Homo sapiens]
 gb|AAH66248.1| Histone cluster 1, H4a [Homo sapiens]
 gb|AAH67497.1| Histone cluster 1, H4i [Homo sapiens]
 gb|AAH67495.1| Histone cluster 1, H4a [Homo sapiens]
 emb|CAF98800.1| unnamed protein product [Tetraodon nigroviridis]
 emb|CAF98840.1| unnamed protein product [Tetraodon nigroviridis]
 gb|AAH69288.1| Histone cluster 1, H4f [Homo sapiens]
 gb|AAH69467.1| Histone cluster 1, H4b [Homo sapiens]
 gb|AAH69654.1| Histone cluster 1, H4a [Homo sapiens]
 gb|AAH69392.1| Histone cluster 1, H4l [Homo sapiens]
 emb|CAG46966.1| HIST1H4H [Homo sapiens]
 emb|CAG46969.1| HIST2H4 [Homo sapiens]
 emb|CAG46977.1| HIST1H4F [Homo sapiens]
 emb|CAG46984.1| HIST1H4H [Homo sapiens]
 gb|AAT68253.1| histone H4/o [Homo sapiens]
 gb|AAH78038.1| Hist1h4l-prov protein [Xenopus laevis]
 emb|CAH90430.1| hypothetical protein [Pongo abelii]
 emb|CAI12560.1| histone cluster 2, H4a [Homo sapiens]
 emb|CAI12567.1| histone cluster 2, H4b [Homo sapiens]
 emb|CAI24885.1| histone cluster 1, H4c [Mus musculus]
 emb|CAI25464.1| H4 histone family member [Mus musculus]
 emb|CAI25465.1| histone cluster 1, H4m [Mus musculus]
 gb|AAW25673.1| SJCHGC05715 protein [Schistosoma japonicum]
 gb|AAH87952.1| Histone cluster 1, H4h [Mus musculus]
 gb|AAX28930.1| histone H4 variant H4-v.1 [Rattus norvegicus]
 gb|AAX42563.1| histone 2 H4 [synthetic construct]
 gb|AAH92144.1| Histone cluster 1, H4i [Mus musculus]
 gb|AAH93763.1| Histone cluster 1, H4f [Homo sapiens]
 gb|AAH93765.1| Histone cluster 1, H4f [Homo sapiens]
 gb|AAH93969.1| Histone cluster 2, H4b [Homo sapiens]
 gb|AAY66895.1| hist1h4i protein [Ixodes scapularis]
 dbj|BAE02457.1| unnamed protein product [Macaca fascicularis]
 gb|AAZ39531.1| histone H4 [Biomphalaria glabrata]
 gb|AAI00620.1| Histone cluster 1, H4b [Rattus norvegicus]
 dbj|BAE24047.1| unnamed protein product [Mus musculus]
 gb|AAI12194.1| Histone cluster 2, H4b [Homo sapiens]
 emb|CAJ83618.1| similar to histone 1, H4h [Xenopus (Silurana) tropicalis]
 gb|ABD76390.1| histone H4 [Azumapecten farreri]
 gb|AAI11435.1| HIST4H4 protein [Homo sapiens]
 gb|AAI11094.1| HIST4H4 protein [Homo sapiens]
 gb|AAI15449.1| Histone cluster 1, H4m [Mus musculus]
 gb|AAI15451.1| Histone cluster 1, H4c [Mus musculus]
 gb|AAI17013.1| Histone cluster 1, H4k [Mus musculus]
 gb|AAI17011.1| Histone cluster 1, H4k [Mus musculus]
 gb|AAI20940.1| HIST1H4H protein [Homo sapiens]
 gb|AAI19244.1| Histone cluster 1, H4a [Mus musculus]
 gb|AAI19242.1| Histone cluster 1, H4a [Mus musculus]
 gb|AAI19613.1| Histone cluster 1, H4k [Mus musculus]
 gb|AAI25599.1| Hist1h4i protein [Mus musculus]
 gb|AAI25601.1| Histone cluster 1, H4i [Mus musculus]
 gb|AAI28105.1| HIST1H4D protein [Homo sapiens]
 gb|EAW55509.1| histone 1, H4a [Homo sapiens]
 gb|EAW55510.1| histone 1, H4b [Homo sapiens]
 gb|EAW55538.1| histone 1, H4d [Homo sapiens]
 gb|EAW55549.1| histone 1, H4f [Homo sapiens]
 gb|EAW55555.1| histone 1, H4h, isoform CRA_a [Homo sapiens]
 gb|EAW55556.1| histone 1, H4h, isoform CRA_a [Homo sapiens]
 gb|EAW96325.1| hCG1644670 [Homo sapiens]
 gb|EAX03086.1| histone 1, H4i [Homo sapiens]
 gb|EAX03111.1| histone 1, H4j [Homo sapiens]
 gb|EAX03112.1| histone 1, H4k [Homo sapiens]
 gb|EAX03121.1| histone 1, H4l [Homo sapiens]
 gb|AAI30559.1| HIST1H4C protein [Homo sapiens]
 gb|AAI30561.1| HIST1H4C protein [Homo sapiens]
 gb|ABM83531.1| histone 1, H4f [synthetic construct]
 gb|ABM83716.1| histone 1, H4h [synthetic construct]
 gb|ABM86771.1| histone 1, H4f [synthetic construct]
 gb|ABM87036.1| histone 1, H4h [synthetic construct]
 gb|AAI32187.1| Histone cluster 1, H4b [Mus musculus]
 gb|AAI32213.1| Histone cluster 1, H4b [Mus musculus]
 gb|AAI39810.1| Hist1h4c protein [Mus musculus]
 gb|AAH28550.3| Histone cluster 1, H4h [Mus musculus]
 gb|AAH57955.1| Histone cluster 2, H4 [Mus musculus]
 gb|AAH58529.2| Histone cluster 1, H4h [Mus musculus]
 gb|AAI40250.1| Histone cluster 1, H4j, partial [synthetic construct]
 gb|EDL10567.1| mCG49272 [Mus musculus]
 gb|EDL10574.1| mCG1027097 [Mus musculus]
 gb|EDL32537.1| mCG142242 [Mus musculus]
 gb|EDL32545.1| mCG7731 [Mus musculus]
 gb|EDL32551.1| mCG7729 [Mus musculus]
 gb|EDL32558.1| mCG7726 [Mus musculus]
 gb|EDL32563.1| mCG1044802 [Mus musculus]
 gb|EDL32608.1| mCG23039 [Mus musculus]
 gb|EDL32622.1| mCG121063 [Mus musculus]
 gb|EDL32632.1| mCG23033 [Mus musculus]
 gb|EDL38881.1| mCG49679 [Mus musculus]
 gb|AAI43046.1| HIST1H4D protein [Homo sapiens]
 gb|AAI42860.1| Zgc:165555 protein [Danio rerio]
 gb|AAI42360.1| LOC530773 protein [Bos taurus]
 gb|AAI46524.1| Histone cluster 1, H4j [synthetic construct]
 gb|AAI46449.1| Histone cluster 2, H4a, partial [synthetic construct]
 gb|AAI46440.1| Histone cluster 1, H4b, partial [synthetic construct]
 gb|EDL84561.1| rCG23088 [Rattus norvegicus]
 gb|EDL84562.1| rCG63094 [Rattus norvegicus]
 gb|EDL85638.1| histone 2, H4 (predicted) [Rattus norvegicus]
 gb|EDL86565.1| rCG45260 [Rattus norvegicus]
 gb|EDL86575.1| rCG45142 [Rattus norvegicus]
 gb|EDL86582.1| rCG45210 [Rattus norvegicus]
 gb|EDL86595.1| rCG45201 [Rattus norvegicus]
 gb|AAI48562.1| Histone cluster 1, H4f, partial [synthetic construct]
 gb|AAI48486.1| Histone cluster 1, H4k, partial [synthetic construct]
 gb|AAI52398.1| Hist1h4m protein [Mus musculus]
 dbj|BAF79670.1| histone H4 [Hyla japonica]
 gb|ABV25914.1| histone H4 [Ruditapes decussatus]
 gb|ABV25919.1| histone H4 [Venerupis corrugata]
 gb|AAI53082.1| Histone cluster 1, H4k [synthetic construct]
 gb|AAI52886.1| Histone cluster 4, H4, partial [synthetic construct]
 gb|AAI52967.1| Histone cluster 1, H4d, partial [synthetic construct]
 gb|AAI53050.1| Histone cluster 1, H4b [synthetic construct]
 gb|AAI52885.1| Histone cluster 1, H4j, partial [synthetic construct]
 gb|AAI53064.1| Histone cluster 2, H4a [synthetic construct]
 gb|AAI14197.1| H4 protein [Bos taurus]
 gb|AAI56619.1| Histone cluster 1, H4j [synthetic construct]
 gb|AAI56843.1| Histone cluster 1, H4d [synthetic construct]
 gb|AAI56621.1| Histone cluster 1, H4d [synthetic construct]
 gb|AAI56749.1| Histone cluster 1, H4f [synthetic construct]
 gb|ABZ92505.1| histone cluster 1, H4a, partial [synthetic construct]
 gb|ABZ92506.1| histone cluster 1, H4c [synthetic construct]
 gb|ABZ92507.1| histone cluster 1, H4e [synthetic construct]
 gb|AAI48272.1| HIST1H4J protein [Homo sapiens]
 gb|AAI39426.1| Hist2h4 protein [Mus musculus]
 gb|AAI39438.1| Hist2h4 protein [Mus musculus]
 dbj|BAG35087.1| unnamed protein product [Homo sapiens]
 dbj|BAG38150.1| unnamed protein product [Homo sapiens]
 dbj|BAG34857.1| unnamed protein product [Homo sapiens]
 dbj|BAG34965.1| unnamed protein product [Homo sapiens]
 gb|ACH43689.1| putative histone 1 H4h variant 1 [Taeniopygia guttata]
 gb|ACH46381.1| putative histone 1 H4h variant 2 [Taeniopygia guttata]
 gb|AAI68455.1| LOC549623 protein [Xenopus (Silurana) tropicalis]
 dbj|BAG70273.1| histone H4 [Homo sapiens]
 dbj|BAG73254.1| Histone H4 [synthetic construct]
 dbj|BAG73255.1| Histone H4 [synthetic construct]
 gb|EEC09558.1| histone H4, putative [Ixodes scapularis]
 gb|ACO52060.1| Histone H4 [Rana catesbeiana]
 gb|EEN51206.1| hypothetical protein BRAFLDRAFT_129780 [Branchiostoma floridae]
 gb|EEN51659.1| hypothetical protein BRAFLDRAFT_56954 [Branchiostoma floridae]
 gb|EEN51676.1| hypothetical protein BRAFLDRAFT_200764 [Branchiostoma floridae]
 gb|EEN51692.1| hypothetical protein BRAFLDRAFT_200752 [Branchiostoma floridae]
 gb|EEN51704.1| hypothetical protein BRAFLDRAFT_200683 [Branchiostoma floridae]
 gb|EEN51724.1| hypothetical protein BRAFLDRAFT_64838 [Branchiostoma floridae]
 gb|EEN51732.1| hypothetical protein BRAFLDRAFT_64845 [Branchiostoma floridae]
 gb|EEN69654.1| hypothetical protein BRAFLDRAFT_127106 [Branchiostoma floridae]
 dbj|BAI46127.1| Histone H4 [synthetic construct]
 dbj|BAI46824.1| histone cluster 1, H4b [synthetic construct]
 dbj|BAI46969.1| histone cluster 1, H4d [synthetic construct]
 gb|EFB20358.1| hypothetical protein PANDA_018356 [Ailuropoda melanoleuca]
 gb|EFB20872.1| hypothetical protein PANDA_018569 [Ailuropoda melanoleuca]
 emb|CAP53843.1| histone H4 [Xenoturbella bocki]
 emb|CAP53862.1| histone H4 [Xenoturbella bocki]
 emb|CAP53865.1| histone H4 [Xenoturbella bocki]
 emb|CAP53868.1| histone H4 [Xenoturbella bocki]
 emb|CAP53878.1| histone H4 [Xenoturbella bocki]
 gb|ADF28514.1| histone H4 [Pelinobius muticus]
 tpg|DAA16108.1| TPA: histone H4 [Bos taurus]
 tpg|DAA16158.1| TPA: histone H4-like [Bos taurus]
 tpg|DAA16170.1| TPA: histone H4 replacement-like [Bos taurus]
 tpg|DAA16176.1| TPA: histone H4 replacement-like [Bos taurus]
 tpg|DAA16177.1| TPA: histone H4 replacement-like [Bos taurus]
 tpg|DAA16186.1| TPA: histone H4 replacement-like [Bos taurus]
 tpg|DAA16191.1| TPA: histone H4 replacement-like [Bos taurus]
 tpg|DAA16254.1| TPA: histone H4 replacement-like [Bos taurus]
 tpg|DAA16260.1| TPA: histone H4 replacement-like [Bos taurus]
 tpg|DAA16261.1| TPA: histone H4 replacement-like [Bos taurus]
 tpg|DAA29383.1| TPA: germinal histone H4-like [Bos taurus]
 tpg|DAA31731.1| TPA: histone H4 replacement-like [Bos taurus]
 tpg|DAA33663.1| TPA: histone H4 replacement-like [Bos taurus]
 gb|ADI87053.1| histone H4 [Crassostrea virginica]
 dbj|BAJ20862.1| histone cluster 1, H4c [synthetic construct]
 dbj|BAJ20864.1| histone cluster 1, H4i [synthetic construct]
 dbj|BAJ21069.1| histone cluster 2, H4a [synthetic construct]
 gb|ADQ32864.1| histone cluster 1, H4b [synthetic construct]
 gb|ADQ32876.1| histone cluster 1, H4l [synthetic construct]
 gb|ADQ33135.1| histone cluster 1, H4i [synthetic construct]
 gb|ADR82736.1| histone cluster 2, H4b (HIST2H4B) [synthetic construct]
 gb|ADR83444.1| histone cluster 2, H4b (HIST2H4B) [synthetic construct]
 gb|ADV40105.1| putative germinal histone H4 [Latrodectus hesperus]
 emb|CBM82503.1| histone H4 replacement protein [Balanoglossus clavigerus]
 emb|CBM82504.1| histone H4 protein [Balanoglossus clavigerus]
 dbj|BAK64165.1| histone H4 [Ambigolimax valentianus]
 gb|EGV94273.1| Histone H4 [Cricetulus griseus]
 gb|EGV94278.1| Histone H4 [Cricetulus griseus]
 gb|EGV94293.1| Histone H4 [Cricetulus griseus]
 gb|EGV94773.1| Histone H4 [Cricetulus griseus]
 gb|EGV96114.1| Histone H4 [Cricetulus griseus]
 gb|EGV96661.1| Histone H4 [Cricetulus griseus]
 gb|EGW03466.1| Histone H4 [Cricetulus griseus]
 gb|EGW03472.1| Histone H4 [Cricetulus griseus]
 dbj|GAA32643.1| histone H4 [Clonorchis sinensis]
 gb|EHB09824.1| Histone H4 [Heterocephalus glaber]
 gb|EHB11498.1| Histone H4 [Heterocephalus glaber]
 gb|EHB11499.1| Histone H4 [Heterocephalus glaber]
 gb|EHB11507.1| Histone H4 [Heterocephalus glaber]
 gb|EHB13134.1| Histone H4 [Heterocephalus glaber]
 gb|EHB13140.1| Histone H4 [Heterocephalus glaber]
 gb|EHB13145.1| Histone H4 [Heterocephalus glaber]
 gb|EHB13168.1| Histone H4 [Heterocephalus glaber]
 emb|CCD74906.1| putative histone H4 [Schistosoma mansoni]
 emb|CCD74913.1| putative histone H4 [Schistosoma mansoni]
 emb|CCD74915.1| putative histone H4 [Schistosoma mansoni]
 gb|EHH18009.1| Histone H4 [Macaca mulatta]
 gb|EHH18010.1| Histone H4 [Macaca mulatta]
 gb|EHH18024.1| hypothetical protein EGK_14553 [Macaca mulatta]
 gb|EHH18028.1| Histone H4 [Macaca mulatta]
 gb|EHH18033.1| Histone H4 [Macaca mulatta]
 gb|EHH18040.1| Histone H4 [Macaca mulatta]
 gb|EHH18063.1| Histone H4 [Macaca mulatta]
 gb|EHH18064.1| Histone H4 [Macaca mulatta]
 gb|EHH18069.1| Histone H4 [Macaca mulatta]
 gb|EHH20540.1| Histone H4 [Macaca mulatta]
 gb|EHH25684.1| hypothetical protein EGK_21175 [Macaca mulatta]
 gb|EHH50939.1| Histone H4 [Macaca fascicularis]
 gb|EHH52781.1| Histone H4 [Macaca fascicularis]
 gb|EHH52788.1| Histone H4 [Macaca fascicularis]
 gb|EHH52795.1| Histone H4 [Macaca fascicularis]
 gb|EHH52799.1| hypothetical protein EGM_13314 [Macaca fascicularis]
 gb|EHH52804.1| Histone H4 [Macaca fascicularis]
 gb|EHH52811.1| Histone H4 [Macaca fascicularis]
 gb|EHH52830.1| Histone H4 [Macaca fascicularis]
 gb|EHH61965.1| Histone H4 [Macaca fascicularis]
 gb|EHH62658.1| hypothetical protein EGM_21077 [Macaca fascicularis]
 gb|EHH66111.1| Histone H4 [Macaca fascicularis]
 dbj|GAA57011.1| histone H4 [Clonorchis sinensis]
 gb|EKC28010.1| Histone H4 [Crassostrea gigas]
 gb|EKC28015.1| Histone H4 [Crassostrea gigas]
 gb|EKC28021.1| Histone H4 [Crassostrea gigas]
 gb|EKC28026.1| Histone H4 [Crassostrea gigas]
 gb|EKC28031.1| Histone H4 [Crassostrea gigas]
 gb|EKC28036.1| Histone H4 [Crassostrea gigas]
 gb|EKC28041.1| Histone H4 [Crassostrea gigas]
 gb|ELK02660.1| Histone H4 [Pteropus alecto]
 gb|ELK02668.1| Histone H4 [Pteropus alecto]
 gb|ELK02677.1| Histone H4 [Pteropus alecto]
 gb|ELK02680.1| Histone H4 [Pteropus alecto]
 gb|ELK02682.1| Histone H4 [Pteropus alecto]
 gb|ELK02688.1| Histone H4 [Pteropus alecto]
 gb|ELK02693.1| Histone H4 [Pteropus alecto]
 gb|ELK02698.1| Histone H4 [Pteropus alecto]
 gb|ELK06005.1| Histone H4 [Pteropus alecto]
 gb|ELK33065.1| Histone H4 [Myotis davidii]
 gb|ELK33075.1| Histone H4 [Myotis davidii]
 gb|ELK36216.1| Histone H4 [Myotis davidii]
 gb|ELR48783.1| hypothetical protein M91_12995 [Bos mutus]
 gb|ELR48784.1| hypothetical protein M91_12996 [Bos mutus]
 gb|ELR50642.1| hypothetical protein M91_04345 [Bos mutus]
 gb|ELR55600.1| hypothetical protein M91_11391 [Bos mutus]
 gb|ELR58893.1| hypothetical protein M91_11344 [Bos mutus]
 gb|ELR58894.1| hypothetical protein M91_11345 [Bos mutus]
 gb|ELR58901.1| hypothetical protein M91_11353 [Bos mutus]
 gb|ELR58912.1| hypothetical protein M91_11366 [Bos mutus]
 gb|ELR59626.1| hypothetical protein M91_09490 [Bos mutus]
 gb|ELT87493.1| hypothetical protein CAPTEDRAFT_113150 [Capitella teleta]
 gb|ELT87527.1| hypothetical protein CAPTEDRAFT_96390 [Capitella teleta]
 gb|ELT91189.1| hypothetical protein CAPTEDRAFT_178734 [Capitella teleta]
 gb|ELT91937.1| hypothetical protein CAPTEDRAFT_143645 [Capitella teleta]
 gb|ELT95146.1| hypothetical protein CAPTEDRAFT_157638 [Capitella teleta]
 gb|ELT97810.1| hypothetical protein CAPTEDRAFT_184022 [Capitella teleta]
 gb|ELT99662.1| hypothetical protein CAPTEDRAFT_97484 [Capitella teleta]
 gb|ELU02043.1| hypothetical protein CAPTEDRAFT_128650 [Capitella teleta]
 gb|ELU02625.1| hypothetical protein CAPTEDRAFT_146051 [Capitella teleta]
 gb|ELU04479.1| hypothetical protein CAPTEDRAFT_103539 [Capitella teleta]
 gb|ELU04789.1| hypothetical protein CAPTEDRAFT_97619 [Capitella teleta]
 gb|ELU08392.1| hypothetical protein CAPTEDRAFT_213300 [Capitella teleta]
 gb|ELU09857.1| hypothetical protein CAPTEDRAFT_90469 [Capitella teleta]
 gb|ELU11087.1| hypothetical protein CAPTEDRAFT_104225 [Capitella teleta]
 gb|ELU12647.1| hypothetical protein CAPTEDRAFT_90262 [Capitella teleta]
 gb|ELU15445.1| hypothetical protein CAPTEDRAFT_203393 [Capitella teleta]
 gb|ELU17535.1| hypothetical protein CAPTEDRAFT_213178 [Capitella teleta]
 gb|ELU17957.1| hypothetical protein CAPTEDRAFT_137816 [Capitella teleta]
 gb|ELV10128.1| Histone H4 [Tupaia chinensis]
 gb|ELV10779.1| Histone H4 [Tupaia chinensis]
 gb|ELV13478.1| Histone H4 [Tupaia chinensis]
 gb|ELV13483.1| Histone H4 [Tupaia chinensis]
 gb|ELV13489.1| Histone H4 [Tupaia chinensis]
 gb|ELV13496.1| Histone H4 [Tupaia chinensis]
 gb|EMC86817.1| Histone H4 [Columba livia]
 gb|EMC89181.1| Histone H4 [Columba livia]
 gb|EMP26028.1| Histone H4 [Chelonia mydas]
 gb|EMP31823.1| Histone H4 [Chelonia mydas]
 gb|EMP31826.1| Histone H4 [Chelonia mydas]
 gb|EMP31831.1| Histone H4 [Chelonia mydas]
 gb|EMP31832.1| Histone H4 [Chelonia mydas]
 gb|EMP31842.1| Histone H4 [Chelonia mydas]
 gb|EMP31845.1| Histone H4 [Chelonia mydas]
 gb|EMP42707.1| Histone H4 [Chelonia mydas]
 gb|EMS60936.1| Histone H4 [Triticum urartu]
 gb|EOB06722.1| Histone H4, partial [Anas platyrhynchos]
 gb|EOB06729.1| Histone H4, partial [Anas platyrhynchos]
 gb|EPQ05779.1| Histone H4 [Myotis brandtii]
 gb|EPQ05780.1| Histone H4 [Myotis brandtii]
 gb|EPQ05785.1| Histone H4 [Myotis brandtii]
 gb|EPQ05791.1| Histone H4 [Myotis brandtii]
 gb|EPQ05796.1| Histone H4 [Myotis brandtii]
 gb|EPQ05799.1| Histone H4 [Myotis brandtii]
 gb|EPQ05803.1| Histone H4 [Myotis brandtii]
 gb|EPQ08519.1| Histone H4 [Myotis brandtii]
 gb|EPQ08522.1| Histone H4 [Myotis brandtii]
 gb|EPQ09444.1| Histone H4 [Myotis brandtii]
 gb|EPY72319.1| histone cluster 1, H4j-like protein [Camelus ferus]
 gb|EPY72767.1| histone cluster 1, H4j-like protein [Camelus ferus]
 gb|EPY73671.1| histone cluster 1, H4j-like protein [Camelus ferus]
 gb|EPY73680.1| histone cluster 1, H4j-like protein [Camelus ferus]
 gb|EPY83082.1| histone cluster 1, H4j-like protein [Camelus ferus]
 gb|EPY83088.1| histone cluster 1, H4j-like protein [Camelus ferus]
 gb|EPY83099.1| histone cluster 1, H4j-like protein [Camelus ferus]
 gb|EPY83109.1| histone cluster 1, H4j-like protein [Camelus ferus]
 gb|EPY83117.1| histone cluster 1, H4j-like protein [Camelus ferus]
 gb|ERE66418.1| histone H4-like protein [Cricetulus griseus]
 gb|ERE77554.1| histone H4-like protein [Cricetulus griseus]
 gb|ERE77557.1| histone H4-like protein [Cricetulus griseus]
 gb|ERE77560.1| histone H4-like protein [Cricetulus griseus]
 gb|ERE78117.1| histone H4-like protein [Cricetulus griseus]
 gb|ERE88446.1| histone H4-like protein [Cricetulus griseus]
 gb|ESN99668.1| hypothetical protein HELRODRAFT_92695 [Helobdella robusta]
 gb|ESO02961.1| hypothetical protein HELRODRAFT_92568 [Helobdella robusta]
 gb|ESO09643.1| hypothetical protein HELRODRAFT_187742 [Helobdella robusta]
 gb|ESO83579.1| hypothetical protein LOTGIDRAFT_176226 [Lottia gigantea]
 gb|ESO86728.1| hypothetical protein LOTGIDRAFT_146028 [Lottia gigantea]
 gb|ESO86730.1| hypothetical protein LOTGIDRAFT_146029 [Lottia gigantea]
 gb|ESO87941.1| hypothetical protein LOTGIDRAFT_148042 [Lottia gigantea]
 gb|ESO90412.1| hypothetical protein LOTGIDRAFT_147781 [Lottia gigantea]
 gb|ESO92936.1| hypothetical protein LOTGIDRAFT_145439 [Lottia gigantea]
 gb|ESO94669.1| hypothetical protein LOTGIDRAFT_147488 [Lottia gigantea]
 gb|ESO96240.1| hypothetical protein LOTGIDRAFT_147329 [Lottia gigantea]
 gb|ESO96573.1| hypothetical protein LOTGIDRAFT_147261 [Lottia gigantea]
 gb|ESO96763.1| hypothetical protein LOTGIDRAFT_202861 [Lottia gigantea]
 gb|ESO97187.1| hypothetical protein LOTGIDRAFT_176527 [Lottia gigantea]
 gb|ESP01102.1| hypothetical protein LOTGIDRAFT_146923 [Lottia gigantea]
 gb|ESP01747.1| hypothetical protein LOTGIDRAFT_148840 [Lottia gigantea]
 gb|ESP01886.1| hypothetical protein LOTGIDRAFT_148824 [Lottia gigantea]
 gb|ESP03157.1| hypothetical protein LOTGIDRAFT_148724 [Lottia gigantea]
 gb|ETE58669.1| hypothetical protein L345_15610, partial [Ophiophagus hannah]
 gb|ETE65547.1| hypothetical protein L345_08666, partial [Ophiophagus hannah]
 gb|ETE70783.1| hypothetical protein L345_03402, partial [Ophiophagus hannah]
 gb|ETE73078.1| hypothetical protein L345_01083, partial [Ophiophagus hannah]
 gb|ETE73079.1| hypothetical protein L345_01084, partial [Ophiophagus hannah]
 gb|EUB54192.1| Histone H4 [Echinococcus granulosus]
 gb|EUB54193.1| Histone H4 [Echinococcus granulosus]
 gb|AIC50074.1| HIST1H4I, partial [synthetic construct]
 gb|AIC50101.1| HIST1H4A, partial [synthetic construct]
 gb|AIC50102.1| HIST1H4F, partial [synthetic construct]
 gb|AIC50103.1| HIST1H4J, partial [synthetic construct]
 gb|AIC50104.1| HIST1H4C, partial [synthetic construct]
 gb|AIC50105.1| HIST1H4B, partial [synthetic construct]
 gb|AIC50106.1| HIST1H4E, partial [synthetic construct]
 gb|AIC50107.1| HIST1H4L, partial [synthetic construct]
 gb|AIC53887.1| HIST2H4B, partial [synthetic construct]
 gb|AIC55386.1| HIST1H4I, partial [synthetic construct]
 gb|AIC59398.1| HIST1H4H, partial [synthetic construct]
 gb|KER27007.1| hypothetical protein T265_05840 [Opisthorchis viverrini]
 emb|CDI99418.1| histone H4 [Echinococcus multilocularis]
 emb|CDI99421.1| histone H4 [Echinococcus multilocularis]
 emb|CDI99424.1| histone H4 [Echinococcus multilocularis]
 emb|CDI99432.1| histone H4 [Echinococcus multilocularis]
 emb|CDI99435.1| histone H4 [Echinococcus multilocularis]
 emb|CDI99437.1| histone H4 [Echinococcus multilocularis]
 emb|CDI99439.1| histone H4 [Echinococcus multilocularis]
 emb|CDI99283.1| histone H4 [Echinococcus multilocularis]
 emb|CDI98941.1| histone H4 [Echinococcus multilocularis]
 emb|CDI98942.1| histone H4 [Echinococcus multilocularis]
 emb|CDI96645.1| histone H4 [Echinococcus multilocularis]
 emb|CDI96644.1| histone H4 [Echinococcus multilocularis]
 emb|CDS24810.1| histone H4 [Echinococcus granulosus]
 emb|CDS36700.1| histone H4 [Echinococcus multilocularis]
 emb|CDS36703.1| histone H4 [Echinococcus multilocularis]
 emb|CDS36706.1| histone H4 [Echinococcus multilocularis]
 emb|CDS36714.1| histone H4 [Echinococcus multilocularis]
 emb|CDS36717.1| histone H4 [Echinococcus multilocularis]
 emb|CDS36719.1| histone H4 [Echinococcus multilocularis]
 emb|CDS36721.1| histone H4 [Echinococcus multilocularis]
 emb|CDS36565.1| histone H4 [Echinococcus multilocularis]
 emb|CDS36223.1| histone H4 [Echinococcus multilocularis]
 emb|CDS36224.1| histone H4 [Echinococcus multilocularis]
 emb|CDS33855.1| histone H4 [Hymenolepis microstoma]
 emb|CDS33863.1| histone H4 [Hymenolepis microstoma]
 gb|KFM02250.1| Histone H4 [Aptenodytes forsteri]
 gb|KFM02252.1| Histone H4 [Aptenodytes forsteri]
 gb|KFM02267.1| Histone H4 [Aptenodytes forsteri]
 gb|KFM76981.1| Histone H4, partial [Stegodyphus mimosarum]
 gb|KFO06577.1| Histone H4 [Balearica regulorum gibbericeps]
 gb|KFO18182.1| Histone H4 [Fukomys damarensis]
 gb|KFO27224.1| Histone H4 [Fukomys damarensis]
 gb|KFO28173.1| Histone H4 [Fukomys damarensis]
 gb|KFO33866.1| Histone H4 [Fukomys damarensis]
 gb|KFO33871.1| Histone H4 [Fukomys damarensis]
 gb|KFO33879.1| Histone H4 [Fukomys damarensis]
 gb|KFO33885.1| Histone H4 [Fukomys damarensis]
 gb|KFO33891.1| Histone H4 [Fukomys damarensis]
 gb|KFO61369.1| Histone H4 [Corvus brachyrhynchos]
 gb|KFO61375.1| Histone H4 [Corvus brachyrhynchos]
 gb|KFO61380.1| Histone H4 [Corvus brachyrhynchos]
 gb|KFO61384.1| Histone H4 [Corvus brachyrhynchos]
 gb|KFO74455.1| Histone H4 [Cuculus canorus]
 gb|KFO74459.1| Histone H4 [Cuculus canorus]
 gb|KFO74460.1| Histone H4 [Cuculus canorus]
 gb|KFO74462.1| Histone H4 [Cuculus canorus]
 gb|KFO83421.1| Histone H4 [Buceros rhinoceros silvestris]
 gb|KFO96011.1| Histone H4 [Calypte anna]
 gb|KFO96023.1| Histone H4 [Calypte anna]
 gb|KFP03104.1| Histone H4 [Calypte anna]
 gb|KFP27382.1| Histone H4 [Colius striatus]
 gb|KFP35235.1| Histone H4 [Chlamydotis macqueenii]
 gb|KFP87231.1| Histone H4 [Apaloderma vittatum]
 gb|KFQ03638.1| Histone H4 [Leptosomus discolor]
 gb|KFQ21091.1| Histone H4 [Mesitornis unicolor]
 gb|KFQ38519.1| Histone H4 [Mesitornis unicolor]
 gb|KFQ68059.1| Histone H4 [Phaethon lepturus]
 gb|KFQ78026.1| Histone H4 [Phoenicopterus ruber ruber]
 gb|KFQ80706.1| Histone H4 [Phoenicopterus ruber ruber]
 gb|KFQ90530.1| Histone H4 [Nipponia nippon]
 gb|KFQ96132.1| Histone H4 [Nipponia nippon]
 gb|KFQ96136.1| Histone H4 [Nipponia nippon]
 gb|KFR08211.1| Histone H4 [Nipponia nippon]
 gb|KFU93222.1| Histone H4 [Chaetura pelagica]
 gb|KFU93225.1| Histone H4 [Chaetura pelagica]
 gb|KFU93229.1| Histone H4 [Chaetura pelagica]
 gb|KFV08677.1| Histone H4 [Tauraco erythrolophus]
 gb|KFV20104.1| Histone H4 [Tauraco erythrolophus]
 gb|KFV65810.1| Histone H4 [Picoides pubescens]
 gb|KFV65815.1| Histone H4 [Picoides pubescens]
 gb|KFV65819.1| Histone H4 [Picoides pubescens]
 gb|KFV82681.1| Histone H4 [Struthio camelus australis]
 gb|KFW60664.1| Histone H4 [Pygoscelis adeliae]
 gb|KFW61152.1| Histone H4 [Pygoscelis adeliae]
 gb|KFW97471.1| Histone H4 [Phalacrocorax carbo]
 gb|KFZ63113.1| Histone H4 [Podiceps cristatus]
 gb|KGB39270.1| Histone H4 [Schistosoma haematobium]
 gb|KGL84316.1| Histone H4 [Tinamus guttatus]
 gb|KGL87469.1| Histone H4 [Charadrius vociferus]
 gb|KGL87472.1| Histone H4, partial [Charadrius vociferus]
 gb|KGL87476.1| Histone H4 [Charadrius vociferus]
Length=103

 Score =   155 bits (392),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>ref|XP_007509432.1| histone H4 [Bathycoccus prasinos]
 ref|XP_007509434.1| histone H4 [Bathycoccus prasinos]
 ref|XP_007514140.1| histone H4 [Bathycoccus prasinos]
 emb|CCO19235.1| histone H4 [Bathycoccus prasinos]
 emb|CCO19237.1| histone H4 [Bathycoccus prasinos]
 emb|CCO15577.1| histone H4 [Bathycoccus prasinos]
Length=103

 Score =   155 bits (392),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHARRKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHARRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQG+TLY
Sbjct  82   VTAMDVVYALKRQGKTLY  99



>ref|XP_003972557.1| PREDICTED: histone H4-like [Takifugu rubripes]
Length=141

 Score =   157 bits (396),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  60   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  119

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  120  VTAMDVVYALKRQGRTLY  137



>gb|EMS63411.1| Histone H4 [Triticum urartu]
Length=126

 Score =   156 bits (394),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 101/107 (94%), Positives = 103/107 (96%), Gaps = 0/107 (0%)
 Frame = +1

Query  61   DFFFLSAKMSgrgkggkglgkggakrhrkVLRDNIQGITKPAIRRLARRGGVKRISGLIY  240
            D   +S+KMSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIY
Sbjct  16   DDDGVSSKMSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIY  75

Query  241  EETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLY  381
            EETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVY LKRQGRTLY
Sbjct  76   EETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYGLKRQGRTLY  122



>ref|XP_002965743.1| hypothetical protein SELMODRAFT_167497 [Selaginella moellendorffii]
 ref|XP_002975853.1| hypothetical protein SELMODRAFT_150847 [Selaginella moellendorffii]
 ref|XP_002977016.1| hypothetical protein SELMODRAFT_105910 [Selaginella moellendorffii]
 ref|XP_002980754.1| hypothetical protein SELMODRAFT_233579 [Selaginella moellendorffii]
 gb|EFJ18405.1| hypothetical protein SELMODRAFT_233579 [Selaginella moellendorffii]
 gb|EFJ22126.1| hypothetical protein SELMODRAFT_105910 [Selaginella moellendorffii]
 gb|EFJ22758.1| hypothetical protein SELMODRAFT_150847 [Selaginella moellendorffii]
 gb|EFJ33163.1| hypothetical protein SELMODRAFT_167497 [Selaginella moellendorffii]
Length=103

 Score =   155 bits (392),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 77/77 (100%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +1

Query  151  LRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTV  330
            LRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTV
Sbjct  23   LRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTV  82

Query  331  TAMDVVYALKRQGRTLY  381
            TAMDVVYALKRQGRTLY
Sbjct  83   TAMDVVYALKRQGRTLY  99



>ref|XP_003768761.1| PREDICTED: histone H4-like [Sarcophilus harrisii]
Length=129

 Score =   156 bits (395),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  48   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  107

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  108  VTAMDVVYALKRQGRTLY  125



>gb|AAG25601.1|AF297469_1 histone H4 [Schistosoma mansoni]
Length=98

 Score =   155 bits (392),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  20   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  79

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  80   VTAMDVVYALKRQGRTLY  97



>gb|KJB61885.1| hypothetical protein B456_009G393400 [Gossypium raimondii]
Length=147

 Score =   157 bits (396),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 78/78 (100%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT
Sbjct  66   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  125

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  126  VTAMDVVYALKRQGRTLY  143



>gb|EHJ66726.1| putative germinal histone H4 protein [Danaus plexippus]
Length=143

 Score =   157 bits (396),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 77/78 (99%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHA+RKT
Sbjct  62   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHAKRKT  121

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  122  VTAMDVVYALKRQGRTLY  139



>ref|XP_001865168.1| histone 1 [Culex quinquefasciatus]
 gb|EDS41246.1| histone 1 [Culex quinquefasciatus]
Length=117

 Score =   156 bits (394),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  36   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  95

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  96   VTAMDVVYALKRQGRTLY  113



>ref|XP_009929443.1| PREDICTED: LOW QUALITY PROTEIN: histone H4-like [Opisthocomus 
hoazin]
Length=131

 Score =   156 bits (395),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  50   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  109

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  110  VTAMDVVYALKRQGRTLY  127



>ref|XP_004599995.1| PREDICTED: histone H4-like, partial [Ochotona princeps]
Length=98

 Score =   155 bits (392),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  17   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  76

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  77   VTAMDVVYALKRQGRTLY  94



>gb|KFZ49305.1| Histone H4, partial [Caprimulgus carolinensis]
Length=88

 Score =   155 bits (391),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  10   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  69

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  70   VTAMDVVYALKRQGRTLY  87



>ref|XP_004778831.1| PREDICTED: histone H4-like [Mustela putorius furo]
 ref|XP_004787973.1| PREDICTED: histone H4-like [Mustela putorius furo]
Length=120

 Score =   156 bits (394),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  39   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  98

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  99   VTAMDVVYALKRQGRTLY  116



>pdb|2HUE|C Chain C, Structure Of The H3-h4 Chaperone Asf1 Bound To Histones 
H3 And H4
 pdb|3NQJ|B Chain B, Crystal Structure Of (Cenp-AH4)2 HETEROTETRAMER
Length=84

 Score =   155 bits (391),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  3    VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  62

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  63   VTAMDVVYALKRQGRTLY  80



>ref|XP_005447443.1| PREDICTED: histone H4-like, partial [Falco cherrug]
 emb|CDI99286.1| histone H4, partial [Echinococcus multilocularis]
 emb|CDS36568.1| histone H4, partial [Echinococcus multilocularis]
 gb|KFZ56429.1| Histone H4, partial [Podiceps cristatus]
Length=101

 Score =   155 bits (392),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>ref|XP_010174840.1| PREDICTED: histone H4-like, partial [Caprimulgus carolinensis]
Length=86

 Score =   155 bits (391),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  9    VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  68

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  69   VTAMDVVYALKRQGRTLY  86



>ref|XP_002045951.1| GM19606 [Drosophila sechellia]
 gb|EDW44573.1| GM19606 [Drosophila sechellia]
Length=97

 Score =   155 bits (392),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  16   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  75

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  76   VTAMDVVYALKRQGRTLY  93



>tpg|DAA23827.1| TPA: histone cluster 1, H4j-like [Bos taurus]
Length=157

 Score =   157 bits (397),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  76   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  135

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  136  VTAMDVVYALKRQGRTLY  153



>dbj|BAE97420.1| histone H4 [Cucumis sativus]
Length=103

 Score =   155 bits (392),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 77/78 (99%), Positives = 77/78 (99%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHA RKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHAXRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>ref|XP_009638184.1| PREDICTED: histone H4-like [Egretta garzetta]
Length=111

 Score =   155 bits (393),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  30   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  89

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  90   VTAMDVVYALKRQGRTLY  107



>gb|EFB20879.1| hypothetical protein PANDA_018576 [Ailuropoda melanoleuca]
Length=111

 Score =   155 bits (393),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  30   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  89

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  90   VTAMDVVYALKRQGRTLY  107



>ref|NP_524352.1| histone H4 replacement, isoform C [Drosophila melanogaster]
 ref|NP_724344.1| histone H4 [Drosophila melanogaster]
 ref|NP_731927.1| histone H4 replacement, isoform A [Drosophila melanogaster]
 ref|NP_731928.1| histone H4 replacement, isoform B [Drosophila melanogaster]
 ref|NP_001027284.1| histone H4 [Drosophila melanogaster]
 ref|NP_001027288.1| histone H4 [Drosophila melanogaster]
 ref|NP_001027293.1| histone H4 [Drosophila melanogaster]
 ref|NP_001027297.1| histone H4 [Drosophila melanogaster]
 ref|NP_001027302.1| histone H4 [Drosophila melanogaster]
 ref|NP_001027307.1| histone H4 [Drosophila melanogaster]
 ref|NP_001027312.1| histone H4 [Drosophila melanogaster]
 ref|NP_001027317.1| histone H4 [Drosophila melanogaster]
 ref|NP_001027322.1| histone H4 [Drosophila melanogaster]
 ref|NP_001027327.1| histone H4 [Drosophila melanogaster]
 ref|NP_001027332.1| histone H4 [Drosophila melanogaster]
 ref|NP_001027337.1| histone H4 [Drosophila melanogaster]
 ref|NP_001027342.1| histone H4 [Drosophila melanogaster]
 ref|NP_001027347.1| histone H4 [Drosophila melanogaster]
 ref|NP_001027367.1| histone H4 [Drosophila melanogaster]
 ref|NP_001027372.1| histone H4 [Drosophila melanogaster]
 ref|NP_001027377.1| histone H4 [Drosophila melanogaster]
 ref|NP_001153669.1| histone H4-like protein [Bombyx mori]
 ref|NP_001156692.1| histone H4 replacement-like [Acyrthosiphon pisum]
 ref|NP_001262576.1| histone H4 replacement, isoform D [Drosophila melanogaster]
 ref|XP_001358473.1| GA17414 [Drosophila pseudoobscura pseudoobscura]
 ref|XP_001608282.1| PREDICTED: histone H4 [Nasonia vitripennis]
 ref|XP_001599832.1| PREDICTED: histone H4 [Nasonia vitripennis]
 ref|XP_001599860.1| PREDICTED: histone H4 [Nasonia vitripennis]
 ref|XP_001599220.1| PREDICTED: histone H4 [Nasonia vitripennis]
 ref|XP_001599230.1| PREDICTED: histone H4 [Nasonia vitripennis]
 ref|XP_001603581.1| PREDICTED: histone H4 [Nasonia vitripennis]
 ref|XP_001607557.1| PREDICTED: histone H4 [Nasonia vitripennis]
 ref|XP_001607554.1| PREDICTED: histone H4 [Nasonia vitripennis]
 ref|XP_001607894.1| PREDICTED: histone H4 [Nasonia vitripennis]
 ref|XP_001607925.1| PREDICTED: histone H4 [Nasonia vitripennis]
 ref|XP_001607199.1| PREDICTED: histone H4 [Nasonia vitripennis]
 ref|XP_001607366.1| PREDICTED: histone H4 [Nasonia vitripennis]
 ref|XP_001608236.1| PREDICTED: histone H4 [Nasonia vitripennis]
 ref|XP_001599591.1| PREDICTED: histone H4 [Nasonia vitripennis]
 ref|XP_001599471.1| PREDICTED: histone H4 [Nasonia vitripennis]
 ref|XP_001662141.1| AAEL011999-PA [Aedes aegypti]
 ref|XP_001656986.1| AAEL000517-PA [Aedes aegypti]
 ref|XP_001656990.1| AAEL000490-PA [Aedes aegypti]
 ref|XP_001656994.1| AAEL000513-PA [Aedes aegypti]
 ref|XP_001656997.1| AAEL000501-PA [Aedes aegypti]
 ref|XP_001663888.1| AAEL013709-PA [Aedes aegypti]
 ref|XP_001657154.1| AAEL003673-PA [Aedes aegypti]
 ref|XP_001657155.1| AAEL003689-PA [Aedes aegypti]
 ref|XP_001657263.1| AAEL003814-PA [Aedes aegypti]
 ref|XP_001657269.1| AAEL003846-PA [Aedes aegypti]
 ref|XP_001657273.1| AAEL003823-PA [Aedes aegypti]
 ref|XP_001657275.1| AAEL003838-PA [Aedes aegypti]
 ref|XP_001657276.1| AAEL003866-PA [Aedes aegypti]
 ref|XP_305995.3| Anopheles gambiae str. PEST AGAP012558-PA [Anopheles gambiae 
str. PEST]
 ref|XP_306004.3| Anopheles gambiae str. PEST AGAP012586-PA [Anopheles gambiae 
str. PEST]
 ref|XP_306825.4| Anopheles gambiae str. PEST AGAP012885-PA [Anopheles gambiae 
str. PEST]
 ref|XP_307600.4| AGAP005026-PA [Anopheles gambiae str. PEST]
 ref|XP_307607.3| Anopheles gambiae str. PEST AGAP012574-PA [Anopheles gambiae 
str. PEST]
 ref|XP_311439.4| AGAP010724-PA [Anopheles gambiae str. PEST]
 ref|XP_315129.4| AGAP005023-PA [Anopheles gambiae str. PEST]
 ref|XP_318361.3| AGAP003909-PA [Anopheles gambiae str. PEST]
 ref|XP_001847698.1| histone H4 [Culex quinquefasciatus]
 ref|XP_001853990.1| H4 histone [Culex quinquefasciatus]
 ref|XP_001862659.1| histone H4 [Culex quinquefasciatus]
 ref|XP_001862662.1| histone 4 [Culex quinquefasciatus]
 ref|XP_001862664.1| histone 1 [Culex quinquefasciatus]
 ref|XP_001862669.1| histone 1 [Culex quinquefasciatus]
 ref|XP_001862673.1| histone 4 [Culex quinquefasciatus]
 ref|XP_001862677.1| histone protein Hist1h4d [Culex quinquefasciatus]
 ref|XP_001862682.1| histone H4 [Culex quinquefasciatus]
 ref|XP_001862686.1| histone H4 [Culex quinquefasciatus]
 ref|XP_001862693.1| histone 2 [Culex quinquefasciatus]
 ref|XP_001862699.1| histone protein Hist1h4i [Culex quinquefasciatus]
 ref|XP_001862704.1| histone H4 [Culex quinquefasciatus]
 ref|XP_001862708.1| histone H4 [Culex quinquefasciatus]
 ref|XP_001862712.1| HIST1H4H [Culex quinquefasciatus]
 ref|XP_001862716.1| histone H4 [Culex quinquefasciatus]
 ref|XP_001862720.1| histone 2 [Culex quinquefasciatus]
 ref|XP_001862724.1| histone 1 [Culex quinquefasciatus]
 ref|XP_001862728.1| histone H4 [Culex quinquefasciatus]
 ref|XP_001950227.1| PREDICTED: histone H4 [Acyrthosiphon pisum]
 ref|XP_001949096.1| PREDICTED: histone H4 [Acyrthosiphon pisum]
 ref|XP_001952977.1| GF17447 [Drosophila ananassae]
 ref|XP_001964807.1| GF22538 [Drosophila ananassae]
 ref|XP_001964812.1| GF22560 [Drosophila ananassae]
 ref|XP_001964817.1| GF22582 [Drosophila ananassae]
 ref|XP_001967674.1| GF15890 [Drosophila ananassae]
 ref|XP_001967679.1| GF15892 [Drosophila ananassae]
 ref|XP_001967728.1| GF15920 [Drosophila ananassae]
 ref|XP_001967759.1| GF20402 [Drosophila ananassae]
 ref|XP_001967774.1| GF19278 [Drosophila ananassae]
 ref|XP_001967786.1| GF20162 [Drosophila ananassae]
 ref|XP_001967815.1| GF22858 [Drosophila ananassae]
 ref|XP_001967870.1| GF19310 [Drosophila ananassae]
 ref|XP_001967893.1| GF21628 [Drosophila ananassae]
 ref|XP_001967898.1| GF22850 [Drosophila ananassae]
 ref|XP_001967929.1| GF18991 [Drosophila ananassae]
 ref|XP_001967939.1| GF18985 [Drosophila ananassae]
 ref|XP_001973987.1| GG21486 [Drosophila erecta]
 ref|XP_001973989.1| GG21487 [Drosophila erecta]
 ref|XP_001973999.1| GG21493 [Drosophila erecta]
 ref|XP_001974004.1| GG21495 [Drosophila erecta]
 ref|XP_001974009.1| GG21497 [Drosophila erecta]
 ref|XP_001974014.1| GG21499 [Drosophila erecta]
 ref|XP_001974019.1| GG21501 [Drosophila erecta]
 ref|XP_001974024.1| GG21504 [Drosophila erecta]
 ref|XP_001974029.1| GG21506 [Drosophila erecta]
 ref|XP_001979948.1| GG16866 [Drosophila erecta]
 ref|XP_001982894.1| GG11015 [Drosophila erecta]
 ref|XP_001982899.1| GG11017 [Drosophila erecta]
 ref|XP_001982904.1| GG11019 [Drosophila erecta]
 ref|XP_001982913.1| GG13027 [Drosophila erecta]
 ref|XP_001982918.1| GG13029 [Drosophila erecta]
 ref|XP_001982923.1| GG13031 [Drosophila erecta]
 ref|XP_001982928.1| GG13033 [Drosophila erecta]
 ref|XP_001982949.1| GG12580 [Drosophila erecta]
 ref|XP_001982954.1| GG12582 [Drosophila erecta]
 ref|XP_001983004.1| GG19846 [Drosophila erecta]
 ref|XP_001983009.1| GG19844 [Drosophila erecta]
 ref|XP_001983023.1| GG18794 [Drosophila erecta]
 ref|XP_001983044.1| GG12956 [Drosophila erecta]
 ref|XP_001983053.1| GG10952 [Drosophila erecta]
 ref|XP_001983062.1| GG16374 [Drosophila erecta]
 ref|XP_001983093.1| GG12991 [Drosophila erecta]
 ref|XP_001983102.1| GG13045 [Drosophila erecta]
 ref|XP_001983117.1| GG13063 [Drosophila erecta]
 ref|XP_001983123.1| GG19854 [Drosophila erecta]
 ref|XP_001983127.1| GG16358 [Drosophila erecta]
 ref|XP_001983132.1| GG11063 [Drosophila erecta]
 ref|XP_001983152.1| GG11047 [Drosophila erecta]
 ref|XP_001989691.1| GH18656 [Drosophila grimshawi]
 ref|XP_001996375.1| GH25065 [Drosophila grimshawi]
 ref|XP_001996380.1| GH25063 [Drosophila grimshawi]
 ref|XP_001996385.1| GH25059 [Drosophila grimshawi]
 ref|XP_001996390.1| GH25057 [Drosophila grimshawi]
 ref|XP_001996394.1| GH25055 [Drosophila grimshawi]
 ref|XP_001996398.1| GH25053 [Drosophila grimshawi]
 ref|XP_001996403.1| GH25051 [Drosophila grimshawi]
 ref|XP_001996408.1| GH25048 [Drosophila grimshawi]
 ref|XP_001996413.1| GH25046 [Drosophila grimshawi]
 ref|XP_001996418.1| GH25044 [Drosophila grimshawi]
 ref|XP_001996421.1| GH25042 [Drosophila grimshawi]
 ref|XP_001996425.1| GH25040 [Drosophila grimshawi]
 ref|XP_001996430.1| GH25037 [Drosophila grimshawi]
 ref|XP_001996434.1| GH25035 [Drosophila grimshawi]
 ref|XP_001996799.1| GH23346 [Drosophila grimshawi]
 ref|XP_001996805.1| GH23349 [Drosophila grimshawi]
 ref|XP_001996810.1| GH23351 [Drosophila grimshawi]
 ref|XP_001996814.1| GH23355 [Drosophila grimshawi]
 ref|XP_001996817.1| GH23356 [Drosophila grimshawi]
 ref|XP_001997177.1| GH23879 [Drosophila grimshawi]
 ref|XP_001997181.1| GH23880 [Drosophila grimshawi]
 ref|XP_001997203.1| GH10193 [Drosophila grimshawi]
 ref|XP_001997206.1| GH10204 [Drosophila grimshawi]
 ref|XP_001997210.1| GH10226 [Drosophila grimshawi]
 ref|XP_001997411.1| GH23768 [Drosophila grimshawi]
 ref|XP_001997451.1| GH23783 [Drosophila grimshawi]
 ref|XP_001997684.1| GH23501 [Drosophila grimshawi]
 ref|XP_001997794.1| GH23258 [Drosophila grimshawi]
 ref|XP_001997796.1| GH23260 [Drosophila grimshawi]
 ref|XP_001997856.1| GH25283 [Drosophila grimshawi]
 ref|XP_001997882.1| GH23786 [Drosophila grimshawi]
 ref|XP_001997925.1| GH11739 [Drosophila grimshawi]
 ref|XP_001997984.1| GH23470 [Drosophila grimshawi]
 ref|XP_001997994.1| GH23573 [Drosophila grimshawi]
 ref|XP_001998136.1| GH23674 [Drosophila grimshawi]
 ref|XP_001998774.1| GI24152 [Drosophila mojavensis]
 ref|XP_001998780.1| GI24155 [Drosophila mojavensis]
 ref|XP_001998784.1| GI24157 [Drosophila mojavensis]
 ref|XP_001998788.1| GI24159 [Drosophila mojavensis]
 ref|XP_002001245.1| GI10680 [Drosophila mojavensis]
 ref|XP_002002200.1| GI13912 [Drosophila mojavensis]
 ref|XP_002002204.1| GI13890 [Drosophila mojavensis]
 ref|XP_002002208.1| GI13868 [Drosophila mojavensis]
 ref|XP_002002987.1| GI17677 [Drosophila mojavensis]
 ref|XP_002002991.1| GI17679 [Drosophila mojavensis]
 ref|XP_002012536.1| GI16889 [Drosophila mojavensis]
 ref|XP_002012684.1| GI12824 [Drosophila mojavensis]
 ref|XP_002012737.1| GI21365 [Drosophila mojavensis]
 ref|XP_002013118.1| GL23560 [Drosophila persimilis]
 ref|XP_002013123.1| GL23558 [Drosophila persimilis]
 ref|XP_002013129.1| GL23556 [Drosophila persimilis]
 ref|XP_002013134.1| GL23554 [Drosophila persimilis]
 ref|XP_002013139.1| GL23552 [Drosophila persimilis]
 ref|XP_002013936.1| GL24413 [Drosophila persimilis]
 ref|XP_002028920.1| GL16866 [Drosophila persimilis]
 ref|XP_002029059.1| GL17799 [Drosophila persimilis]
 ref|XP_002029383.1| GL22985 [Drosophila persimilis]
 ref|XP_002031180.1| GM24174 [Drosophila sechellia]
 ref|XP_002044742.1| GM19705 [Drosophila sechellia]
 ref|XP_002044745.1| GM19704 [Drosophila sechellia]
 ref|XP_002044755.1| GM19700 [Drosophila sechellia]
 ref|XP_002044769.1| GM19694 [Drosophila sechellia]
 ref|XP_002044951.1| GM11745 [Drosophila sechellia]
 ref|XP_002044954.1| GM13192 [Drosophila sechellia]
 ref|XP_002044959.1| GM13190 [Drosophila sechellia]
 ref|XP_002044963.1| GM13186 [Drosophila sechellia]
 ref|XP_002045028.1| GM11713 [Drosophila sechellia]
 ref|XP_002045033.1| GM11715 [Drosophila sechellia]
 ref|XP_002045050.1| GM13538 [Drosophila sechellia]
 ref|XP_002045059.1| GM22670 [Drosophila sechellia]
 ref|XP_002045091.1| GM19737 [Drosophila sechellia]
 ref|XP_002045095.1| GM19735 [Drosophila sechellia]
 ref|XP_002045108.1| GM16185 [Drosophila sechellia]
 ref|XP_002045140.1| GM13168 [Drosophila sechellia]
 ref|XP_002045157.1| GM19326 [Drosophila sechellia]
 ref|XP_002045355.1| GM11162 [Drosophila sechellia]
 ref|XP_002045360.1| GM11159 [Drosophila sechellia]
 ref|XP_002045367.1| GM11845 [Drosophila sechellia]
 ref|XP_002045391.1| GM11187 [Drosophila sechellia]
 ref|XP_002045406.1| GM13630 [Drosophila sechellia]
 ref|XP_002045410.1| GM13631 [Drosophila sechellia]
 ref|XP_002045458.1| GM19376 [Drosophila sechellia]
 ref|XP_002045487.1| GM19352 [Drosophila sechellia]
 ref|XP_002045493.1| GM19324 [Drosophila sechellia]
 ref|XP_002045501.1| GM16164 [Drosophila sechellia]
 ref|XP_002045515.1| GM26664 [Drosophila sechellia]
 ref|XP_002045521.1| GM16230 [Drosophila sechellia]
 ref|XP_002045549.1| GM18818 [Drosophila sechellia]
 ref|XP_002045562.1| GM11683 [Drosophila sechellia]
 ref|XP_002045567.1| GM19340 [Drosophila sechellia]
 ref|XP_002045594.1| GM16107 [Drosophila sechellia]
 ref|XP_002045640.1| GM13125 [Drosophila sechellia]
 ref|XP_002045655.1| GM16109 [Drosophila sechellia]
 ref|XP_002045661.1| GM18833 [Drosophila sechellia]
 ref|XP_002045684.1| GM16891 [Drosophila sechellia]
 ref|XP_002045688.1| GM20007 [Drosophila sechellia]
 ref|XP_002045690.1| GM26728 [Drosophila sechellia]
 ref|XP_002045698.1| GM19313 [Drosophila sechellia]
 ref|XP_002045710.1| GM22033 [Drosophila sechellia]
 ref|XP_002045716.1| GM13562 [Drosophila sechellia]
 ref|XP_002045751.1| GM26662 [Drosophila sechellia]
 ref|XP_002045763.1| GM13525 [Drosophila sechellia]
 ref|XP_002045764.1| GM16393 [Drosophila sechellia]
 ref|XP_002045780.1| GM18806 [Drosophila sechellia]
 ref|XP_002045783.1| GM15454 [Drosophila sechellia]
 ref|XP_002045798.1| GM16879 [Drosophila sechellia]
 ref|XP_002045802.1| GM15136 [Drosophila sechellia]
 ref|XP_002045810.1| GM11149 [Drosophila sechellia]
 ref|XP_002045822.1| GM12950 [Drosophila sechellia]
 ref|XP_002045834.1| GM19645 [Drosophila sechellia]
 ref|XP_002045836.1| GM16925 [Drosophila sechellia]
 ref|XP_002045864.1| GM17443 [Drosophila sechellia]
 ref|XP_002045880.1| GM19693 [Drosophila sechellia]
 ref|XP_002045896.1| GM13120 [Drosophila sechellia]
 ref|XP_002045928.1| GM24351 [Drosophila sechellia]
 ref|XP_002045938.1| GM13140 [Drosophila sechellia]
 ref|XP_002045957.1| GM14868 [Drosophila sechellia]
 ref|XP_002045976.1| GM19626 [Drosophila sechellia]
 ref|XP_002045986.1| GM11749 [Drosophila sechellia]
 ref|XP_002046001.1| GM19317 [Drosophila sechellia]
 ref|XP_002046011.1| GM19601 [Drosophila sechellia]
 ref|XP_002052266.1| GJ17459 [Drosophila virilis]
 ref|XP_002052274.1| GJ17462 [Drosophila virilis]
 ref|XP_002053091.1| GJ23529 [Drosophila virilis]
 ref|XP_002053095.1| GJ23527 [Drosophila virilis]
 ref|XP_002053100.1| GJ23525 [Drosophila virilis]
 ref|XP_002053105.1| GJ23522 [Drosophila virilis]
 ref|XP_002053109.1| GJ23520 [Drosophila virilis]
 ref|XP_002053113.1| GJ23518 [Drosophila virilis]
 ref|XP_002053121.1| GJ23515 [Drosophila virilis]
 ref|XP_002054263.1| GJ24352 [Drosophila virilis]
 ref|XP_002060409.1| GJ15444 [Drosophila virilis]
 ref|XP_002060450.1| GJ19810 [Drosophila virilis]
 ref|XP_002060476.1| GJ18399 [Drosophila virilis]
 ref|XP_002060485.1| GJ18578 [Drosophila virilis]
 ref|XP_002060493.1| GJ19569 [Drosophila virilis]
 ref|XP_002060500.1| GJ14615 [Drosophila virilis]
 ref|XP_002060501.1| GJ18587 [Drosophila virilis]
 ref|XP_002060509.1| GJ17834 [Drosophila virilis]
 ref|XP_002060525.1| GJ19566 [Drosophila virilis]
 ref|XP_002060526.1| GJ14115 [Drosophila virilis]
 ref|XP_002060533.1| GJ16340 [Drosophila virilis]
 ref|XP_002060605.1| GK24036 [Drosophila willistoni]
 ref|XP_002069214.1| GK10373 [Drosophila willistoni]
 ref|XP_002074075.1| GK12810 [Drosophila willistoni]
 ref|XP_002075826.1| GK10779 [Drosophila willistoni]
 ref|XP_002075884.1| GK19438 [Drosophila willistoni]
 ref|XP_002075935.1| GK24099 [Drosophila willistoni]
 ref|XP_002075989.1| GK21030 [Drosophila willistoni]
 ref|XP_002086120.1| GE14476 [Drosophila yakuba]
 ref|XP_002097845.1| GE24247 [Drosophila yakuba]
 ref|XP_002077280.1| GD10660 [Drosophila simulans]
 ref|XP_002077299.1| GD11217 [Drosophila simulans]
 ref|XP_002077324.1| GD11690 [Drosophila simulans]
 ref|XP_002077329.1| GD11764 [Drosophila simulans]
 ref|XP_002077371.1| GD12574 [Drosophila simulans]
 ref|XP_002077411.1| GD18759 [Drosophila simulans]
 ref|XP_002077419.1| GD18653 [Drosophila simulans]
 ref|XP_002077463.1| GD18050 [Drosophila simulans]
 ref|XP_002077464.1| GD18029 [Drosophila simulans]
 ref|XP_002077516.1| GD10926 [Drosophila simulans]
 ref|XP_002077559.1| GD19097 [Drosophila simulans]
 ref|XP_002103427.1| GD18968 [Drosophila simulans]
 ref|XP_002422653.1| histone H4 [Pediculus humanus corporis]
 ref|XP_002430917.1| histone H4 [Pediculus humanus corporis]
 ref|XP_003251221.1| PREDICTED: histone H4-like [Apis mellifera]
 ref|XP_003251624.1| PREDICTED: histone H4-like isoform 1 [Apis mellifera]
 ref|XP_003392964.1| PREDICTED: histone H4-like [Bombus terrestris]
 ref|XP_003392970.1| PREDICTED: histone H4-like [Bombus terrestris]
 ref|XP_003393115.1| PREDICTED: histone H4-like [Bombus terrestris]
 ref|XP_003424595.1| PREDICTED: histone H4 [Nasonia vitripennis]
 ref|XP_003489847.1| PREDICTED: histone H4-like [Bombus impatiens]
 ref|XP_003489854.1| PREDICTED: histone H4-like [Bombus impatiens]
 ref|XP_003492168.1| PREDICTED: histone H4-like [Bombus impatiens]
 ref|XP_003697961.1| PREDICTED: histone H4-like [Apis florea]
 ref|XP_003697997.1| PREDICTED: histone H4-like isoform 1 [Apis florea]
 ref|XP_003697998.1| PREDICTED: histone H4-like isoform 2 [Apis florea]
 ref|XP_003697999.1| PREDICTED: histone H4-like isoform 3 [Apis florea]
 ref|XP_003703730.1| PREDICTED: histone H4-like [Megachile rotundata]
 ref|XP_003707915.1| PREDICTED: histone H4-like [Megachile rotundata]
 ref|XP_004934064.1| PREDICTED: histone H4-like [Bombyx mori]
 ref|XP_004934111.1| PREDICTED: histone H4-like [Bombyx mori]
 ref|XP_004934124.1| PREDICTED: histone H4-like [Bombyx mori]
 ref|XP_004934145.1| PREDICTED: histone H4-like [Bombyx mori]
 ref|XP_004934168.1| PREDICTED: histone H4-like [Bombyx mori]
 ref|XP_006570863.1| PREDICTED: histone H4-like [Apis mellifera]
 ref|XP_006611181.1| PREDICTED: histone H4-like [Apis dorsata]
 ref|XP_006618074.1| PREDICTED: histone H4-like [Apis dorsata]
 ref|XP_006621111.1| PREDICTED: histone H4-like [Apis dorsata]
 ref|XP_008190046.1| PREDICTED: histone H4 [Acyrthosiphon pisum]
 ref|XP_008203124.1| PREDICTED: LOW QUALITY PROTEIN: histone H4-like [Nasonia vitripennis]
 ref|XP_008479068.1| PREDICTED: histone H4 [Diaphorina citri]
 ref|XP_008479069.1| PREDICTED: histone H4 [Diaphorina citri]
 ref|XP_008482962.1| PREDICTED: histone H4 [Diaphorina citri]
 ref|XP_008482967.1| PREDICTED: histone H4 [Diaphorina citri]
 ref|XP_008484710.1| PREDICTED: histone H4 [Diaphorina citri]
 ref|XP_008560082.1| PREDICTED: histone H4 [Microplitis demolitor]
 ref|XP_008560151.1| PREDICTED: histone H4 [Microplitis demolitor]
 ref|XP_008560347.1| PREDICTED: histone H4 [Microplitis demolitor]
 ref|XP_008545621.1| PREDICTED: histone H4 [Microplitis demolitor]
 ref|XP_008545946.1| PREDICTED: histone H4 [Microplitis demolitor]
 ref|XP_008545952.1| PREDICTED: histone H4 [Microplitis demolitor]
 ref|XP_008548644.1| PREDICTED: histone H4 [Microplitis demolitor]
 ref|XP_008550903.1| PREDICTED: histone H4 [Microplitis demolitor]
 ref|XP_008552419.1| PREDICTED: histone H4 [Microplitis demolitor]
 ref|XP_008555618.1| PREDICTED: histone H4 [Microplitis demolitor]
 ref|XP_008556699.1| PREDICTED: histone H4 [Microplitis demolitor]
 ref|XP_008557899.1| PREDICTED: histone H4 [Microplitis demolitor]
 ref|XP_008557956.1| PREDICTED: histone H4 [Microplitis demolitor]
 ref|XP_009794608.1| PREDICTED: histone H4 isoform X1 [Nicotiana sylvestris]
 ref|XP_011068001.1| PREDICTED: histone H4 [Acromyrmex echinatior]
 ref|XP_011057614.1| PREDICTED: histone H4 [Acromyrmex echinatior]
 ref|XP_011062464.1| PREDICTED: histone H4 [Acromyrmex echinatior]
 ref|XP_011144465.1| PREDICTED: histone H4 [Harpegnathos saltator]
 ref|XP_011151030.1| PREDICTED: histone H4 [Harpegnathos saltator]
 ref|XP_011156268.1| PREDICTED: histone H4 [Solenopsis invicta]
 ref|XP_011163197.1| PREDICTED: histone H4 [Solenopsis invicta]
 ref|XP_011182595.1| PREDICTED: histone H4 [Bactrocera cucurbitae]
 ref|XP_011202703.1| PREDICTED: histone H4 [Bactrocera dorsalis]
 ref|XP_011268846.1| PREDICTED: histone H4 [Camponotus floridanus]
 ref|XP_011264341.1| PREDICTED: histone H4 [Camponotus floridanus]
 ref|XP_011265836.1| PREDICTED: histone H4 [Camponotus floridanus]
 ref|XP_011290206.1| PREDICTED: histone H4 [Musca domestica]
 ref|XP_011311167.1| PREDICTED: histone H4 [Fopius arisanus]
 ref|XP_011311714.1| PREDICTED: histone H4 [Fopius arisanus]
 ref|XP_011311737.1| PREDICTED: histone H4 [Fopius arisanus]
 ref|XP_011311822.1| PREDICTED: histone H4 [Fopius arisanus]
 ref|XP_011312036.1| PREDICTED: histone H4 [Fopius arisanus]
 ref|XP_011313088.1| PREDICTED: histone H4 [Fopius arisanus]
 ref|XP_011313115.1| PREDICTED: histone H4 [Fopius arisanus]
 ref|XP_011313159.1| PREDICTED: histone H4 [Fopius arisanus]
 ref|XP_011352081.1| PREDICTED: histone H4 [Cerapachys biroi]
 ref|XP_011336929.1| PREDICTED: histone H4 [Cerapachys biroi]
 ref|XP_011339814.1| PREDICTED: histone H4 [Cerapachys biroi]
 ref|XP_011347770.1| PREDICTED: histone H4 [Cerapachys biroi]
 ref|XP_011495699.1| PREDICTED: histone H4 [Ceratosolen solmsi marchali]
 ref|XP_011496660.1| PREDICTED: histone H4 [Ceratosolen solmsi marchali]
 ref|XP_011496730.1| PREDICTED: histone H4 [Ceratosolen solmsi marchali]
 ref|XP_011501816.1| PREDICTED: histone H4 [Ceratosolen solmsi marchali]
 ref|XP_011501821.1| PREDICTED: histone H4 [Ceratosolen solmsi marchali]
 sp|P84040.2|H4_DROME RecName: Full=Histone H4 [Drosophila melanogaster]
 sp|P84041.2|H4_DROER RecName: Full=Histone H4 [Drosophila erecta]
 sp|P84042.2|H4_DROHY RecName: Full=Histone H4 [Drosophila hydei]
 sp|P84043.2|H4_DROSI RecName: Full=Histone H4 [Drosophila simulans]
 sp|P84044.2|H4_DROYA RecName: Full=Histone H4 [Drosophila yakuba]
 sp|P84045.2|H4_TIGCA RecName: Full=Histone H4 [Tigriopus californicus]
 sp|P84046.2|H4_CHITH RecName: Full=Histone H4 [Chironomus thummi thummi]
 sp|P84047.2|H4_ASEAQ RecName: Full=Histone H4 [Asellus aquaticus]
 sp|P84048.2|H4_ACRAS RecName: Full=Histone H4 [Acrolepiopsis assectella]
 sp|P84049.2|H4_MYRRU RecName: Full=Histone H4 [Myrmica ruginodis]
 sp|P84050.2|H4_RHYAM RecName: Full=Histone H4 [Rhynchosciara americana]
 sp|Q76FD9.3|H4_DROSE RecName: Full=Histone H4 [Drosophila sechellia]
 sp|Q76FE7.3|H4_DROMA RecName: Full=Histone H4 [Drosophila mauritiana]
 sp|Q76FF1.3|H4_DROOR RecName: Full=Histone H4 [Drosophila orena]
 sp|Q76FF5.3|H4_DROTE RecName: Full=Histone H4 [Drosophila teissieri]
 pdb|4UUZ|B Chain B, Mcm2-histone Complex
 gb|AAK58065.1|AF378198_5 histone H4 [Rhynchosciara americana]
 emb|CAA39772.1| histone H4 [Chironomus thummi]
 emb|CAA36806.1| histone H4 [Drosophila hydei]
 emb|CAA34920.1| unnamed protein product [Drosophila hydei]
 emb|CAA32435.1| H4 histone [Drosophila melanogaster]
 emb|CAA36639.1| histone H4 [Tigriopus californicus]
 gb|AAC41553.1| histone H4 [Tigriopus californicus]
 emb|CAA51323.1| histone H4 [Chironomus thummi]
 emb|CAA66066.1| histone H4 [Drosophila hydei]
 emb|CAA66067.1| histone H4 [Drosophila melanogaster]
 emb|CAA66068.1| histone H4 [Drosophila melanogaster]
 emb|CAA62808.1| histone H4 [Acrolepiopsis assectella]
 emb|CAA62814.1| histone H4 [Myrmica ruginodis]
 emb|CAB64686.1| putative H4 histone [Asellus aquaticus]
 gb|AAF55080.1| histone H4 replacement, isoform A [Drosophila melanogaster]
 gb|AAN11126.1| histone H4 [Drosophila melanogaster]
 gb|AAN13612.1| histone H4 replacement, isoform B [Drosophila melanogaster]
 gb|AAN13613.1| histone H4 replacement, isoform C [Drosophila melanogaster]
 gb|AAN71603.1| RH52884p [Drosophila melanogaster]
 dbj|BAC54547.1| histone 4 [Drosophila simulans]
 dbj|BAC54551.1| histone 4 [Drosophila erecta]
 dbj|BAC54555.1| histone 4 [Drosophila yakuba]
 dbj|BAD02420.1| histone 4 [Drosophila yakuba]
 dbj|BAD02424.1| histone 4 [Drosophila teissieri]
 dbj|BAD02428.1| histone 4 [Drosophila orena]
 dbj|BAD02432.1| histone 4 [Drosophila mauritiana]
 dbj|BAD02440.1| histone 4 [Drosophila sechellia]
 dbj|BAD02444.1| histone 4 [Drosophila sechellia]
 gb|EAL27612.1| GA17414 [Drosophila pseudoobscura pseudoobscura]
 gb|AAZ66480.1| histone H4 [Drosophila melanogaster]
 gb|AAZ66484.1| histone H4 [Drosophila melanogaster]
 gb|AAZ66489.1| histone H4 [Drosophila melanogaster]
 gb|AAZ66493.1| histone H4 [Drosophila melanogaster]
 gb|AAZ66498.1| histone H4 [Drosophila melanogaster]
 gb|AAZ66503.1| histone H4 [Drosophila melanogaster]
 gb|AAZ66508.1| histone H4 [Drosophila melanogaster]
 gb|AAZ66513.1| histone H4 [Drosophila melanogaster]
 gb|AAZ66518.1| histone H4 [Drosophila melanogaster]
 gb|AAZ66523.1| histone H4 [Drosophila melanogaster]
 gb|AAZ66528.1| histone H4 [Drosophila melanogaster]
 gb|AAZ66533.1| histone H4 [Drosophila melanogaster]
 gb|AAZ66538.1| histone H4 [Drosophila melanogaster]
 gb|AAZ66543.1| histone H4 [Drosophila melanogaster]
 gb|AAZ66563.1| histone H4 [Drosophila melanogaster]
 gb|AAZ66568.1| histone H4 [Drosophila melanogaster]
 gb|AAZ66573.1| histone H4 [Drosophila melanogaster]
 gb|EAT34022.1| AAEL013709-PA [Aedes aegypti]
 gb|EAT35859.1| AAEL011999-PA [Aedes aegypti]
 gb|EAT44807.1| AAEL003814-PA [Aedes aegypti]
 gb|EAT44813.1| AAEL003846-PA [Aedes aegypti]
 gb|EAT44817.1| AAEL003823-PA [Aedes aegypti]
 gb|EAT44819.1| AAEL003838-PA [Aedes aegypti]
 gb|EAT44820.1| AAEL003866-PA [Aedes aegypti]
 gb|EAT45036.1| AAEL003673-PA [Aedes aegypti]
 gb|EAT45037.1| AAEL003689-PA [Aedes aegypti]
 gb|EAT48478.1| AAEL000517-PA [Aedes aegypti]
 gb|EAT48482.1| AAEL000490-PA [Aedes aegypti]
 gb|EAT48486.1| AAEL000513-PA [Aedes aegypti]
 gb|EAT48489.1| AAEL000501-PA [Aedes aegypti]
 dbj|BAF56189.1| histone 4 [Drosophila americana]
 dbj|BAF56194.1| histone 4 [Drosophila americana]
 gb|ABS82574.1| histone 4 [Plutella xylostella]
 gb|ABU41047.1| histone H4 [Lepeophtheirus salmonis]
 gb|EAA13590.3| AGAP003909-PA [Anopheles gambiae str. PEST]
 gb|EAA10504.4| AGAP005023-PA [Anopheles gambiae str. PEST]
 gb|EAA07054.4| AGAP010724-PA [Anopheles gambiae str. PEST]
 gb|EAA03403.3| AGAP012574-PA [Anopheles gambiae str. PEST]
 gb|EAA03396.4| AGAP005026-PA [Anopheles gambiae str. PEST]
 gb|EAA03012.3| AGAP012586-PA [Anopheles gambiae str. PEST]
 gb|EAA03003.3| AGAP012558-PA [Anopheles gambiae str. PEST]
 gb|EAA01970.5| AGAP012885-PA [Anopheles gambiae str. PEST]
 gb|ABW86654.1| histone H4 [Anthonomus grandis]
 gb|EDS26760.1| histone H4 [Culex quinquefasciatus]
 gb|EDS34373.1| H4 histone [Culex quinquefasciatus]
 gb|EDS37351.1| histone H4 [Culex quinquefasciatus]
 gb|EDS37354.1| histone 4 [Culex quinquefasciatus]
 gb|EDS37356.1| histone 1 [Culex quinquefasciatus]
 gb|EDS37361.1| histone 1 [Culex quinquefasciatus]
 gb|EDS37365.1| histone 4 [Culex quinquefasciatus]
 gb|EDS37369.1| histone protein Hist1h4d [Culex quinquefasciatus]
 gb|EDS37374.1| histone H4 [Culex quinquefasciatus]
 gb|EDS37378.1| histone H4 [Culex quinquefasciatus]
 gb|EDS37385.1| histone 2 [Culex quinquefasciatus]
 gb|EDS37391.1| histone protein Hist1h4i [Culex quinquefasciatus]
 gb|EDS37396.1| histone H4 [Culex quinquefasciatus]
 gb|EDS37400.1| histone H4 [Culex quinquefasciatus]
 gb|EDS37404.1| HIST1H4H [Culex quinquefasciatus]
 gb|EDS37408.1| histone H4 [Culex quinquefasciatus]
 gb|EDS37412.1| histone 2 [Culex quinquefasciatus]
 gb|EDS37416.1| histone 1 [Culex quinquefasciatus]
 gb|EDS37420.1| histone H4 [Culex quinquefasciatus]
 gb|EDV32941.1| GF22538 [Drosophila ananassae]
 gb|EDV32946.1| GF22560 [Drosophila ananassae]
 gb|EDV32951.1| GF22582 [Drosophila ananassae]
 gb|EDV33668.1| GF15890 [Drosophila ananassae]
 gb|EDV33673.1| GF15892 [Drosophila ananassae]
 gb|EDV41560.1| GF17447 [Drosophila ananassae]
 gb|EDV44810.1| GF19310 [Drosophila ananassae]
 gb|EDV44812.1| GF21628 [Drosophila ananassae]
 gb|EDV44834.1| GF22850 [Drosophila ananassae]
 gb|EDV44861.1| GF15920 [Drosophila ananassae]
 gb|EDV44872.1| GF18985 [Drosophila ananassae]
 gb|EDV44873.1| GF18991 [Drosophila ananassae]
 gb|EDV44931.1| GF22858 [Drosophila ananassae]
 gb|EDV44940.1| GF20402 [Drosophila ananassae]
 gb|EDV44945.1| GF20162 [Drosophila ananassae]
 gb|EDV44960.1| GF19278 [Drosophila ananassae]
 gb|EDV45003.1| GG19854 [Drosophila erecta]
 gb|EDV45007.1| GG13063 [Drosophila erecta]
 gb|EDV45041.1| GG13045 [Drosophila erecta]
 gb|EDV45048.1| GG16358 [Drosophila erecta]
 gb|EDV45060.1| GG18794 [Drosophila erecta]
 gb|EDV45081.1| GG19846 [Drosophila erecta]
 gb|EDV45086.1| GG19844 [Drosophila erecta]
 gb|EDV45092.1| GG11047 [Drosophila erecta]
 gb|EDV45096.1| GG12991 [Drosophila erecta]
 gb|EDV45100.1| GG10952 [Drosophila erecta]
 gb|EDV45117.1| GG13027 [Drosophila erecta]
 gb|EDV45122.1| GG13029 [Drosophila erecta]
 gb|EDV45127.1| GG13031 [Drosophila erecta]
 gb|EDV45132.1| GG13033 [Drosophila erecta]
 gb|EDV45295.1| GG12580 [Drosophila erecta]
 gb|EDV45300.1| GG12582 [Drosophila erecta]
 gb|EDV45310.1| GG11015 [Drosophila erecta]
 gb|EDV45315.1| GG11017 [Drosophila erecta]
 gb|EDV45320.1| GG11019 [Drosophila erecta]
 gb|EDV45330.1| GG12956 [Drosophila erecta]
 gb|EDV45337.1| GG16374 [Drosophila erecta]
 gb|EDV45648.1| GG11063 [Drosophila erecta]
 gb|EDV48906.1| GG16866 [Drosophila erecta]
 gb|EDV54387.1| GG21486 [Drosophila erecta]
 gb|EDV54389.1| GG21487 [Drosophila erecta]
 gb|EDV54399.1| GG21493 [Drosophila erecta]
 gb|EDV54404.1| GG21495 [Drosophila erecta]
 gb|EDV54409.1| GG21497 [Drosophila erecta]
 gb|EDV54414.1| GG21499 [Drosophila erecta]
 gb|EDV54419.1| GG21501 [Drosophila erecta]
 gb|EDV54424.1| GG21504 [Drosophila erecta]
 gb|EDV54429.1| GG21506 [Drosophila erecta]
 gb|EDV92753.1| GH18656 [Drosophila grimshawi]
 gb|EDV94009.1| GH23346 [Drosophila grimshawi]
 gb|EDV94015.1| GH23349 [Drosophila grimshawi]
 gb|EDV94020.1| GH23351 [Drosophila grimshawi]
 gb|EDV94024.1| GH23355 [Drosophila grimshawi]
 gb|EDV94027.1| GH23356 [Drosophila grimshawi]
 gb|EDV94106.1| GH25065 [Drosophila grimshawi]
 gb|EDV94111.1| GH25063 [Drosophila grimshawi]
 gb|EDV94116.1| GH25059 [Drosophila grimshawi]
 gb|EDV94121.1| GH25057 [Drosophila grimshawi]
 gb|EDV94125.1| GH25055 [Drosophila grimshawi]
 gb|EDV94129.1| GH25053 [Drosophila grimshawi]
 gb|EDV94134.1| GH25051 [Drosophila grimshawi]
 gb|EDV94139.1| GH25048 [Drosophila grimshawi]
 gb|EDV94144.1| GH25046 [Drosophila grimshawi]
 gb|EDV94149.1| GH25044 [Drosophila grimshawi]
 gb|EDV94152.1| GH25042 [Drosophila grimshawi]
 gb|EDV94156.1| GH25040 [Drosophila grimshawi]
 gb|EDV94161.1| GH25037 [Drosophila grimshawi]
 gb|EDV94165.1| GH25035 [Drosophila grimshawi]
 gb|EDV99504.1| GH23573 [Drosophila grimshawi]
 gb|EDW04354.1| GH25283 [Drosophila grimshawi]
 gb|EDW04406.1| GH23786 [Drosophila grimshawi]
 gb|EDW04448.1| GH23674 [Drosophila grimshawi]
 gb|EDW04453.1| GH23470 [Drosophila grimshawi]
 gb|EDW04514.1| GH23768 [Drosophila grimshawi]
 gb|EDW04717.1| GH11739 [Drosophila grimshawi]
 gb|EDW04769.1| GH23501 [Drosophila grimshawi]
 gb|EDW05037.1| GH23879 [Drosophila grimshawi]
 gb|EDW05041.1| GH23880 [Drosophila grimshawi]
 gb|EDW05148.1| GH10193 [Drosophila grimshawi]
 gb|EDW05151.1| GH10204 [Drosophila grimshawi]
 gb|EDW05155.1| GH10226 [Drosophila grimshawi]
 gb|EDW05220.1| GH23258 [Drosophila grimshawi]
 gb|EDW05222.1| GH23260 [Drosophila grimshawi]
 gb|EDW05225.1| GH23783 [Drosophila grimshawi]
 gb|EDW05446.1| GI12824 [Drosophila mojavensis]
 gb|EDW11642.1| GI13912 [Drosophila mojavensis]
 gb|EDW11646.1| GI13890 [Drosophila mojavensis]
 gb|EDW11650.1| GI13868 [Drosophila mojavensis]
 gb|EDW12429.1| GI17677 [Drosophila mojavensis]
 gb|EDW12433.1| GI17679 [Drosophila mojavensis]
 gb|EDW14235.1| GI24152 [Drosophila mojavensis]
 gb|EDW14241.1| GI24155 [Drosophila mojavensis]
 gb|EDW14245.1| GI24157 [Drosophila mojavensis]
 gb|EDW14249.1| GI24159 [Drosophila mojavensis]
 gb|EDW16706.1| GI10680 [Drosophila mojavensis]
 gb|EDW17073.1| GI21365 [Drosophila mojavensis]
 gb|EDW19822.1| GI16889 [Drosophila mojavensis]
 gb|EDW24104.1| GL23560 [Drosophila persimilis]
 gb|EDW24109.1| GL23558 [Drosophila persimilis]
 gb|EDW24115.1| GL23556 [Drosophila persimilis]
 gb|EDW24120.1| GL23554 [Drosophila persimilis]
 gb|EDW24125.1| GL23552 [Drosophila persimilis]
 gb|EDW24922.1| GL24413 [Drosophila persimilis]
 gb|EDW26939.1| GL17799 [Drosophila persimilis]
 gb|EDW29385.1| GL16866 [Drosophila persimilis]
 gb|EDW39502.1| GL22985 [Drosophila persimilis]
 gb|EDW42166.1| GM24174 [Drosophila sechellia]
 gb|EDW43588.1| GM16925 [Drosophila sechellia]
 gb|EDW43606.1| GM13630 [Drosophila sechellia]
 gb|EDW43610.1| GM13631 [Drosophila sechellia]
 gb|EDW43639.1| GM17443 [Drosophila sechellia]
 gb|EDW43662.1| GM19693 [Drosophila sechellia]
 gb|EDW44101.1| GM13120 [Drosophila sechellia]
 gb|EDW44150.1| GM24351 [Drosophila sechellia]
 gb|EDW44549.1| GM13140 [Drosophila sechellia]
 gb|EDW44583.1| GM14868 [Drosophila sechellia]
 gb|EDW44916.1| GM19626 [Drosophila sechellia]
 gb|EDW44927.1| GM11749 [Drosophila sechellia]
 gb|EDW44949.1| GM19317 [Drosophila sechellia]
 gb|EDW44969.1| GM19601 [Drosophila sechellia]
 gb|EDW48753.1| GM19376 [Drosophila sechellia]
 gb|EDW48891.1| GM11745 [Drosophila sechellia]
 gb|EDW49035.1| GM13192 [Drosophila sechellia]
 gb|EDW49040.1| GM13190 [Drosophila sechellia]
 gb|EDW49044.1| GM13186 [Drosophila sechellia]
 gb|EDW49763.1| GM19352 [Drosophila sechellia]
 gb|EDW50883.1| GM19324 [Drosophila sechellia]
 gb|EDW50947.1| GM16164 [Drosophila sechellia]
 gb|EDW51028.1| GM26664 [Drosophila sechellia]
 gb|EDW51099.1| GM16230 [Drosophila sechellia]
 gb|EDW51457.1| GM11713 [Drosophila sechellia]
 gb|EDW51462.1| GM11715 [Drosophila sechellia]
 gb|EDW51646.1| GM18818 [Drosophila sechellia]
 gb|EDW52636.1| GM13538 [Drosophila sechellia]
 gb|EDW52675.1| GM22670 [Drosophila sechellia]
 gb|EDW52709.1| GM11683 [Drosophila sechellia]
 gb|EDW52722.1| GM19340 [Drosophila sechellia]
 gb|EDW52839.1| GM19737 [Drosophila sechellia]
 gb|EDW52843.1| GM19735 [Drosophila sechellia]
 gb|EDW53644.1| GM11162 [Drosophila sechellia]
 gb|EDW53649.1| GM11159 [Drosophila sechellia]
 gb|EDW53700.1| GM16107 [Drosophila sechellia]
 gb|EDW53730.1| GM16185 [Drosophila sechellia]
 gb|EDW53866.1| GM11845 [Drosophila sechellia]
 gb|EDW54674.1| GM13125 [Drosophila sechellia]
 gb|EDW54713.1| GM16109 [Drosophila sechellia]
 gb|EDW54722.1| GM18833 [Drosophila sechellia]
 gb|EDW55360.1| GM13168 [Drosophila sechellia]
 gb|EDW55400.1| GM16891 [Drosophila sechellia]
 gb|EDW55410.1| GM20007 [Drosophila sechellia]
 gb|EDW55412.1| GM26728 [Drosophila sechellia]
 gb|EDW55421.1| GM19313 [Drosophila sechellia]
 gb|EDW55455.1| GM22033 [Drosophila sechellia]
 gb|EDW55848.1| GM13562 [Drosophila sechellia]
 gb|EDW55859.1| GM11187 [Drosophila sechellia]
 gb|EDW55906.1| GM26662 [Drosophila sechellia]
 gb|EDW55917.1| GM19326 [Drosophila sechellia]
 gb|EDW55929.1| GM13525 [Drosophila sechellia]
 gb|EDW55930.1| GM16393 [Drosophila sechellia]
 gb|EDW56412.1| GM18806 [Drosophila sechellia]
 gb|EDW56415.1| GM19705 [Drosophila sechellia]
 gb|EDW56418.1| GM19704 [Drosophila sechellia]
 gb|EDW56428.1| GM19700 [Drosophila sechellia]
 gb|EDW56442.1| GM19694 [Drosophila sechellia]
 gb|EDW56447.1| GM15454 [Drosophila sechellia]
 gb|EDW56464.1| GM16879 [Drosophila sechellia]
 gb|EDW56468.1| GM15136 [Drosophila sechellia]
 gb|EDW56485.1| GM11149 [Drosophila sechellia]
 gb|EDW56501.1| GM12950 [Drosophila sechellia]
 gb|EDW56521.1| GM19645 [Drosophila sechellia]
 gb|EDW57337.1| GJ14115 [Drosophila virilis]
 gb|EDW57468.1| GJ15444 [Drosophila virilis]
 gb|EDW64421.1| GJ17459 [Drosophila virilis]
 gb|EDW64429.1| GJ17462 [Drosophila virilis]
 gb|EDW66611.1| GJ23529 [Drosophila virilis]
 gb|EDW66615.1| GJ23527 [Drosophila virilis]
 gb|EDW66620.1| GJ23525 [Drosophila virilis]
 gb|EDW66625.1| GJ23522 [Drosophila virilis]
 gb|EDW66629.1| GJ23520 [Drosophila virilis]
 gb|EDW66633.1| GJ23518 [Drosophila virilis]
 gb|EDW66641.1| GJ23515 [Drosophila virilis]
 gb|EDW67783.1| GJ24352 [Drosophila virilis]
 gb|EDW71165.1| GJ18587 [Drosophila virilis]
 gb|EDW71454.1| GJ17834 [Drosophila virilis]
 gb|EDW71462.1| GJ19566 [Drosophila virilis]
 gb|EDW71507.1| GJ16340 [Drosophila virilis]
 gb|EDW71521.1| GJ19569 [Drosophila virilis]
 gb|EDW71532.1| GJ18399 [Drosophila virilis]
 gb|EDW71538.1| GJ18578 [Drosophila virilis]
 gb|EDW71544.1| GJ19810 [Drosophila virilis]
 gb|EDW71559.1| GJ14615 [Drosophila virilis]
 gb|EDW71591.1| GK24036 [Drosophila willistoni]
 gb|EDW80200.1| GK10373 [Drosophila willistoni]
 gb|EDW85061.1| GK12810 [Drosophila willistoni]
 gb|EDW86812.1| GK10779 [Drosophila willistoni]
 gb|EDW86870.1| GK19438 [Drosophila willistoni]
 gb|EDW86921.1| GK24099 [Drosophila willistoni]
 gb|EDW86975.1| GK21030 [Drosophila willistoni]
 gb|EDW97557.1| GE24247 [Drosophila yakuba]
 gb|EDW99590.1| GE14476 [Drosophila yakuba]
 gb|EDX12930.1| GD18968 [Drosophila simulans]
 gb|EDX15953.1| GD10660 [Drosophila simulans]
 gb|EDX15974.1| GD11217 [Drosophila simulans]
 gb|EDX16002.1| GD11690 [Drosophila simulans]
 gb|EDX16007.1| GD11764 [Drosophila simulans]
 gb|EDX16053.1| GD12574 [Drosophila simulans]
 gb|EDX16098.1| GD18759 [Drosophila simulans]
 gb|EDX16106.1| GD18653 [Drosophila simulans]
 gb|EDX16152.1| GD18050 [Drosophila simulans]
 gb|EDX16154.1| GD18029 [Drosophila simulans]
 gb|EDX16208.1| GD10926 [Drosophila simulans]
 gb|EDX16251.1| GD19097 [Drosophila simulans]
 dbj|BAG68517.1| histone 4 [Drosophila pseudoobscura]
 dbj|BAG68509.1| histone 4 [Drosophila lutescens]
 gb|EEB09915.1| histone H4 [Pediculus humanus corporis]
 gb|EEB18179.1| histone H4 [Pediculus humanus corporis]
 dbj|BAH23274.1| histone H4-like protein [Bombyx mori]
 gb|ACO10353.1| Histone H4 [Caligus rogercresseyi]
 gb|ACO10710.1| Histone H4 [Caligus rogercresseyi]
 gb|ACO11602.1| Histone H4 [Caligus rogercresseyi]
 gb|ACO12400.1| Histone H4 [Lepeophtheirus salmonis]
 gb|ACO12948.1| Histone H4 [Lepeophtheirus salmonis]
 dbj|BAH72194.1| ACYPI006416 [Acyrthosiphon pisum]
 gb|ADD24385.1| Histone H4 [Lepeophtheirus salmonis]
 gb|ADD38540.1| Histone H4 [Lepeophtheirus salmonis]
 dbj|BAJ06135.1| histone 4 [Drosophila yakuba]
 gb|EFN61842.1| Histone H4 [Camponotus floridanus]
 gb|EFN62818.1| Histone H4 [Camponotus floridanus]
 gb|EFN72894.1| Histone H4 [Camponotus floridanus]
 gb|EFN76784.1| Histone H4 [Harpegnathos saltator]
 gb|EFN81297.1| Histone H4 [Harpegnathos saltator]
 gb|EFX62752.1| hypothetical protein DAPPUDRAFT_67720 [Daphnia pulex]
 gb|EFX63157.1| hypothetical protein DAPPUDRAFT_67318 [Daphnia pulex]
 gb|EFX71389.1| hypothetical protein DAPPUDRAFT_255863 [Daphnia pulex]
 gb|EFX86862.1| hypothetical protein DAPPUDRAFT_312260 [Daphnia pulex]
 gb|EFX86885.1| hypothetical protein DAPPUDRAFT_235631 [Daphnia pulex]
 gb|EFX86905.1| hypothetical protein DAPPUDRAFT_43920 [Daphnia pulex]
 gb|EFX86918.1| hypothetical protein DAPPUDRAFT_312353 [Daphnia pulex]
 gb|EFX86973.1| hypothetical protein DAPPUDRAFT_97168 [Daphnia pulex]
 gb|EFX87016.1| hypothetical protein DAPPUDRAFT_43738 [Daphnia pulex]
 gb|EFX87057.1| hypothetical protein DAPPUDRAFT_43649 [Daphnia pulex]
 gb|EFX87068.1| hypothetical protein DAPPUDRAFT_235965 [Daphnia pulex]
 gb|EFX87249.1| hypothetical protein DAPPUDRAFT_235971 [Daphnia pulex]
 gb|EFX87258.1| hypothetical protein DAPPUDRAFT_235957 [Daphnia pulex]
 gb|EFX87266.1| hypothetical protein DAPPUDRAFT_43914 [Daphnia pulex]
 gb|EFX87299.1| hypothetical protein DAPPUDRAFT_312519 [Daphnia pulex]
 gb|EFX87335.1| hypothetical protein DAPPUDRAFT_97173 [Daphnia pulex]
 gb|EFX87347.1| hypothetical protein DAPPUDRAFT_44079 [Daphnia pulex]
 gb|EFX87382.1| hypothetical protein DAPPUDRAFT_43647 [Daphnia pulex]
 gb|EFX87414.1| hypothetical protein DAPPUDRAFT_44077 [Daphnia pulex]
 gb|EFX87438.1| hypothetical protein DAPPUDRAFT_43601 [Daphnia pulex]
 gb|EFX87465.1| hypothetical protein DAPPUDRAFT_127187 [Daphnia pulex]
 gb|EFX88477.1| hypothetical protein DAPPUDRAFT_190957 [Daphnia pulex]
 gb|EFX88781.1| hypothetical protein DAPPUDRAFT_206519 [Daphnia pulex]
 gb|EFZ15885.1| hypothetical protein SINV_12043 [Solenopsis invicta]
 gb|EGI60522.1| Histone H4 [Acromyrmex echinatior]
 gb|EGI63564.1| Histone H4 [Acromyrmex echinatior]
 gb|EGI69637.1| Histone H4 [Acromyrmex echinatior]
 gb|AEE63448.1| unknown [Dendroctonus ponderosae]
 gb|EHJ75635.1| hypothetical protein KGM_19628 [Danaus plexippus]
 gb|AGB95957.1| histone H4 replacement, isoform D [Drosophila melanogaster]
 gb|AGN29606.1| histone H4 [Acartia pacifica]
 gb|ERL94562.1| hypothetical protein D910_11839 [Dendroctonus ponderosae]
 gb|ETN62628.1| histone 1 [Anopheles darlingi]
 gb|ETN63608.1| histone 1 [Anopheles darlingi]
 gb|ETN66358.1| histone 1 [Anopheles darlingi]
 gb|EZA48674.1| Histone H4 [Cerapachys biroi]
 gb|EZA53713.1| Histone H4 [Cerapachys biroi]
 gb|EZA55492.1| Histone H4 [Cerapachys biroi]
 gb|EZA60715.1| Histone H4 [Cerapachys biroi]
 gb|KDR03943.1| Histone H4 [Zootermopsis nevadensis]
 gb|KDR07174.1| Histone H4 [Zootermopsis nevadensis]
 gb|KDR23796.1| Histone H4 [Zootermopsis nevadensis]
Length=103

 Score =   155 bits (392),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>pdb|3AZL|B Chain B, Crystal Structure Of Human Nucleosome Core Particle 
Containing H4k77q Mutation
 pdb|3AZL|F Chain F, Crystal Structure Of Human Nucleosome Core Particle 
Containing H4k77q Mutation
Length=106

 Score =   155 bits (393),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  25   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAQRKT  84

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  85   VTAMDVVYALKRQGRTLY  102



>ref|XP_009288417.1| PREDICTED: histone H4-like [Aptenodytes forsteri]
Length=152

 Score =   157 bits (396),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  71   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  130

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  131  VTAMDVVYALKRQGRTLY  148



>gb|EUB54305.1| Histone H4 [Echinococcus granulosus]
Length=147

 Score =   157 bits (396),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>ref|XP_009081497.1| PREDICTED: histone H4, partial [Acanthisitta chloris]
 ref|XP_010165225.1| PREDICTED: histone H4, partial [Caprimulgus carolinensis]
 gb|KFP08769.1| Histone H4, partial [Egretta garzetta]
 gb|KFU93220.1| Histone H4, partial [Chaetura pelagica]
Length=99

 Score =   155 bits (392),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  18   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  77

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  78   VTAMDVVYALKRQGRTLY  95



>ref|XP_005039664.1| PREDICTED: histone H4-like [Ficedula albicollis]
Length=143

 Score =   157 bits (396),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  62   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  121

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  122  VTAMDVVYALKRQGRTLY  139



>ref|XP_001865499.1| histone 4 [Culex quinquefasciatus]
 gb|EDS41771.1| histone 4 [Culex quinquefasciatus]
Length=110

 Score =   155 bits (393),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>ref|XP_005809247.1| PREDICTED: histone H4-like [Xiphophorus maculatus]
Length=103

 Score =   155 bits (392),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>ref|XP_007575252.1| PREDICTED: histone H4-like [Poecilia formosa]
Length=126

 Score =   156 bits (394),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  45   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  104

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  105  VTAMDVVYALKRQGRTLY  122



>ref|XP_003942034.2| PREDICTED: histone H4 [Saimiri boliviensis boliviensis]
Length=121

 Score =   156 bits (394),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  40   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  99

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  100  VTAMDVVYALKRQGRTLY  117



>gb|AIC55397.1| HIST1H4H, partial [synthetic construct]
Length=103

 Score =   155 bits (392),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>gb|EHH18017.1| Histone H4 [Macaca mulatta]
Length=103

 Score =   155 bits (392),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>pdb|2PYO|B Chain B, Drosophila Nucleosome Core
 pdb|2PYO|F Chain F, Drosophila Nucleosome Core
Length=102

 Score =   155 bits (392),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  21   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  80

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  81   VTAMDVVYALKRQGRTLY  98



>gb|EFB21587.1| hypothetical protein PANDA_016840 [Ailuropoda melanoleuca]
 gb|KFW03129.1| Histone H4, partial [Eurypyga helias]
Length=103

 Score =   155 bits (392),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>gb|ABV25909.1| histone H4 [Ruditapes philippinarum]
Length=103

 Score =   155 bits (392),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>gb|AFY26254.1| histone H4, partial [Plectorhinchus mediterraneus]
 gb|AFY26256.1| histone H4, partial [Plectorhinchus mediterraneus]
 gb|AFY26257.1| histone H4, partial [Plectorhinchus mediterraneus]
 gb|AFY26258.1| histone H4, partial [Plectorhinchus mediterraneus]
 gb|AFY26260.1| histone H4, partial [Plectorhinchus mediterraneus]
 gb|AFY26261.1| histone H4, partial [Plectorhinchus mediterraneus]
 gb|AFY26262.1| histone H4, partial [Plectorhinchus mediterraneus]
 gb|AFY26263.1| histone H4, partial [Plectorhinchus mediterraneus]
 gb|AFY26265.1| histone H4, partial [Plectorhinchus mediterraneus]
Length=101

 Score =   155 bits (392),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  20   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  79

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  80   VTAMDVVYALKRQGRTLY  97



>ref|XP_005515123.1| PREDICTED: histone H4-like [Columba livia]
Length=103

 Score =   155 bits (392),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>ref|XP_005431671.1| PREDICTED: histone H4-like, partial [Geospiza fortis]
 ref|XP_009645524.1| PREDICTED: histone H4, partial [Egretta garzetta]
Length=96

 Score =   155 bits (391),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  17   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  76

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  77   VTAMDVVYALKRQGRTLY  94



>pdb|3W99|B Chain B, Crystal Structure Of Human Nucleosome Core Particle 
Lacking H4 N- Terminal Region
 pdb|3W99|F Chain F, Crystal Structure Of Human Nucleosome Core Particle 
Lacking H4 N- Terminal Region
Length=91

 Score =   155 bits (391),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  10   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  69

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  70   VTAMDVVYALKRQGRTLY  87



>emb|CCA15305.1| AlNc14C10G1266 [Albugo laibachii Nc14]
 emb|CCA21792.1| AlNc14C134G7038 [Albugo laibachii Nc14]
Length=103

 Score =   155 bits (392),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRD+VTYTEHARRKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDSVTYTEHARRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>gb|AAI15447.1| Hist1h4f protein, partial [Mus musculus]
Length=99

 Score =   155 bits (392),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  19   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  78

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  79   VTAMDVVYALKRQGRTLY  96



>ref|XP_004088801.1| PREDICTED: histone H4-like [Nomascus leucogenys]
Length=129

 Score =   156 bits (394),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  48   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  107

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  108  VTAMDVVYALKRQGRTLY  125



>gb|ACG30828.1| histone H4 [Zea mays]
 gb|EMT17607.1| Histone H4 [Aegilops tauschii]
Length=103

 Score =   155 bits (392),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 77/78 (99%), Positives = 77/78 (99%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK FLENVIRDAVTYTEHARRKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKTFLENVIRDAVTYTEHARRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>ref|XP_006890704.1| PREDICTED: histone H4-like [Elephantulus edwardii]
Length=85

 Score =   154 bits (390),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  4    VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  63

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  64   VTAMDVVYALKRQGRTLY  81



>ref|XP_004085100.1| PREDICTED: histone H4-like [Oryzias latipes]
Length=109

 Score =   155 bits (392),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  28   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  87

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  88   VTAMDVVYALKRQGRTLY  105



>gb|ELR58906.1| hypothetical protein M91_11360 [Bos mutus]
Length=123

 Score =   156 bits (394),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  42   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  101

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  102  VTAMDVVYALKRQGRTLY  119



>ref|XP_004406590.1| PREDICTED: histone H4-like [Odobenus rosmarus divergens]
Length=122

 Score =   156 bits (394),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  41   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  100

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  101  VTAMDVVYALKRQGRTLY  118



>ref|XP_003770487.1| PREDICTED: histone H4-like, partial [Sarcophilus harrisii]
Length=119

 Score =   155 bits (393),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>emb|CBM82432.1| histone H4-I protein [Rhabdopleura compacta]
 emb|CBM82433.1| histone H4-II protein [Rhabdopleura compacta]
 emb|CBM82434.1| histone H4-III protein [Rhabdopleura compacta]
 emb|CBM82493.1| histone H4-I protein [Balanoglossus clavigerus]
 emb|CBM82494.1| histone H4-II protein [Balanoglossus clavigerus]
 emb|CBM82495.1| histone H4-III protein [Balanoglossus clavigerus]
 emb|CBM82496.1| histone H4-IV protein [Balanoglossus clavigerus]
 emb|CBM82497.1| histone H4-V protein [Balanoglossus clavigerus]
 emb|CBM82498.1| histone H4-VI protein [Balanoglossus clavigerus]
 emb|CBM82499.1| histone H4-VII protein [Balanoglossus clavigerus]
 emb|CBM82500.1| histone H4-VIII protein [Balanoglossus clavigerus]
 emb|CBM82501.1| histone H4-IX protein [Balanoglossus clavigerus]
 emb|CBM82502.1| histone H4-X protein [Balanoglossus clavigerus]
 gb|EMC89196.1| Histone H4, partial [Columba livia]
Length=96

 Score =   155 bits (391),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  15   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  74

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  75   VTAMDVVYALKRQGRTLY  92



>pdb|3KWQ|B Chain B, Structural Characterization Of H3k56q Nucleosomes And 
Nucleo Arrays
 pdb|3KWQ|F Chain F, Structural Characterization Of H3k56q Nucleosomes And 
Nucleo Arrays
 pdb|4H9S|C Chain C, Complex Structure 6 Of DaxxH3.3(SUB7)H4
 pdb|4H9S|D Chain D, Complex Structure 6 Of DaxxH3.3(SUB7)H4
Length=83

 Score =   154 bits (390),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  2    VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  61

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  62   VTAMDVVYALKRQGRTLY  79



>ref|XP_004670884.1| PREDICTED: histone H4-like isoform X2 [Jaculus jaculus]
Length=111

 Score =   155 bits (393),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  30   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  89

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  90   VTAMDVVYALKRQGRTLY  107



>ref|XP_008653038.1| PREDICTED: histone H4-like [Zea mays]
Length=206

 Score =   158 bits (400),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 78/78 (100%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT
Sbjct  125  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  184

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  185  VTAMDVVYALKRQGRTLY  202



>ref|XP_005553930.1| PREDICTED: histone H4-like [Macaca fascicularis]
Length=129

 Score =   156 bits (394),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  48   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  107

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  108  VTAMDVVYALKRQGRTLY  125



>gb|KFR08207.1| Histone H4 [Nipponia nippon]
Length=103

 Score =   155 bits (392),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>gb|KFO74449.1| Histone H4 [Cuculus canorus]
Length=103

 Score =   155 bits (392),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>sp|Q6WV74.3|H4_MYTCH RecName: Full=Histone H4 [Mytilus chilensis]
 gb|AAP94670.1| histone H4 [Mytilus chilensis]
Length=103

 Score =   155 bits (392),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>ref|XP_008830098.1| PREDICTED: histone H4-like [Nannospalax galili]
Length=145

 Score =   156 bits (395),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  64   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  123

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  124  VTAMDVVYALKRQGRTLY  141



>ref|XP_001997928.1| GH12997 [Drosophila grimshawi]
 gb|AAI15452.1| Hist1h4c protein, partial [Mus musculus]
 gb|AAI15448.1| Hist2h4 protein, partial [Mus musculus]
 gb|EDW04730.1| GH12997, partial [Drosophila grimshawi]
 gb|KFP71499.1| Histone H4, partial [Acanthisitta chloris]
 gb|KFZ46921.1| Histone H4, partial [Caprimulgus carolinensis]
Length=100

 Score =   155 bits (391),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  19   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  78

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  79   VTAMDVVYALKRQGRTLY  96



>ref|NP_001288381.1| histone H4 [Zea mays]
 gb|ACG38877.1| histone H4 [Zea mays]
Length=103

 Score =   155 bits (392),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 77/78 (99%), Positives = 77/78 (99%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVK ISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKHISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>ref|XP_004500224.1| PREDICTED: histone H4-like [Cicer arietinum]
Length=103

 Score =   155 bits (392),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 77/78 (99%), Positives = 77/78 (99%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRL RRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT
Sbjct  22   VLRDNIQGITKPAIRRLTRRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>pdb|2NQB|B Chain B, Drosophila Nucleosome Structure
 pdb|2NQB|F Chain F, Drosophila Nucleosome Structure
Length=103

 Score =   155 bits (392),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>ref|XP_002045379.1| GM19760 [Drosophila sechellia]
 gb|EDW55440.1| GM19760 [Drosophila sechellia]
Length=103

 Score =   155 bits (392),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>gb|ACO14889.1| Histone H4 [Caligus clemensi]
Length=103

 Score =   155 bits (392),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>ref|XP_009976860.1| PREDICTED: histone H4-like, partial [Tauraco erythrolophus]
Length=124

 Score =   155 bits (393),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  43   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  102

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  103  VTAMDVVYALKRQGRTLY  120



>ref|XP_002045100.1| GM19733 [Drosophila sechellia]
 gb|EDW52848.1| GM19733 [Drosophila sechellia]
Length=88

 Score =   154 bits (390),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  7    VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  66

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  67   VTAMDVVYALKRQGRTLY  84



>ref|XP_001619043.1| hypothetical protein NEMVEDRAFT_v1g227759 [Nematostella vectensis]
 gb|EDO26943.1| predicted protein, partial [Nematostella vectensis]
Length=99

 Score =   155 bits (391),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 75/78 (96%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            +LRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  22   ILRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>gb|AAI28106.1| HIST2H4B protein, partial [Homo sapiens]
Length=102

 Score =   155 bits (392),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  21   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  80

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  81   VTAMDVVYALKRQGRTLY  98



>ref|XP_007971592.1| PREDICTED: histone H4-like [Chlorocebus sabaeus]
Length=140

 Score =   156 bits (395),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  59   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  118

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  119  VTAMDVVYALKRQGRTLY  136



>ref|XP_006872834.1| PREDICTED: histone H4-like [Chrysochloris asiatica]
Length=120

 Score =   155 bits (393),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  39   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  98

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  99   VTAMDVVYALKRQGRTLY  116



>ref|XP_003581994.2| PREDICTED: histone H4 [Bos taurus]
 ref|XP_002686104.2| PREDICTED: histone H4 [Bos taurus]
Length=150

 Score =   157 bits (396),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 102/123 (83%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = +1

Query  13   KSTCPIYLSLHQFKTLDFFFLSAKMSgrgkggkglgkggakrhrkVLRDNIQGITKPAIR  192
            +S   +YL       +  F  S+ MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIR
Sbjct  24   RSAALVYLGESSPFCIRGFLTSSVMSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIR  83

Query  193  RLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGR  372
            RLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKTVTAMDVVYALKRQGR
Sbjct  84   RLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGR  143

Query  373  TLY  381
            TLY
Sbjct  144  TLY  146



>ref|XP_009150050.1| PREDICTED: histone H4 [Brassica rapa]
 ref|XP_009103711.1| PREDICTED: histone H4-like [Brassica rapa]
Length=103

 Score =   155 bits (392),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 77/78 (99%), Positives = 77/78 (99%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRG LKIFLENVIRDAVTYTEHARRKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGGLKIFLENVIRDAVTYTEHARRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>ref|XP_005905833.1| PREDICTED: histone H4-like [Bos mutus]
 gb|ELR49045.1| hypothetical protein M91_09149 [Bos mutus]
Length=103

 Score =   155 bits (392),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>gb|KFM02258.1| Histone H4, partial [Aptenodytes forsteri]
Length=101

 Score =   155 bits (391),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>gb|EPQ09434.1| Histone H4, partial [Myotis brandtii]
Length=109

 Score =   155 bits (392),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  28   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  87

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  88   VTAMDVVYALKRQGRTLY  105



>gb|KFW77911.1| Histone H4, partial [Manacus vitellinus]
 gb|KFW77915.1| Histone H4, partial [Manacus vitellinus]
Length=84

 Score =   154 bits (390),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  3    VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  62

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  63   VTAMDVVYALKRQGRTLY  80



>ref|XP_010409233.1| PREDICTED: histone H4-like [Corvus cornix cornix]
Length=101

 Score =   155 bits (391),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  20   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  79

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  80   VTAMDVVYALKRQGRTLY  97



>ref|XP_009638177.1| PREDICTED: histone H4-like [Egretta garzetta]
Length=103

 Score =   155 bits (392),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>ref|XP_003746295.1| PREDICTED: uncharacterized protein LOC100903522 [Metaseiulus 
occidentalis]
Length=253

 Score =   160 bits (404),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 104/129 (81%), Positives = 109/129 (84%), Gaps = 2/129 (2%)
 Frame = +1

Query  1    TSKSKSTCP--IYLSLHQFKTLDFFFLSAKMSgrgkggkglgkggakrhrkVLRDNIQGI  174
            TS +   CP  +Y  LH         +   MSGRGKGGKGLGKGGAKRHRKVLRDNIQGI
Sbjct  121  TSSNDRRCPPGVYKRLHFEAEHSVSVIRGNMSGRGKGGKGLGKGGAKRHRKVLRDNIQGI  180

Query  175  TKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYA  354
            TKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKTVTAMDVVYA
Sbjct  181  TKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYA  240

Query  355  LKRQGRTLY  381
            LKRQGRTLY
Sbjct  241  LKRQGRTLY  249



>ref|XP_009927541.1| PREDICTED: histone H4, partial [Haliaeetus albicilla]
Length=90

 Score =   154 bits (390),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  11   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  70

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  71   VTAMDVVYALKRQGRTLY  88



>ref|XP_002430908.1| histone H4, putative [Pediculus humanus corporis]
 gb|EEB18170.1| histone H4, putative [Pediculus humanus corporis]
Length=115

 Score =   155 bits (393),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>gb|EFB20858.1| hypothetical protein PANDA_018552 [Ailuropoda melanoleuca]
Length=106

 Score =   155 bits (392),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  25   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  84

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  85   VTAMDVVYALKRQGRTLY  102



>ref|XP_003770632.1| PREDICTED: histone H4-like [Sarcophilus harrisii]
Length=149

 Score =   156 bits (395),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  68   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  127

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  128  VTAMDVVYALKRQGRTLY  145



>ref|XP_006810721.1| PREDICTED: histone H4-like, partial [Neolamprologus brichardi]
Length=98

 Score =   155 bits (391),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  18   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  77

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  78   VTAMDVVYALKRQGRTLY  95



>gb|AAS17527.1| histone H4.1 [Bos grunniens]
Length=104

 Score =   155 bits (391),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>gb|KFU99743.1| Histone H4, partial [Tauraco erythrolophus]
Length=94

 Score =   155 bits (391),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  13   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  72

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  73   VTAMDVVYALKRQGRTLY  90



>ref|XP_004043433.1| PREDICTED: histone H4-like [Gorilla gorilla gorilla]
Length=99

 Score =   155 bits (391),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  18   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  77

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  78   VTAMDVVYALKRQGRTLY  95



>ref|XP_006872873.1| PREDICTED: histone H4-like isoform X2 [Chrysochloris asiatica]
Length=125

 Score =   155 bits (393),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  44   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  103

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  104  VTAMDVVYALKRQGRTLY  121



>ref|XP_006648942.1| PREDICTED: histone H4 variant TH011-like [Oryza brachyantha]
Length=176

 Score =   157 bits (398),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 78/78 (100%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT
Sbjct  95   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  154

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  155  VTAMDVVYALKRQGRTLY  172


 Score =   117 bits (293),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 57/58 (98%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARR  321
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHAR+
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARK  79



>ref|XP_010483643.1| PREDICTED: histone H4-like [Camelina sativa]
Length=103

 Score =   155 bits (391),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 77/78 (99%), Positives = 77/78 (99%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHA RKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHASRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>ref|XP_002045915.1| GM13181 [Drosophila sechellia]
 gb|EDW44127.1| GM13181 [Drosophila sechellia]
Length=103

 Score =   155 bits (391),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>gb|AGS78022.1| histone H4, partial [Schmidtea mediterranea]
 gb|KFP95676.1| Histone H4, partial [Haliaeetus albicilla]
Length=93

 Score =   154 bits (390),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  12   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  71

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  72   VTAMDVVYALKRQGRTLY  89



>ref|XP_001865498.1| Histone H4 [Culex quinquefasciatus]
 gb|EDS41770.1| Histone H4 [Culex quinquefasciatus]
Length=104

 Score =   155 bits (391),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>ref|XP_008808353.1| PREDICTED: histone H4-like [Phoenix dactylifera]
Length=156

 Score =   157 bits (396),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 77/78 (99%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHARRKT
Sbjct  75   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHARRKT  134

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  135  VTAMDVVYALKRQGRTLY  152



>ref|XP_001498258.2| PREDICTED: histone H4-like [Equus caballus]
Length=160

 Score =   157 bits (396),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>ref|XP_001997886.1| GH24367 [Drosophila grimshawi]
 gb|EDW04798.1| GH24367 [Drosophila grimshawi]
Length=94

 Score =   154 bits (390),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  13   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  72

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  73   VTAMDVVYALKRQGRTLY  90



>gb|ACG36906.1| histone H4 [Zea mays]
Length=103

 Score =   155 bits (391),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 77/78 (99%), Positives = 77/78 (99%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            V RDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT
Sbjct  22   VSRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>emb|CAA56154.1| histone H4 [Lolium temulentum]
Length=103

 Score =   155 bits (391),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 77/78 (99%), Positives = 77/78 (99%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHA RKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHAXRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>ref|XP_006125956.1| PREDICTED: histone H4-like isoform X1 [Pelodiscus sinensis]
 ref|XP_006125957.1| PREDICTED: histone H4-like isoform X2 [Pelodiscus sinensis]
Length=129

 Score =   155 bits (393),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  48   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  107

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  108  VTAMDVVYALKRQGRTLY  125



>gb|EAW55528.1| histone 1, H4c [Homo sapiens]
Length=129

 Score =   155 bits (393),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  48   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  107

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  108  VTAMDVVYALKRQGRTLY  125



>ref|XP_002422631.1| histone H4, putative [Pediculus humanus corporis]
 gb|EEB09893.1| histone H4, putative [Pediculus humanus corporis]
Length=130

 Score =   155 bits (393),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>gb|EFB21599.1| hypothetical protein PANDA_016906 [Ailuropoda melanoleuca]
Length=113

 Score =   155 bits (392),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  32   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  91

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  92   VTAMDVVYALKRQGRTLY  109



>gb|KFP16829.1| Histone H4, partial [Egretta garzetta]
 gb|KFP16834.1| Histone H4, partial [Egretta garzetta]
 gb|KFP16838.1| Histone H4, partial [Egretta garzetta]
Length=99

 Score =   155 bits (391),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  18   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  77

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  78   VTAMDVVYALKRQGRTLY  95



>ref|XP_011278078.1| PREDICTED: histone H4-like, partial [Felis catus]
Length=92

 Score =   154 bits (390),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  11   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  70

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  71   VTAMDVVYALKRQGRTLY  88



>ref|XP_009892680.1| PREDICTED: histone H4-like [Charadrius vociferus]
Length=110

 Score =   155 bits (392),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>pdb|1P3P|B Chain B, Crystallographic Studies Of Nucleosome Core Particles 
Containing Histone 'sin' Mutants
 pdb|1P3P|F Chain F, Crystallographic Studies Of Nucleosome Core Particles 
Containing Histone 'sin' Mutants
Length=102

 Score =   155 bits (391),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 75/78 (96%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGG+KRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  21   VLRDNIQGITKPAIRRLARRGGIKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  80

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  81   VTAMDVVYALKRQGRTLY  98



>ref|XP_001983122.1| GG21374 [Drosophila erecta]
 gb|EDV45001.1| GG21374, partial [Drosophila erecta]
Length=112

 Score =   155 bits (392),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  31   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  90

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  91   VTAMDVVYALKRQGRTLY  108



>ref|XP_006650981.1| PREDICTED: histone H4 variant TH011-like [Oryza brachyantha]
Length=180

 Score =   157 bits (398),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 78/78 (100%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT
Sbjct  99   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  158

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  159  VTAMDVVYALKRQGRTLY  176


 Score =   125 bits (315),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/63 (98%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  81

Query  328  VTA  336
            VT 
Sbjct  82   VTG  84



>ref|XP_009126676.1| PREDICTED: histone H4 [Brassica rapa]
Length=103

 Score =   155 bits (391),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 77/78 (99%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNI+GITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT
Sbjct  22   VLRDNIRGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>ref|XP_010093859.1| Histone H4 [Morus notabilis]
 gb|EXB54747.1| Histone H4 [Morus notabilis]
Length=103

 Score =   155 bits (391),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 77/78 (99%), Positives = 77/78 (99%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK FLENVIRDAVTYTEHARRKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKSFLENVIRDAVTYTEHARRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>ref|XP_006988975.1| PREDICTED: histone H4-like, partial [Peromyscus maniculatus bairdii]
 ref|XP_009047049.1| hypothetical protein LOTGIDRAFT_148809, partial [Lottia gigantea]
 gb|ESP02264.1| hypothetical protein LOTGIDRAFT_148809, partial [Lottia gigantea]
 gb|KFM02255.1| Histone H4, partial [Aptenodytes forsteri]
Length=89

 Score =   154 bits (390),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  8    VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  67

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  68   VTAMDVVYALKRQGRTLY  85



>ref|XP_008668988.1| PREDICTED: histone H4-like [Zea mays]
 gb|ACG37173.1| histone H4 [Zea mays]
Length=183

 Score =   157 bits (398),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 78/78 (100%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT
Sbjct  102  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  161

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  162  VTAMDVVYALKRQGRTLY  179



>ref|XP_005773457.1| hypothetical protein EMIHUDRAFT_435795 [Emiliania huxleyi CCMP1516]
 gb|EOD21028.1| hypothetical protein EMIHUDRAFT_435795 [Emiliania huxleyi CCMP1516]
Length=176

 Score =   157 bits (397),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 75/78 (96%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKR+SGLIYEETRGVLK+FLENVIRDA+TYTEHARRKT
Sbjct  95   VLRDNIQGITKPAIRRLARRGGVKRMSGLIYEETRGVLKVFLENVIRDAITYTEHARRKT  154

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  155  VTAMDVVYALKRQGRTLY  172



>pdb|1AOI|B Chain B, Complex Between Nucleosome Core Particle (H3,H4,H2a,H2b) 
And 146 Bp Long Dna Fragment
 pdb|1AOI|F Chain F, Complex Between Nucleosome Core Particle (H3,H4,H2a,H2b) 
And 146 Bp Long Dna Fragment
Length=87

 Score =   154 bits (389),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  6    VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  65

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  66   VTAMDVVYALKRQGRTLY  83



>ref|XP_006817031.1| PREDICTED: histone H4-like [Saccoglossus kowalevskii]
Length=103

 Score =   155 bits (391),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 75/78 (96%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENV+RDAVTYTEHA+RKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVVRDAVTYTEHAKRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMD+VYALKRQGRTLY
Sbjct  82   VTAMDIVYALKRQGRTLY  99



>ref|XP_001618258.1| hypothetical protein NEMVEDRAFT_v1g155159 [Nematostella vectensis]
 ref|XP_001618259.1| hypothetical protein NEMVEDRAFT_v1g155165 [Nematostella vectensis]
 ref|XP_001618410.1| hypothetical protein NEMVEDRAFT_v1g225179 [Nematostella vectensis]
 ref|XP_001618627.1| hypothetical protein NEMVEDRAFT_v1g224955 [Nematostella vectensis]
 ref|XP_001618630.1| hypothetical protein NEMVEDRAFT_v1g153967 [Nematostella vectensis]
 ref|XP_001619029.1| hypothetical protein NEMVEDRAFT_v1g176824 [Nematostella vectensis]
 ref|XP_001619101.1| hypothetical protein NEMVEDRAFT_v1g224503 [Nematostella vectensis]
 ref|XP_001619114.1| hypothetical protein NEMVEDRAFT_v1g196014 [Nematostella vectensis]
 ref|XP_001619754.1| hypothetical protein NEMVEDRAFT_v1g231525 [Nematostella vectensis]
 ref|XP_001619865.1| hypothetical protein NEMVEDRAFT_v1g195934 [Nematostella vectensis]
 ref|XP_001622253.1| hypothetical protein NEMVEDRAFT_v1g141889 [Nematostella vectensis]
 ref|XP_001628144.1| predicted protein [Nematostella vectensis]
 ref|XP_001630309.1| predicted protein [Nematostella vectensis]
 ref|XP_001632584.1| predicted protein [Nematostella vectensis]
 ref|XP_001632827.1| predicted protein [Nematostella vectensis]
 ref|XP_001638463.1| predicted protein [Nematostella vectensis]
 ref|XP_001638523.1| predicted protein [Nematostella vectensis]
 ref|XP_001640351.1| predicted protein [Nematostella vectensis]
 ref|XP_001640356.1| predicted protein [Nematostella vectensis]
 ref|XP_001640459.1| predicted protein [Nematostella vectensis]
 ref|XP_001640480.1| predicted protein [Nematostella vectensis]
 ref|XP_001618854.1| hypothetical protein NEMVEDRAFT_v1g153118 [Nematostella vectensis]
 ref|XP_002111561.1| expressed hypothetical protein [Trichoplax adhaerens]
 ref|XP_002111880.1| hypothetical protein TRIADDRAFT_55348 [Trichoplax adhaerens]
 ref|XP_004205459.1| PREDICTED: histone H4-like [Hydra vulgaris]
 ref|XP_002161992.2| PREDICTED: histone H4-like [Hydra vulgaris]
 ref|XP_011409848.1| PREDICTED: histone H4 [Amphimedon queenslandica]
 sp|P35059.2|H4_ACRFO RecName: Full=Histone H4 [Acropora formosa]
 sp|Q6LAF1.3|H4_DENKL RecName: Full=Histone H4 [Dendronephthya klunzingeri]
 gb|AAC37355.1| histone H4 [Acropora formosa]
 gb|AAB28739.1| histone H4 [Acropora formosa]
 emb|CAC80129.1| histone 4 [Dendronephthya klunzingeri]
 gb|EDO26158.1| predicted protein [Nematostella vectensis]
 gb|EDO26159.1| predicted protein [Nematostella vectensis]
 gb|EDO26310.1| predicted protein [Nematostella vectensis]
 gb|EDO26527.1| predicted protein [Nematostella vectensis]
 gb|EDO26530.1| predicted protein [Nematostella vectensis]
 gb|EDO26754.1| predicted protein [Nematostella vectensis]
 gb|EDO26929.1| predicted protein [Nematostella vectensis]
 gb|EDO27001.1| predicted protein [Nematostella vectensis]
 gb|EDO27014.1| predicted protein [Nematostella vectensis]
 gb|EDO27654.1| predicted protein [Nematostella vectensis]
 gb|EDO27765.1| predicted protein [Nematostella vectensis]
 gb|EDO30153.1| predicted protein [Nematostella vectensis]
 gb|EDO36081.1| predicted protein [Nematostella vectensis]
 gb|EDO38246.1| predicted protein [Nematostella vectensis]
 gb|EDO40521.1| predicted protein [Nematostella vectensis]
 gb|EDO40764.1| predicted protein [Nematostella vectensis]
 gb|EDO46400.1| predicted protein [Nematostella vectensis]
 gb|EDO46460.1| predicted protein [Nematostella vectensis]
 gb|EDO48288.1| predicted protein [Nematostella vectensis]
 gb|EDO48293.1| predicted protein [Nematostella vectensis]
 gb|EDO48396.1| predicted protein [Nematostella vectensis]
 gb|EDO48417.1| predicted protein [Nematostella vectensis]
 gb|EDV25528.1| expressed hypothetical protein [Trichoplax adhaerens]
 gb|EDV25847.1| hypothetical protein TRIADDRAFT_55348 [Trichoplax adhaerens]
 prf||1920342D histone H4
Length=103

 Score =   155 bits (391),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 75/78 (96%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            +LRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  22   ILRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>ref|XP_006872940.1| PREDICTED: histone H4-like [Chrysochloris asiatica]
Length=118

 Score =   155 bits (392),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>ref|XP_009590447.1| PREDICTED: uncharacterized protein LOC104087621 [Nicotiana tomentosiformis]
Length=209

 Score =   158 bits (400),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 105/118 (89%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = +1

Query  28   IYLSLHQFKTLDFFFLSAKMSgrgkggkglgkggakrhrkVLRDNIQGITKPAIRRLARR  207
            +Y    Q +TL  F    KMSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARR
Sbjct  88   VYALKRQGRTLYGFGGRLKMSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARR  147

Query  208  GGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLY  381
            GGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLY
Sbjct  148  GGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLY  205


 Score =   156 bits (395),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 78/78 (100%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>gb|AHV84765.1| histone 4, partial [Tecoma stans]
Length=82

 Score =   154 bits (389),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 77/78 (99%), Positives = 77/78 (99%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT
Sbjct  1    VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  60

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQG TLY
Sbjct  61   VTAMDVVYALKRQGSTLY  78



>ref|XP_009017682.1| hypothetical protein HELRODRAFT_172804 [Helobdella robusta]
 gb|ESO04413.1| hypothetical protein HELRODRAFT_172804 [Helobdella robusta]
Length=115

 Score =   155 bits (392),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  82   VTAMDVVYALKRQGRTLY  99



>ref|XP_009638182.1| PREDICTED: histone H4-like [Egretta garzetta]
Length=117

 Score =   155 bits (392),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct  36   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT  95

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  96   VTAMDVVYALKRQGRTLY  113



>gb|ABK23845.1| unknown [Picea sitchensis]
Length=103

 Score =   155 bits (391),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVI+DAVTYTEHARRKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIKDAVTYTEHARRKT  81

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVY+LKRQGRTLY
Sbjct  82   VTAMDVVYSLKRQGRTLY  99



>ref|XP_010841748.1| PREDICTED: uncharacterized protein LOC104991099 [Bison bison 
bison]
Length=332

 Score =   162 bits (409),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 103/123 (84%), Positives = 110/123 (89%), Gaps = 1/123 (1%)
 Frame = +1

Query  13   KSTCPIYLSLHQFKTLDFFFLSAKMSgrgkggkglgkggakrhrkVLRDNIQGITKPAIR  192
            +  C  YL +  F+  + F  +A MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIR
Sbjct  207  QEACEAYL-VGLFEDTNLFIATATMSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIR  265

Query  193  RLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGR  372
            RLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKTVTAMDVVYALKRQGR
Sbjct  266  RLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGR  325

Query  373  TLY  381
            TLY
Sbjct  326  TLY  328


 Score =   147 bits (372),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 72/75 (96%), Positives = 74/75 (99%), Gaps = 0/75 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRG LK+FLENVIRDAVTYTEHA+RKT
Sbjct  22   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGGLKVFLENVIRDAVTYTEHAKRKT  81

Query  328  VTAMDVVYALKRQGR  372
            VTAMDVVYALKRQGR
Sbjct  82   VTAMDVVYALKRQGR  96



>ref|XP_007133251.1| hypothetical protein PHAVU_011G164600g [Phaseolus vulgaris]
 gb|ESW05245.1| hypothetical protein PHAVU_011G164600g [Phaseolus vulgaris]
Length=244

 Score =   159 bits (402),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 78/78 (100%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT
Sbjct  163  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  222

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  223  VTAMDVVYALKRQGRTLY  240



>ref|XP_003542580.2| PREDICTED: histone H4-like [Glycine max]
Length=160

 Score =   156 bits (395),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 78/78 (100%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  148  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  327
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT
Sbjct  79   VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT  138

Query  328  VTAMDVVYALKRQGRTLY  381
            VTAMDVVYALKRQGRTLY
Sbjct  139  VTAMDVVYALKRQGRTLY  156



>ref|XP_003979641.1| PREDICTED: uncharacterized protein LOC101077311 [Takifugu rubripes]
Length=318

 Score =   161 bits (408),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 100/107 (93%), Positives = 103/107 (96%), Gaps = 0/107 (0%)
 Frame = +1

Query  61   DFFFLSAKMSgrgkggkglgkggakrhrkVLRDNIQGITKPAIRRLARRGGVKRISGLIY  240
            D   L A+MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIY
Sbjct  208  DHTRLQARMSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIY  267

Query  241  EETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLY  381
            EETRGVLK+FLENVIRDAVTYTEHA+RKTVTAMDVVYALKRQGRTLY
Sbjct  268  EETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLY  314



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 567734137750