BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002A08

Length=600
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AAK69541.1|AF283476_1  cathepsin B-like cysteine proteinase          359   5e-121   Ipomoea batatas [batate]
gb|AAF04727.1|AF101239_1  cathepsin B-like cysteine proteinase          358   6e-121   Ipomoea batatas [batate]
gb|ABF47216.1|  cathepsin B                                             275   7e-88    Nicotiana benthamiana
ref|XP_007221486.1|  hypothetical protein PRUPE_ppa007538mg             274   1e-87    Prunus persica
ref|XP_009608669.1|  PREDICTED: cathepsin B-like                        274   1e-87    
gb|KDO86710.1|  hypothetical protein CISIN_1g018568mg                   271   2e-87    Citrus sinensis [apfelsine]
ref|XP_009111352.1|  PREDICTED: cathepsin B                             273   2e-87    Brassica rapa
ref|XP_004141146.1|  PREDICTED: cathepsin B-like                        273   2e-87    Cucumis sativus [cucumbers]
ref|XP_004158338.1|  PREDICTED: cathepsin B-like                        273   3e-87    
gb|KJB40275.1|  hypothetical protein B456_007G055400                    272   4e-87    Gossypium raimondii
ref|XP_009787301.1|  PREDICTED: cathepsin B-like                        272   5e-87    Nicotiana sylvestris
ref|XP_008465335.1|  PREDICTED: cathepsin B-like isoform X1             272   5e-87    Cucumis melo [Oriental melon]
gb|KDO86709.1|  hypothetical protein CISIN_1g018568mg                   270   5e-87    Citrus sinensis [apfelsine]
ref|XP_008465336.1|  PREDICTED: cathepsin B-like isoform X2             272   5e-87    Cucumis melo [Oriental melon]
ref|XP_008227748.1|  PREDICTED: cathepsin B                             272   6e-87    Prunus mume [ume]
gb|AAR25797.1|  cathepsin B-like cysteine proteinase                    267   7e-87    Solanum tuberosum [potatoes]
ref|XP_009787300.1|  PREDICTED: cathepsin B-like                        271   8e-87    Nicotiana sylvestris
ref|XP_004233219.1|  PREDICTED: cathepsin B                             271   1e-86    Solanum lycopersicum
dbj|BAG69285.1|  cathepsin B-like cysteine protease                     271   1e-86    Raphanus sativus
ref|XP_006444663.1|  hypothetical protein CICLE_v10020859mg             271   1e-86    Citrus clementina [clementine]
gb|KJB40274.1|  hypothetical protein B456_007G055400                    271   2e-86    Gossypium raimondii
gb|KFK30754.1|  hypothetical protein AALP_AA6G022300                    270   2e-86    Arabis alpina [alpine rockcress]
gb|KDO86712.1|  hypothetical protein CISIN_1g018568mg                   270   2e-86    Citrus sinensis [apfelsine]
gb|EYU46892.1|  hypothetical protein MIMGU_mgv1a008339mg                271   2e-86    Erythranthe guttata [common monkey flower]
emb|CAA57522.1|  cathepsin B-like cysteine proteinase                   270   4e-86    Nicotiana rustica [wild tobacco]
ref|XP_006491433.1|  PREDICTED: cathepsin B-like isoform X1             270   4e-86    Citrus sinensis [apfelsine]
gb|KHG03644.1|  Cathepsin B                                             270   5e-86    Gossypium arboreum [tree cotton]
ref|NP_567215.1|  putative cathepsin B-like cysteine protease           270   5e-86    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011025297.1|  PREDICTED: cathepsin B-like                        269   8e-86    Populus euphratica
ref|XP_004233221.1|  PREDICTED: cathepsin B                             269   9e-86    Solanum lycopersicum
gb|KDO86711.1|  hypothetical protein CISIN_1g018568mg                   269   1e-85    Citrus sinensis [apfelsine]
ref|XP_002301457.2|  putative cathepsin B-like protease family pr...    268   2e-85    
ref|NP_001275088.1|  cathepsin B-like cysteine proteinase precursor     268   2e-85    Solanum tuberosum [potatoes]
emb|CDY58223.1|  BnaA09g52180D                                          268   2e-85    Brassica napus [oilseed rape]
ref|XP_009608670.1|  PREDICTED: cathepsin B-like                        268   2e-85    Nicotiana tomentosiformis
ref|XP_010428573.1|  PREDICTED: cathepsin B-like                        268   3e-85    Camelina sativa [gold-of-pleasure]
emb|CDY07129.1|  BnaCnng01440D                                          268   3e-85    
ref|XP_006396358.1|  hypothetical protein EUTSA_v10028753mg             267   5e-85    Eutrema salsugineum [saltwater cress]
ref|XP_006362602.1|  PREDICTED: cathepsin B-like                        267   5e-85    Solanum tuberosum [potatoes]
ref|XP_011025296.1|  PREDICTED: cathepsin B-like                        266   8e-85    Populus euphratica
ref|XP_002874969.1|  hypothetical protein ARALYDRAFT_490415             266   8e-85    Arabidopsis lyrata subsp. lyrata
ref|XP_010247244.1|  PREDICTED: cathepsin B-like                        266   1e-84    Nelumbo nucifera [Indian lotus]
ref|XP_010456139.1|  PREDICTED: cathepsin B-like                        265   3e-84    Camelina sativa [gold-of-pleasure]
ref|XP_007051347.1|  Cysteine proteinases superfamily protein           265   3e-84    
ref|XP_008343231.1|  PREDICTED: cathepsin B-like                        265   4e-84    Malus domestica [apple tree]
ref|XP_010422703.1|  PREDICTED: cathepsin B-like                        265   5e-84    Camelina sativa [gold-of-pleasure]
ref|XP_010542823.1|  PREDICTED: cathepsin B-like                        265   6e-84    Tarenaya hassleriana [spider flower]
ref|NP_849281.1|  putative cathepsin B-like cysteine protease           264   6e-84    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010103114.1|  Cathepsin B                                        266   9e-84    
gb|KCW88611.1|  hypothetical protein EUGRSUZ_A00982                     260   2e-83    Eucalyptus grandis [rose gum]
ref|XP_009341533.1|  PREDICTED: cathepsin B-like                        263   2e-83    Pyrus x bretschneideri [bai li]
gb|KCW88610.1|  hypothetical protein EUGRSUZ_A00982                     261   2e-83    Eucalyptus grandis [rose gum]
ref|XP_010907756.1|  PREDICTED: cathepsin B-like                        263   3e-83    Elaeis guineensis
gb|KJB41698.1|  hypothetical protein B456_007G115600                    262   3e-83    Gossypium raimondii
ref|XP_003632421.1|  PREDICTED: cathepsin B-like                        261   1e-82    Vitis vinifera
ref|XP_010556663.1|  PREDICTED: cathepsin B-like                        261   1e-82    Tarenaya hassleriana [spider flower]
ref|XP_006418358.1|  hypothetical protein EUTSA_v10008009mg             260   2e-82    Eutrema salsugineum [saltwater cress]
ref|XP_011079459.1|  PREDICTED: cathepsin B                             260   3e-82    Sesamum indicum [beniseed]
ref|XP_006288020.1|  hypothetical protein CARUB_v10001253mg             259   5e-82    
gb|KCW88609.1|  hypothetical protein EUGRSUZ_A00982                     259   5e-82    Eucalyptus grandis [rose gum]
ref|XP_003554589.1|  PREDICTED: cathepsin B-like                        259   8e-82    Glycine max [soybeans]
gb|KDP28374.1|  hypothetical protein JCGZ_14145                         258   1e-81    Jatropha curcas
ref|XP_002320244.2|  putative cathepsin B-like protease family pr...    258   2e-81    
ref|XP_006491435.1|  PREDICTED: cathepsin B-like isoform X3             256   2e-81    
gb|ACU24206.1|  unknown                                                 257   2e-81    Glycine max [soybeans]
ref|XP_006375410.1|  hypothetical protein POPTR_0014s10540g             258   2e-81    Populus trichocarpa [western balsam poplar]
emb|CAB62589.1|  putative cathepsin B-like protease                     252   2e-81    Pisum sativum [garden pea]
ref|XP_003521632.1|  PREDICTED: cathepsin B                             258   3e-81    Glycine max [soybeans]
ref|XP_009393126.1|  PREDICTED: cathepsin B-like                        257   3e-81    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004233222.1|  PREDICTED: cathepsin B-like                        257   4e-81    Solanum lycopersicum
gb|AGV54421.1|  cathepsin B-like protein                                257   4e-81    Phaseolus vulgaris [French bean]
ref|XP_010103115.1|  Cathepsin B                                        256   6e-81    
ref|XP_008776548.1|  PREDICTED: cathepsin B-like isoform X3             256   8e-81    Phoenix dactylifera
ref|XP_003626103.1|  Cathepsin B                                        256   8e-81    
gb|ACJ84734.1|  unknown                                                 256   9e-81    Medicago truncatula
ref|XP_006840260.1|  hypothetical protein AMTR_s00045p00036790          256   1e-80    Amborella trichopoda
ref|XP_004494492.1|  PREDICTED: cathepsin B-like                        256   2e-80    Cicer arietinum [garbanzo]
ref|NP_563648.1|  putative cathepsin B-like cysteine protease           255   3e-80    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008776546.1|  PREDICTED: cathepsin B-like isoform X1             254   5e-80    
ref|XP_008776547.1|  PREDICTED: cathepsin B-like isoform X2             254   5e-80    
ref|XP_007163268.1|  hypothetical protein PHAVU_001G220100g             254   5e-80    Phaseolus vulgaris [French bean]
ref|XP_006362603.1|  PREDICTED: cathepsin B-like                        254   5e-80    Solanum tuberosum [potatoes]
gb|AFK38097.1|  unknown                                                 254   7e-80    Lotus japonicus
ref|XP_009111203.1|  PREDICTED: cathepsin B                             253   1e-79    Brassica rapa
ref|XP_002889395.1|  hypothetical protein ARALYDRAFT_887368             253   1e-79    Arabidopsis lyrata subsp. lyrata
ref|XP_010474644.1|  PREDICTED: cathepsin B-like                        253   1e-79    Camelina sativa [gold-of-pleasure]
ref|XP_010480863.1|  PREDICTED: cathepsin B-like                        253   1e-79    Camelina sativa [gold-of-pleasure]
ref|XP_010457204.1|  PREDICTED: cathepsin B-like                        253   1e-79    Camelina sativa [gold-of-pleasure]
ref|XP_009412165.1|  PREDICTED: cathepsin B-like                        253   2e-79    Musa acuminata subsp. malaccensis [pisang utan]
gb|ACJ85175.1|  unknown                                                 252   4e-79    Medicago truncatula
ref|XP_004288649.1|  PREDICTED: cathepsin B-like                        250   1e-78    Fragaria vesca subsp. vesca
ref|XP_006305170.1|  hypothetical protein CARUB_v10009537mg             251   2e-78    Capsella rubella
gb|KEH24451.1|  cathepsin B-like cysteine protease                      248   2e-78    Medicago truncatula
gb|ACN40436.1|  unknown                                                 249   3e-78    Picea sitchensis
ref|XP_003626102.1|  Cathepsin L-like proteinase                        248   8e-78    
gb|ABK23329.1|  unknown                                                 248   8e-78    Picea sitchensis
gb|ABK21175.1|  unknown                                                 248   9e-78    Picea sitchensis
gb|ABD32839.1|  Peptidase C1A, papain; Somatotropin hormone; Pept...    248   1e-77    Medicago truncatula
gb|KHN43391.1|  Cathepsin B                                             248   2e-77    Glycine soja [wild soybean]
gb|AHL68670.1|  cathepsin B-like cysteine proteinase                    246   8e-77    Picrorhiza kurrooa
ref|XP_006375409.1|  hypothetical protein POPTR_0014s10540g             245   2e-76    
ref|XP_010695986.1|  PREDICTED: cathepsin B-like                        245   2e-76    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002515139.1|  cathepsin B, putative                              246   2e-76    
ref|XP_008651490.1|  PREDICTED: LOC100283781 isoform X1                 243   8e-76    Zea mays [maize]
ref|NP_001150152.1|  LOC100283781 precursor                             243   9e-76    Zea mays [maize]
ref|XP_010045446.1|  PREDICTED: cathepsin B-like                        244   9e-76    
ref|XP_006664962.1|  PREDICTED: cathepsin B-like isoform X1             243   2e-75    Oryza brachyantha
ref|XP_006664995.1|  PREDICTED: cathepsin B-like isoform X1             243   2e-75    Oryza brachyantha
emb|CDY61859.1|  BnaAnng17870D                                          243   2e-75    Brassica napus [oilseed rape]
tpg|DAA62884.1|  TPA: cathepsin B-like cysteine proteinase 3            241   3e-75    
emb|CBI37076.3|  unnamed protein product                                243   4e-75    Vitis vinifera
gb|AAX11351.1|  cathepsin B-like cysteine protease                      241   6e-75    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004969895.1|  PREDICTED: cathepsin B-like isoform X1             237   3e-73    Setaria italica
dbj|BAJ90198.1|  predicted protein                                      236   7e-73    Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CAQ00112.1|  papain-like cysteine proteinase                        236   8e-73    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004978407.1|  PREDICTED: cathepsin B-like isoform X1             234   4e-72    Setaria italica
ref|XP_003560199.1|  PREDICTED: cathepsin B-like                        229   3e-70    Brachypodium distachyon [annual false brome]
ref|XP_003560204.2|  PREDICTED: cathepsin B-like                        229   6e-70    Brachypodium distachyon [annual false brome]
emb|CAA46812.1|  cathepsin B                                            227   7e-70    Triticum aestivum [Canadian hard winter wheat]
gb|AAC24376.1|  cathepsin B-like cysteine proteinase                    227   2e-69    Arabidopsis thaliana [mouse-ear cress]
gb|ACY38050.1|  cathepsin B                                             227   2e-69    Dactylis glomerata [cocksfoot]
emb|CAA46811.1|  cathepsin B                                            227   2e-69    Triticum aestivum [Canadian hard winter wheat]
emb|CAC83720.1|  cathepsin B                                            226   3e-69    Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ90118.1|  predicted protein                                      223   3e-68    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ACN40354.1|  unknown                                                 223   4e-68    Picea sitchensis
emb|CAA46810.1|  cathepsin B                                            222   5e-68    Triticum aestivum [Canadian hard winter wheat]
ref|XP_011039855.1|  PREDICTED: cathepsin B-like                        221   2e-67    Populus euphratica
dbj|BAG90919.1|  unnamed protein product                                222   8e-67    Oryza sativa Japonica Group [Japonica rice]
ref|NP_563647.1|  putative cathepsin B-like cysteine protease           219   5e-66    Arabidopsis thaliana [mouse-ear cress]
dbj|BAH20325.1|  AT1G02305                                              211   6e-64    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002301456.1|  putative cathepsin B-like protease family pr...    210   4e-63    
gb|EMT07038.1|  Cathepsin B                                             211   9e-63    
ref|XP_002993195.1|  hypothetical protein SELMODRAFT_270024             209   2e-62    Selaginella moellendorffii
ref|XP_001762922.1|  predicted protein                                  208   3e-62    
ref|XP_002889394.1|  hypothetical protein ARALYDRAFT_887367             207   9e-62    Arabidopsis lyrata subsp. lyrata
ref|XP_002965469.1|  hypothetical protein SELMODRAFT_143272             206   1e-61    
ref|XP_001765840.1|  predicted protein                                  204   1e-60    
emb|CAB62588.1|  putative cathepsin B-like protease                     195   2e-59    Pisum sativum [garden pea]
emb|CDX85150.1|  BnaC07g07560D                                          196   1e-57    
ref|XP_001753172.1|  predicted protein                                  195   3e-57    
gb|EPS69258.1|  hypothetical protein M569_05509                         192   3e-56    Genlisea aurea
gb|EMS60125.1|  Cathepsin B                                             188   1e-54    Triticum urartu
ref|XP_004494938.1|  PREDICTED: cathepsin B-like                        190   3e-54    
emb|CAO02548.1|  putative cathepsin B-like cysteine protease,puta...    181   1e-53    Vigna unguiculata
emb|CDY64824.1|  BnaCnng45130D                                          180   2e-53    Brassica napus [oilseed rape]
gb|AAM00234.1|AF359422_1  cathepsin B-like cysteine proteinase          176   1e-52    Nicotiana tabacum [American tobacco]
emb|CAO02547.1|  putative cathepsin B-like cysteine protease            179   1e-52    Vigna unguiculata
ref|XP_007163269.1|  hypothetical protein PHAVU_001G220100g             169   2e-47    Phaseolus vulgaris [French bean]
gb|KHG09617.1|  Cathepsin B                                             168   5e-47    Gossypium arboreum [tree cotton]
emb|CAX83033.1|  Cysteine PRotease related protein                      149   2e-40    Schistosoma japonicum
gb|AAW27205.1|  unknown                                                 149   2e-40    Schistosoma japonicum
gb|AAW27462.1|  unknown                                                 149   3e-40    Schistosoma japonicum
sp|P43157.1|CYSP_SCHJA  RecName: Full=Cathepsin B-like cysteine p...    149   2e-39    Schistosoma japonicum
gb|AAW26391.1|  unknown                                                 148   2e-39    Schistosoma japonicum
gb|KDO86713.1|  hypothetical protein CISIN_1g018568mg                   146   3e-39    Citrus sinensis [apfelsine]
emb|CDP07747.1|  unnamed protein product                                145   4e-39    Coffea canephora [robusta coffee]
emb|CDY64994.1|  BnaC04g02450D                                          145   5e-39    Brassica napus [oilseed rape]
gb|AAW24925.1|  unknown                                                 147   7e-39    Schistosoma japonicum
ref|XP_010382894.1|  PREDICTED: cathepsin B                             146   1e-38    Rhinopithecus roxellana
dbj|BAE87131.1|  unnamed protein product                                144   3e-38    Macaca fascicularis [crab eating macaque]
ref|XP_003479431.1|  PREDICTED: cathepsin B                             145   4e-38    Cavia porcellus [guinea pig]
ref|XP_007959824.1|  PREDICTED: cathepsin B                             145   5e-38    Chlorocebus sabaeus
ref|NP_001181828.1|  cathepsin B precursor                              145   5e-38    Macaca mulatta [rhesus macaque]
ref|XP_003902454.1|  PREDICTED: cathepsin B                             144   6e-38    Papio anubis [baboon]
ref|NP_001270414.1|  cathepsin B precursor                              144   7e-38    Macaca fascicularis [crab eating macaque]
gb|EHH28274.1|  Cathepsin B                                             144   7e-38    Macaca mulatta [rhesus macaque]
ref|NP_001174338.1|  Os05g0310500                                       140   2e-37    
pdb|1PBH|A  Chain A, Crystal Structure Of Human Recombinant Proca...    142   4e-37    Homo sapiens [man]
ref|XP_004630768.1|  PREDICTED: cathepsin B                             142   4e-37    Octodon degus
ref|XP_008968041.1|  PREDICTED: cathepsin B                             142   4e-37    Pan paniscus [bonobo]
ref|XP_003317964.1|  PREDICTED: cathepsin B                             142   5e-37    
ref|NP_001126573.1|  cathepsin B precursor                              142   6e-37    Pongo abelii [orang utan]
ref|XP_004046705.1|  PREDICTED: cathepsin B isoform 1                   142   6e-37    
dbj|BAF82928.1|  unnamed protein product                                142   7e-37    Homo sapiens [man]
ref|NP_001899.1|  cathepsin B preproprotein                             142   8e-37    Homo sapiens [man]
ref|NP_001232104.1|  putative cathepsin B variant 2 precursor           139   9e-37    Taeniopygia guttata
emb|CAD44624.1|  cathepsin B1 isotype 1                                 141   1e-36    Schistosoma mansoni
gb|ACH45720.1|  putative cathepsin B variant 2                          138   1e-36    Taeniopygia guttata
ref|XP_002756833.2|  PREDICTED: cathepsin B                             141   1e-36    Callithrix jacchus [common marmoset]
ref|XP_005373887.1|  PREDICTED: cathepsin B                             141   2e-36    Chinchilla lanigera
gb|AAA52129.1|  preprocathepsin B                                       140   2e-36    Homo sapiens [man]
gb|KFP80814.1|  Cathepsin B                                             139   2e-36    Apaloderma vittatum
ref|XP_009863384.1|  PREDICTED: cathepsin B                             139   2e-36    Apaloderma vittatum
ref|XP_010620915.1|  PREDICTED: cathepsin B                             140   2e-36    Fukomys damarensis [Damara mole rat]
ref|XP_004877226.1|  PREDICTED: cathepsin B                             140   3e-36    
ref|XP_010993449.1|  PREDICTED: cathepsin B                             140   3e-36    Camelus dromedarius [camel]
ref|XP_010971493.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin B        140   3e-36    Camelus bactrianus [camel]
ref|XP_006189621.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin B        140   3e-36    Camelus ferus
sp|P25792.1|CYSP_SCHMA  RecName: Full=Cathepsin B-like cysteine p...    140   4e-36    Schistosoma mansoni
emb|CAD44625.1|  cathepsin B1 isotype 2                                 140   4e-36    Schistosoma mansoni
emb|CCD74607.1|  cathepsin B-like peptidase (C01 family)                139   5e-36    Schistosoma mansoni
ref|XP_003757972.1|  PREDICTED: cathepsin B                             139   6e-36    Sarcophilus harrisii
gb|EYB87045.1|  hypothetical protein Y032_0269g828                      140   6e-36    Ancylostoma ceylanicum
ref|XP_006219920.1|  PREDICTED: cathepsin B-like cysteine protein...    139   6e-36    Vicugna pacos
ref|XP_010330375.1|  PREDICTED: cathepsin B                             139   7e-36    Saimiri boliviensis boliviensis
ref|XP_006906367.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin B        139   7e-36    
gb|KFZ58860.1|  Cathepsin B                                             135   7e-36    Podiceps cristatus
gb|ELK17542.1|  Cathepsin B                                             139   7e-36    Pteropus alecto
ref|XP_003412496.1|  PREDICTED: cathepsin B                             139   8e-36    Loxodonta africana [African bush elephant]
emb|CDP07745.1|  unnamed protein product                                137   8e-36    Coffea canephora [robusta coffee]
gb|AAH10240.1|  Cathepsin B                                             139   8e-36    Homo sapiens [man]
gb|AAP36125.1|  Homo sapiens cathepsin B                                139   9e-36    synthetic construct
gb|EMT13478.1|  Cathepsin B                                             139   9e-36    
ref|XP_005495471.1|  PREDICTED: cathepsin B isoform X1                  139   1e-35    Zonotrichia albicollis
ref|XP_005044491.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin B        139   1e-35    
gb|ACG50796.1|  cathepsin B1                                            139   1e-35    Trichobilharzia szidati
ref|XP_010409681.1|  PREDICTED: cathepsin B                             139   1e-35    Corvus cornix cornix
pdb|4I04|A  Chain A, Structure Of Zymogen Of Cathepsin B1 From Sc...    138   1e-35    Schistosoma mansoni
ref|XP_008629247.1|  PREDICTED: cathepsin B                             139   1e-35    Corvus brachyrhynchos
ref|XP_004449108.1|  PREDICTED: cathepsin B                             139   1e-35    Dasypus novemcinctus
ref|XP_009094371.1|  PREDICTED: cathepsin B                             139   1e-35    Serinus canaria [canary]
gb|EDL85315.1|  rCG52258, isoform CRA_b                                 135   1e-35    Rattus norvegicus [brown rat]
ref|XP_005425007.1|  PREDICTED: cathepsin B                             139   1e-35    Geospiza fortis
ref|NP_001080410.1|  uncharacterized protein LOC380102 precursor        138   1e-35    Xenopus laevis [clawed frog]
ref|XP_008490612.1|  PREDICTED: cathepsin B                             138   1e-35    Calypte anna
gb|AAV65883.1|  cathepsin B1 isotype 3 precursor                        138   2e-35    Trichobilharzia regenti [bird nasal schistosome]
gb|AAV65884.1|  cathepsin B1 isotype 4 precursor                        138   2e-35    Trichobilharzia regenti [bird nasal schistosome]
ref|XP_006993062.1|  PREDICTED: cathepsin B                             138   2e-35    Peromyscus maniculatus bairdii
ref|XP_005146463.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin B        138   2e-35    Melopsittacus undulatus
gb|AAV65881.1|  cathepsin B1 isotype 1 precursor                        138   2e-35    Trichobilharzia regenti [bird nasal schistosome]
gb|AAX36379.1|  cathepsin B                                             138   2e-35    synthetic construct
gb|KGB41272.1|  Cathepsin B-like cysteine proteinase                    138   2e-35    Schistosoma haematobium
ref|XP_005528842.1|  PREDICTED: cathepsin B                             138   2e-35    
emb|CDJ95148.1|  Peptidase C1A domain containing protein                136   2e-35    Haemonchus contortus [red stomach worm]
gb|AAV65882.1|  cathepsin B1 isotype 2 precursor                        137   2e-35    Trichobilharzia regenti [bird nasal schistosome]
ref|XP_005355595.1|  PREDICTED: cathepsin B                             137   3e-35    Microtus ochrogaster [prairie voles]
ref|XP_008943972.1|  PREDICTED: cathepsin B                             137   3e-35    Merops nubicus
ref|XP_010021694.1|  PREDICTED: cathepsin B                             137   3e-35    Nestor notabilis
gb|KFV51489.1|  Cathepsin B                                             135   3e-35    Gavia stellata
ref|XP_009078810.1|  PREDICTED: cathepsin B                             137   3e-35    Acanthisitta chloris
ref|NP_989225.1|  cathepsin B precursor                                 137   3e-35    Xenopus tropicalis [western clawed frog]
gb|KFW64114.1|  Cathepsin B                                             137   3e-35    Pygoscelis adeliae
ref|XP_009318029.1|  PREDICTED: cathepsin B                             137   3e-35    Pygoscelis adeliae
ref|XP_009807350.1|  PREDICTED: cathepsin B                             135   3e-35    Gavia stellata
gb|KFP55740.1|  Cathepsin B                                             133   3e-35    Cariama cristata
gb|KFP86330.1|  Cathepsin B                                             137   3e-35    Acanthisitta chloris
ref|XP_005859690.1|  PREDICTED: cathepsin B                             137   4e-35    Myotis brandtii
ref|XP_009706626.1|  PREDICTED: cathepsin B-like                        133   4e-35    Cariama cristata
ref|XP_010305166.1|  PREDICTED: cathepsin B                             137   4e-35    Balearica regulorum gibbericeps
gb|KHJ75862.1|  papain family cysteine protease                         137   4e-35    Oesophagostomum dentatum [nodule worm]
ref|XP_004382268.1|  PREDICTED: cathepsin B                             137   4e-35    Trichechus manatus latirostris
gb|EMS65947.1|  Cathepsin B                                             136   4e-35    Triticum urartu
emb|CAX70257.1|  Cathepsin B-like cysteine proteinase precursor         137   5e-35    Schistosoma japonicum
gb|KFQ68035.1|  Cathepsin B                                             135   6e-35    Phaethon lepturus
ref|XP_010146010.1|  PREDICTED: cathepsin B                             137   6e-35    Eurypyga helias
ref|XP_008148990.1|  PREDICTED: cathepsin B                             137   6e-35    Eptesicus fuscus
emb|CAX71578.1|  Cathepsin B-like cysteine proteinase precursor         137   6e-35    Schistosoma japonicum
emb|CAX71574.1|  Cathepsin B-like cysteine proteinase precursor         137   6e-35    Schistosoma japonicum
emb|CAX71570.1|  Cathepsin B-like cysteine proteinase precursor         137   6e-35    Schistosoma japonicum
gb|AAW27375.1|  unknown                                                 134   6e-35    Schistosoma japonicum
ref|XP_006774850.1|  PREDICTED: cathepsin B                             136   7e-35    Myotis davidii
emb|CAX71572.1|  Cathepsin B-like cysteine proteinase precursor         136   7e-35    Schistosoma japonicum
emb|CAX71573.1|  Cathepsin B-like cysteine proteinase precursor         136   7e-35    Schistosoma japonicum
ref|XP_010289383.1|  PREDICTED: cathepsin B                             135   7e-35    Phaethon lepturus
ref|XP_005236722.1|  PREDICTED: cathepsin B isoform X2                  136   8e-35    
ref|XP_009498859.1|  PREDICTED: cathepsin B                             136   8e-35    Phalacrocorax carbo [common cormorant]
ref|XP_009287226.1|  PREDICTED: cathepsin B                             136   8e-35    Aptenodytes forsteri
sp|P00787.2|CATB_RAT  RecName: Full=Cathepsin B; AltName: Full=Ca...    136   9e-35    Rattus norvegicus [brown rat]
gb|KFM13982.1|  Cathepsin B                                             136   9e-35    Aptenodytes forsteri
emb|CCC48215.1|  cysteine peptidase C (CPC)                             136   9e-35    Trypanosoma vivax Y486
ref|XP_009560855.1|  PREDICTED: cathepsin B isoform X2                  136   9e-35    Cuculus canorus
ref|XP_009957017.1|  PREDICTED: cathepsin B                             136   9e-35    Leptosomus discolor
ref|XP_010072079.1|  PREDICTED: cathepsin B                             136   1e-34    Pterocles gutturalis
ref|XP_009986798.1|  PREDICTED: cathepsin B                             136   1e-34    Tauraco erythrolophus
ref|XP_009924144.1|  PREDICTED: cathepsin B isoform X2                  136   1e-34    Haliaeetus albicilla
emb|CAX71577.1|  Cathepsin B-like cysteine proteinase precursor         136   1e-34    Schistosoma japonicum
ref|XP_010581426.1|  PREDICTED: cathepsin B isoform X2                  136   1e-34    Haliaeetus leucocephalus
ref|XP_006033868.1|  PREDICTED: cathepsin B isoform X1                  136   1e-34    Alligator sinensis
ref|XP_009560854.1|  PREDICTED: cathepsin B isoform X1                  136   1e-34    Cuculus canorus
ref|XP_008917711.1|  PREDICTED: cathepsin B                             135   1e-34    Manacus vitellinus
ref|XP_006263356.1|  PREDICTED: cathepsin B                             135   1e-34    Alligator mississippiensis
ref|XP_005236721.1|  PREDICTED: cathepsin B isoform X1                  136   1e-34    
emb|CAX70255.1|  Cathepsin B-like cysteine proteinase precursor         135   1e-34    Schistosoma japonicum
ref|XP_009906051.1|  PREDICTED: cathepsin B                             135   1e-34    Picoides pubescens
emb|CAX70256.1|  Cathepsin B-like cysteine proteinase precursor         135   1e-34    Schistosoma japonicum
gb|KFZ57397.1|  Cathepsin B                                             135   1e-34    Antrostomus carolinensis
pir||S31909  cathepsin B-like cysteine proteinase (EC 3.4.22.-) -...    135   1e-34 
gb|AAW24616.1|  unknown                                                 135   1e-34    Schistosoma japonicum
ref|XP_009465635.1|  PREDICTED: cathepsin B                             135   2e-34    Nipponia nippon
emb|CAX71565.1|  Cathepsin B-like cysteine proteinase precursor         135   2e-34    
gb|KGL95686.1|  Cathepsin B                                             135   2e-34    
gb|AAW25905.1|  unknown                                                 135   2e-34    
emb|CAX71563.1|  Cathepsin B-like cysteine proteinase precursor         135   2e-34    
ref|XP_010165412.1|  PREDICTED: cathepsin B                             135   2e-34    
ref|NP_072119.2|  cathepsin B preproprotein                             135   2e-34    
gb|AAW26625.1|  unknown                                                 135   2e-34    
ref|XP_004707704.1|  PREDICTED: cathepsin B                             135   2e-34    
ref|XP_010119922.1|  PREDICTED: cathepsin B isoform X2                  135   2e-34    
ref|NP_001079570.1|  cathepsin B precursor                              135   2e-34    
ref|XP_009886240.1|  PREDICTED: cathepsin B                             135   2e-34    
ref|XP_010581423.1|  PREDICTED: cathepsin B isoform X1                  136   2e-34    
ref|XP_009924142.1|  PREDICTED: cathepsin B isoform X1                  136   2e-34    
emb|CAX71566.1|  Cathepsin B-like cysteine proteinase precursor         135   2e-34    
emb|CAX71576.1|  Cathepsin B-like cysteine proteinase precursor         135   2e-34    
ref|XP_005513696.1|  PREDICTED: cathepsin B                             135   2e-34    
ref|XP_006203342.1|  PREDICTED: cathepsin B                             135   2e-34    
ref|XP_009638213.1|  PREDICTED: cathepsin B                             135   2e-34    
emb|CAX71575.1|  Cathepsin B-like cysteine proteinase precursor         135   2e-34    
gb|AIS22047.1|  cathepsin B4                                            135   2e-34    
ref|XP_010706477.1|  PREDICTED: cathepsin B isoform X2                  135   2e-34    
ref|XP_010119921.1|  PREDICTED: cathepsin B isoform X1                  135   2e-34    
ref|XP_010000498.1|  PREDICTED: cathepsin B                             135   2e-34    
gb|AAW26378.1|  unknown                                                 135   2e-34    
gb|KFP54498.1|  Cathepsin B                                             135   3e-34    
ref|XP_009579008.1|  PREDICTED: cathepsin B                             135   3e-34    
ref|XP_010200274.1|  PREDICTED: cathepsin B                             135   3e-34    
gb|AAW26973.1|  unknown                                                 135   3e-34    
ref|XP_009964801.1|  PREDICTED: cathepsin B                             135   3e-34    
gb|AAW27884.1|  unknown                                                 135   3e-34    
gb|AAX31052.2|  SJCHGC09761 protein                                     135   3e-34    
gb|KIH52740.1|  papain family cysteine protease                         134   3e-34    
gb|AAW26410.1|  unknown                                                 135   3e-34    
ref|XP_543203.3|  PREDICTED: cathepsin B                                134   3e-34    
ref|XP_010706475.1|  PREDICTED: cathepsin B isoform X1                  135   3e-34    
ref|XP_009026914.1|  hypothetical protein HELRODRAFT_186015             134   4e-34    
gb|AAN76202.1|  lysosomal cysteine proteinase cathepsin B/green f...    137   4e-34    
gb|KGB41271.1|  Cathepsin B-like cysteine proteinase                    134   4e-34    
ref|XP_004004501.1|  PREDICTED: cathepsin B                             134   5e-34    
gb|AFC90100.1|  cathepsin B                                             134   5e-34    
ref|NP_990702.2|  cathepsin B precursor                                 134   5e-34    
gb|AAO73003.1|  cathepsin B                                             134   5e-34    
ref|XP_005683582.1|  PREDICTED: cathepsin B                             134   5e-34    
emb|CAX71567.1|  Cathepsin B-like cysteine proteinase precursor         134   6e-34    
ref|XP_005075331.1|  PREDICTED: cathepsin B                             134   6e-34    
gb|AAO73002.1|  cathepsin B                                             134   6e-34    
ref|XP_008116128.1|  PREDICTED: cathepsin B                             134   7e-34    
prf||1701299A  cathepsin B                                              134   7e-34 
ref|XP_010186210.1|  PREDICTED: cathepsin B                             134   8e-34    
gb|EYC36434.1|  hypothetical protein Y032_0897g2931                     135   8e-34    
emb|CAX71568.1|  Cathepsin B-like cysteine proteinase precursor         134   8e-34    
ref|XP_006884954.1|  PREDICTED: cathepsin B                             134   9e-34    
emb|CAX71564.1|  Cathepsin B-like cysteine proteinase precursor         134   9e-34    
ref|XP_009486904.1|  PREDICTED: cathepsin B                             133   9e-34    
gb|AAW26235.1|  unknown                                                 134   9e-34    
gb|AAW27572.1|  unknown                                                 133   9e-34    
ref|XP_010211001.1|  PREDICTED: cathepsin B                             133   1e-33    
gb|EDL36071.1|  cathepsin B, isoform CRA_b                              131   1e-33    
gb|AAV65886.1|  cathepsin B1 isotype 6 precursor                        133   1e-33    
dbj|BAH04068.1|  cathepsin B                                            129   1e-33    
gb|AAW25437.1|  unknown                                                 133   1e-33    
gb|AAW26363.1|  unknown                                                 133   1e-33    
gb|AAV65885.1|  cathepsin B1 isotype 5 precursor                        133   1e-33    
gb|ABM47070.1|  cathepsin B1                                            133   1e-33    
ref|XP_007507881.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin B        133   1e-33    
ref|XP_002120307.3|  PREDICTED: cathepsin B                             133   1e-33    
gb|AAR19103.1|  cathepsin B                                             133   2e-33    
gb|EOA95210.1|  Cathepsin B                                             133   2e-33    
gb|AAW26790.1|  unknown                                                 129   2e-33    
ref|XP_011357748.1|  PREDICTED: cathepsin B                             132   2e-33    
emb|CCD13852.1|  unnamed protein product                                132   2e-33    
gb|AAA37494.1|  mouse preprocathepsin B                                 132   2e-33    
pdb|1MIR|A  Chain A, Rat Procathepsin B                                 132   2e-33    
gb|ABY78826.1|  cathepsin B-like protease                               132   2e-33    
gb|AAI02998.1|  CTSB protein                                            132   2e-33    
dbj|BAE42140.1|  unnamed protein product                                132   2e-33    
dbj|BAE35542.1|  unnamed protein product                                132   2e-33    
ref|NP_031824.1|  cathepsin B preproprotein                             132   2e-33    
ref|XP_006864486.1|  PREDICTED: cathepsin B                             132   2e-33    
gb|ERE90223.1|  cathepsin B-like protein                                131   2e-33    
gb|ABF85679.1|  cathepsin B2                                            131   2e-33    
ref|XP_004328594.1|  PREDICTED: cathepsin B-like                        132   3e-33    
ref|XP_005104799.1|  PREDICTED: cathepsin B-like                        130   3e-33    
ref|XP_005028294.1|  PREDICTED: cathepsin B isoform X4                  133   3e-33    
ref|XP_007097201.1|  PREDICTED: cathepsin B                             132   3e-33    
emb|CAH04630.1|  cathepsin B                                            132   3e-33    
ref|XP_001435272.1|  hypothetical protein                               132   3e-33    
ref|XP_004364814.1|  cathepsin B                                        131   4e-33    
ref|XP_004278740.1|  PREDICTED: cathepsin B                             132   4e-33    
gb|ABS57370.1|  cathepsin B2                                            132   4e-33    
ref|XP_005028295.1|  PREDICTED: cathepsin B isoform X5                  132   4e-33    
ref|XP_002923704.1|  PREDICTED: cathepsin B isoform X1                  132   4e-33    
ref|XP_007471179.1|  PREDICTED: cathepsin B                             131   4e-33    
gb|AAS49538.1|  cathepsin B                                             129   4e-33    
ref|XP_004433563.1|  PREDICTED: cathepsin B isoform 1                   131   5e-33    
ref|XP_003984894.1|  PREDICTED: cathepsin B                             131   5e-33    
ref|XP_009665207.1|  PREDICTED: cathepsin B                             132   5e-33    
ref|XP_005028293.1|  PREDICTED: cathepsin B isoform X3                  132   6e-33    
ref|XP_007655112.1|  PREDICTED: cathepsin B                             129   6e-33    
gb|KFV76997.1|  Cathepsin B                                             131   6e-33    
ref|XP_007517286.1|  PREDICTED: cathepsin B                             131   6e-33    
ref|XP_005028292.1|  PREDICTED: cathepsin B isoform X2                  132   6e-33    
gb|AJF94889.1|  C1 family cathepsin B17                                 131   6e-33    
gb|ELT94358.1|  hypothetical protein CAPTEDRAFT_221292                  132   7e-33    
ref|XP_003498026.1|  PREDICTED: cathepsin B                             131   7e-33    
ref|XP_005028291.1|  PREDICTED: cathepsin B isoform X1                  132   8e-33    
gb|EPY28844.1|  CPC cysteine peptidase, Clan CA, family C1, Cathe...    130   9e-33    
gb|EPY42505.1|  cysteine peptidase C                                    130   9e-33    
ref|XP_009164805.1|  hypothetical protein T265_02327                    130   1e-32    
ref|XP_001498242.1|  PREDICTED: cathepsin B isoform X1                  130   1e-32    
ref|XP_007936893.1|  PREDICTED: cathepsin B                             130   1e-32    
emb|CBY09988.1|  unnamed protein product                                130   1e-32    
gb|AAW27498.1|  unknown                                                 130   1e-32    
ref|XP_007192740.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin B        130   2e-32    
ref|XP_004614813.1|  PREDICTED: cathepsin B                             130   2e-32    
ref|XP_974220.1|  PREDICTED: cathepsin B                                130   2e-32    
gb|AAP05883.1|  similar to GenBank Accession Number X70968 cathep...    129   2e-32    
gb|AGL33709.1|  cathepsin B                                             130   2e-32    
gb|AFM37365.1|  cathepsin B2                                            130   2e-32    
ref|XP_011206268.1|  PREDICTED: cathepsin B                             129   3e-32    
gb|ADQ57304.1|  cathepsin B-like cysteine protease 2                    129   3e-32    
ref|XP_007068990.1|  PREDICTED: cathepsin B                             129   3e-32    
gb|AJA74413.1|  cysteine protease                                       130   3e-32    
ref|NP_001281168.1|  cathepsin B-like precursor                         129   3e-32    
ref|XP_005290733.1|  PREDICTED: cathepsin B                             129   3e-32    
gb|ACG50797.1|  cathepsin B2                                            129   3e-32    
sp|P43233.1|CATB_CHICK  RecName: Full=Cathepsin B; AltName: Full=...    129   4e-32    
gb|AAW24674.1|  unknown                                                 129   4e-32    
gb|ACO10136.1|  Cathepsin B precursor                                   129   4e-32    
ref|XP_004395307.1|  PREDICTED: cathepsin B                             129   4e-32    
gb|AAR10056.1|  similar to Drosophila melanogaster CG10992              125   5e-32    
ref|NP_001090927.1|  cathepsin B precursor                              129   5e-32    
ref|XP_007429057.1|  PREDICTED: cathepsin B isoform X1                  129   5e-32    
gb|KHJ93493.1|  papain family cysteine protease                         129   6e-32    
pdb|3AI8|B  Chain B, Cathepsin B In Complex With The Nitroxoline        127   6e-32    
ref|XP_004993760.1|  cathepsin B                                        128   7e-32    
gb|AAW26807.1|  unknown                                                 128   7e-32    
ref|XP_005101994.1|  PREDICTED: cathepsin B-like                        128   8e-32    
gb|AAC72873.1|  contains similarity to cysteine proteases (Pfam: ...    123   9e-32    
ref|XP_005657322.1|  PREDICTED: cathepsin B isoform X1                  129   9e-32    
gb|ACO11618.1|  Cathepsin B precursor                                   128   1e-31    
ref|XP_004622621.1|  PREDICTED: cathepsin B-like                        127   1e-31    
emb|CAE47498.1|  cathepsin B-like proteinase                            128   1e-31    
gb|EGT43070.1|  hypothetical protein CAEBREN_13756                      129   1e-31    
gb|AAW25005.1|  SJCHGC02852 protein                                     128   1e-31    
gb|EYB99721.1|  hypothetical protein Y032_0120g904                      128   1e-31    
gb|ACB59245.1|  cathepsin B                                             127   1e-31    
pdb|1GMY|A  Chain A, Cathepsin B Complexed With Dipeptidyl Nitril...    126   1e-31    
gb|AAW24605.1|  unknown                                                 127   1e-31    
ref|XP_002042729.1|  GM17589                                            127   1e-31    
pdb|3K9M|A  Chain A, Cathepsin B In Complex With Stefin A               125   2e-31    
ref|XP_002106884.1|  GD15875                                            127   2e-31    
gb|AEF32260.1|  cathepsin B                                             127   2e-31    
gb|ABC88766.1|  putative cathepsin B-like like proteinase               126   2e-31    
ref|XP_006729441.1|  PREDICTED: cathepsin B                             127   2e-31    
gb|AAX26576.1|  unknown                                                 123   3e-31    
emb|CDJ98210.1|  Peptidase C1A domain containing protein                128   3e-31    
ref|XP_006642995.1|  PREDICTED: cathepsin B-like                        126   4e-31    
gb|ADI80349.1|  cathepsin B                                             126   4e-31    
gb|AAS49537.1|  cathepsin B                                             124   4e-31    
ref|XP_002636643.1|  Hypothetical protein CBG23351                      127   4e-31    
ref|XP_002023566.1|  GL19846                                            126   4e-31    
ref|XP_974298.1|  PREDICTED: cathepsin B                                126   4e-31    
ref|XP_004766141.1|  PREDICTED: cathepsin B isoform X2                  126   4e-31    
ref|XP_004766140.1|  PREDICTED: cathepsin B isoform X1                  126   4e-31    
ref|XP_006082080.1|  PREDICTED: cathepsin B                             124   4e-31    
emb|CDP07746.1|  unnamed protein product                                121   5e-31    
ref|NP_506011.2|  Protein F57F5.1                                       126   5e-31    
gb|KGB39581.1|  Cathepsin B-like cysteine proteinase                    126   5e-31    
gb|AAW26240.1|  unknown                                                 121   7e-31    
gb|KFM56515.1|  hypothetical protein X975_02319                         125   7e-31    
ref|XP_005107685.1|  PREDICTED: cathepsin B-like                        125   7e-31    
gb|AHA83423.1|  cathepsin B                                             125   7e-31    
emb|CDQ56793.1|  unnamed protein product                                125   8e-31    
ref|XP_004027690.1|  hypothetical protein IMG5_177790                   125   8e-31    
pdb|3CBJ|A  Chain A, Chagasin-cathepsin B Complex                       124   8e-31    
ref|NP_001117776.1|  procathepsin B precursor                           125   9e-31    
ref|XP_001354605.1|  GA10694                                            125   9e-31    
ref|XP_008396054.1|  PREDICTED: cathepsin B                             125   9e-31    
ref|NP_572920.1|  cathepsin B1, isoform A                               125   9e-31    
gb|ACM09189.1|  Cathepsin B precursor                                   122   1e-30    
pdb|1CPJ|A  Chain A, Crystal Structures Of Recombinant Rat Cathep...    124   1e-30    
ref|XP_003118162.1|  CRE-CPR-6 protein                                  125   1e-30    
emb|CDS27962.1|  cathepsin b                                            128   1e-30    
emb|CAD32937.1|  pro-cathepsin B2                                       125   1e-30    
dbj|BAJ83491.1|  cathepsin B-like peptidase                             125   1e-30    
gb|ACM08561.1|  Cathepsin B precursor                                   122   1e-30    
gb|KIH46857.1|  papain family cysteine protease                         125   1e-30    
emb|CAC85211.2|  cathepsin B endopeptidase                              125   2e-30    
emb|CAX71090.1|  cathepsin B                                            124   2e-30    
gb|AAA40993.1|  cathepsin (EC 3.4.22.1)                                 123   2e-30    
ref|XP_003388842.1|  PREDICTED: cathepsin B-like                        124   2e-30    
ref|XP_008290519.1|  PREDICTED: cathepsin B-like                        124   2e-30    
ref|XP_001015806.1|  Papain family cysteine protease containing p...    124   2e-30    
gb|ABJ80691.1|  cathepsin B                                             124   2e-30    
gb|AJF94890.1|  C1 family cathepsin B18                                 124   2e-30    
gb|AJF94901.1|  C1 family cathepsin B33                                 124   2e-30    
ref|XP_005100061.1|  PREDICTED: cathepsin B-like                        124   2e-30    
gb|AFM37364.1|  cathepsin B1                                            124   2e-30    
dbj|BAN21476.1|  cathepsin B                                            122   2e-30    
gb|ACO82382.1|  cathepsin B                                             124   2e-30    
ref|XP_009313219.1|  cysteine peptidase C (CPC)                         124   2e-30    
ref|XP_006008975.1|  PREDICTED: cathepsin B                             124   2e-30    
gb|AFM82475.1|  cathepsin B                                             124   3e-30    
ref|XP_002114497.1|  expressed hypothetical protein                     124   3e-30    
emb|CAX76409.1|  cathepsin B                                            124   3e-30    
gb|AAO59414.2|  cathepsin B endopeptidase                               124   3e-30    
emb|CAX71086.1|  cathepsin B                                            124   3e-30    
gb|ABO26563.1|  cathepsin B-like cysteine protease form 1               124   3e-30    
ref|XP_001015333.1|  Papain family cysteine protease containing p...    124   4e-30    
gb|ACO14731.1|  Cathepsin B precursor                                   124   4e-30    
gb|ABQ10737.1|  cathepsin B                                             123   4e-30    
ref|XP_002100515.1|  GE16138                                            124   4e-30    
emb|CEF71274.1|  Cathepsin B                                            124   4e-30    
ref|XP_003971767.1|  PREDICTED: cathepsin B-like                        123   5e-30    
gb|AAW28820.1|  Parcxpwnx02                                             123   5e-30    
ref|XP_002009699.1|  GI15503                                            123   5e-30    
dbj|BAN21511.1|  cathepsin B                                            120   5e-30    
dbj|GAM26244.1|  hypothetical protein SAMD00019534_094190               123   5e-30    
emb|CDQ96571.1|  unnamed protein product                                123   6e-30    
gb|AGV55414.1|  cathepsin B                                             123   6e-30    



>gb|AAK69541.1|AF283476_1 cathepsin B-like cysteine proteinase [Ipomoea batatas]
Length=352

 Score =   359 bits (921),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 182/191 (95%), Positives = 186/191 (97%), Gaps = 0/191 (0%)
 Frame = +3

Query  21   METIKTllligaisllilQVVAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRF  200
            METIKTLLLIGAISLLILQVVAVKPVT +EVDPKILQDEIVKTVNENPEAGWKADMNPRF
Sbjct  1    METIKTLLLIGAISLLILQVVAVKPVTLTEVDPKILQDEIVKTVNENPEAGWKADMNPRF  60

Query  201  SDFTVSQFKRLLGAKKAPKSLLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGH  380
            SDFTVSQFKRLLG KKAPKSLLKRTPV TH K+IELPKTFDARTAWPQC+SIADILDQGH
Sbjct  61   SDFTVSQFKRLLGVKKAPKSLLKRTPVVTHSKEIELPKTFDARTAWPQCLSIADILDQGH  120

Query  381  CGSCWAFGAVESLTDRFCIHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTG  560
            CGSCWAFGAVESLTDRFCIHYGTNVTLSVNDLLACCGF+CGEGCDGGYPIAAWQYF RTG
Sbjct  121  CGSCWAFGAVESLTDRFCIHYGTNVTLSVNDLLACCGFLCGEGCDGGYPIAAWQYFKRTG  180

Query  561  VVTSECDPYFD  593
            VVTSECDPYFD
Sbjct  181  VVTSECDPYFD  191



>gb|AAF04727.1|AF101239_1 cathepsin B-like cysteine proteinase [Ipomoea batatas]
Length=352

 Score =   358 bits (920),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 182/191 (95%), Positives = 186/191 (97%), Gaps = 0/191 (0%)
 Frame = +3

Query  21   METIKTllligaisllilQVVAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRF  200
            METIKTLLLIGAISLLILQVVAVKPVT +EVDPKILQDEIVKTVNENPEAGWKADMNPRF
Sbjct  1    METIKTLLLIGAISLLILQVVAVKPVTLTEVDPKILQDEIVKTVNENPEAGWKADMNPRF  60

Query  201  SDFTVSQFKRLLGAKKAPKSLLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGH  380
            SDFTVSQFKRLLG KKAPKSLLKRTPV TH K+IELPKTFDARTAWPQC+SIADILDQGH
Sbjct  61   SDFTVSQFKRLLGVKKAPKSLLKRTPVVTHSKEIELPKTFDARTAWPQCLSIADILDQGH  120

Query  381  CGSCWAFGAVESLTDRFCIHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTG  560
            CGSCWAFGAVESLTDRFCIHYGTNVTLSVNDLLACCGF+CGEGCDGGYPIAAWQYF RTG
Sbjct  121  CGSCWAFGAVESLTDRFCIHYGTNVTLSVNDLLACCGFLCGEGCDGGYPIAAWQYFKRTG  180

Query  561  VVTSECDPYFD  593
            VVTSECDPYFD
Sbjct  181  VVTSECDPYFD  191



>gb|ABF47216.1| cathepsin B [Nicotiana benthamiana]
Length=356

 Score =   275 bits (702),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 122/173 (71%), Positives = 142/173 (82%), Gaps = 0/173 (0%)
 Frame = +3

Query  75   QVVAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAP  254
            QVVA +P++Q++ +  ILQD IVK VNEN +AGWKA +NPRFS+FTVSQFKRLLG K   
Sbjct  23   QVVAEQPISQAKAESAILQDSIVKQVNENEKAGWKAALNPRFSNFTVSQFKRLLGVKPTR  82

Query  255  KSLLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFC  434
            K  LK  P+ TH K +ELP+ FDAR AWP C +I  ILDQGHCGSCWAFGAVESL+DRFC
Sbjct  83   KGDLKGIPILTHPKLLELPQEFDARVAWPNCSTIGRILDQGHCGSCWAFGAVESLSDRFC  142

Query  435  IHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            IHYG N++LS NDLLACCGF+CG+GCDGGYP+ AW+YF R GVVT ECDPYFD
Sbjct  143  IHYGLNISLSANDLLACCGFLCGDGCDGGYPLQAWKYFVRKGVVTDECDPYFD  195



>ref|XP_007221486.1| hypothetical protein PRUPE_ppa007538mg [Prunus persica]
 gb|EMJ22685.1| hypothetical protein PRUPE_ppa007538mg [Prunus persica]
Length=364

 Score =   274 bits (701),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 118/174 (68%), Positives = 143/174 (82%), Gaps = 0/174 (0%)
 Frame = +3

Query  75   QVVAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAP  254
            Q +A KPVT+S+++ +ILQD I+K +N+NP AGW+A MNPRFS++TVSQF  LLG K  P
Sbjct  30   QFIAAKPVTKSKLNSRILQDSIIKQINDNPMAGWEAAMNPRFSNYTVSQFMHLLGVKPTP  89

Query  255  KSLLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFC  434
            +  L+  P+ TH K ++LP  FDARTAWPQC +I  ILDQGHCGSCWAF AVE+L+DRFC
Sbjct  90   RKDLQSFPILTHPKSLKLPTNFDARTAWPQCNTIGRILDQGHCGSCWAFAAVEALSDRFC  149

Query  435  IHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFDP  596
            IH+G N++LSVNDLLACCGFMCG+GCDGGYPI AW+YF   GVVT ECDPYFDP
Sbjct  150  IHFGMNISLSVNDLLACCGFMCGDGCDGGYPIYAWRYFVHHGVVTEECDPYFDP  203



>ref|XP_009608669.1| PREDICTED: cathepsin B-like [Nicotiana tomentosiformis]
Length=354

 Score =   274 bits (700),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 121/173 (70%), Positives = 142/173 (82%), Gaps = 0/173 (0%)
 Frame = +3

Query  75   QVVAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAP  254
            QVVA +P++Q++ +  ILQD I+K VNEN +AGWKA +NPRFS+FTVSQFKRLLG K   
Sbjct  21   QVVAEQPISQAKAESAILQDAIIKQVNENEKAGWKAALNPRFSNFTVSQFKRLLGVKPTR  80

Query  255  KSLLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFC  434
            K  LK  P+ TH K +ELP+ FDAR AWP C +I  ILDQGHCGSCWAFGAVESL+DRFC
Sbjct  81   KGDLKGIPILTHPKLLELPQEFDARVAWPNCSTIGRILDQGHCGSCWAFGAVESLSDRFC  140

Query  435  IHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            IHYG N++LS NDLLACCGF+CG+GCDGGYP+ AW+YF R GVVT ECDPYFD
Sbjct  141  IHYGLNISLSANDLLACCGFLCGDGCDGGYPLQAWKYFVRKGVVTDECDPYFD  193



>gb|KDO86710.1| hypothetical protein CISIN_1g018568mg [Citrus sinensis]
Length=279

 Score =   271 bits (692),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 119/173 (69%), Positives = 143/173 (83%), Gaps = 0/173 (0%)
 Frame = +3

Query  75   QVVAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAP  254
            Q  A   V++ ++D  ILQD I+K VNENP+AGWKA  NP+FS++TV QFK LLG K  P
Sbjct  21   QTFAEGVVSKLKLDSHILQDSIIKEVNENPKAGWKAARNPQFSNYTVGQFKHLLGVKPTP  80

Query  255  KSLLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFC  434
            K LL   PV THDK ++LPK+FDAR+AWPQC +I+ ILDQGHCGSCWAFGAVE+L+DRFC
Sbjct  81   KGLLLGVPVKTHDKSLKLPKSFDARSAWPQCSTISRILDQGHCGSCWAFGAVEALSDRFC  140

Query  435  IHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            IH+G N++LSVNDLLACCGF+CG+GCDGGYPI+AW+YF   GVVT ECDPYFD
Sbjct  141  IHFGMNLSLSVNDLLACCGFLCGDGCDGGYPISAWRYFVHHGVVTEECDPYFD  193



>ref|XP_009111352.1| PREDICTED: cathepsin B [Brassica rapa]
Length=358

 Score =   273 bits (699),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 122/173 (71%), Positives = 146/173 (84%), Gaps = 0/173 (0%)
 Frame = +3

Query  75   QVVAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAP  254
            Q V+   +T+ +++ KILQ+EIVK VNE+P AGWKA +N RFS+ TV++FKRLLG K  P
Sbjct  25   QGVSADNLTKQKLNSKILQEEIVKKVNEHPNAGWKAALNDRFSNATVAEFKRLLGVKPTP  84

Query  255  KSLLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFC  434
            K LL   PV +HD+ ++LPK+FDARTAWPQC SI +ILDQGHCGSCWAFGAVESL+DRFC
Sbjct  85   KKLLLGVPVVSHDQSLKLPKSFDARTAWPQCTSIGNILDQGHCGSCWAFGAVESLSDRFC  144

Query  435  IHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            I +G N+TLSVNDLLACCGF CG+GCDGGYPIAAWQYF+ +GVVT ECDPYFD
Sbjct  145  IQFGMNITLSVNDLLACCGFRCGDGCDGGYPIAAWQYFSYSGVVTEECDPYFD  197



>ref|XP_004141146.1| PREDICTED: cathepsin B-like [Cucumis sativus]
Length=348

 Score =   273 bits (697),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 121/173 (70%), Positives = 146/173 (84%), Gaps = 0/173 (0%)
 Frame = +3

Query  75   QVVAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAP  254
            QV A + V + ++D  ILQ+ IV+ VNE+P+AGWKA MNPRFS+++VSQFK LLG K+ P
Sbjct  24   QVYAEEQVLKFKLDADILQESIVRHVNEHPQAGWKATMNPRFSNYSVSQFKYLLGVKQTP  83

Query  255  KSLLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFC  434
            +  LK TPV +H K ++LPK+FDAR AWPQC+SI  ILDQGHCGSCWAFGAVESL+DRFC
Sbjct  84   EKDLKSTPVLSHPKSLKLPKSFDAREAWPQCISIGTILDQGHCGSCWAFGAVESLSDRFC  143

Query  435  IHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            IH+  N+TLSVNDLLACCGFMCG+GCDGGYPI+AW+YF R GVVT +CDPYFD
Sbjct  144  IHFDMNITLSVNDLLACCGFMCGDGCDGGYPISAWRYFVRHGVVTEQCDPYFD  196



>ref|XP_004158338.1| PREDICTED: cathepsin B-like [Cucumis sativus]
 gb|KGN59769.1| hypothetical protein Csa_3G844870 [Cucumis sativus]
Length=349

 Score =   273 bits (697),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 121/173 (70%), Positives = 146/173 (84%), Gaps = 0/173 (0%)
 Frame = +3

Query  75   QVVAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAP  254
            QV A + V + ++D  ILQ+ IV+ VNE+P+AGWKA MNPRFS+++VSQFK LLG K+ P
Sbjct  25   QVYAEEQVLKFKLDADILQESIVRHVNEHPQAGWKATMNPRFSNYSVSQFKYLLGVKQTP  84

Query  255  KSLLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFC  434
            +  LK TPV +H K ++LPK+FDAR AWPQC+SI  ILDQGHCGSCWAFGAVESL+DRFC
Sbjct  85   EKDLKSTPVLSHPKSLKLPKSFDAREAWPQCISIGTILDQGHCGSCWAFGAVESLSDRFC  144

Query  435  IHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            IH+  N+TLSVNDLLACCGFMCG+GCDGGYPI+AW+YF R GVVT +CDPYFD
Sbjct  145  IHFDMNITLSVNDLLACCGFMCGDGCDGGYPISAWRYFVRHGVVTEQCDPYFD  197



>gb|KJB40275.1| hypothetical protein B456_007G055400 [Gossypium raimondii]
Length=355

 Score =   272 bits (696),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 117/173 (68%), Positives = 146/173 (84%), Gaps = 0/173 (0%)
 Frame = +3

Query  75   QVVAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAP  254
            QV+AV+ ++  +++ +ILQD IVK VN+NP+AGW+A +NPRFS++T+ +FK LLG K  P
Sbjct  22   QVIAVEQLSDVKLNSRILQDSIVKQVNQNPKAGWEAALNPRFSNYTIGEFKHLLGVKPTP  81

Query  255  KSLLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFC  434
            K  L   P+ THDK ++LP +FDARTAWPQC SI  ILDQGHCGSCWAFGAVESL+DRFC
Sbjct  82   KKELLGVPILTHDKSLKLPTSFDARTAWPQCTSIGRILDQGHCGSCWAFGAVESLSDRFC  141

Query  435  IHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            IH+  N++LSVNDLLACCGF+CG+GCDGGYPI+AW+YF R+GVVT ECDPYFD
Sbjct  142  IHFDMNISLSVNDLLACCGFLCGDGCDGGYPISAWRYFVRSGVVTEECDPYFD  194



>ref|XP_009787301.1| PREDICTED: cathepsin B-like [Nicotiana sylvestris]
Length=355

 Score =   272 bits (696),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 121/173 (70%), Positives = 141/173 (82%), Gaps = 0/173 (0%)
 Frame = +3

Query  75   QVVAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAP  254
            QVVA +P++Q++ +  ILQD IVK VNEN +AGWKA +NP FS+FTVSQFKRLLG K   
Sbjct  23   QVVAEQPISQAKAESAILQDSIVKQVNENEKAGWKAALNPHFSNFTVSQFKRLLGVKPTR  82

Query  255  KSLLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFC  434
            K  LK  P+ TH K +ELP+ FDAR AWP C +I  ILDQGHCGSCWAFGAVESL+DRFC
Sbjct  83   KGDLKGIPILTHPKLLELPQEFDARVAWPNCSTIGRILDQGHCGSCWAFGAVESLSDRFC  142

Query  435  IHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            IHYG N++LS NDLLACCGF+CG+GCDGGYP+ AW+YF R GVVT ECDPYFD
Sbjct  143  IHYGLNISLSANDLLACCGFLCGDGCDGGYPLQAWKYFVRKGVVTDECDPYFD  195



>ref|XP_008465335.1| PREDICTED: cathepsin B-like isoform X1 [Cucumis melo]
Length=349

 Score =   272 bits (695),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 121/173 (70%), Positives = 145/173 (84%), Gaps = 0/173 (0%)
 Frame = +3

Query  75   QVVAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAP  254
            QV A + V + ++D  ILQ+ IV+ VNE+P+AGWKA MNPRFS+++VSQFK LLG K+ P
Sbjct  25   QVHAEEQVLKFKLDADILQESIVRHVNEHPQAGWKATMNPRFSNYSVSQFKYLLGVKQTP  84

Query  255  KSLLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFC  434
            +  LK TPV +H K + LPK+FDAR AWPQC+SI  ILDQGHCGSCWAFGAVESL+DRFC
Sbjct  85   EKDLKSTPVLSHPKSLRLPKSFDAREAWPQCISIGTILDQGHCGSCWAFGAVESLSDRFC  144

Query  435  IHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            IH+  N+TLSVNDLLACCGFMCG+GCDGGYPI+AW+YF R GVVT +CDPYFD
Sbjct  145  IHFDMNITLSVNDLLACCGFMCGDGCDGGYPISAWRYFVRHGVVTEQCDPYFD  197



>gb|KDO86709.1| hypothetical protein CISIN_1g018568mg [Citrus sinensis]
Length=300

 Score =   270 bits (691),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 119/173 (69%), Positives = 143/173 (83%), Gaps = 0/173 (0%)
 Frame = +3

Query  75   QVVAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAP  254
            Q  A   V++ ++D  ILQD I+K VNENP+AGWKA  NP+FS++TV QFK LLG K  P
Sbjct  21   QTFAEGVVSKLKLDSHILQDSIIKEVNENPKAGWKAARNPQFSNYTVGQFKHLLGVKPTP  80

Query  255  KSLLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFC  434
            K LL   PV THDK ++LPK+FDAR+AWPQC +I+ ILDQGHCGSCWAFGAVE+L+DRFC
Sbjct  81   KGLLLGVPVKTHDKSLKLPKSFDARSAWPQCSTISRILDQGHCGSCWAFGAVEALSDRFC  140

Query  435  IHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            IH+G N++LSVNDLLACCGF+CG+GCDGGYPI+AW+YF   GVVT ECDPYFD
Sbjct  141  IHFGMNLSLSVNDLLACCGFLCGDGCDGGYPISAWRYFVHHGVVTEECDPYFD  193



>ref|XP_008465336.1| PREDICTED: cathepsin B-like isoform X2 [Cucumis melo]
Length=348

 Score =   272 bits (695),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 121/173 (70%), Positives = 145/173 (84%), Gaps = 0/173 (0%)
 Frame = +3

Query  75   QVVAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAP  254
            QV A + V + ++D  ILQ+ IV+ VNE+P+AGWKA MNPRFS+++VSQFK LLG K+ P
Sbjct  24   QVHAEEQVLKFKLDADILQESIVRHVNEHPQAGWKATMNPRFSNYSVSQFKYLLGVKQTP  83

Query  255  KSLLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFC  434
            +  LK TPV +H K + LPK+FDAR AWPQC+SI  ILDQGHCGSCWAFGAVESL+DRFC
Sbjct  84   EKDLKSTPVLSHPKSLRLPKSFDAREAWPQCISIGTILDQGHCGSCWAFGAVESLSDRFC  143

Query  435  IHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            IH+  N+TLSVNDLLACCGFMCG+GCDGGYPI+AW+YF R GVVT +CDPYFD
Sbjct  144  IHFDMNITLSVNDLLACCGFMCGDGCDGGYPISAWRYFVRHGVVTEQCDPYFD  196



>ref|XP_008227748.1| PREDICTED: cathepsin B [Prunus mume]
Length=364

 Score =   272 bits (696),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 117/174 (67%), Positives = 142/174 (82%), Gaps = 0/174 (0%)
 Frame = +3

Query  75   QVVAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAP  254
            Q +A KPVT+S+++ +ILQD I+K +N+NP AGW+A MNPRFS++TVSQF  LLG K  P
Sbjct  30   QFIAAKPVTKSKLNSRILQDSIIKQINDNPMAGWEAAMNPRFSNYTVSQFMHLLGVKPTP  89

Query  255  KSLLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFC  434
            +   +  P+ TH K ++LP  FDARTAWPQC +I  ILDQGHCGSCWAF AVE+L+DRFC
Sbjct  90   RKDFQSFPILTHPKSLKLPTNFDARTAWPQCNTIGRILDQGHCGSCWAFAAVEALSDRFC  149

Query  435  IHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFDP  596
            IH+G N++LSVNDLLACCGFMCG+GCDGGYPI AW+YF   GVVT ECDPYFDP
Sbjct  150  IHFGMNISLSVNDLLACCGFMCGDGCDGGYPIYAWRYFVHHGVVTEECDPYFDP  203



>gb|AAR25797.1| cathepsin B-like cysteine proteinase [Solanum tuberosum]
Length=218

 Score =   267 bits (682),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 121/173 (70%), Positives = 141/173 (82%), Gaps = 0/173 (0%)
 Frame = +3

Query  75   QVVAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAP  254
            QV A KP+++++++  ILQD IVK VNEN EAGWKA  NP+ S+FTVSQFKRLLG K A 
Sbjct  21   QVAAEKPISEAKLESAILQDSIVKRVNENAEAGWKAAFNPQLSNFTVSQFKRLLGVKPAR  80

Query  255  KSLLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFC  434
            +  L+  PV TH +  ELPK FDAR AWPQC +I  ILDQGHCGSCWAFGAVESL+DRFC
Sbjct  81   EGDLEGIPVLTHPRLKELPKEFDARKAWPQCSTIGKILDQGHCGSCWAFGAVESLSDRFC  140

Query  435  IHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            IHY  +++LSVNDLLACC F+CG GCDGGYPIAAW+YF R+GVVT ECDPYFD
Sbjct  141  IHYNLSISLSVNDLLACCSFLCGSGCDGGYPIAAWRYFKRSGVVTEECDPYFD  193



>ref|XP_009787300.1| PREDICTED: cathepsin B-like [Nicotiana sylvestris]
Length=357

 Score =   271 bits (694),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 121/173 (70%), Positives = 143/173 (83%), Gaps = 0/173 (0%)
 Frame = +3

Query  75   QVVAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAP  254
            QVVA +P+++++V+  ILQ+ I+K VNEN +AGWKA  NPRFS+FTVSQFKRLLG K A 
Sbjct  23   QVVAEQPISEAKVESAILQESIIKEVNENAKAGWKAAFNPRFSNFTVSQFKRLLGVKPAR  82

Query  255  KSLLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFC  434
            +  L+  P+ TH K +ELPK FDAR AWPQC +I  ILDQGHCGSCWAFGAVESL+DRFC
Sbjct  83   EGDLEGIPILTHPKLLELPKEFDARKAWPQCSTIGRILDQGHCGSCWAFGAVESLSDRFC  142

Query  435  IHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            IH+  N++LSVNDLLACCGF+CG GCDGGYPI AW+YF R GVVT ECDPYFD
Sbjct  143  IHHNLNISLSVNDLLACCGFLCGSGCDGGYPITAWRYFIRRGVVTEECDPYFD  195



>ref|XP_004233219.1| PREDICTED: cathepsin B [Solanum lycopersicum]
Length=354

 Score =   271 bits (693),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 124/173 (72%), Positives = 141/173 (82%), Gaps = 0/173 (0%)
 Frame = +3

Query  75   QVVAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAP  254
            QV A KP+T+++++  ILQD IVK VNEN EAGWKA  NP+ S+FTVSQFKRLLG K A 
Sbjct  23   QVAAEKPITEAKLESAILQDSIVKQVNENAEAGWKAAFNPQLSNFTVSQFKRLLGVKPAR  82

Query  255  KSLLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFC  434
            +  L+  PV TH K  ELPK FDAR AWPQC +I  ILDQGHCGSCWAFGAVESL+DRFC
Sbjct  83   EGDLEGIPVLTHPKLKELPKEFDARKAWPQCSTIGRILDQGHCGSCWAFGAVESLSDRFC  142

Query  435  IHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            IHY  +++LSVNDLLACCGF+CG GCDGGYPIAAW+YF R GVVT ECDPYFD
Sbjct  143  IHYNLSISLSVNDLLACCGFLCGSGCDGGYPIAAWRYFKRRGVVTEECDPYFD  195



>dbj|BAG69285.1| cathepsin B-like cysteine protease [Raphanus sativus]
Length=343

 Score =   271 bits (692),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 121/173 (70%), Positives = 145/173 (84%), Gaps = 0/173 (0%)
 Frame = +3

Query  75   QVVAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAP  254
            Q VA + +T+ +++ KILQ+EIVK VNE+P AGWKA +N RFS+ TV++FKRLLG K  P
Sbjct  27   QGVAAENLTKQKLNSKILQEEIVKKVNEHPNAGWKAAINDRFSNATVAEFKRLLGVKPTP  86

Query  255  KSLLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFC  434
            K LL   PV +HD+ ++LPK+FDART WPQC SI  ILDQGHCGSCWAFGAVESL+DRFC
Sbjct  87   KKLLLGVPVVSHDQSLKLPKSFDARTHWPQCTSIGKILDQGHCGSCWAFGAVESLSDRFC  146

Query  435  IHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            I +G N+TLSVNDLLACCGF CG+GCDGGYPI+AWQYF+ +GVVT ECDPYFD
Sbjct  147  IQFGMNITLSVNDLLACCGFRCGDGCDGGYPISAWQYFSYSGVVTEECDPYFD  199



>ref|XP_006444663.1| hypothetical protein CICLE_v10020859mg [Citrus clementina]
 ref|XP_006491434.1| PREDICTED: cathepsin B-like isoform X2 [Citrus sinensis]
 gb|ESR57903.1| hypothetical protein CICLE_v10020859mg [Citrus clementina]
 gb|KDO86708.1| hypothetical protein CISIN_1g018568mg [Citrus sinensis]
Length=354

 Score =   271 bits (693),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 119/173 (69%), Positives = 143/173 (83%), Gaps = 0/173 (0%)
 Frame = +3

Query  75   QVVAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAP  254
            Q  A   V++ ++D  ILQD I+K VNENP+AGWKA  NP+FS++TV QFK LLG K  P
Sbjct  21   QTFAEGVVSKLKLDSHILQDSIIKEVNENPKAGWKAARNPQFSNYTVGQFKHLLGVKPTP  80

Query  255  KSLLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFC  434
            K LL   PV THDK ++LPK+FDAR+AWPQC +I+ ILDQGHCGSCWAFGAVE+L+DRFC
Sbjct  81   KGLLLGVPVKTHDKSLKLPKSFDARSAWPQCSTISRILDQGHCGSCWAFGAVEALSDRFC  140

Query  435  IHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            IH+G N++LSVNDLLACCGF+CG+GCDGGYPI+AW+YF   GVVT ECDPYFD
Sbjct  141  IHFGMNLSLSVNDLLACCGFLCGDGCDGGYPISAWRYFVHHGVVTEECDPYFD  193



>gb|KJB40274.1| hypothetical protein B456_007G055400 [Gossypium raimondii]
Length=354

 Score =   271 bits (692),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 116/173 (67%), Positives = 146/173 (84%), Gaps = 0/173 (0%)
 Frame = +3

Query  75   QVVAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAP  254
            +V+AV+ ++  +++ +ILQD IVK VN+NP+AGW+A +NPRFS++T+ +FK LLG K  P
Sbjct  21   KVIAVEQLSDVKLNSRILQDSIVKQVNQNPKAGWEAALNPRFSNYTIGEFKHLLGVKPTP  80

Query  255  KSLLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFC  434
            K  L   P+ THDK ++LP +FDARTAWPQC SI  ILDQGHCGSCWAFGAVESL+DRFC
Sbjct  81   KKELLGVPILTHDKSLKLPTSFDARTAWPQCTSIGRILDQGHCGSCWAFGAVESLSDRFC  140

Query  435  IHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            IH+  N++LSVNDLLACCGF+CG+GCDGGYPI+AW+YF R+GVVT ECDPYFD
Sbjct  141  IHFDMNISLSVNDLLACCGFLCGDGCDGGYPISAWRYFVRSGVVTEECDPYFD  193



>gb|KFK30754.1| hypothetical protein AALP_AA6G022300 [Arabis alpina]
Length=350

 Score =   270 bits (691),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 120/173 (69%), Positives = 145/173 (84%), Gaps = 0/173 (0%)
 Frame = +3

Query  75   QVVAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAP  254
            Q VA + +T+ +++ KILQ+EIVK VN+NP+AGWKA +N RFS+ TV++FKRLLG K+ P
Sbjct  22   QGVAGESLTKQKLNSKILQEEIVKKVNQNPDAGWKAAINDRFSNATVAEFKRLLGVKQTP  81

Query  255  KSLLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFC  434
            K      P  +HD+ ++LPK FDARTAWPQC+SI  ILDQGHCGSCWAFGAVESL+DRFC
Sbjct  82   KKHFLGVPSVSHDRSLKLPKEFDARTAWPQCISIGKILDQGHCGSCWAFGAVESLSDRFC  141

Query  435  IHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            I +G N+TLSVNDLLACCGF CG+GCDGGYPIAAWQYF+ +GVVT ECDPYFD
Sbjct  142  IQFGMNITLSVNDLLACCGFRCGDGCDGGYPIAAWQYFSYSGVVTEECDPYFD  194



>gb|KDO86712.1| hypothetical protein CISIN_1g018568mg [Citrus sinensis]
Length=349

 Score =   270 bits (691),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 119/173 (69%), Positives = 143/173 (83%), Gaps = 0/173 (0%)
 Frame = +3

Query  75   QVVAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAP  254
            Q  A   V++ ++D  ILQD I+K VNENP+AGWKA  NP+FS++TV QFK LLG K  P
Sbjct  16   QTFAEGVVSKLKLDSHILQDSIIKEVNENPKAGWKAARNPQFSNYTVGQFKHLLGVKPTP  75

Query  255  KSLLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFC  434
            K LL   PV THDK ++LPK+FDAR+AWPQC +I+ ILDQGHCGSCWAFGAVE+L+DRFC
Sbjct  76   KGLLLGVPVKTHDKSLKLPKSFDARSAWPQCSTISRILDQGHCGSCWAFGAVEALSDRFC  135

Query  435  IHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            IH+G N++LSVNDLLACCGF+CG+GCDGGYPI+AW+YF   GVVT ECDPYFD
Sbjct  136  IHFGMNLSLSVNDLLACCGFLCGDGCDGGYPISAWRYFVHHGVVTEECDPYFD  188



>gb|EYU46892.1| hypothetical protein MIMGU_mgv1a008339mg [Erythranthe guttata]
Length=377

 Score =   271 bits (693),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 117/173 (68%), Positives = 144/173 (83%), Gaps = 0/173 (0%)
 Frame = +3

Query  75   QVVAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAP  254
            +V+A KP  Q ++D KILQ+ ++K +N+NP+AGWKA MN RF++++V QF  LLG KK P
Sbjct  45   KVIAGKPDVQLKLDNKILQESLIKLINDNPQAGWKASMNLRFANYSVGQFMHLLGVKKMP  104

Query  255  KSLLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFC  434
            +  LK  PV TH+K ++LPK FDARTAWPQC +I  ILDQGHCGSCWAFGAVE+L+DRFC
Sbjct  105  EGDLKGIPVVTHEKGLDLPKKFDARTAWPQCSTIGKILDQGHCGSCWAFGAVEALSDRFC  164

Query  435  IHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            +H+  N++LSVNDLLACCGFMCGEGCDGGYPI+AW+YF  TGVVT ECDPYFD
Sbjct  165  VHFQMNISLSVNDLLACCGFMCGEGCDGGYPISAWRYFVHTGVVTEECDPYFD  217



>emb|CAA57522.1| cathepsin B-like cysteine proteinase [Nicotiana rustica]
Length=356

 Score =   270 bits (690),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 120/173 (69%), Positives = 140/173 (81%), Gaps = 0/173 (0%)
 Frame = +3

Query  75   QVVAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAP  254
            QVVA +P++Q++ +  ILQD IVK VNEN +AGWKA +NPRFS+FTVSQFKRLLG K   
Sbjct  23   QVVAEQPISQAKAESAILQDSIVKQVNENEKAGWKAALNPRFSNFTVSQFKRLLGVKPTR  82

Query  255  KSLLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFC  434
            K  LK  P+ TH K +ELP+ FDAR AW  C +I  ILDQGHCGSCWAFGAVESL+DRFC
Sbjct  83   KGDLKGIPILTHPKLLELPQEFDARVAWSNCSTIGRILDQGHCGSCWAFGAVESLSDRFC  142

Query  435  IHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            IHYG N++LS NDL ACCGF+CG+GCDGGYP+ AW+YF R GVVT ECDPYFD
Sbjct  143  IHYGLNISLSANDLYACCGFLCGDGCDGGYPLQAWKYFVRKGVVTDECDPYFD  195



>ref|XP_006491433.1| PREDICTED: cathepsin B-like isoform X1 [Citrus sinensis]
Length=362

 Score =   270 bits (690),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 117/166 (70%), Positives = 141/166 (85%), Gaps = 0/166 (0%)
 Frame = +3

Query  96   VTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSLLKRT  275
            V++ ++D  ILQD I+K VNENP+AGWKA  NP+FS++TV QFK LLG K  PK LL   
Sbjct  36   VSKLKLDSHILQDSIIKEVNENPKAGWKAARNPQFSNYTVGQFKHLLGVKPTPKGLLLGV  95

Query  276  PVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYGTNV  455
            PV THDK ++LPK+FDAR+AWPQC +I+ ILDQGHCGSCWAFGAVE+L+DRFCIH+G N+
Sbjct  96   PVKTHDKSLKLPKSFDARSAWPQCSTISRILDQGHCGSCWAFGAVEALSDRFCIHFGMNL  155

Query  456  TLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            +LSVNDLLACCGF+CG+GCDGGYPI+AW+YF   GVVT ECDPYFD
Sbjct  156  SLSVNDLLACCGFLCGDGCDGGYPISAWRYFVHHGVVTEECDPYFD  201



>gb|KHG03644.1| Cathepsin B [Gossypium arboreum]
Length=354

 Score =   270 bits (689),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 115/173 (66%), Positives = 146/173 (84%), Gaps = 0/173 (0%)
 Frame = +3

Query  75   QVVAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAP  254
            +V+AV+ ++  +++ +ILQD IVK VN+NP+AGW+A +NPRFS++T+ +FK LLG K  P
Sbjct  21   KVIAVEQLSDVKLNSRILQDSIVKQVNQNPKAGWEAALNPRFSNYTIGEFKHLLGVKPTP  80

Query  255  KSLLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFC  434
            K  L   P+ +HDK ++LP +FDARTAWPQC SI  ILDQGHCGSCWAFGAVESL+DRFC
Sbjct  81   KKELLGVPILSHDKSLKLPTSFDARTAWPQCTSIGRILDQGHCGSCWAFGAVESLSDRFC  140

Query  435  IHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            IH+  N++LSVNDLLACCGF+CG+GCDGGYPI+AW+YF R+GVVT ECDPYFD
Sbjct  141  IHFDMNISLSVNDLLACCGFLCGDGCDGGYPISAWRYFVRSGVVTEECDPYFD  193



>ref|NP_567215.1| putative cathepsin B-like cysteine protease [Arabidopsis thaliana]
 gb|AAK44008.1|AF370193_1 putative cathepsin B cysteine protease [Arabidopsis thaliana]
 gb|AAL38343.1| unknown protein [Arabidopsis thaliana]
 gb|AAM45063.1| putative cathepsin B cysteine protease [Arabidopsis thaliana]
 gb|AAM63244.1| cathepsin B-like cysteine protease, putative [Arabidopsis thaliana]
 gb|AAN60355.1| unknown [Arabidopsis thaliana]
 gb|AAN65077.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43043.1| cathepsin B-like cysteine protease [Arabidopsis thaliana]
 dbj|BAD43244.1| cathepsin B-like cysteine protease [Arabidopsis thaliana]
 dbj|BAD43302.1| cathepsin B-like cysteine protease [Arabidopsis thaliana]
 dbj|BAD43928.1| cathepsin B-like cysteine protease [Arabidopsis thaliana]
 dbj|BAD44007.1| cathepsin B-like cysteine protease [Arabidopsis thaliana]
 dbj|BAD44044.1| cathepsin B-like cysteine protease [Arabidopsis thaliana]
 dbj|BAD44093.1| cathepsin B-like cysteine protease [Arabidopsis thaliana]
 dbj|BAD44179.1| cathepsin B-like cysteine protease [Arabidopsis thaliana]
 dbj|BAD44196.1| cathepsin B-like cysteine protease [Arabidopsis thaliana]
 dbj|BAD44250.1| cathepsin B-like cysteine protease [Arabidopsis thaliana]
 dbj|BAD94342.1| cathepsin B-like cysteine protease [Arabidopsis thaliana]
 dbj|BAF02040.1| cathepsin B-like cysteine protease [Arabidopsis thaliana]
 gb|AEE82052.1| putative cathepsin B-like cysteine protease [Arabidopsis thaliana]
Length=359

 Score =   270 bits (689),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 119/171 (70%), Positives = 141/171 (82%), Gaps = 0/171 (0%)
 Frame = +3

Query  81   VAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKS  260
            +  + +T+ ++D KILQDEIVK VNENP AGWKA +N RFS+ TV++FKRLLG K  PK 
Sbjct  28   IEAESLTKQKLDSKILQDEIVKKVNENPNAGWKAAINDRFSNATVAEFKRLLGVKPTPKK  87

Query  261  LLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIH  440
                 P+ +HD  ++LPK FDARTAWPQC SI +ILDQGHCGSCWAFGAVESL+DRFCI 
Sbjct  88   HFLGVPIVSHDPSLKLPKAFDARTAWPQCTSIGNILDQGHCGSCWAFGAVESLSDRFCIQ  147

Query  441  YGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            +G N++LSVNDLLACCGF CG+GCDGGYPIAAWQYF+ +GVVT ECDPYFD
Sbjct  148  FGMNISLSVNDLLACCGFRCGDGCDGGYPIAAWQYFSYSGVVTEECDPYFD  198



>ref|XP_011025297.1| PREDICTED: cathepsin B-like [Populus euphratica]
Length=357

 Score =   269 bits (688),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 118/173 (68%), Positives = 142/173 (82%), Gaps = 0/173 (0%)
 Frame = +3

Query  75   QVVAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAP  254
            QV+AV+PV+  +++ +ILQD I+K VN NP+AGWKA MN  FS+++V+QFK LLG K  P
Sbjct  24   QVIAVEPVSDLKLNSRILQDSILKKVNGNPKAGWKATMNHHFSNYSVAQFKYLLGVKPTP  83

Query  255  KSLLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFC  434
            K  L+  PV +H K + LP+ FDARTAWPQC +I  ILDQGHCGSCWAFGAVESL+DRFC
Sbjct  84   KEELRGIPVISHPKSLRLPEEFDARTAWPQCSTIGKILDQGHCGSCWAFGAVESLSDRFC  143

Query  435  IHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            IHYG N++LSVNDLLACCGF+CG GCDGGYPI+AW+YF   GVVT ECDPYFD
Sbjct  144  IHYGMNISLSVNDLLACCGFLCGSGCDGGYPISAWRYFVHHGVVTEECDPYFD  196



>ref|XP_004233221.1| PREDICTED: cathepsin B [Solanum lycopersicum]
Length=352

 Score =   269 bits (687),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 124/191 (65%), Positives = 154/191 (81%), Gaps = 0/191 (0%)
 Frame = +3

Query  21   METIKTllligaisllilQVVAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRF  200
            M+ I T LL+ ++S L+LQVVA  P++Q++ +  ILQD IVK VNEN +AGW+A +NP+F
Sbjct  1    MKHIATFLLLVSVSTLVLQVVAENPISQAKAESAILQDSIVKQVNENEKAGWRAALNPQF  60

Query  201  SDFTVSQFKRLLGAKKAPKSLLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGH  380
            S+FTVSQFKRLLG K   K  LK  P+ TH K ++LP+ FDAR AWPQC +I  ILDQGH
Sbjct  61   SNFTVSQFKRLLGVKPTRKGDLKGIPILTHPKLLKLPQEFDARVAWPQCSTIGRILDQGH  120

Query  381  CGSCWAFGAVESLTDRFCIHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTG  560
            CGSCWAFGA ESL+DRFCIHYG N++LS ND++ACCG++CG+GCDGGYP+ AW+YF R G
Sbjct  121  CGSCWAFGAAESLSDRFCIHYGLNISLSANDIIACCGYLCGDGCDGGYPLEAWKYFVRKG  180

Query  561  VVTSECDPYFD  593
            VVT ECDPYFD
Sbjct  181  VVTEECDPYFD  191



>gb|KDO86711.1| hypothetical protein CISIN_1g018568mg [Citrus sinensis]
Length=351

 Score =   269 bits (687),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 117/166 (70%), Positives = 141/166 (85%), Gaps = 0/166 (0%)
 Frame = +3

Query  96   VTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSLLKRT  275
            V++ ++D  ILQD I+K VNENP+AGWKA  NP+FS++TV QFK LLG K  PK LL   
Sbjct  25   VSKLKLDSHILQDSIIKEVNENPKAGWKAARNPQFSNYTVGQFKHLLGVKPTPKGLLLGV  84

Query  276  PVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYGTNV  455
            PV THDK ++LPK+FDAR+AWPQC +I+ ILDQGHCGSCWAFGAVE+L+DRFCIH+G N+
Sbjct  85   PVKTHDKSLKLPKSFDARSAWPQCSTISRILDQGHCGSCWAFGAVEALSDRFCIHFGMNL  144

Query  456  TLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            +LSVNDLLACCGF+CG+GCDGGYPI+AW+YF   GVVT ECDPYFD
Sbjct  145  SLSVNDLLACCGFLCGDGCDGGYPISAWRYFVHHGVVTEECDPYFD  190



>ref|XP_002301457.2| putative cathepsin B-like protease family protein [Populus trichocarpa]
 gb|EEE80730.2| putative cathepsin B-like protease family protein [Populus trichocarpa]
Length=357

 Score =   268 bits (686),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 118/173 (68%), Positives = 142/173 (82%), Gaps = 0/173 (0%)
 Frame = +3

Query  75   QVVAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAP  254
            QV+AV+PV+  +++ +ILQD I+K VN NP+AGWKA MN  FS++TV+QFK LLG K  P
Sbjct  24   QVIAVEPVSDLKLNSRILQDSILKKVNGNPKAGWKATMNHHFSNYTVAQFKYLLGVKPTP  83

Query  255  KSLLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFC  434
            K  L+  PV +H K + LP+ FDARTAWPQC +I  ILDQGHCGSCWAFGAVESL+DRFC
Sbjct  84   KEELRGIPVISHPKSLRLPEEFDARTAWPQCSTIGKILDQGHCGSCWAFGAVESLSDRFC  143

Query  435  IHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            IHYG N++LSVNDLLACCGF+CG GC+GGYPI+AW+YF   GVVT ECDPYFD
Sbjct  144  IHYGMNISLSVNDLLACCGFLCGSGCNGGYPISAWRYFVHHGVVTEECDPYFD  196



>ref|NP_001275088.1| cathepsin B-like cysteine proteinase precursor [Solanum tuberosum]
 gb|AAR25800.1| cathepsin B-like cysteine proteinase [Solanum tuberosum]
Length=354

 Score =   268 bits (685),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 121/173 (70%), Positives = 141/173 (82%), Gaps = 0/173 (0%)
 Frame = +3

Query  75   QVVAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAP  254
            QV A KP+++++++  ILQD IVK VNEN EAGWKA  NP+ S+FTVSQFKRLLG K A 
Sbjct  23   QVAAEKPISEAKLESAILQDSIVKRVNENAEAGWKAAFNPQLSNFTVSQFKRLLGVKPAR  82

Query  255  KSLLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFC  434
            +  L+  PV TH +  ELPK FDAR AWPQC +I  ILDQGHCGSCWAFGAVESL+DRFC
Sbjct  83   EGDLEGIPVLTHPRLKELPKEFDARKAWPQCSTIGKILDQGHCGSCWAFGAVESLSDRFC  142

Query  435  IHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            IHY  +++LSVNDLLACC F+CG GCDGGYPIAAW+YF R+GVVT ECDPYFD
Sbjct  143  IHYNLSISLSVNDLLACCSFLCGSGCDGGYPIAAWRYFKRSGVVTEECDPYFD  195



>emb|CDY58223.1| BnaA09g52180D [Brassica napus]
Length=358

 Score =   268 bits (685),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 120/173 (69%), Positives = 144/173 (83%), Gaps = 0/173 (0%)
 Frame = +3

Query  75   QVVAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAP  254
            Q V+   +T+ +++ KILQ+EIVK VNE+P AGWKA +N RFS+ TV++FKRLLG K  P
Sbjct  25   QGVSADNLTKQKLNSKILQEEIVKKVNEHPNAGWKAAINDRFSNATVAEFKRLLGVKPTP  84

Query  255  KSLLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFC  434
            K LL   PV +HD+ ++LPK+FDARTAWPQC SI +IL  GHCGSCWAFGAVESL+DRFC
Sbjct  85   KKLLLGVPVVSHDQSLKLPKSFDARTAWPQCTSIGNILGSGHCGSCWAFGAVESLSDRFC  144

Query  435  IHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            I +G N+TLSVNDLLACCGF CG+GCDGGYPIAAWQYF+ +GVVT ECDPYFD
Sbjct  145  IQFGMNITLSVNDLLACCGFRCGDGCDGGYPIAAWQYFSYSGVVTEECDPYFD  197



>ref|XP_009608670.1| PREDICTED: cathepsin B-like [Nicotiana tomentosiformis]
Length=357

 Score =   268 bits (685),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 120/173 (69%), Positives = 143/173 (83%), Gaps = 0/173 (0%)
 Frame = +3

Query  75   QVVAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAP  254
            QVVA KP+++++V+  IL++ I+K VNEN +AGWKA  NP+FS+FTVSQFKRLLG K A 
Sbjct  23   QVVAEKPISEAKVESAILKESIIKEVNENAKAGWKAAFNPQFSNFTVSQFKRLLGVKPAR  82

Query  255  KSLLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFC  434
            +  L+  P+ TH K  ELPK FDAR AWPQC +I  ILDQGHCGSCWAFGAVESL+DRFC
Sbjct  83   EGDLEGIPLLTHPKLSELPKEFDARKAWPQCSTIGRILDQGHCGSCWAFGAVESLSDRFC  142

Query  435  IHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            IH+  N++LSVNDLLACCGF+CG GCDGGYPI+AW+YF R GVVT ECDPYFD
Sbjct  143  IHHNLNISLSVNDLLACCGFLCGSGCDGGYPISAWRYFIRRGVVTEECDPYFD  195



>ref|XP_010428573.1| PREDICTED: cathepsin B-like [Camelina sativa]
Length=359

 Score =   268 bits (685),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 118/173 (68%), Positives = 141/173 (82%), Gaps = 0/173 (0%)
 Frame = +3

Query  75   QVVAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAP  254
            Q +A + +T+ ++D KILQDEIVK +N+NP AGWKA +N RFS+ TV++FKRLLG K  P
Sbjct  26   QGIAAENLTKQKLDSKILQDEIVKKINQNPNAGWKASINDRFSNATVAEFKRLLGVKPTP  85

Query  255  KSLLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFC  434
            K      PV +HD  ++LPK FDAR  WPQC SI +ILDQGHCGSCWAFGAVESL+DRFC
Sbjct  86   KQHFLGVPVVSHDPSLKLPKQFDARANWPQCTSIGNILDQGHCGSCWAFGAVESLSDRFC  145

Query  435  IHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            I +G N+TLSVNDLLACCGF CGEGCDGGYP+AAW+YF+ +GVVT ECDPYFD
Sbjct  146  IQFGMNITLSVNDLLACCGFRCGEGCDGGYPVAAWKYFSYSGVVTEECDPYFD  198



>emb|CDY07129.1| BnaCnng01440D [Brassica napus]
Length=358

 Score =   268 bits (684),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 119/173 (69%), Positives = 144/173 (83%), Gaps = 0/173 (0%)
 Frame = +3

Query  75   QVVAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAP  254
            Q VA   +T+ +++ KILQ+EIVK VNE+P AGWKA +N RFS+ TV++FKRLLG K  P
Sbjct  25   QGVAADNLTKQKLNSKILQEEIVKKVNEHPNAGWKAALNDRFSNATVAEFKRLLGVKPTP  84

Query  255  KSLLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFC  434
            K LL   PV +HD+ ++LPK+FDARTAWPQC SI +IL  GHCGSCWAFGAVESL+DRFC
Sbjct  85   KKLLLGVPVVSHDQSLKLPKSFDARTAWPQCTSIGNILGSGHCGSCWAFGAVESLSDRFC  144

Query  435  IHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            I +G N+TLSVNDLLACCGF CG+GCDGGYP+AAW+YF+ +GVVT ECDPYFD
Sbjct  145  IQFGMNITLSVNDLLACCGFRCGDGCDGGYPVAAWRYFSYSGVVTEECDPYFD  197



>ref|XP_006396358.1| hypothetical protein EUTSA_v10028753mg [Eutrema salsugineum]
 dbj|BAJ34434.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ37811.1| hypothetical protein EUTSA_v10028753mg [Eutrema salsugineum]
Length=362

 Score =   267 bits (683),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 117/173 (68%), Positives = 144/173 (83%), Gaps = 0/173 (0%)
 Frame = +3

Query  75   QVVAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAP  254
            Q V  + +++ +++ KILQ+EIVK VN+NP+AGWKA +N RFS+ TV++FKRLLG K  P
Sbjct  29   QGVKAENLSKQKLNSKILQEEIVKKVNQNPDAGWKAAINDRFSNATVAEFKRLLGVKPTP  88

Query  255  KSLLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFC  434
            K      P+ +HD+ ++LPK FDARTAWPQC SI +ILDQGHCGSCWAFGAVESL+DRFC
Sbjct  89   KKHFLGVPIVSHDRSLKLPKEFDARTAWPQCTSIGNILDQGHCGSCWAFGAVESLSDRFC  148

Query  435  IHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            I +G N++LSVNDLLACCGF CG+GCDGGYPIAAWQYF+ +GVVT ECDPYFD
Sbjct  149  IEFGMNISLSVNDLLACCGFRCGDGCDGGYPIAAWQYFSYSGVVTEECDPYFD  201



>ref|XP_006362602.1| PREDICTED: cathepsin B-like [Solanum tuberosum]
Length=352

 Score =   267 bits (682),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 124/191 (65%), Positives = 154/191 (81%), Gaps = 0/191 (0%)
 Frame = +3

Query  21   METIKTllligaisllilQVVAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRF  200
            M+ I T LL+ A+S L+LQVVA  P++Q++ +  ILQD IVK VNEN +AGW+A +NP+F
Sbjct  1    MKHITTFLLLVAVSTLVLQVVAENPISQAKAESAILQDSIVKQVNENEKAGWRAALNPQF  60

Query  201  SDFTVSQFKRLLGAKKAPKSLLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGH  380
            S+FTVSQFKRLLG K   K  LK  P+ TH + ++LP+ FDAR AWPQC +I  ILDQGH
Sbjct  61   SNFTVSQFKRLLGVKPTRKGDLKGIPILTHPELLKLPQEFDARVAWPQCSTIGRILDQGH  120

Query  381  CGSCWAFGAVESLTDRFCIHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTG  560
            CGSCWAFGA ESL+DRFCIHYG N++LS ND++ACCG++CG+GCDGGYP+ AW+YF R G
Sbjct  121  CGSCWAFGAAESLSDRFCIHYGLNISLSANDIVACCGYLCGDGCDGGYPLEAWKYFVRKG  180

Query  561  VVTSECDPYFD  593
            VVT ECDPYFD
Sbjct  181  VVTEECDPYFD  191



>ref|XP_011025296.1| PREDICTED: cathepsin B-like [Populus euphratica]
Length=356

 Score =   266 bits (681),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 115/173 (66%), Positives = 144/173 (83%), Gaps = 0/173 (0%)
 Frame = +3

Query  75   QVVAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAP  254
            QV+AV+PV++ +++ +ILQD IV+ +NENP AGW+A MNP+FS+++V +FK LLG K  P
Sbjct  23   QVIAVEPVSKLKLNSRILQDSIVQKINENPNAGWEATMNPQFSNYSVGEFKYLLGVKPTP  82

Query  255  KSLLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFC  434
               L+  P+  H K ++LPK FDARTAWP C +I  ILDQGHCGSCWAFGAVESL+DRFC
Sbjct  83   GKELRGVPLVRHPKSMKLPKEFDARTAWPHCSTIGRILDQGHCGSCWAFGAVESLSDRFC  142

Query  435  IHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            IHYG N++LSVNDLLACCG+MCG+GCDGGYPI AW+YF ++GVVT ECDPYFD
Sbjct  143  IHYGMNLSLSVNDLLACCGWMCGDGCDGGYPIDAWRYFVQSGVVTEECDPYFD  195



>ref|XP_002874969.1| hypothetical protein ARALYDRAFT_490415 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51228.1| hypothetical protein ARALYDRAFT_490415 [Arabidopsis lyrata subsp. 
lyrata]
Length=359

 Score =   266 bits (681),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 118/171 (69%), Positives = 141/171 (82%), Gaps = 0/171 (0%)
 Frame = +3

Query  81   VAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKS  260
            ++ + +T+ +++ KILQDEIVK VN+NP AGWKA +N RFS+ TV++FKRLLG K  PK 
Sbjct  28   ISAENLTKQKLNSKILQDEIVKKVNQNPNAGWKAAINDRFSNATVAEFKRLLGVKPTPKK  87

Query  261  LLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIH  440
                 PV +HD  ++LPK FDARTAWPQC SI  ILDQGHCGSCWAFGAVESL+DRFCI 
Sbjct  88   HFLGVPVVSHDPSLKLPKAFDARTAWPQCTSIGKILDQGHCGSCWAFGAVESLSDRFCIQ  147

Query  441  YGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            +G N++LSVNDLLACCGF CG+GCDGGYPIAAWQYF+ +GVVT ECDPYFD
Sbjct  148  FGMNISLSVNDLLACCGFRCGDGCDGGYPIAAWQYFSYSGVVTEECDPYFD  198



>ref|XP_010247244.1| PREDICTED: cathepsin B-like [Nelumbo nucifera]
Length=355

 Score =   266 bits (679),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 118/173 (68%), Positives = 142/173 (82%), Gaps = 0/173 (0%)
 Frame = +3

Query  75   QVVAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAP  254
            QVVAVKP+   +   +ILQ+EIV  +N NP+A W+A MNPRF+++T++QFK LLG K AP
Sbjct  22   QVVAVKPILPIKPRTEILQEEIVWHINANPKARWEAAMNPRFTNYTIAQFKHLLGVKPAP  81

Query  255  KSLLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFC  434
            ++ L+  PV TH K + LPK FDAR AWPQC +I  ILDQGHCGSCWAFGAVESL+DRFC
Sbjct  82   QNDLEGIPVITHPKSLNLPKQFDARMAWPQCSTIGKILDQGHCGSCWAFGAVESLSDRFC  141

Query  435  IHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            IH+G N++LSVNDLLACCGFMCG+GCDGGYPI+AW+YF   GVVT ECDPYFD
Sbjct  142  IHFGMNISLSVNDLLACCGFMCGDGCDGGYPISAWRYFVHDGVVTEECDPYFD  194



>ref|XP_010456139.1| PREDICTED: cathepsin B-like [Camelina sativa]
Length=359

 Score =   265 bits (677),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 117/173 (68%), Positives = 141/173 (82%), Gaps = 0/173 (0%)
 Frame = +3

Query  75   QVVAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAP  254
            Q +  + +T+ +++ KILQDEIVK VN+NP AGWKA +N RFS+ TV++FKRLLG K  P
Sbjct  26   QGIEAENLTKQKLNSKILQDEIVKEVNKNPNAGWKASINDRFSNATVAEFKRLLGVKPTP  85

Query  255  KSLLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFC  434
            K+     PV +HD  ++LPK FDAR  WPQC SI +ILDQGHCGSCWAFGAVESL+DRFC
Sbjct  86   KTHFLGVPVVSHDPSLKLPKQFDARANWPQCTSIGNILDQGHCGSCWAFGAVESLSDRFC  145

Query  435  IHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            I +G N+TLSVNDLLACCGF CGEGCDGGYP+AAW+YF+ +GVVT ECDPYFD
Sbjct  146  IQFGMNITLSVNDLLACCGFRCGEGCDGGYPVAAWKYFSYSGVVTEECDPYFD  198



>ref|XP_007051347.1| Cysteine proteinases superfamily protein [Theobroma cacao]
 gb|EOX95504.1| Cysteine proteinases superfamily protein [Theobroma cacao]
Length=359

 Score =   265 bits (677),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 116/173 (67%), Positives = 142/173 (82%), Gaps = 0/173 (0%)
 Frame = +3

Query  75   QVVAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAP  254
            +V+AV+ +++ +++ +ILQD IVK VNENP+AGWKA +NPR S++TV +FK LLG K  P
Sbjct  24   KVIAVEQLSEVKLNSQILQDSIVKQVNENPKAGWKAALNPRLSNYTVGEFKHLLGVKPTP  83

Query  255  KSLLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFC  434
            K  L   PV TH K +++P  FDARTAWPQC +I  ILDQGHCGSCWAFGAVESL+DRFC
Sbjct  84   KKELLGIPVITHGKSLKVPTKFDARTAWPQCSTIGRILDQGHCGSCWAFGAVESLSDRFC  143

Query  435  IHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            IH+  N++LSVNDLLACCGF+CG GCDGGYPI+AW+YF R GVVT ECDPYFD
Sbjct  144  IHFSMNISLSVNDLLACCGFLCGSGCDGGYPISAWRYFVRRGVVTEECDPYFD  196



>ref|XP_008343231.1| PREDICTED: cathepsin B-like [Malus domestica]
Length=363

 Score =   265 bits (677),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 113/173 (65%), Positives = 141/173 (82%), Gaps = 0/173 (0%)
 Frame = +3

Query  75   QVVAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAP  254
            Q++A KP++++++   ILQD I+K +NENP+AGW+A MNPRFS++TVSQF  LLG K  P
Sbjct  29   QLIAAKPLSKTKLQSPILQDSIIKQINENPKAGWEAAMNPRFSNYTVSQFMHLLGVKPTP  88

Query  255  KSLLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFC  434
            +  L+  P+ T+ K ++LP  FDARTAWPQC +I  ILDQGHCGSCWAF AVE+L+DRFC
Sbjct  89   QKDLQSFPIKTYPKSLKLPNNFDARTAWPQCNTIGRILDQGHCGSCWAFAAVEALSDRFC  148

Query  435  IHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            +HYG N++LSVNDLLACCGFMCG GC+GGYPI AW+YF   GVVT ECDPYFD
Sbjct  149  VHYGMNISLSVNDLLACCGFMCGAGCNGGYPIYAWRYFIHHGVVTEECDPYFD  201



>ref|XP_010422703.1| PREDICTED: cathepsin B-like [Camelina sativa]
Length=359

 Score =   265 bits (676),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 116/173 (67%), Positives = 140/173 (81%), Gaps = 0/173 (0%)
 Frame = +3

Query  75   QVVAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAP  254
            Q +A + +T+ ++  +ILQDEIVK +N+NP AGWKA +N RFS+ TV++FKRLLG K  P
Sbjct  26   QGIAAENLTKQKLSSRILQDEIVKKINQNPNAGWKASINDRFSNATVAEFKRLLGVKPTP  85

Query  255  KSLLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFC  434
            K      PV +HD  ++LPK FDAR  WPQC SI +ILDQGHCGSCWAFGAVESL+DRFC
Sbjct  86   KKHFLGVPVVSHDPSLKLPKQFDARANWPQCTSIGNILDQGHCGSCWAFGAVESLSDRFC  145

Query  435  IHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            I +G N+TLSVNDLLACCGF CGEGCDGGYP+AAW+YF+ +GVVT ECDPYFD
Sbjct  146  IQFGMNITLSVNDLLACCGFRCGEGCDGGYPVAAWKYFSYSGVVTEECDPYFD  198



>ref|XP_010542823.1| PREDICTED: cathepsin B-like [Tarenaya hassleriana]
Length=359

 Score =   265 bits (676),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 117/171 (68%), Positives = 140/171 (82%), Gaps = 0/171 (0%)
 Frame = +3

Query  81   VAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKS  260
            V+   +++ +++ +ILQDEIVK VNENP AGWKA +N RFS+ TV++FKRLLG K  PK 
Sbjct  28   VSAVSLSKLKLNSRILQDEIVKQVNENPNAGWKAAINDRFSNATVAEFKRLLGVKPTPKK  87

Query  261  LLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIH  440
             L   P+ +HD+ ++LPK FDARTAWPQC +I  ILDQGHCGSCWAF AVESL+DRFCIH
Sbjct  88   ELLGVPIVSHDRSLKLPKEFDARTAWPQCTTIGRILDQGHCGSCWAFAAVESLSDRFCIH  147

Query  441  YGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            +G NV LSVNDLLACCGF+CG+GCDGGYPI+AWQYF   GVVT ECDPYFD
Sbjct  148  FGMNVPLSVNDLLACCGFLCGDGCDGGYPISAWQYFKYRGVVTEECDPYFD  198



>ref|NP_849281.1| putative cathepsin B-like cysteine protease [Arabidopsis thaliana]
 gb|AAC72872.1| contains similarity to cysteine proteases (Pfam: PF00112, E=1.3e-79, 
N=1) [Arabidopsis thaliana]
 emb|CAB77732.1| cathepsin B-like cysteine protease [Arabidopsis thaliana]
 gb|AEE82053.1| putative cathepsin B-like cysteine protease [Arabidopsis thaliana]
Length=359

 Score =   264 bits (675),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 117/171 (68%), Positives = 139/171 (81%), Gaps = 0/171 (0%)
 Frame = +3

Query  81   VAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKS  260
            +  + +T+ ++D KILQDEIVK VNENP AGWKA +N RFS+ TV++FKRLLG K  PK 
Sbjct  28   IEAESLTKQKLDSKILQDEIVKKVNENPNAGWKAAINDRFSNATVAEFKRLLGVKPTPKK  87

Query  261  LLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIH  440
                 P+ +HD  ++LPK FDARTAWPQC SI +IL  GHCGSCWAFGAVESL+DRFCI 
Sbjct  88   HFLGVPIVSHDPSLKLPKAFDARTAWPQCTSIGNILGLGHCGSCWAFGAVESLSDRFCIQ  147

Query  441  YGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            +G N++LSVNDLLACCGF CG+GCDGGYPIAAWQYF+ +GVVT ECDPYFD
Sbjct  148  FGMNISLSVNDLLACCGFRCGDGCDGGYPIAAWQYFSYSGVVTEECDPYFD  198



>ref|XP_010103114.1| Cathepsin B [Morus notabilis]
 gb|EXB94879.1| Cathepsin B [Morus notabilis]
Length=420

 Score =   266 bits (680),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 115/173 (66%), Positives = 143/173 (83%), Gaps = 0/173 (0%)
 Frame = +3

Query  75   QVVAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAP  254
            +V+A++P++  +++  ILQ+ IVK VNENPEAGW+A+MNPRFS+FT  +F+RLLG K+ P
Sbjct  26   RVIALQPLSNLKLNSPILQESIVKRVNENPEAGWRAEMNPRFSNFTAGEFRRLLGVKETP  85

Query  255  KSLLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFC  434
            K  L+ TPV TH K ++LP  FDARTAWPQC +I  ILDQGHCGSCWAFGAVESL+DRFC
Sbjct  86   KHELESTPVITHPKSLKLPDKFDARTAWPQCSTIKRILDQGHCGSCWAFGAVESLSDRFC  145

Query  435  IHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            IH+ TN++LSVND+LACCGF+CG GCDGG P+ AW+Y    GVVT ECDPYFD
Sbjct  146  IHFNTNISLSVNDVLACCGFLCGAGCDGGTPLFAWRYLHHHGVVTEECDPYFD  198



>gb|KCW88611.1| hypothetical protein EUGRSUZ_A00982 [Eucalyptus grandis]
Length=272

 Score =   260 bits (665),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 114/173 (66%), Positives = 137/173 (79%), Gaps = 0/173 (0%)
 Frame = +3

Query  75   QVVAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAP  254
            QV A K ++Q +++  ILQ+ I+K +NENP AGW+A MNPRFS+FTV QFK LLG K  P
Sbjct  24   QVNAEKSLSQLKLNSHILQNSIIKEINENPNAGWQAAMNPRFSNFTVGQFKHLLGVKPTP  83

Query  255  KSLLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFC  434
               L + P+ TH K ++LP+ FDARTAW QC +I  ILDQGHCGSCWAFGAVESL+DRFC
Sbjct  84   HGELTQVPIKTHPKSLKLPEKFDARTAWSQCSTIGRILDQGHCGSCWAFGAVESLSDRFC  143

Query  435  IHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            IH+G N++LSVNDLLACCGFMCG GC+GGYP+ AW+YF   GVVT EC PYFD
Sbjct  144  IHFGMNISLSVNDLLACCGFMCGAGCNGGYPMFAWRYFMHHGVVTEECYPYFD  196



>ref|XP_009341533.1| PREDICTED: cathepsin B-like [Pyrus x bretschneideri]
Length=363

 Score =   263 bits (672),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 113/173 (65%), Positives = 141/173 (82%), Gaps = 0/173 (0%)
 Frame = +3

Query  75   QVVAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAP  254
            Q++AVKP++++++   ILQD I+K +NENP+AGW+A MNPRFS++TVSQF  LLG K  P
Sbjct  29   QLIAVKPLSKTKLQSPILQDSIIKQINENPKAGWEAAMNPRFSNYTVSQFMHLLGVKPTP  88

Query  255  KSLLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFC  434
            +  L+  P+ T+ K ++LP  FDARTAWPQC +I  ILDQGHCGSCWAF AVE+L+DRFC
Sbjct  89   QKDLQSFPIKTYPKSLKLPNNFDARTAWPQCNTIGRILDQGHCGSCWAFAAVEALSDRFC  148

Query  435  IHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            + YG N++LSVNDLLACCGFMCG GC+GGYPI AW+YF   GVVT ECDPYFD
Sbjct  149  VRYGMNISLSVNDLLACCGFMCGAGCNGGYPIYAWRYFIHHGVVTEECDPYFD  201



>gb|KCW88610.1| hypothetical protein EUGRSUZ_A00982 [Eucalyptus grandis]
Length=289

 Score =   261 bits (666),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 114/173 (66%), Positives = 137/173 (79%), Gaps = 0/173 (0%)
 Frame = +3

Query  75   QVVAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAP  254
            QV A K ++Q +++  ILQ+ I+K +NENP AGW+A MNPRFS+FTV QFK LLG K  P
Sbjct  24   QVNAEKSLSQLKLNSHILQNSIIKEINENPNAGWQAAMNPRFSNFTVGQFKHLLGVKPTP  83

Query  255  KSLLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFC  434
               L + P+ TH K ++LP+ FDARTAW QC +I  ILDQGHCGSCWAFGAVESL+DRFC
Sbjct  84   HGELTQVPIKTHPKSLKLPEKFDARTAWSQCSTIGRILDQGHCGSCWAFGAVESLSDRFC  143

Query  435  IHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            IH+G N++LSVNDLLACCGFMCG GC+GGYP+ AW+YF   GVVT EC PYFD
Sbjct  144  IHFGMNISLSVNDLLACCGFMCGAGCNGGYPMFAWRYFMHHGVVTEECYPYFD  196



>ref|XP_010907756.1| PREDICTED: cathepsin B-like [Elaeis guineensis]
Length=380

 Score =   263 bits (673),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 115/173 (66%), Positives = 142/173 (82%), Gaps = 0/173 (0%)
 Frame = +3

Query  75   QVVAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAP  254
            QV+A KP+ + +++  ILQ+ I++ +N NP AGWKA  N RFS++TV QFK +LG K AP
Sbjct  47   QVIAGKPMPKLKMESMILQNSIIEKINGNPIAGWKASTNSRFSNYTVGQFKHILGVKPAP  106

Query  255  KSLLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFC  434
            ++  +  PV TH K ++LPK FDARTAWPQC +I  ILDQGHCGSCWAFGAVESL+DRFC
Sbjct  107  RNAWEDIPVKTHQKSVKLPKQFDARTAWPQCSTIGRILDQGHCGSCWAFGAVESLSDRFC  166

Query  435  IHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            +H+G NV+LSVNDLLACCGFMCG+GCDGGYPI AW+YF ++GVVT ECDPYFD
Sbjct  167  VHFGMNVSLSVNDLLACCGFMCGDGCDGGYPIYAWRYFVQSGVVTEECDPYFD  219



>gb|KJB41698.1| hypothetical protein B456_007G115600 [Gossypium raimondii]
Length=357

 Score =   262 bits (670),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 113/173 (65%), Positives = 141/173 (82%), Gaps = 0/173 (0%)
 Frame = +3

Query  75   QVVAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAP  254
            +V+AV   ++ +++ +ILQD IVK VNENP+AGWKA +NPRFS++TV +FK +LG K  P
Sbjct  24   KVIAVGQPSEVKLNSRILQDSIVKRVNENPKAGWKAALNPRFSNYTVGEFKHILGVKPTP  83

Query  255  KSLLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFC  434
            K  L   P+  H K +++P  FDARTAWPQC +I  ILDQGHCGSCWAFGAVESL+DRFC
Sbjct  84   KKELLGIPIIRHGKSLKMPANFDARTAWPQCSTIGRILDQGHCGSCWAFGAVESLSDRFC  143

Query  435  IHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            IH+G N++LSVNDLLACCGF+CG GCDGG PI+AW+YF R+GVV+ ECDPYFD
Sbjct  144  IHFGMNISLSVNDLLACCGFLCGSGCDGGVPISAWRYFVRSGVVSEECDPYFD  196



>ref|XP_003632421.1| PREDICTED: cathepsin B-like [Vitis vinifera]
Length=358

 Score =   261 bits (667),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 115/173 (66%), Positives = 140/173 (81%), Gaps = 0/173 (0%)
 Frame = +3

Query  75   QVVAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAP  254
            +VVA+K V+Q + + KILQ+ +V+ +N NP+AGWKA MNPRFS+++V QF  LLG K   
Sbjct  24   EVVALKSVSQLKFNTKILQESMVELINANPKAGWKAAMNPRFSNYSVGQFMHLLGVKPTL  83

Query  255  KSLLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFC  434
            +  L+  PV TH K ++LPK FDARTAWPQC +I  ILDQGHCGSCWAFGAVESL+DRFC
Sbjct  84   QKDLEGVPVITHPKTLKLPKHFDARTAWPQCSTIGKILDQGHCGSCWAFGAVESLSDRFC  143

Query  435  IHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            IH+G N++LSVNDLLACCGF+CG GCDGGYP+ AW+YF   GVVT ECDPYFD
Sbjct  144  IHFGMNISLSVNDLLACCGFLCGSGCDGGYPLYAWRYFIHHGVVTEECDPYFD  196



>ref|XP_010556663.1| PREDICTED: cathepsin B-like [Tarenaya hassleriana]
Length=359

 Score =   261 bits (667),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 117/173 (68%), Positives = 140/173 (81%), Gaps = 0/173 (0%)
 Frame = +3

Query  75   QVVAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAP  254
            Q +A + +++ +++  ILQDEIVK VNENP AGWKA +N RFS+ TV++FKRLLG K  P
Sbjct  26   QGIAAENLSELKLNSPILQDEIVKQVNENPNAGWKAAINDRFSNTTVAEFKRLLGVKPTP  85

Query  255  KSLLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFC  434
            K  L   P+ +HD+ ++LPK FDARTAWPQC +I  ILDQGHCGSCWAF AVESL+DRFC
Sbjct  86   KKELLGVPIVSHDRSLKLPKEFDARTAWPQCSTIGRILDQGHCGSCWAFAAVESLSDRFC  145

Query  435  IHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            IH+G +V LSVNDLLACCGF+CG GCDGGYPIAAW+YF   GVVT ECDPYFD
Sbjct  146  IHFGMDVPLSVNDLLACCGFLCGSGCDGGYPIAAWRYFWYRGVVTEECDPYFD  198



>ref|XP_006418358.1| hypothetical protein EUTSA_v10008009mg [Eutrema salsugineum]
 gb|ESQ36711.1| hypothetical protein EUTSA_v10008009mg [Eutrema salsugineum]
Length=360

 Score =   260 bits (665),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 115/173 (66%), Positives = 139/173 (80%), Gaps = 0/173 (0%)
 Frame = +3

Query  75   QVVAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAP  254
            Q +A + +T+ ++  +ILQDEIVK VNENP AGWKA  N RF++ TV++FKRLLG K  P
Sbjct  27   QGIAAENLTKQKLTSRILQDEIVKEVNENPNAGWKAAFNDRFANATVAEFKRLLGVKPTP  86

Query  255  KSLLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFC  434
            K      P+ +HD+ ++LPK FDARTAW QC SIA ILDQGHCGSCWAFGAVESL+DRFC
Sbjct  87   KKEYLGVPIVSHDRSLKLPKEFDARTAWSQCTSIARILDQGHCGSCWAFGAVESLSDRFC  146

Query  435  IHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            I Y  N++LSVNDLLACCGF+CG+GC+GGYPI+AW+YF   GVVT ECDPYFD
Sbjct  147  IKYNMNISLSVNDLLACCGFLCGQGCNGGYPISAWRYFKHHGVVTEECDPYFD  199



>ref|XP_011079459.1| PREDICTED: cathepsin B [Sesamum indicum]
Length=360

 Score =   260 bits (664),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 114/173 (66%), Positives = 138/173 (80%), Gaps = 0/173 (0%)
 Frame = +3

Query  75   QVVAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAP  254
            QV   K   Q +V+ +ILQ+ +++ +N+N +AGWKA MNPRF+++TV QF  LLG K  P
Sbjct  27   QVSEGKTDLQLKVNSRILQESVIELINDNAQAGWKAAMNPRFTNYTVGQFMHLLGVKPIP  86

Query  255  KSLLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFC  434
               LK  PV TH K ++LPK FDART WPQC +I  ILDQGHCGSCWAFGAVE+L+DRFC
Sbjct  87   DGDLKGIPVVTHRKGLKLPKKFDARTVWPQCSTIGKILDQGHCGSCWAFGAVEALSDRFC  146

Query  435  IHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            IH+G N++LSVNDLLACCGFMCG+GCDGGYPI+AW+YF  TGVVT ECDPYFD
Sbjct  147  IHFGMNISLSVNDLLACCGFMCGDGCDGGYPISAWRYFVHTGVVTEECDPYFD  199



>ref|XP_006288020.1| hypothetical protein CARUB_v10001253mg [Capsella rubella]
 gb|EOA20918.1| hypothetical protein CARUB_v10001253mg [Capsella rubella]
Length=359

 Score =   259 bits (663),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 115/173 (66%), Positives = 138/173 (80%), Gaps = 0/173 (0%)
 Frame = +3

Query  75   QVVAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAP  254
            Q +A + +T+ +++ KILQDEIVK VN+NP AGWKA +N RFS+ TV++FKRLLG K  P
Sbjct  26   QGIAAENLTKQKLNSKILQDEIVKKVNQNPNAGWKAAINDRFSNATVAEFKRLLGVKPTP  85

Query  255  KSLLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFC  434
            K      P+ +HD  ++LPK FDAR  WPQC SI  IL  GHCGSCWAFGAVESL+DRFC
Sbjct  86   KKHFLGVPIVSHDPSLKLPKDFDARANWPQCTSIGKILGLGHCGSCWAFGAVESLSDRFC  145

Query  435  IHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            I +G N+TLSVNDLLACCGF CG+GCDGGYP+AAWQYF+ +GVVT ECDPYFD
Sbjct  146  IQFGMNITLSVNDLLACCGFRCGDGCDGGYPVAAWQYFSYSGVVTEECDPYFD  198



>gb|KCW88609.1| hypothetical protein EUGRSUZ_A00982 [Eucalyptus grandis]
Length=357

 Score =   259 bits (663),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 114/173 (66%), Positives = 137/173 (79%), Gaps = 0/173 (0%)
 Frame = +3

Query  75   QVVAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAP  254
            QV A K ++Q +++  ILQ+ I+K +NENP AGW+A MNPRFS+FTV QFK LLG K  P
Sbjct  24   QVNAEKSLSQLKLNSHILQNSIIKEINENPNAGWQAAMNPRFSNFTVGQFKHLLGVKPTP  83

Query  255  KSLLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFC  434
               L + P+ TH K ++LP+ FDARTAW QC +I  ILDQGHCGSCWAFGAVESL+DRFC
Sbjct  84   HGELTQVPIKTHPKSLKLPEKFDARTAWSQCSTIGRILDQGHCGSCWAFGAVESLSDRFC  143

Query  435  IHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            IH+G N++LSVNDLLACCGFMCG GC+GGYP+ AW+YF   GVVT EC PYFD
Sbjct  144  IHFGMNISLSVNDLLACCGFMCGAGCNGGYPMFAWRYFMHHGVVTEECYPYFD  196



>ref|XP_003554589.1| PREDICTED: cathepsin B-like [Glycine max]
Length=356

 Score =   259 bits (661),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 112/169 (66%), Positives = 134/169 (79%), Gaps = 0/169 (0%)
 Frame = +3

Query  87   VKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSLL  266
             +P+T  +++  ILQ+ I K +NENPEAGW+A +NP FS++TV QFKRLLG K  PK  L
Sbjct  27   AQPLTSLKLNSPILQESIAKEINENPEAGWEAAINPHFSNYTVEQFKRLLGVKPTPKKEL  86

Query  267  KRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYG  446
            + TP  +H K ++LPK FDARTAW QC +I  ILDQGHCGSCWAFGAVESL+DRFCIH+ 
Sbjct  87   RSTPAISHPKSLKLPKNFDARTAWSQCSTIGRILDQGHCGSCWAFGAVESLSDRFCIHFD  146

Query  447  TNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
             N++LSVNDLLACCGF+CG GCDGGYP+ AWQY    GVVT ECDPYFD
Sbjct  147  VNISLSVNDLLACCGFLCGSGCDGGYPLYAWQYLAHHGVVTEECDPYFD  195



>gb|KDP28374.1| hypothetical protein JCGZ_14145 [Jatropha curcas]
Length=358

 Score =   258 bits (660),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 110/173 (64%), Positives = 139/173 (80%), Gaps = 0/173 (0%)
 Frame = +3

Query  75   QVVAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAP  254
            QV+A  P ++ ++  ++LQD I++ +NENP AGW+A MNPRFS++TV +FK LLG K  P
Sbjct  23   QVIAEAPDSKLKLSSRVLQDSIIRKINENPNAGWEAAMNPRFSNYTVGEFKYLLGVKPTP  82

Query  255  KSLLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFC  434
            K  L+  P+ +H K ++LPK FDAR+AWPQC +I  ILDQGHCGSCWAFGAVESL+DRFC
Sbjct  83   KKELRGVPLVSHPKSLKLPKEFDARSAWPQCSTIGRILDQGHCGSCWAFGAVESLSDRFC  142

Query  435  IHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            I++G N++LSVNDLLACCGF+CG GCDGGYP+ AW+Y    GVVT ECDPYFD
Sbjct  143  INFGMNISLSVNDLLACCGFLCGNGCDGGYPLYAWRYLVHHGVVTEECDPYFD  195



>ref|XP_002320244.2| putative cathepsin B-like protease family protein [Populus trichocarpa]
 gb|EEE98559.2| putative cathepsin B-like protease family protein [Populus trichocarpa]
Length=339

 Score =   258 bits (658),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 112/173 (65%), Positives = 141/173 (82%), Gaps = 0/173 (0%)
 Frame = +3

Query  75   QVVAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAP  254
            Q  A +PV++ +++ +ILQD IV+ VNENP+AGW+A MNP+FS+++V +FK LLG K+ P
Sbjct  6    QATAEEPVSKLKLNSRILQDSIVQKVNENPKAGWEATMNPQFSNYSVGEFKYLLGVKQTP  65

Query  255  KSLLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFC  434
            +  L+  P+  H K ++LP  FDARTAWP C +I  ILDQGHCGSCWAFGAVESL+DRFC
Sbjct  66   RKELRGVPLLRHPKSMKLPIEFDARTAWPHCSTIGRILDQGHCGSCWAFGAVESLSDRFC  125

Query  435  IHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            IHYG N++LSVNDLLACCG+MCG GCDGG PI AW+YF ++GVVT ECDPYFD
Sbjct  126  IHYGMNLSLSVNDLLACCGWMCGAGCDGGSPIDAWRYFVQSGVVTEECDPYFD  178



>ref|XP_006491435.1| PREDICTED: cathepsin B-like isoform X3 [Citrus sinensis]
Length=289

 Score =   256 bits (653),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 111/160 (69%), Positives = 135/160 (84%), Gaps = 0/160 (0%)
 Frame = +3

Query  96   VTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSLLKRT  275
            V++ ++D  ILQD I+K VNENP+AGWKA  NP+FS++TV QFK LLG K  PK LL   
Sbjct  36   VSKLKLDSHILQDSIIKEVNENPKAGWKAARNPQFSNYTVGQFKHLLGVKPTPKGLLLGV  95

Query  276  PVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYGTNV  455
            PV THDK ++LPK+FDAR+AWPQC +I+ ILDQGHCGSCWAFGAVE+L+DRFCIH+G N+
Sbjct  96   PVKTHDKSLKLPKSFDARSAWPQCSTISRILDQGHCGSCWAFGAVEALSDRFCIHFGMNL  155

Query  456  TLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSE  575
            +LSVNDLLACCGF+CG+GCDGGYPI+AW+YF   GVVT E
Sbjct  156  SLSVNDLLACCGFLCGDGCDGGYPISAWRYFVHHGVVTEE  195



>gb|ACU24206.1| unknown [Glycine max]
Length=327

 Score =   257 bits (656),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 111/169 (66%), Positives = 134/169 (79%), Gaps = 0/169 (0%)
 Frame = +3

Query  87   VKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSLL  266
             +P+T  +++  ILQ+   K +NENPEAGW+A +NPRFS++TV QFKRLLG K  PK  L
Sbjct  28   AQPLTSLKLNSHILQESTAKEINENPEAGWEAAINPRFSNYTVEQFKRLLGVKPMPKKEL  87

Query  267  KRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYG  446
            + TP  +H K ++LPK FDARTAW QC +I  ILDQGHCGSCWAFGAVESL+DRFCIH+ 
Sbjct  88   RSTPAISHPKTLKLPKNFDARTAWSQCSTIGRILDQGHCGSCWAFGAVESLSDRFCIHFD  147

Query  447  TNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
             N++LSVNDLLACCGF+CG GCDGGYP+ AW+Y    GVVT ECDPYFD
Sbjct  148  VNISLSVNDLLACCGFLCGSGCDGGYPLYAWRYLAHHGVVTEECDPYFD  196



>ref|XP_006375410.1| hypothetical protein POPTR_0014s10540g [Populus trichocarpa]
 gb|ERP53207.1| hypothetical protein POPTR_0014s10540g [Populus trichocarpa]
Length=352

 Score =   258 bits (658),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 112/173 (65%), Positives = 141/173 (82%), Gaps = 0/173 (0%)
 Frame = +3

Query  75   QVVAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAP  254
            Q  A +PV++ +++ +ILQD IV+ VNENP+AGW+A MNP+FS+++V +FK LLG K+ P
Sbjct  19   QATAEEPVSKLKLNSRILQDSIVQKVNENPKAGWEATMNPQFSNYSVGEFKYLLGVKQTP  78

Query  255  KSLLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFC  434
            +  L+  P+  H K ++LP  FDARTAWP C +I  ILDQGHCGSCWAFGAVESL+DRFC
Sbjct  79   RKELRGVPLLRHPKSMKLPIEFDARTAWPHCSTIGRILDQGHCGSCWAFGAVESLSDRFC  138

Query  435  IHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            IHYG N++LSVNDLLACCG+MCG GCDGG PI AW+YF ++GVVT ECDPYFD
Sbjct  139  IHYGMNLSLSVNDLLACCGWMCGAGCDGGSPIDAWRYFVQSGVVTEECDPYFD  191



>emb|CAB62589.1| putative cathepsin B-like protease [Pisum sativum]
Length=206

 Score =   252 bits (644),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 113/155 (73%), Positives = 127/155 (82%), Gaps = 0/155 (0%)
 Frame = +3

Query  129  QDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSLLKRTPVATHDKQIEL  308
            Q+ I K VNENP AGWKA +NPRFS+ TV QFKRLLG K+ P++ L   PV TH K + L
Sbjct  43   QESIAKEVNENPGAGWKAAINPRFSNSTVGQFKRLLGVKQTPRNELSSIPVVTHPKSLNL  102

Query  309  PKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYGTNVTLSVNDLLACC  488
            PK FDARTAWPQC +I  ILDQGHCGSCWAFGAVESL+DRFCIH+G +V LSVNDLLACC
Sbjct  103  PKEFDARTAWPQCSTIGRILDQGHCGSCWAFGAVESLSDRFCIHFGVDVPLSVNDLLACC  162

Query  489  GFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            GF+CG GCDGGYPI+AW+YF   GVVT ECDPYFD
Sbjct  163  GFLCGSGCDGGYPISAWKYFAHHGVVTEECDPYFD  197



>ref|XP_003521632.1| PREDICTED: cathepsin B [Glycine max]
 gb|KHN14189.1| Cathepsin B [Glycine soja]
Length=357

 Score =   258 bits (658),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 111/169 (66%), Positives = 134/169 (79%), Gaps = 0/169 (0%)
 Frame = +3

Query  87   VKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSLL  266
             +P+T  +++  ILQ+   K +NENPEAGW+A +NPRFS++TV QFKRLLG K  PK  L
Sbjct  28   AQPLTSLKLNSHILQESTAKEINENPEAGWEAAINPRFSNYTVEQFKRLLGVKPMPKKEL  87

Query  267  KRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYG  446
            + TP  +H K ++LPK FDARTAW QC +I  ILDQGHCGSCWAFGAVESL+DRFCIH+ 
Sbjct  88   RSTPAISHPKTLKLPKNFDARTAWSQCSTIGRILDQGHCGSCWAFGAVESLSDRFCIHFD  147

Query  447  TNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
             N++LSVNDLLACCGF+CG GCDGGYP+ AW+Y    GVVT ECDPYFD
Sbjct  148  VNISLSVNDLLACCGFLCGSGCDGGYPLYAWRYLAHHGVVTEECDPYFD  196



>ref|XP_009393126.1| PREDICTED: cathepsin B-like [Musa acuminata subsp. malaccensis]
Length=358

 Score =   257 bits (657),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 111/173 (64%), Positives = 135/173 (78%), Gaps = 0/173 (0%)
 Frame = +3

Query  75   QVVAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAP  254
            QV AVKP+ +   D  ILQ+ I++ +N NP AGWKA MN RF ++T+ QFK +LG K  P
Sbjct  25   QVFAVKPMPRLRTDSMILQNSIIQKINANPNAGWKASMNSRFENYTIGQFKHILGVKPMP  84

Query  255  KSLLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFC  434
             + +   P  T+ K ++LPK FDARTAWPQC +I  ILDQGHCGSCWAFGAVESL+DRFC
Sbjct  85   HNEVMDIPTKTYTKSLKLPKQFDARTAWPQCSTIGRILDQGHCGSCWAFGAVESLSDRFC  144

Query  435  IHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            +H+G N++LSVNDLL+CCGFMCG+GCDGGYPI AW+YF   GVVT ECDPYFD
Sbjct  145  VHFGMNISLSVNDLLSCCGFMCGDGCDGGYPIRAWRYFVENGVVTDECDPYFD  197



>ref|XP_004233222.1| PREDICTED: cathepsin B-like [Solanum lycopersicum]
Length=354

 Score =   257 bits (657),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 116/173 (67%), Positives = 138/173 (80%), Gaps = 0/173 (0%)
 Frame = +3

Query  75   QVVAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAP  254
            QVVA KP+++++ +  IL++ I+K VNEN +AGWKA  NPRFS+FTVSQFKRLLG K   
Sbjct  23   QVVAEKPISEAKGESVILRESIIKEVNENGKAGWKAAFNPRFSNFTVSQFKRLLGVKPPR  82

Query  255  KSLLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFC  434
            +  LK  P+ TH K   LPK FDARTAW +C +I  ILDQGHCGSCWAFGAVESL+DRFC
Sbjct  83   EGDLKSIPILTHPKLKNLPKEFDARTAWSECSTIGRILDQGHCGSCWAFGAVESLSDRFC  142

Query  435  IHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            IHYG N++LSVND++ACCGF CG GCDGG PIAAW YF R GVV+ +CDPYFD
Sbjct  143  IHYGLNISLSVNDVIACCGFHCGNGCDGGSPIAAWHYFIRKGVVSEKCDPYFD  195



>gb|AGV54421.1| cathepsin B-like protein [Phaseolus vulgaris]
Length=356

 Score =   257 bits (656),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 112/168 (67%), Positives = 133/168 (79%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   KPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSLLK  269
            +P+T   +   ILQ  I K +NENPEAGW+A +NPRFS++TV QFKRLLG K+ PK  L+
Sbjct  28   EPLTTLHLKSPILQKSIAKQINENPEAGWEAAINPRFSNYTVEQFKRLLGVKQTPKIELR  87

Query  270  RTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYGT  449
             TPV +H K ++LP  FDARTAW QC +I  ILDQGHCGSCWAFGAVESL+DRFCIH+  
Sbjct  88   STPVISHSKSLKLPVNFDARTAWSQCNTIGRILDQGHCGSCWAFGAVESLSDRFCIHFDV  147

Query  450  NVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            N++LSVNDLLACCGF+CG GCDGGYP+ AW+Y    GVVT ECDPYFD
Sbjct  148  NISLSVNDLLACCGFLCGSGCDGGYPLYAWRYLAHHGVVTEECDPYFD  195



>ref|XP_010103115.1| Cathepsin B [Morus notabilis]
 gb|EXB94880.1| Cathepsin B [Morus notabilis]
Length=342

 Score =   256 bits (654),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 131/155 (85%), Gaps = 0/155 (0%)
 Frame = +3

Query  129  QDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSLLKRTPVATHDKQIEL  308
            Q+ IVK VNENPEAGW+A MNPRFS+ TV++F+R+LG K  PK  L+  PV T+ K ++L
Sbjct  27   QESIVKHVNENPEAGWEAAMNPRFSNSTVAEFRRMLGVKPRPKQDLRSAPVKTYPKSLKL  86

Query  309  PKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYGTNVTLSVNDLLACC  488
            PK FDARTAWPQC +I  ILDQGHCGSCWAFGAVESL+DRFCIH+G N++LSVNDLLACC
Sbjct  87   PKEFDARTAWPQCSTIGRILDQGHCGSCWAFGAVESLSDRFCIHFGLNISLSVNDLLACC  146

Query  489  GFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            GF CGEGCDGGYP+ AW+Y  R+GVVT ECDPYFD
Sbjct  147  GFFCGEGCDGGYPLEAWEYLARSGVVTEECDPYFD  181



>ref|XP_008776548.1| PREDICTED: cathepsin B-like isoform X3 [Phoenix dactylifera]
Length=368

 Score =   256 bits (655),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 113/173 (65%), Positives = 135/173 (78%), Gaps = 0/173 (0%)
 Frame = +3

Query  75   QVVAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAP  254
            QV+A K + +      ILQ+ I++ +N NP AGWKA MN RF ++T+ QFK LLG K  P
Sbjct  35   QVIAAKRMPKLRTGSMILQNSIIEKINANPNAGWKASMNSRFVNYTIDQFKHLLGVKPMP  94

Query  255  KSLLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFC  434
             + L+  PV TH K + LPK FDARTAWPQC +I  IL QGHCGSCWAFGAVESL+DRFC
Sbjct  95   CNTLEDIPVMTHQKSLNLPKQFDARTAWPQCSTIGRILGQGHCGSCWAFGAVESLSDRFC  154

Query  435  IHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            IH+G N++LSVNDLLACCGFMCG+GCDGGYPI AW+YF ++GVVT ECDPYFD
Sbjct  155  IHFGMNISLSVNDLLACCGFMCGDGCDGGYPIYAWRYFIQSGVVTEECDPYFD  207



>ref|XP_003626103.1| Cathepsin B [Medicago truncatula]
 gb|ABD32840.1| Peptidase C1A, papain; Somatotropin hormone; Peptidase C1, propeptide 
[Medicago truncatula]
Length=357

 Score =   256 bits (655),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 114/162 (70%), Positives = 131/162 (81%), Gaps = 0/162 (0%)
 Frame = +3

Query  108  EVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSLLKRTPVAT  287
            +++  ILQ+ I K +NENPEAGW+A +NPRFS+FTV QFKRLLG K+APK  L  TPV T
Sbjct  35   KLNSHILQESIAKQINENPEAGWEAAINPRFSNFTVGQFKRLLGVKQAPKKELLSTPVVT  94

Query  288  HDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYGTNVTLSV  467
            H K ++LPK FDARTAW QC +I  ILDQGHCGSCWAFGAVESL DRFCIH+  N++LSV
Sbjct  95   HPKSLKLPKEFDARTAWSQCSTIGKILDQGHCGSCWAFGAVESLQDRFCIHFDMNISLSV  154

Query  468  NDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            NDLLACCGF+CG GCDGG PI AW+Y    GVVT ECDPYFD
Sbjct  155  NDLLACCGFLCGAGCDGGTPIYAWRYLAHHGVVTEECDPYFD  196



>gb|ACJ84734.1| unknown [Medicago truncatula]
 gb|AFK40806.1| unknown [Medicago truncatula]
 gb|AES82321.2| cathepsin B-like cysteine protease [Medicago truncatula]
Length=359

 Score =   256 bits (654),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 114/162 (70%), Positives = 131/162 (81%), Gaps = 0/162 (0%)
 Frame = +3

Query  108  EVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSLLKRTPVAT  287
            +++  ILQ+ I K +NENPEAGW+A +NPRFS+FTV QFKRLLG K+APK  L  TPV T
Sbjct  37   KLNSHILQESIAKQINENPEAGWEAAINPRFSNFTVGQFKRLLGVKQAPKKELLSTPVVT  96

Query  288  HDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYGTNVTLSV  467
            H K ++LPK FDARTAW QC +I  ILDQGHCGSCWAFGAVESL DRFCIH+  N++LSV
Sbjct  97   HPKSLKLPKEFDARTAWSQCSTIGKILDQGHCGSCWAFGAVESLQDRFCIHFDMNISLSV  156

Query  468  NDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            NDLLACCGF+CG GCDGG PI AW+Y    GVVT ECDPYFD
Sbjct  157  NDLLACCGFLCGAGCDGGTPIYAWRYLAHHGVVTEECDPYFD  198



>ref|XP_006840260.1| hypothetical protein AMTR_s00045p00036790 [Amborella trichopoda]
 gb|ERN01935.1| hypothetical protein AMTR_s00045p00036790 [Amborella trichopoda]
Length=351

 Score =   256 bits (653),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 110/173 (64%), Positives = 140/173 (81%), Gaps = 0/173 (0%)
 Frame = +3

Query  75   QVVAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAP  254
            +V AVKP+  ++    ILQD I++ +N NP AGW+A +NPRFS++T+ QFK +LG K  P
Sbjct  19   EVQAVKPIPPTKDKTHILQDSIIEKINGNPNAGWQAALNPRFSNYTIGQFKYILGVKPVP  78

Query  255  KSLLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFC  434
            ++ L   P+  ++K ++LPK FDARTAW QC +I+ ILDQGHCGSCWAFGAVESL+DRFC
Sbjct  79   QNSLVPVPIRRYEKTVKLPKDFDARTAWTQCATISRILDQGHCGSCWAFGAVESLSDRFC  138

Query  435  IHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            IH+G N++LSVNDLL+CCGFMCG+GCDGGYPI AW+YF + GVVT ECDPYFD
Sbjct  139  IHFGMNISLSVNDLLSCCGFMCGDGCDGGYPIYAWRYFVQNGVVTEECDPYFD  191



>ref|XP_004494492.1| PREDICTED: cathepsin B-like [Cicer arietinum]
Length=364

 Score =   256 bits (653),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 113/166 (68%), Positives = 135/166 (81%), Gaps = 0/166 (0%)
 Frame = +3

Query  96   VTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSLLKRT  275
            +TQ +++  ILQ+ I K +NENP AGWKA +NPRFS+FTV QFKRLLG K+ P++ L  T
Sbjct  30   LTQLKLNSHILQESIAKQINENPGAGWKAAINPRFSNFTVGQFKRLLGVKQTPRNELINT  89

Query  276  PVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYGTNV  455
            P+ TH K  +LPK FDARTAW QC +I  ILDQGHCGSCWAFGAVESL+DRFCIH+  NV
Sbjct  90   PIVTHPKSFKLPKDFDARTAWSQCSTIGRILDQGHCGSCWAFGAVESLSDRFCIHFDVNV  149

Query  456  TLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            +LSVNDLLACCGF+CG GCDGG P++AW+Y  + GVVT ECDPYFD
Sbjct  150  SLSVNDLLACCGFLCGSGCDGGDPLSAWRYLAQHGVVTEECDPYFD  195



>ref|NP_563648.1| putative cathepsin B-like cysteine protease [Arabidopsis thaliana]
 gb|AAL16267.1|AF428337_1 At1g02300/T6A9_10 [Arabidopsis thaliana]
 gb|AAK63991.1| At1g02300/T6A9_10 [Arabidopsis thaliana]
 gb|AAN72238.1| At1g02300/T6A9_10 [Arabidopsis thaliana]
 gb|AEE27413.1| putative cathepsin B-like cysteine protease [Arabidopsis thaliana]
Length=362

 Score =   255 bits (651),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 114/173 (66%), Positives = 137/173 (79%), Gaps = 0/173 (0%)
 Frame = +3

Query  75   QVVAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAP  254
            Q +A + +++ ++   ILQ+EIVK VNENP AGWKA  N RF++ TV++FKRLLG K  P
Sbjct  29   QGIAAENLSKQKLTSWILQNEIVKEVNENPNAGWKASFNDRFANATVAEFKRLLGVKPTP  88

Query  255  KSLLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFC  434
            K+     P+ +HD  ++LPK FDARTAW QC SI  ILDQGHCGSCWAFGAVESL+DRFC
Sbjct  89   KTEFLGVPIVSHDISLKLPKEFDARTAWSQCTSIGRILDQGHCGSCWAFGAVESLSDRFC  148

Query  435  IHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            I Y  NV+LSVNDLLACCGF+CG+GC+GGYPIAAW+YF   GVVT ECDPYFD
Sbjct  149  IKYNMNVSLSVNDLLACCGFLCGQGCNGGYPIAAWRYFKHHGVVTEECDPYFD  201



>ref|XP_008776546.1| PREDICTED: cathepsin B-like isoform X1 [Phoenix dactylifera]
Length=369

 Score =   254 bits (650),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 114/174 (66%), Positives = 136/174 (78%), Gaps = 1/174 (1%)
 Frame = +3

Query  75   QVVAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAP  254
            QV+A K + +      ILQ+ I++ +N NP AGWKA MN RF ++T+ QFK LLG K  P
Sbjct  35   QVIAAKRMPKLRTGSMILQNSIIEKINANPNAGWKASMNSRFVNYTIDQFKHLLGVKPMP  94

Query  255  KSLLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILD-QGHCGSCWAFGAVESLTDRF  431
             + L+  PV TH K + LPK FDARTAWPQC +I  ILD QGHCGSCWAFGAVESL+DRF
Sbjct  95   CNTLEDIPVMTHQKSLNLPKQFDARTAWPQCSTIGRILDEQGHCGSCWAFGAVESLSDRF  154

Query  432  CIHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            CIH+G N++LSVNDLLACCGFMCG+GCDGGYPI AW+YF ++GVVT ECDPYFD
Sbjct  155  CIHFGMNISLSVNDLLACCGFMCGDGCDGGYPIYAWRYFIQSGVVTEECDPYFD  208



>ref|XP_008776547.1| PREDICTED: cathepsin B-like isoform X2 [Phoenix dactylifera]
Length=368

 Score =   254 bits (650),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 114/174 (66%), Positives = 136/174 (78%), Gaps = 1/174 (1%)
 Frame = +3

Query  75   QVVAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAP  254
            QV+A K + +      ILQ+ I++ +N NP AGWKA MN RF ++T+ QFK LLG K  P
Sbjct  34   QVIAAKRMPKLRTGSMILQNSIIEKINANPNAGWKASMNSRFVNYTIDQFKHLLGVKPMP  93

Query  255  KSLLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILD-QGHCGSCWAFGAVESLTDRF  431
             + L+  PV TH K + LPK FDARTAWPQC +I  ILD QGHCGSCWAFGAVESL+DRF
Sbjct  94   CNTLEDIPVMTHQKSLNLPKQFDARTAWPQCSTIGRILDEQGHCGSCWAFGAVESLSDRF  153

Query  432  CIHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            CIH+G N++LSVNDLLACCGFMCG+GCDGGYPI AW+YF ++GVVT ECDPYFD
Sbjct  154  CIHFGMNISLSVNDLLACCGFMCGDGCDGGYPIYAWRYFIQSGVVTEECDPYFD  207



>ref|XP_007163268.1| hypothetical protein PHAVU_001G220100g [Phaseolus vulgaris]
 gb|ESW35262.1| hypothetical protein PHAVU_001G220100g [Phaseolus vulgaris]
Length=357

 Score =   254 bits (649),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 111/168 (66%), Positives = 132/168 (79%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   KPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSLLK  269
            +P+T   +   ILQ  I K +NENPEAGW+A +NPRFS++TV QFKRLLG K+ PK  L+
Sbjct  28   EPLTTLHLKSPILQKSIAKQINENPEAGWEAALNPRFSNYTVEQFKRLLGVKQTPKIELR  87

Query  270  RTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYGT  449
             TPV +H K ++LP  FDAR AW QC +I  ILDQGHCGSCWAFGAVESL+DRFCIH+  
Sbjct  88   STPVISHPKSLKLPVNFDARKAWSQCNTIGRILDQGHCGSCWAFGAVESLSDRFCIHFDV  147

Query  450  NVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            N++LSVNDLLACCGF+CG GCDGGYP+ AW+Y    GVVT ECDPYFD
Sbjct  148  NISLSVNDLLACCGFLCGSGCDGGYPLYAWRYLAHHGVVTEECDPYFD  195



>ref|XP_006362603.1| PREDICTED: cathepsin B-like [Solanum tuberosum]
Length=354

 Score =   254 bits (649),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 115/173 (66%), Positives = 135/173 (78%), Gaps = 0/173 (0%)
 Frame = +3

Query  75   QVVAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAP  254
            QV A KP+++++ +  ILQ+ I+K VNEN +AGWKA  NPRFS+FTVSQFK LLG K   
Sbjct  23   QVFAEKPISEAKGESVILQESIIKEVNENVKAGWKAAFNPRFSNFTVSQFKFLLGVKPPR  82

Query  255  KSLLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFC  434
            +  LK  P+ TH K   LPK FDARTAWPQC +I  ILDQGHCGSCWAFGAVESL+DRFC
Sbjct  83   EGDLKSIPILTHPKLKNLPKEFDARTAWPQCSTIGRILDQGHCGSCWAFGAVESLSDRFC  142

Query  435  IHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            IHYG N++LSVND++ACCGF CG GCDGG PI AW YF   GVV+ +CDPYFD
Sbjct  143  IHYGLNISLSVNDVIACCGFYCGNGCDGGSPIRAWHYFIHKGVVSEKCDPYFD  195



>gb|AFK38097.1| unknown [Lotus japonicus]
Length=357

 Score =   254 bits (648),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 111/175 (63%), Positives = 140/175 (80%), Gaps = 2/175 (1%)
 Frame = +3

Query  75   QVVAVKP--VTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKK  248
            Q+   +P  ++  +++ +ILQ+ I K +NENP AGW+A ++PRFS++TV+QFKRLLG K 
Sbjct  22   QIAEAEPQQLSTLKLNSRILQESIAKEINENPGAGWEAAISPRFSNYTVAQFKRLLGVKP  81

Query  249  APKSLLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDR  428
            +PK  L+ TPV +H + ++LPK+FDARTAW QC +I  ILDQGHCGSCWAFGAVESL+DR
Sbjct  82   SPKKELRSTPVVSHPRSLKLPKSFDARTAWSQCSTIGRILDQGHCGSCWAFGAVESLSDR  141

Query  429  FCIHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            FCIH   NV+LSVNDLLACCGF+CG GCDGGYP+ AW+Y    GVVT ECDPYFD
Sbjct  142  FCIHLDVNVSLSVNDLLACCGFLCGSGCDGGYPLYAWRYLAHHGVVTEECDPYFD  196



>ref|XP_009111203.1| PREDICTED: cathepsin B [Brassica rapa]
Length=357

 Score =   253 bits (647),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 112/171 (65%), Positives = 136/171 (80%), Gaps = 0/171 (0%)
 Frame = +3

Query  81   VAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKS  260
            +A + ++Q ++  +ILQ+EIVK VNENP AGW A  N RF++ TV++FKRLLG K  PK+
Sbjct  26   IAAENLSQQKLTSRILQNEIVKEVNENPNAGWIAAFNDRFANSTVAEFKRLLGVKPTPKN  85

Query  261  LLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIH  440
                 PV +HD  ++LPK FDARTAW QC SI  ILDQGHCGSCWAFGAVESL+DRFCI 
Sbjct  86   EFLGVPVVSHDISLKLPKEFDARTAWSQCSSIGRILDQGHCGSCWAFGAVESLSDRFCIK  145

Query  441  YGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            Y  N++LSVNDLLACCGF+CG+GC+GGYPI+AW+YF   GVVT ECDPYFD
Sbjct  146  YNMNISLSVNDLLACCGFLCGQGCNGGYPISAWRYFKHHGVVTEECDPYFD  196



>ref|XP_002889395.1| hypothetical protein ARALYDRAFT_887368 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65654.1| hypothetical protein ARALYDRAFT_887368 [Arabidopsis lyrata subsp. 
lyrata]
Length=360

 Score =   253 bits (647),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 112/173 (65%), Positives = 137/173 (79%), Gaps = 0/173 (0%)
 Frame = +3

Query  75   QVVAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAP  254
            Q +A + +++ ++   ILQ+EIVK VNENP AGWKA  N RF++ TV++FKRLLG K  P
Sbjct  27   QGIAAENLSKQKLTSWILQNEIVKEVNENPNAGWKAAFNDRFANATVAEFKRLLGVKPTP  86

Query  255  KSLLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFC  434
            K+     P+ +HD  ++LPK FDARTAW QC S+  ILDQGHCGSCWAFGAVESL+DRFC
Sbjct  87   KTEFLGVPIVSHDISLKLPKEFDARTAWSQCTSVGRILDQGHCGSCWAFGAVESLSDRFC  146

Query  435  IHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            I Y  N++LSVNDLLACCGF+CG+GC+GGYPIAAW+YF   GVVT ECDPYFD
Sbjct  147  IKYNMNISLSVNDLLACCGFLCGQGCNGGYPIAAWRYFKHHGVVTEECDPYFD  199



>ref|XP_010474644.1| PREDICTED: cathepsin B-like [Camelina sativa]
Length=360

 Score =   253 bits (647),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 110/173 (64%), Positives = 138/173 (80%), Gaps = 0/173 (0%)
 Frame = +3

Query  75   QVVAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAP  254
            Q +A + +++ ++  +ILQ+EIV  VN NP+AGWKA +N RF++ TV++FKRLLG K  P
Sbjct  27   QGIAAENLSKQKLSSRILQNEIVNEVNGNPKAGWKAALNDRFANATVAEFKRLLGVKPTP  86

Query  255  KSLLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFC  434
            K+     P+ +HD  ++LPK FDARTAW QC +I  ILDQGHCGSCWAFGAVESL+DRFC
Sbjct  87   KTEFLGAPIVSHDLSLKLPKEFDARTAWSQCTTIGRILDQGHCGSCWAFGAVESLSDRFC  146

Query  435  IHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            I Y  N++LSVNDLLACCGF+CG+GC+GGYPIAAW+YF   GVVT ECDPYFD
Sbjct  147  IKYNMNISLSVNDLLACCGFLCGQGCNGGYPIAAWRYFKHHGVVTEECDPYFD  199



>ref|XP_010480863.1| PREDICTED: cathepsin B-like [Camelina sativa]
Length=360

 Score =   253 bits (647),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 110/173 (64%), Positives = 138/173 (80%), Gaps = 0/173 (0%)
 Frame = +3

Query  75   QVVAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAP  254
            Q +A + +++ ++  +ILQ+EIV  VN NP+AGWKA +N RF++ TV++FKRLLG K  P
Sbjct  27   QGIAAENLSKQKLSSRILQNEIVNEVNGNPKAGWKAALNDRFANATVAEFKRLLGVKPTP  86

Query  255  KSLLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFC  434
            K+     P+ +HD  ++LPK FDARTAW QC +I  ILDQGHCGSCWAFGAVESL+DRFC
Sbjct  87   KTEFLGVPIVSHDLSLKLPKEFDARTAWSQCTTIGRILDQGHCGSCWAFGAVESLSDRFC  146

Query  435  IHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            I Y  N++LSVNDLLACCGF+CG+GC+GGYPIAAW+YF   GVVT ECDPYFD
Sbjct  147  IKYNMNISLSVNDLLACCGFLCGQGCNGGYPIAAWRYFKHHGVVTEECDPYFD  199



>ref|XP_010457204.1| PREDICTED: cathepsin B-like [Camelina sativa]
Length=360

 Score =   253 bits (646),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 110/173 (64%), Positives = 138/173 (80%), Gaps = 0/173 (0%)
 Frame = +3

Query  75   QVVAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAP  254
            Q +A + +++ ++  +ILQ+EIV  VN NP+AGWKA +N RF++ TV++FKRLLG K  P
Sbjct  27   QGIAAENLSKQKLSSRILQNEIVNEVNGNPKAGWKAALNDRFANATVAEFKRLLGVKPTP  86

Query  255  KSLLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFC  434
            K+     P+ +HD  ++LPK FDARTAW QC +I  ILDQGHCGSCWAFGAVESL+DRFC
Sbjct  87   KTEFLGVPIVSHDLSLKLPKEFDARTAWSQCTTIGRILDQGHCGSCWAFGAVESLSDRFC  146

Query  435  IHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            I Y  N++LSVNDLLACCGF+CG+GC+GGYPIAAW+YF   GVVT ECDPYFD
Sbjct  147  IKYNMNISLSVNDLLACCGFLCGQGCNGGYPIAAWRYFKHHGVVTEECDPYFD  199



>ref|XP_009412165.1| PREDICTED: cathepsin B-like [Musa acuminata subsp. malaccensis]
Length=361

 Score =   253 bits (646),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 111/173 (64%), Positives = 134/173 (77%), Gaps = 0/173 (0%)
 Frame = +3

Query  75   QVVAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAP  254
            QV AV+   Q   D  ILQ  IV+ +N NP AGW+A MN RF ++T+ QFK +LG K  P
Sbjct  28   QVFAVESTPQLRSDSMILQKSIVQEINANPNAGWQAAMNSRFENYTIGQFKHILGVKPTP  87

Query  255  KSLLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFC  434
             + +   P  T+ K ++LPK FDARTAWPQC +I  ILDQGHCGSCWAFGAVESL+DRFC
Sbjct  88   SNEVMDIPKRTYPKSLKLPKQFDARTAWPQCSTIGTILDQGHCGSCWAFGAVESLSDRFC  147

Query  435  IHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            IH+G N++LSVNDLL+CCGFMCG+GCDGGYPI+AW+YF + GVVT ECDPYFD
Sbjct  148  IHFGINISLSVNDLLSCCGFMCGDGCDGGYPISAWRYFVQNGVVTDECDPYFD  200



>gb|ACJ85175.1| unknown [Medicago truncatula]
Length=359

 Score =   252 bits (644),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 112/162 (69%), Positives = 129/162 (80%), Gaps = 0/162 (0%)
 Frame = +3

Query  108  EVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSLLKRTPVAT  287
            +++  ILQ+ I K +NENPEAGW+A +NPRFS+FTV QFKRLLG K+APK  L  TPV T
Sbjct  37   KLNSHILQESIAKQINENPEAGWEAAINPRFSNFTVGQFKRLLGVKQAPKKELLSTPVVT  96

Query  288  HDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYGTNVTLSV  467
            H K ++LPK FDAR AW QC +I  ILDQGHCGSCWAFGAVESL DRFC H+  N++LSV
Sbjct  97   HPKSLKLPKEFDARAAWSQCSTIGKILDQGHCGSCWAFGAVESLQDRFCSHFDMNISLSV  156

Query  468  NDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            NDLLACCGF+CG GCDGG PI AW+Y    GVVT ECDPYFD
Sbjct  157  NDLLACCGFLCGAGCDGGTPIYAWRYLAHHGVVTEECDPYFD  198



>ref|XP_004288649.1| PREDICTED: cathepsin B-like [Fragaria vesca subsp. vesca]
Length=353

 Score =   250 bits (639),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 109/173 (63%), Positives = 134/173 (77%), Gaps = 0/173 (0%)
 Frame = +3

Query  75   QVVAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAP  254
            Q VA KP++QS++   +LQ+ I+K +NENPEAGW+A M+PRFS++TV  F  +LG K+ P
Sbjct  19   QFVAAKPLSQSKLQSPLLQESIIKEINENPEAGWQAAMSPRFSNYTVGDFMHILGVKQIP  78

Query  255  KSLLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFC  434
            K  L   PV +H K ++LP +FDAR AW QC +I  ILDQGHCGSCWAF AVE+L+DRFC
Sbjct  79   KKELLGVPVVSHPKTLKLPNSFDAREAWSQCNTIGRILDQGHCGSCWAFAAVEALSDRFC  138

Query  435  IHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            I +G N +LSVNDLLACCGFMCG GCDGG PI AW+YF   GVVT +CDPYFD
Sbjct  139  IQFGKNTSLSVNDLLACCGFMCGNGCDGGIPIYAWRYFVHHGVVTEKCDPYFD  191



>ref|XP_006305170.1| hypothetical protein CARUB_v10009537mg [Capsella rubella]
 gb|EOA38068.1| hypothetical protein CARUB_v10009537mg [Capsella rubella]
Length=360

 Score =   251 bits (640),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 109/173 (63%), Positives = 137/173 (79%), Gaps = 0/173 (0%)
 Frame = +3

Query  75   QVVAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAP  254
            Q +A + +++ ++  +ILQ+EIV  VN NP+AGWKA +N RF++ TV++FKRLLG K  P
Sbjct  27   QGIAAENLSKQKLSSRILQNEIVNEVNANPKAGWKAALNDRFANATVAEFKRLLGVKPTP  86

Query  255  KSLLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFC  434
            K+     P+ +H   ++LPK FDARTAW QC SI  ILDQGHCGSCWAFGAVESL+DRFC
Sbjct  87   KTEFLGVPIVSHGISLKLPKEFDARTAWSQCTSIGRILDQGHCGSCWAFGAVESLSDRFC  146

Query  435  IHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            I Y  N++LSVNDLLACCGF+CG+GC+GGYPI+AW+YF   GVVT ECDPYFD
Sbjct  147  IKYNMNISLSVNDLLACCGFLCGQGCNGGYPISAWRYFKHHGVVTEECDPYFD  199



>gb|KEH24451.1| cathepsin B-like cysteine protease [Medicago truncatula]
Length=297

 Score =   248 bits (633),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 108/166 (65%), Positives = 131/166 (79%), Gaps = 0/166 (0%)
 Frame = +3

Query  96   VTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSLLKRT  275
            +++ +++  ILQ+ I + +NENPEAGW+A +NPRFS+FTV QFKRLLG K+ P+S L   
Sbjct  25   LSEVKLNSHILQESIARQINENPEAGWEATINPRFSNFTVGQFKRLLGVKQTPRSELSSA  84

Query  276  PVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYGTNV  455
            PV TH K ++LPK FDARTAW QC +I  ILDQGHCGSCWAFGAVESL+DRFCIH+  NV
Sbjct  85   PVVTHPKSLKLPKDFDARTAWSQCSTIGRILDQGHCGSCWAFGAVESLSDRFCIHFDMNV  144

Query  456  TLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            +LSVND+LACCG +CG GC GG P +AW Y    GVVT ECDPYFD
Sbjct  145  SLSVNDILACCGLLCGAGCAGGTPFSAWIYLAHHGVVTEECDPYFD  190



>gb|ACN40436.1| unknown [Picea sitchensis]
Length=350

 Score =   249 bits (637),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 110/158 (70%), Positives = 129/158 (82%), Gaps = 0/158 (0%)
 Frame = +3

Query  120  KILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSLLKRTPVATHDKQ  299
            +IL++ IV+ +N +P AGWKA MN RFS+ TV QFKRLLG    P++ L+  PV T+ K 
Sbjct  34   RILKEPIVEEINRHPNAGWKAGMNSRFSNHTVGQFKRLLGVLPTPRNFLENVPVITYPKG  93

Query  300  IELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYGTNVTLSVNDLL  479
            I LPK FDAR AWPQC S+  ILDQGHCGSCWAFGAVE+L+DRFCIH+  NVTLS NDL+
Sbjct  94   INLPKQFDAREAWPQCTSVQTILDQGHCGSCWAFGAVEALSDRFCIHHKVNVTLSENDLV  153

Query  480  ACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            ACCGFMCG+GCDGGYPI+AWQYF  TGVVT+ECDPYFD
Sbjct  154  ACCGFMCGDGCDGGYPISAWQYFISTGVVTAECDPYFD  191



>ref|XP_003626102.1| Cathepsin L-like proteinase [Medicago truncatula]
Length=351

 Score =   248 bits (634),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 108/166 (65%), Positives = 131/166 (79%), Gaps = 0/166 (0%)
 Frame = +3

Query  96   VTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSLLKRT  275
            +++ +++  ILQ+ I + +NENPEAGW+A +NPRFS+FTV QFKRLLG K+ P+S L   
Sbjct  25   LSEVKLNSHILQESIARQINENPEAGWEATINPRFSNFTVGQFKRLLGVKQTPRSELSSA  84

Query  276  PVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYGTNV  455
            PV TH K ++LPK FDARTAW QC +I  ILDQGHCGSCWAFGAVESL+DRFCIH+  NV
Sbjct  85   PVVTHPKSLKLPKDFDARTAWSQCSTIGRILDQGHCGSCWAFGAVESLSDRFCIHFDMNV  144

Query  456  TLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            +LSVND+LACCG +CG GC GG P +AW Y    GVVT ECDPYFD
Sbjct  145  SLSVNDILACCGLLCGAGCAGGTPFSAWIYLAHHGVVTEECDPYFD  190



>gb|ABK23329.1| unknown [Picea sitchensis]
Length=350

 Score =   248 bits (634),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 109/158 (69%), Positives = 129/158 (82%), Gaps = 0/158 (0%)
 Frame = +3

Query  120  KILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSLLKRTPVATHDKQ  299
            +IL++ IV+ +N +P AGWKA MN RFS+ TV QFKRLLG    P++ L+  PV T+ K 
Sbjct  34   RILKEPIVEEINRHPNAGWKAGMNSRFSNHTVGQFKRLLGVLPTPRNFLENVPVITYPKG  93

Query  300  IELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYGTNVTLSVNDLL  479
            + LPK FDAR AWPQC S+  ILDQGHCGSCWAFGAVE+L+DRFCIH+  NVTLS NDL+
Sbjct  94   MNLPKQFDAREAWPQCTSVQTILDQGHCGSCWAFGAVEALSDRFCIHHKVNVTLSENDLV  153

Query  480  ACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            ACCGFMCG+GCDGGYPI+AWQYF  TGVVT+ECDPYFD
Sbjct  154  ACCGFMCGDGCDGGYPISAWQYFISTGVVTAECDPYFD  191



>gb|ABK21175.1| unknown [Picea sitchensis]
 gb|ABR17096.1| unknown [Picea sitchensis]
 gb|ACN40172.1| unknown [Picea sitchensis]
Length=350

 Score =   248 bits (634),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 109/158 (69%), Positives = 130/158 (82%), Gaps = 0/158 (0%)
 Frame = +3

Query  120  KILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSLLKRTPVATHDKQ  299
            +IL++ IV+ +N +P+AGWKA MN RFS+ TV QFKRLLG    P++LL+  PV T+ K 
Sbjct  34   RILKEPIVEEINRHPKAGWKAGMNSRFSNHTVGQFKRLLGVLPTPRNLLENVPVRTYPKG  93

Query  300  IELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYGTNVTLSVNDLL  479
            + LPK FDAR AWPQC S+  ILDQGHCGSCWAFGAVE+L+DRFCIHY  NVTLS NDL+
Sbjct  94   LNLPKQFDARKAWPQCTSVRTILDQGHCGSCWAFGAVEALSDRFCIHYKVNVTLSENDLV  153

Query  480  ACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            ACCGF CG+GCDGGYP++AWQYF  TGVVT+ECDPYFD
Sbjct  154  ACCGFRCGDGCDGGYPLSAWQYFISTGVVTAECDPYFD  191



>gb|ABD32839.1| Peptidase C1A, papain; Somatotropin hormone; Peptidase C1, propeptide 
[Medicago truncatula]
 gb|AES82320.2| cathepsin B-like cysteine protease [Medicago truncatula]
Length=356

 Score =   248 bits (634),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 108/166 (65%), Positives = 131/166 (79%), Gaps = 0/166 (0%)
 Frame = +3

Query  96   VTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSLLKRT  275
            +++ +++  ILQ+ I + +NENPEAGW+A +NPRFS+FTV QFKRLLG K+ P+S L   
Sbjct  30   LSEVKLNSHILQESIARQINENPEAGWEATINPRFSNFTVGQFKRLLGVKQTPRSELSSA  89

Query  276  PVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYGTNV  455
            PV TH K ++LPK FDARTAW QC +I  ILDQGHCGSCWAFGAVESL+DRFCIH+  NV
Sbjct  90   PVVTHPKSLKLPKDFDARTAWSQCSTIGRILDQGHCGSCWAFGAVESLSDRFCIHFDMNV  149

Query  456  TLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            +LSVND+LACCG +CG GC GG P +AW Y    GVVT ECDPYFD
Sbjct  150  SLSVNDILACCGLLCGAGCAGGTPFSAWIYLAHHGVVTEECDPYFD  195



>gb|KHN43391.1| Cathepsin B [Glycine soja]
Length=368

 Score =   248 bits (633),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 111/180 (62%), Positives = 133/180 (74%), Gaps = 12/180 (7%)
 Frame = +3

Query  90   KPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSLLK  269
            +P+T  +++  ILQ+ I K +NENPEAGW+A +NP FS++TV QFKRLLG K  PK  L+
Sbjct  28   QPLTSLKLNSPILQESIAKEINENPEAGWEAAINPHFSNYTVEQFKRLLGVKPTPKKELR  87

Query  270  RTPVATHDKQIELPKTFDARTAWPQCVSIADILD------------QGHCGSCWAFGAVE  413
             TP  +H K ++LPK FDARTAW QC +I  IL             QGHCGSCWAFGAVE
Sbjct  88   STPAISHPKSLKLPKNFDARTAWSQCSTIGRILGSKSFQLILVLMIQGHCGSCWAFGAVE  147

Query  414  SLTDRFCIHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            SL+DRFCIH+  N++LSVNDLLACCGF+CG GCDGGYP+ AWQY    GVVT ECDPYFD
Sbjct  148  SLSDRFCIHFDVNISLSVNDLLACCGFLCGSGCDGGYPLYAWQYLAHHGVVTEECDPYFD  207



>gb|AHL68670.1| cathepsin B-like cysteine proteinase [Picrorhiza kurrooa]
Length=359

 Score =   246 bits (628),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 105/173 (61%), Positives = 139/173 (80%), Gaps = 0/173 (0%)
 Frame = +3

Query  75   QVVAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAP  254
            Q+ A KP +  +++ +ILQ+ +VK +N+N +AGW+A M+ RF+++TV QF +LLG K   
Sbjct  22   QLNAGKPKSPLKLNSRILQESMVKLINDNAQAGWRATMSSRFANYTVGQFMQLLGVKPMS  81

Query  255  KSLLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFC  434
            +  L+   V TH + ++LP++FDAR  W QC +I +ILDQGHCGSCWAFGAVE+L+DRFC
Sbjct  82   EGDLEGISVITHRRGLKLPRSFDARKTWSQCGTIGEILDQGHCGSCWAFGAVEALSDRFC  141

Query  435  IHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            IH+G N++LSVNDLLACCGFMCG+GCDGGYPI+AW+YF  TGVVT ECDPYFD
Sbjct  142  IHFGKNISLSVNDLLACCGFMCGDGCDGGYPISAWRYFVHTGVVTEECDPYFD  194



>ref|XP_006375409.1| hypothetical protein POPTR_0014s10540g [Populus trichocarpa]
 gb|ERP53206.1| hypothetical protein POPTR_0014s10540g [Populus trichocarpa]
Length=362

 Score =   245 bits (626),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 110/183 (60%), Positives = 139/183 (76%), Gaps = 10/183 (5%)
 Frame = +3

Query  75   QVVAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAP  254
            Q  A +PV++ +++ +ILQD IV+ VNENP+AGW+A MNP+FS+++V +FK LLG K+ P
Sbjct  19   QATAEEPVSKLKLNSRILQDSIVQKVNENPKAGWEATMNPQFSNYSVGEFKYLLGVKQTP  78

Query  255  KSLLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQ----------GHCGSCWAFG  404
            +  L+  P+  H K ++LP  FDARTAWP C +I  IL            GHCGSCWAFG
Sbjct  79   RKELRGVPLLRHPKSMKLPIEFDARTAWPHCSTIGRILGHFLPACIAWFSGHCGSCWAFG  138

Query  405  AVESLTDRFCIHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDP  584
            AVESL+DRFCIHYG N++LSVNDLLACCG+MCG GCDGG PI AW+YF ++GVVT ECDP
Sbjct  139  AVESLSDRFCIHYGMNLSLSVNDLLACCGWMCGAGCDGGSPIDAWRYFVQSGVVTEECDP  198

Query  585  YFD  593
            YFD
Sbjct  199  YFD  201



>ref|XP_010695986.1| PREDICTED: cathepsin B-like [Beta vulgaris subsp. vulgaris]
Length=352

 Score =   245 bits (625),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 104/172 (60%), Positives = 131/172 (76%), Gaps = 0/172 (0%)
 Frame = +3

Query  78   VVAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPK  257
            +   + V + +++  +LQD ++ ++N NP+AGWKA MN + SD+TV QFKR+LGA+K P 
Sbjct  20   IFVAESVPELKLNSNLLQDSMINSINGNPKAGWKAGMNQQLSDYTVGQFKRILGARKTPP  79

Query  258  SLLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCI  437
               +  PV  HD+ ++LPK FDAR AWPQC +I  I DQGHCGSCWA+ AVE+L DRFCI
Sbjct  80   GEKRNIPVVHHDRSLKLPKEFDARKAWPQCRTIGRIYDQGHCGSCWAYAAVEALQDRFCI  139

Query  438  HYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            HYG N++LSVNDLLACCGFMCG GC+GG PI AW+YF   GVVT ECDPYFD
Sbjct  140  HYGMNISLSVNDLLACCGFMCGSGCNGGTPIFAWRYFVHHGVVTEECDPYFD  191



>ref|XP_002515139.1| cathepsin B, putative [Ricinus communis]
 gb|EEF47123.1| cathepsin B, putative [Ricinus communis]
Length=376

 Score =   246 bits (627),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 111/190 (58%), Positives = 140/190 (74%), Gaps = 17/190 (9%)
 Frame = +3

Query  75   QVVAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAP  254
            +V++ +  ++ +++ +ILQ+ I+K VNENP+AGW+A MNP+ S+FTV QFK LLGAK  P
Sbjct  24   RVISTELDSKLKLNSRILQESIIKKVNENPDAGWEAAMNPQLSNFTVGQFKYLLGAKPTP  83

Query  255  KSLLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQ-----------------GHC  383
            K  L   P+ +H K ++LPK FDARTAWP C +I  IL Q                 GHC
Sbjct  84   KKELMGVPMISHPKTLKLPKEFDARTAWPHCSTIGKILGQLLSFYNIFSIFFFLFLEGHC  143

Query  384  GSCWAFGAVESLTDRFCIHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGV  563
            GSCWAFGAVESL+DRFCIH+G N++LSVNDLLACCGF+CG+GCDGGYP+ AW+YF   GV
Sbjct  144  GSCWAFGAVESLSDRFCIHFGMNISLSVNDLLACCGFLCGDGCDGGYPMYAWRYFVHHGV  203

Query  564  VTSECDPYFD  593
            VT ECDPYFD
Sbjct  204  VTEECDPYFD  213



>ref|XP_008651490.1| PREDICTED: LOC100283781 isoform X1 [Zea mays]
Length=347

 Score =   243 bits (620),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 105/170 (62%), Positives = 132/170 (78%), Gaps = 0/170 (0%)
 Frame = +3

Query  87   VKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSLL  266
            V  V   +   +I+Q++I++TVN +P AGW A  NP FS++T++QFK +LG K AP++ L
Sbjct  20   VLGVGNGDNHMRIIQEDIIETVNNHPSAGWTASRNPYFSNYTIAQFKHILGVKPAPQNAL  79

Query  267  KRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYG  446
               PV T+ + +ELPK FDAR+AW +C +I +ILDQGHCGSCWAFGAVE L DRFCIH  
Sbjct  80   SNVPVKTYSRSLELPKEFDARSAWSRCSTIGNILDQGHCGSCWAFGAVECLQDRFCIHLN  139

Query  447  TNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFDP  596
             ++ LSVNDLLACCGFMCG+GCDGGYPI AW+YF + GVVT ECDPYFDP
Sbjct  140  MSILLSVNDLLACCGFMCGDGCDGGYPIEAWRYFVQNGVVTDECDPYFDP  189



>ref|NP_001150152.1| LOC100283781 precursor [Zea mays]
 gb|ACG38052.1| cathepsin B-like cysteine proteinase 3 precursor [Zea mays]
Length=347

 Score =   243 bits (620),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 105/170 (62%), Positives = 132/170 (78%), Gaps = 0/170 (0%)
 Frame = +3

Query  87   VKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSLL  266
            V  V   +   +I+Q++I++TVN +P AGW A  NP FS++T++QFK +LG K AP++ L
Sbjct  20   VLGVGNGDNHMRIIQEDIIETVNNHPSAGWTASRNPYFSNYTIAQFKHILGVKPAPQNAL  79

Query  267  KRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYG  446
               PV T+ + +ELPK FDAR+AW +C +I +ILDQGHCGSCWAFGAVE L DRFCIH  
Sbjct  80   SNVPVKTYSRSLELPKEFDARSAWSRCSTIGNILDQGHCGSCWAFGAVECLQDRFCIHLN  139

Query  447  TNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFDP  596
             ++ LSVNDLLACCGFMCG+GCDGGYPI AW+YF + GVVT ECDPYFDP
Sbjct  140  MSILLSVNDLLACCGFMCGDGCDGGYPIEAWRYFVQNGVVTDECDPYFDP  189



>ref|XP_010045446.1| PREDICTED: cathepsin B-like [Eucalyptus grandis]
Length=380

 Score =   244 bits (623),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 113/196 (58%), Positives = 136/196 (69%), Gaps = 23/196 (12%)
 Frame = +3

Query  75   QVVAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAP  254
            QV A K ++Q +++  ILQ+ I+K +NENP AGW+A MNPRFS+FTV QFK LLG K  P
Sbjct  24   QVNAEKSLSQLKLNSHILQNSIIKEINENPNAGWQAAMNPRFSNFTVGQFKHLLGVKPTP  83

Query  255  KSLLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQ--------------------  374
               L + P+ TH K ++LP+ FDARTAW QC +I  IL Q                    
Sbjct  84   HGELTQVPIKTHPKSLKLPEKFDARTAWSQCSTIGRILGQFVCLVFHLIYSRYYADAFSL  143

Query  375  ---GHCGSCWAFGAVESLTDRFCIHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQY  545
               GHCGSCWAFGAVESL+DRFCIH+G N++LSVNDLLACCGFMCG GC+GGYP+ AW+Y
Sbjct  144  LCDGHCGSCWAFGAVESLSDRFCIHFGMNISLSVNDLLACCGFMCGAGCNGGYPMFAWRY  203

Query  546  FTRTGVVTSECDPYFD  593
            F   GVVT EC PYFD
Sbjct  204  FMHHGVVTEECYPYFD  219



>ref|XP_006664962.1| PREDICTED: cathepsin B-like isoform X1 [Oryza brachyantha]
 ref|XP_006664963.1| PREDICTED: cathepsin B-like isoform X2 [Oryza brachyantha]
 ref|XP_006664964.1| PREDICTED: cathepsin B-like isoform X3 [Oryza brachyantha]
Length=362

 Score =   243 bits (619),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 103/158 (65%), Positives = 125/158 (79%), Gaps = 0/158 (0%)
 Frame = +3

Query  120  KILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSLLKRTPVATHDKQ  299
            +I+QD+I+KT+N++P AGW A  NP F+++TV+QFK +LG K  P SLL   P  T+ + 
Sbjct  46   RIIQDDIIKTINKHPNAGWTAAQNPYFANYTVAQFKHILGVKATPHSLLSNVPAKTYSRS  105

Query  300  IELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYGTNVTLSVNDLL  479
            + LPK FDAR+AW  C +I  ILDQGHCGSCWAFGAVE L DRFCIH+  N +LSVNDLL
Sbjct  106  LMLPKEFDARSAWSHCSTIGTILDQGHCGSCWAFGAVECLQDRFCIHFNMNTSLSVNDLL  165

Query  480  ACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            ACCGFMCG+GCDGGYPI AW+YF + GVVT ECDPYFD
Sbjct  166  ACCGFMCGDGCDGGYPIMAWRYFVQNGVVTDECDPYFD  203



>ref|XP_006664995.1| PREDICTED: cathepsin B-like isoform X1 [Oryza brachyantha]
 ref|XP_006664996.1| PREDICTED: cathepsin B-like isoform X2 [Oryza brachyantha]
Length=362

 Score =   243 bits (619),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 102/158 (65%), Positives = 126/158 (80%), Gaps = 0/158 (0%)
 Frame = +3

Query  120  KILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSLLKRTPVATHDKQ  299
            +I+QD+I+KT+N++P AGW A  NP F+++TV+QFK +LG K  P SLL   P  T+ + 
Sbjct  46   RIIQDDIIKTINKHPNAGWTAAQNPYFANYTVAQFKHILGVKATPHSLLSNVPAKTYSRS  105

Query  300  IELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYGTNVTLSVNDLL  479
            + LPK FDAR+AW  C +I  ILDQGHCGSCWAFGAVE L DRFCIH+  N++LSVNDLL
Sbjct  106  LMLPKEFDARSAWSHCSTIGTILDQGHCGSCWAFGAVECLQDRFCIHFNMNISLSVNDLL  165

Query  480  ACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            +CCGFMCG+GCDGGYPI AW+YF + GVVT ECDPYFD
Sbjct  166  SCCGFMCGDGCDGGYPIMAWRYFVQNGVVTDECDPYFD  203



>emb|CDY61859.1| BnaAnng17870D [Brassica napus]
Length=364

 Score =   243 bits (619),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 110/178 (62%), Positives = 134/178 (75%), Gaps = 7/178 (4%)
 Frame = +3

Query  81   VAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKS  260
            +A + ++Q ++  +ILQ+EIVK VNENP AGW A  N RF++ TV++FKRLLG K  PK+
Sbjct  26   IAAENLSQQKLTSRILQNEIVKEVNENPNAGWIAAFNDRFANSTVAEFKRLLGVKPTPKN  85

Query  261  LLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQG-------HCGSCWAFGAVESL  419
                 PV +HD  ++LPK FDARTAW QC SI  IL  G       HCGSCWAFGAVESL
Sbjct  86   EFLGVPVVSHDISLKLPKEFDARTAWSQCSSIGRILGHGIYTKLYGHCGSCWAFGAVESL  145

Query  420  TDRFCIHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            +DRFCI Y  N++LSVNDLLACCGF+CG+GC+GGYPI+AW+YF   GVVT ECDPYFD
Sbjct  146  SDRFCIKYNMNISLSVNDLLACCGFLCGQGCNGGYPISAWRYFKHHGVVTEECDPYFD  203



>tpg|DAA62884.1| TPA: cathepsin B-like cysteine proteinase 3 [Zea mays]
Length=347

 Score =   241 bits (616),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 104/170 (61%), Positives = 132/170 (78%), Gaps = 0/170 (0%)
 Frame = +3

Query  87   VKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSLL  266
            V  V   +   +I+Q++I++TVN +P AGW A  NP FS++T++QFK +LG K AP++ L
Sbjct  20   VLGVGNGDNHMRIIQEDIIETVNNHPSAGWTASRNPYFSNYTIAQFKHILGVKPAPQNAL  79

Query  267  KRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYG  446
               PV T+ + +ELPK FDAR+AW +C +I +IL+QGHCGSCWAFGAVE L DRFCIH  
Sbjct  80   SNVPVKTYSRSLELPKEFDARSAWSRCSTIGNILEQGHCGSCWAFGAVECLQDRFCIHLN  139

Query  447  TNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFDP  596
             ++ LSVNDLLACCGFMCG+GCDGGYPI AW+YF + GVVT ECDPYFDP
Sbjct  140  MSILLSVNDLLACCGFMCGDGCDGGYPIEAWRYFVQNGVVTDECDPYFDP  189



>emb|CBI37076.3| unnamed protein product [Vitis vinifera]
Length=392

 Score =   243 bits (620),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 115/209 (55%), Positives = 140/209 (67%), Gaps = 36/209 (17%)
 Frame = +3

Query  75   QVVAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAP  254
            +VVA+K V+Q + + KILQ+ +V+ +N NP+AGWKA MNPRFS+++V QF  LLG K   
Sbjct  22   EVVALKSVSQLKFNTKILQESMVELINANPKAGWKAAMNPRFSNYSVGQFMHLLGVKPTL  81

Query  255  KSLLKRTPVATHDKQIELPKTFDARTAWPQCVSIADIL----------------------  368
            +  L+  PV TH K ++LPK FDARTAWPQC +I  IL                      
Sbjct  82   QKDLEGVPVITHPKTLKLPKHFDARTAWPQCSTIGKILGRLLDSFSSYFDDFFCFGCTDA  141

Query  369  --------------DQGHCGSCWAFGAVESLTDRFCIHYGTNVTLSVNDLLACCGFMCGE  506
                          DQGHCGSCWAFGAVESL+DRFCIH+G N++LSVNDLLACCGF+CG 
Sbjct  142  LYFSYHLLVPFYIKDQGHCGSCWAFGAVESLSDRFCIHFGMNISLSVNDLLACCGFLCGS  201

Query  507  GCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            GCDGGYP+ AW+YF   GVVT ECDPYFD
Sbjct  202  GCDGGYPLYAWRYFIHHGVVTEECDPYFD  230



>gb|AAX11351.1| cathepsin B-like cysteine protease [Oryza sativa Japonica Group]
 gb|EAY97476.1| hypothetical protein OsI_19406 [Oryza sativa Indica Group]
 dbj|BAG89222.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94499.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87079.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE63190.1| hypothetical protein OsJ_17999 [Oryza sativa Japonica Group]
Length=358

 Score =   241 bits (615),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 106/176 (60%), Positives = 132/176 (75%), Gaps = 6/176 (3%)
 Frame = +3

Query  84   AVKPV------TQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAK  245
            A KP+      T+     +I+QD+I+K +N++P AGW A  NP F+++T +QFK +LG K
Sbjct  22   AAKPIPNLQLMTKEGGSSRIIQDDIIKAINKHPNAGWTAARNPYFANYTTAQFKHILGVK  81

Query  246  KAPKSLLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTD  425
              P S+L   PV T+ + + LPK FDAR+AW QC +I  ILDQGHCGSCWAFGAVE L D
Sbjct  82   PTPHSVLNDVPVKTYPRSLMLPKEFDARSAWSQCNTIGTILDQGHCGSCWAFGAVECLQD  141

Query  426  RFCIHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            RFCIH+  N++LSVNDL+ACCGFMCG+GCDGGYPI AW+YF R GVVT ECDPYFD
Sbjct  142  RFCIHFNMNISLSVNDLVACCGFMCGDGCDGGYPIMAWRYFVRNGVVTDECDPYFD  197



>ref|XP_004969895.1| PREDICTED: cathepsin B-like isoform X1 [Setaria italica]
 ref|XP_004969896.1| PREDICTED: cathepsin B-like isoform X2 [Setaria italica]
Length=360

 Score =   237 bits (604),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 104/179 (58%), Positives = 133/179 (74%), Gaps = 7/179 (4%)
 Frame = +3

Query  78   VVAVKPVTQSEVDPK-------ILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLL  236
            V AVKP+  S +  +       I+Q +I++TVN++P+AGW A  NP F+++T++QFK +L
Sbjct  23   VRAVKPIPNSNLGVEEGDNSIGIIQKDIIQTVNKHPDAGWTAAHNPYFANYTIAQFKHIL  82

Query  237  GAKKAPKSLLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVES  416
            G K  P+  L   P  T+ + ++LPK FDAR+ W  C +I +ILDQGHCGSCWAFGAVE 
Sbjct  83   GVKPTPRDALTDVPAKTYSRSLKLPKEFDARSKWSHCSTIGNILDQGHCGSCWAFGAVEC  142

Query  417  LTDRFCIHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            L DRFCIH   N++LSVNDLLACCGFMCG+GCDGGYPI AW+YF + GVVT ECDPYFD
Sbjct  143  LQDRFCIHMNVNISLSVNDLLACCGFMCGDGCDGGYPIMAWRYFVQNGVVTDECDPYFD  201



>dbj|BAJ90198.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=355

 Score =   236 bits (602),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 101/166 (61%), Positives = 127/166 (77%), Gaps = 0/166 (0%)
 Frame = +3

Query  96   VTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSLLKRT  275
              ++E    I+Q++I++TVN++P AGW A  NP F+++T+ QFK +LG K  P  LL   
Sbjct  31   AAKAEHSLGIIQEDIIQTVNDHPNAGWTAGHNPYFANYTIEQFKHILGVKPTPPGLLAGV  90

Query  276  PVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYGTNV  455
            P+ TH K  +LPK FDART W  C +I +ILDQGHCG+CWAF AVESL DRFCIH   +V
Sbjct  91   PIKTHPKSADLPKEFDARTQWSSCSTIGNILDQGHCGACWAFAAVESLQDRFCIHLNMSV  150

Query  456  TLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            +LSVNDLLACCGF+CG GC+GGYPI+AW+YF R+GVVT ECDPYFD
Sbjct  151  SLSVNDLLACCGFLCGSGCNGGYPISAWRYFRRSGVVTEECDPYFD  196



>emb|CAQ00112.1| papain-like cysteine proteinase [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93928.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ99330.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=355

 Score =   236 bits (601),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 101/166 (61%), Positives = 127/166 (77%), Gaps = 0/166 (0%)
 Frame = +3

Query  96   VTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSLLKRT  275
              ++E    I+Q++I++TVN++P AGW A  NP F+++T+ QFK +LG K  P  LL   
Sbjct  31   AAKAEHSLGIIQEDIIQTVNDHPNAGWTAGHNPYFANYTIEQFKHILGVKPTPPGLLAGV  90

Query  276  PVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYGTNV  455
            P+ TH K  +LPK FDART W  C +I +ILDQGHCG+CWAF AVESL DRFCIH   +V
Sbjct  91   PIKTHPKSADLPKEFDARTQWSSCSTIGNILDQGHCGACWAFAAVESLQDRFCIHLNMSV  150

Query  456  TLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            +LSVNDLLACCGF+CG GC+GGYPI+AW+YF R+GVVT ECDPYFD
Sbjct  151  SLSVNDLLACCGFLCGSGCNGGYPISAWRYFRRSGVVTEECDPYFD  196



>ref|XP_004978407.1| PREDICTED: cathepsin B-like isoform X1 [Setaria italica]
 ref|XP_004978408.1| PREDICTED: cathepsin B-like isoform X2 [Setaria italica]
Length=360

 Score =   234 bits (597),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 103/179 (58%), Positives = 132/179 (74%), Gaps = 7/179 (4%)
 Frame = +3

Query  78   VVAVKPVTQSEVDPK-------ILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLL  236
            V AVKP+  S +  +       I+Q +I++TVN++P AGW A  NP F+++T++QFK +L
Sbjct  23   VRAVKPIPNSNLGVEEGDNSIGIIQKDIIETVNKHPNAGWTAAQNPYFANYTIAQFKHIL  82

Query  237  GAKKAPKSLLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVES  416
            G K  P+  L   P  T+ + ++LPK FDAR+ W  C +I +ILDQGHCGSCWAFGAVE 
Sbjct  83   GVKPTPQDALTDVPSKTYSRSLKLPKEFDARSKWSHCSTIGNILDQGHCGSCWAFGAVEC  142

Query  417  LTDRFCIHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            L DRFCIH   N++LSVNDLLACCGFMCG+GC+GGYPI AW+YF + GVVT ECDPYFD
Sbjct  143  LQDRFCIHMNMNISLSVNDLLACCGFMCGDGCNGGYPIMAWRYFVQNGVVTDECDPYFD  201



>ref|XP_003560199.1| PREDICTED: cathepsin B-like [Brachypodium distachyon]
Length=350

 Score =   229 bits (583),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 96/157 (61%), Positives = 120/157 (76%), Gaps = 0/157 (0%)
 Frame = +3

Query  123  ILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSLLKRTPVATHDKQI  302
            I+Q++I++T+N +P AGW A  N  F+++T++QFK +LG K  P  LL+  P  T+ +  
Sbjct  37   IIQNDIIETINNHPNAGWTAGQNSYFANYTIAQFKHILGVKPTPPGLLRGVPTKTYSRST  96

Query  303  ELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYGTNVTLSVNDLLA  482
            +LPK FDAR+ W  C +I  ILDQGHCGSCWAFGAVE L DRFCIH   N++LSVNDL+A
Sbjct  97   DLPKEFDARSKWSGCSTIGTILDQGHCGSCWAFGAVECLQDRFCIHLNMNISLSVNDLVA  156

Query  483  CCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            CCGFMCG+GCDGGYPI+AWQY    GVVT ECDPYFD
Sbjct  157  CCGFMCGDGCDGGYPISAWQYLVENGVVTDECDPYFD  193



>ref|XP_003560204.2| PREDICTED: cathepsin B-like [Brachypodium distachyon]
Length=380

 Score =   229 bits (584),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 95/158 (60%), Positives = 124/158 (78%), Gaps = 0/158 (0%)
 Frame = +3

Query  120  KILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSLLKRTPVATHDKQ  299
            +I+Q++I++T+N++P AGW A  NP F+++T++QFK +LG K  P +LL   P  ++ + 
Sbjct  64   RIIQNDIIETINKHPNAGWTAGHNPYFANYTITQFKHILGVKPTPPALLAGVPTKSYSRS  123

Query  300  IELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYGTNVTLSVNDLL  479
            ++LP  FDAR+ W  C +I  ILDQGHCGSCWAFGAVE L DRFCIH   N++LSVNDLL
Sbjct  124  MKLPTEFDARSQWSGCSTIGTILDQGHCGSCWAFGAVECLQDRFCIHLNMNISLSVNDLL  183

Query  480  ACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            ACCGF+CG GC+GGYPI+AW+YF R GVVT ECDPYFD
Sbjct  184  ACCGFLCGSGCNGGYPISAWRYFRRKGVVTDECDPYFD  221



>emb|CAA46812.1| cathepsin B [Triticum aestivum]
Length=310

 Score =   227 bits (578),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 126/165 (76%), Gaps = 1/165 (1%)
 Frame = +3

Query  99   TQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSLLKRTP  278
             ++E    I+Q +I++TVN++P AGW A  NP F+++T+ QFK +LG K  P  LL   P
Sbjct  29   AKAEHSLGIIQKDIIQTVNKHPNAGWTAGHNPYFANYTIEQFKHILGVKPTPPGLLAGVP  88

Query  279  VATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYGTNVT  458
            +  H  +++LPK FDART W  C +I +ILDQGHCG+CWAF AVE+L DRFCIH   +V+
Sbjct  89   IKIH-PEMDLPKEFDARTQWSSCSTIGNILDQGHCGACWAFAAVEALQDRFCIHLNMSVS  147

Query  459  LSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            LSVNDLLACCGF+CG GC+GGYPI+AW+YF R+GVVT ECDPYFD
Sbjct  148  LSVNDLLACCGFLCGSGCNGGYPISAWRYFRRSGVVTEECDPYFD  192



>gb|AAC24376.1| cathepsin B-like cysteine proteinase [Arabidopsis thaliana]
Length=357

 Score =   227 bits (579),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 103/173 (60%), Positives = 128/173 (74%), Gaps = 2/173 (1%)
 Frame = +3

Query  75   QVVAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAP  254
            Q +A + +++ ++   ILQ+EIVK VNENP AGWKA  N RF++ TV++FKRLLG  + P
Sbjct  26   QGIAAENLSKQKLTSLILQNEIVKEVNENPNAGWKAAFNDRFANATVAEFKRLLGVIQTP  85

Query  255  KSLLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFC  434
            K+     P+  HD  ++LPK FDARTAW  C SI  IL  GHCGSCWAFGAVESL+DRFC
Sbjct  86   KTAYLGVPIVRHDLSLKLPKEFDARTAWSHCTSIRRIL--GHCGSCWAFGAVESLSDRFC  143

Query  435  IHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            I Y  NV+LS ND++ACCG +CG GC+GG+P+ AW YF   GVVT ECDPYFD
Sbjct  144  IKYNLNVSLSANDVIACCGLLCGFGCNGGFPMGAWLYFKYHGVVTQECDPYFD  196



>gb|ACY38050.1| cathepsin B [Dactylis glomerata]
Length=348

 Score =   227 bits (578),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 97/158 (61%), Positives = 119/158 (75%), Gaps = 0/158 (0%)
 Frame = +3

Query  120  KILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSLLKRTPVATHDKQ  299
            +I+Q +I++T+N++P AGW A  N   +++T+ QFK +LG K  P  LL   P  T+ K 
Sbjct  32   RIIQKDIIETINKHPNAGWTAGHNAYLANYTIEQFKHILGVKPTPPGLLAGVPTKTYSKS  91

Query  300  IELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYGTNVTLSVNDLL  479
             ELPK FDAR+ W  C +I  ILDQGHCGSCWAFGAVE L DRFCIH   N++LS NDL+
Sbjct  92   EELPKQFDARSKWSGCSTIGTILDQGHCGSCWAFGAVECLQDRFCIHQNINISLSANDLV  151

Query  480  ACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            ACCGFMCG+GCDGGYPI AWQYF ++GVVT ECDPYFD
Sbjct  152  ACCGFMCGDGCDGGYPIKAWQYFVQSGVVTEECDPYFD  189



>emb|CAA46811.1| cathepsin B [Triticum aestivum]
Length=353

 Score =   227 bits (578),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 126/165 (76%), Gaps = 1/165 (1%)
 Frame = +3

Query  99   TQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSLLKRTP  278
             ++E    I+Q +I++TVN++P AGW A  NP F+++T+ QFK +LG K  P  LL   P
Sbjct  29   AKAEHSLGIIQKDIIQTVNKHPNAGWTAGHNPYFANYTIEQFKHILGVKPTPPGLLAGVP  88

Query  279  VATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYGTNVT  458
            +  H  +++LPK FDART W  C +I +ILDQGHCG+CWAF AVE+L DRFCIH   +V+
Sbjct  89   IKIH-PEMDLPKEFDARTQWSSCSTIGNILDQGHCGACWAFAAVEALQDRFCIHLNMSVS  147

Query  459  LSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            LSVNDLLACCGF+CG GC+GGYPI+AW+YF R+GVVT ECDPYFD
Sbjct  148  LSVNDLLACCGFLCGSGCNGGYPISAWRYFRRSGVVTEECDPYFD  192



>emb|CAC83720.1| cathepsin B [Hordeum vulgare subsp. vulgare]
 dbj|BAJ90387.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ90767.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=344

 Score =   226 bits (576),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 97/157 (62%), Positives = 117/157 (75%), Gaps = 0/157 (0%)
 Frame = +3

Query  123  ILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSLLKRTPVATHDKQI  302
            I+Q  I++TVN +P AGW A  NP  +++T+ QFK +LG K  P  LL      TH +  
Sbjct  35   IIQKGIIQTVNNHPNAGWTAGHNPYLANYTIEQFKHMLGVKPTPPGLLAGVRTKTHPRSE  94

Query  303  ELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYGTNVTLSVNDLLA  482
            +LPK FDAR+ W  C +I  ILDQGHCGSCWAFGAVE L DRFCIH+  N++LS NDL+A
Sbjct  95   QLPKEFDARSKWSGCSTIGKILDQGHCGSCWAFGAVECLQDRFCIHHNMNISLSANDLVA  154

Query  483  CCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            CCGFMCG+GCDGGYPI+AWQYF + GVVT ECDPYFD
Sbjct  155  CCGFMCGDGCDGGYPISAWQYFVQNGVVTEECDPYFD  191



>dbj|BAJ90118.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ99469.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ99817.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=345

 Score =   223 bits (569),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 97/159 (61%), Positives = 120/159 (75%), Gaps = 2/159 (1%)
 Frame = +3

Query  123  ILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSLLKRTPVATHDK--  296
            I+Q++I++TVN +P AGW A  NP  +++T+ QFK +LG K  P  LL   P  T+ +  
Sbjct  34   IIQEDIIRTVNSHPNAGWTAGHNPYLANYTIEQFKHILGVKPTPPGLLAGVPTKTYSRSE  93

Query  297  QIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYGTNVTLSVNDL  476
            + ELPK FDAR+ W  C +I  ILDQGHCG+CWAFGAVE L DRFCIH+  NV+LSVNDL
Sbjct  94   KAELPKEFDARSKWSGCSTIGKILDQGHCGACWAFGAVECLQDRFCIHHSVNVSLSVNDL  153

Query  477  LACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            +ACCGF+CG+GCDGGYPI AWQYF   GVVT ECDP+FD
Sbjct  154  VACCGFLCGDGCDGGYPIFAWQYFVENGVVTDECDPFFD  192



>gb|ACN40354.1| unknown [Picea sitchensis]
Length=350

 Score =   223 bits (569),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 98/173 (57%), Positives = 124/173 (72%), Gaps = 0/173 (0%)
 Frame = +3

Query  75   QVVAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAP  254
            +V  ++     E    ILQ   V+ +N++P AGWKA M+ RFS++TV +F  LLG    P
Sbjct  18   KVSGLESFHSLESQRPILQKSFVEHINKHPNAGWKAAMSTRFSNYTVREFAHLLGVLPTP  77

Query  255  KSLLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFC  434
            + LL+  PV  + K ++LP  FDAR AWP C S   ILDQGHCGSCWAF AVE+L+DRFC
Sbjct  78   QKLLETVPVRVYPKGLKLPSKFDARKAWPHCTSTRSILDQGHCGSCWAFAAVEALSDRFC  137

Query  435  IHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            IH+  N TLS NDL+ACCGF CG GC+GG+P++AW+YF+R GVVT ECDPYFD
Sbjct  138  IHFQVNATLSENDLVACCGFRCGSGCNGGFPLSAWRYFSRRGVVTDECDPYFD  190



>emb|CAA46810.1| cathepsin B [Triticum aestivum]
Length=305

 Score =   222 bits (565),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 95/152 (63%), Positives = 113/152 (74%), Gaps = 0/152 (0%)
 Frame = +3

Query  138  IVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSLLKRTPVATHDKQIELPKT  317
            I++TVN +P AGW A  NP  +++T+ QFK +LG K  P  L       TH +  +LPK 
Sbjct  1    IIQTVNNHPNAGWTAGHNPYLANYTIEQFKHMLGVKPTPPGLRAAVRTKTHSRSEQLPKV  60

Query  318  FDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYGTNVTLSVNDLLACCGFM  497
            FDAR+ W  C +I  ILDQGHCGSCWAFGAVE L DRFCIH+  N+TLS NDL+ACCGFM
Sbjct  61   FDARSKWSGCSTIGKILDQGHCGSCWAFGAVECLQDRFCIHHNMNITLSANDLVACCGFM  120

Query  498  CGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            CG+GCDGGYPI+AWQYF + GVVT ECDPYFD
Sbjct  121  CGDGCDGGYPISAWQYFVQNGVVTDECDPYFD  152



>ref|XP_011039855.1| PREDICTED: cathepsin B-like [Populus euphratica]
Length=353

 Score =   221 bits (564),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 109/173 (63%), Positives = 140/173 (81%), Gaps = 0/173 (0%)
 Frame = +3

Query  75   QVVAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAP  254
            Q + V+ V++ +++ +ILQD IV+ VNENP+AGW+A MNP+FS+++V +FK LLG K+ P
Sbjct  19   QAITVEAVSKLKLNSRILQDSIVQKVNENPKAGWEATMNPQFSNYSVGEFKYLLGVKQTP  78

Query  255  KSLLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFC  434
            +  L+  P+  H K ++LP  FDARTAWP C +I  ILDQGHCGSCWAFGAVESL+DRFC
Sbjct  79   RKELRGVPLLRHPKSMKLPIEFDARTAWPHCSTIGRILDQGHCGSCWAFGAVESLSDRFC  138

Query  435  IHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            IHYG N++LSVNDLLACCG+MCG GC GG PI +W+YF ++GVVT ECDPYFD
Sbjct  139  IHYGMNLSLSVNDLLACCGWMCGGGCGGGSPIDSWRYFVQSGVVTEECDPYFD  191



>dbj|BAG90919.1| unnamed protein product [Oryza sativa Japonica Group]
Length=403

 Score =   222 bits (565),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 107/221 (48%), Positives = 133/221 (60%), Gaps = 51/221 (23%)
 Frame = +3

Query  84   AVKPV------TQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTV----------  215
            A KP+      T+     +I+QD+I+K +N++P AGW A  NP F+++TV          
Sbjct  22   AAKPIPNLQLMTKEGGSSRIIQDDIIKAINKHPNAGWTAARNPYFANYTVNNNTLLLLFS  81

Query  216  -----------------------------------SQFKRLLGAKKAPKSLLKRTPVATH  290
                                               +QFK +LG K  P S+L   PV T+
Sbjct  82   FFFLRGHLPVVVSIAYIKTFISCLFGGLNNPPVQTAQFKHILGVKPTPHSVLNDVPVKTY  141

Query  291  DKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYGTNVTLSVN  470
             + + LPK FDAR+AW QC +I  ILDQGHCGSCWAFGAVE L DRFCIH+  N++LSVN
Sbjct  142  PRSLMLPKEFDARSAWSQCNTIGTILDQGHCGSCWAFGAVECLQDRFCIHFNMNISLSVN  201

Query  471  DLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            DL+ACCGFMCG+GCDGGYPI AW+YF R GVVT ECDPYFD
Sbjct  202  DLVACCGFMCGDGCDGGYPIMAWRYFVRNGVVTDECDPYFD  242



>ref|NP_563647.1| putative cathepsin B-like cysteine protease [Arabidopsis thaliana]
 gb|AEE27412.1| putative cathepsin B-like cysteine protease [Arabidopsis thaliana]
Length=379

 Score =   219 bits (558),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 103/193 (53%), Positives = 128/193 (66%), Gaps = 20/193 (10%)
 Frame = +3

Query  75   QVVAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAP  254
            Q +A + +++ ++   ILQ+EIVK VNENP AGWKA  N RF++ TV++FKRLLG  + P
Sbjct  26   QGIAAENLSKQKLTSLILQNEIVKEVNENPNAGWKAAFNDRFANATVAEFKRLLGVIQTP  85

Query  255  KSLLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQ--------------------  374
            K+     P+  HD  ++LPK FDARTAW  C SI  IL                      
Sbjct  86   KTAYLGVPIVRHDLSLKLPKEFDARTAWSHCTSIRRILVGYILNNVLLWSTITLWFWFLL  145

Query  375  GHCGSCWAFGAVESLTDRFCIHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTR  554
            GHCGSCWAFGAVESL+DRFCI Y  NV+LS ND++ACCG +CG GC+GG+P+ AW YF  
Sbjct  146  GHCGSCWAFGAVESLSDRFCIKYNLNVSLSANDVIACCGLLCGFGCNGGFPMGAWLYFKY  205

Query  555  TGVVTSECDPYFD  593
             GVVT ECDPYFD
Sbjct  206  HGVVTQECDPYFD  218



>dbj|BAH20325.1| AT1G02305 [Arabidopsis thaliana]
Length=293

 Score =   211 bits (536),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 93/132 (70%), Positives = 108/132 (82%), Gaps = 0/132 (0%)
 Frame = +3

Query  198  FSDFTVSQFKRLLGAKKAPKSLLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQG  377
            F++ TV++FKRLLG K  PK+     P+ +HD  ++LPK FDARTAW QC SI  ILDQG
Sbjct  1    FANATVAEFKRLLGVKPTPKTEFLGVPIVSHDISLKLPKEFDARTAWSQCTSIGRILDQG  60

Query  378  HCGSCWAFGAVESLTDRFCIHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRT  557
            HCGSCWAFGAVESL+DRFCI Y  NV+LSVNDLLACCGF+CG+GC+GGYPIAAW+YF   
Sbjct  61   HCGSCWAFGAVESLSDRFCIKYNMNVSLSVNDLLACCGFLCGQGCNGGYPIAAWRYFKHH  120

Query  558  GVVTSECDPYFD  593
            GVVT ECDPYFD
Sbjct  121  GVVTEECDPYFD  132



>ref|XP_002301456.1| putative cathepsin B-like protease family protein [Populus trichocarpa]
 gb|EEE80729.1| putative cathepsin B-like protease family protein [Populus trichocarpa]
Length=325

 Score =   210 bits (534),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 97/173 (56%), Positives = 122/173 (71%), Gaps = 31/173 (18%)
 Frame = +3

Query  75   QVVAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAP  254
            QV+AV+PV++ +++ +ILQD IV+ VNENP AGW+A MNP+FS+++V +FK LLG K  P
Sbjct  23   QVIAVEPVSKLKLNSRILQDSIVQKVNENPNAGWEATMNPQFSNYSVGEFKYLLGVKPTP  82

Query  255  KSLLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFC  434
               L+  P+                               GHCGSCWAFGAVESL+DRFC
Sbjct  83   GKELRGVPL-------------------------------GHCGSCWAFGAVESLSDRFC  111

Query  435  IHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            IHYG N++LSVNDLLACCG+MCG+GCDGGYPI AW+YF ++GVVT ECDPYFD
Sbjct  112  IHYGMNLSLSVNDLLACCGWMCGDGCDGGYPIDAWRYFVQSGVVTEECDPYFD  164



>gb|EMT07038.1| Cathepsin B [Aegilops tauschii]
Length=418

 Score =   211 bits (538),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 96/177 (54%), Positives = 116/177 (66%), Gaps = 20/177 (11%)
 Frame = +3

Query  123  ILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSLLKRTPVATHDKQI  302
            I+Q +I++TVN +P AGW A  NP  +++T+ QFK +LG K  P  L       TH +  
Sbjct  34   IIQKDIIQTVNNHPNAGWTAGHNPYLANYTIEQFKHMLGVKPTPPGLRAGVRTKTHLRSE  93

Query  303  ELPKTFDARTAWPQCVSIADILD--------------------QGHCGSCWAFGAVESLT  422
            +LPK FDAR+ W  C +I  IL                     QGHCGSCWAFGAVE L 
Sbjct  94   QLPKVFDARSKWSGCSTIGKILAPRVLTEQLKMLKLACTGYQWQGHCGSCWAFGAVECLQ  153

Query  423  DRFCIHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            DRFCIH+  N+TLS NDL+ACCGFMCG+GCDGGYPI+AWQYF + GVVT ECDPYFD
Sbjct  154  DRFCIHHNMNITLSANDLVACCGFMCGDGCDGGYPISAWQYFVQNGVVTDECDPYFD  210



>ref|XP_002993195.1| hypothetical protein SELMODRAFT_270024 [Selaginella moellendorffii]
 gb|EFJ05715.1| hypothetical protein SELMODRAFT_270024 [Selaginella moellendorffii]
Length=342

 Score =   209 bits (531),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 102/174 (59%), Positives = 123/174 (71%), Gaps = 2/174 (1%)
 Frame = +3

Query  75   QVVAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGA-KKA  251
            Q V V    + ++   +LQ  IV  VN +P AGWKA  N RF + TV  FKRL G   K+
Sbjct  21   QGVRVAESGKLDLGRPLLQKSIVDIVNNDPNAGWKAGFNERFINHTVRDFKRLCGVLPKS  80

Query  252  PKSLLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRF  431
             + +    P+ +H + ++LPK FDAR AWPQC SI +ILDQGHCGSCWAFGAVE+LTDRF
Sbjct  81   SEEVQPLRPLRSHPRTLDLPKHFDAREAWPQCSSIKNILDQGHCGSCWAFGAVEALTDRF  140

Query  432  CIHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            CI    NV+LS NDL+ACC   CG GCDGGYP AAW+YF +TGVVTS+CDPYFD
Sbjct  141  CILNNENVSLSENDLVACCS-SCGFGCDGGYPYAAWEYFAQTGVVTSQCDPYFD  193



>ref|XP_001762922.1| predicted protein [Physcomitrella patens]
 gb|EDQ72127.1| predicted protein [Physcomitrella patens]
Length=345

 Score =   208 bits (529),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 97/164 (59%), Positives = 117/164 (71%), Gaps = 2/164 (1%)
 Frame = +3

Query  108  EVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSLLKRT--PV  281
            E +  I Q  +V  +N +P A WKA +N RF+  TV   K++ GAK  P + ++ +   V
Sbjct  33   ENNRLIHQQSLVDKINAHPGATWKAGLNDRFAKHTVEHLKKMCGAKMTPANEVEPSIERV  92

Query  282  ATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYGTNVTL  461
                K ++LP  FDAR  W  C +I DILDQGHCGSCWAFGAVESLTDRFCIH   +V+L
Sbjct  93   THKHKNLDLPTEFDARKHWSHCSTIGDILDQGHCGSCWAFGAVESLTDRFCIHLNESVSL  152

Query  462  SVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            S NDLLACCGF CG+GC+GGYPI AWQYF RTGVVTS+CDPYFD
Sbjct  153  SENDLLACCGFECGDGCEGGYPIRAWQYFKRTGVVTSKCDPYFD  196



>ref|XP_002889394.1| hypothetical protein ARALYDRAFT_887367 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65653.1| hypothetical protein ARALYDRAFT_887367 [Arabidopsis lyrata subsp. 
lyrata]
Length=359

 Score =   207 bits (527),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 107/173 (62%), Positives = 130/173 (75%), Gaps = 0/173 (0%)
 Frame = +3

Query  75   QVVAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAP  254
            Q  A   +++ ++   ILQ+EIVK VNENP AGWKA +N RF++ TV++FKRLLG K  P
Sbjct  26   QGTAAGNLSKQKLTSLILQNEIVKEVNENPNAGWKASLNDRFANATVAEFKRLLGVKPTP  85

Query  255  KSLLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFC  434
            K+     P+  HD  ++LPK FDARTAW QC SI  ILDQGHCGSCWAFGAVESL+DRFC
Sbjct  86   KTAYLGVPIVRHDLSLKLPKEFDARTAWSQCTSIPRILDQGHCGSCWAFGAVESLSDRFC  145

Query  435  IHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            I Y  NV+LS ND++ACCG +CG GC+GG+P+ AW YF   GVVT ECDPYFD
Sbjct  146  IKYNLNVSLSANDVVACCGLLCGLGCNGGFPMGAWLYFKYHGVVTEECDPYFD  198



>ref|XP_002965469.1| hypothetical protein SELMODRAFT_143272, partial [Selaginella 
moellendorffii]
 gb|EFJ32889.1| hypothetical protein SELMODRAFT_143272, partial [Selaginella 
moellendorffii]
Length=331

 Score =   206 bits (524),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 101/174 (58%), Positives = 122/174 (70%), Gaps = 2/174 (1%)
 Frame = +3

Query  75   QVVAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGA-KKA  251
            Q V V    + ++   +LQ  IV  VN +P AGWKA  N RF + TV  FKRL G   K+
Sbjct  10   QGVRVAESGKLDLGRPLLQKSIVDIVNNDPNAGWKAGFNERFINHTVRDFKRLCGVLPKS  69

Query  252  PKSLLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRF  431
             + +    P+ +H + ++LPK FDAR AWPQC SI  ILDQGHCGSCWAFGAVE+LTDRF
Sbjct  70   SEEVQPLRPLRSHPRTLDLPKHFDAREAWPQCASIKTILDQGHCGSCWAFGAVEALTDRF  129

Query  432  CIHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            CI    NV+LS NDL+ACC   CG GC+GGYP AAW+YF +TGVVTS+CDPYFD
Sbjct  130  CILNNENVSLSENDLVACCS-SCGFGCEGGYPYAAWEYFAQTGVVTSQCDPYFD  182



>ref|XP_001765840.1| predicted protein [Physcomitrella patens]
 gb|EDQ69431.1| predicted protein [Physcomitrella patens]
Length=339

 Score =   204 bits (519),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 96/159 (60%), Positives = 112/159 (70%), Gaps = 2/159 (1%)
 Frame = +3

Query  123  ILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSLLKRT--PVATHDK  296
            I Q  +V  VN +P A WKA  N RF   T+   K++ GAK  P + L+ +   V    K
Sbjct  32   IHQQLLVDKVNAHPRATWKAGFNDRFEGHTIEHLKKICGAKMTPANELEPSIERVTHKHK  91

Query  297  QIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYGTNVTLSVNDL  476
            ++ LPK FDAR  W  C +I  ILDQGHCGSCWAFGA ESLTDRFCIH   +V+LS NDL
Sbjct  92   KLVLPKEFDARKHWGHCSTIGAILDQGHCGSCWAFGAAESLTDRFCIHMNESVSLSENDL  151

Query  477  LACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            LACCGF CG+GCDGGYPI AW+YF RTGVVTS+CDPYFD
Sbjct  152  LACCGFECGDGCDGGYPIRAWRYFKRTGVVTSKCDPYFD  190



>emb|CAB62588.1| putative cathepsin B-like protease [Pisum sativum]
Length=166

 Score =   195 bits (496),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 86/117 (74%), Positives = 97/117 (83%), Gaps = 0/117 (0%)
 Frame = +3

Query  243  KKAPKSLLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLT  422
            K+ P++ L   PV TH K + LPK FDARTAWPQC +I  ILDQGHCGSCWAFGAVESL+
Sbjct  41   KQTPRNELSSIPVVTHPKSLNLPKEFDARTAWPQCSTIGRILDQGHCGSCWAFGAVESLS  100

Query  423  DRFCIHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            DRFCIH+G +V LSVNDLLACCGF+CG GCDGGYPI+AW+YF   GVVT ECDPYFD
Sbjct  101  DRFCIHFGVDVPLSVNDLLACCGFLCGSGCDGGYPISAWKYFAHHGVVTEECDPYFD  157



>emb|CDX85150.1| BnaC07g07560D [Brassica napus]
Length=341

 Score =   196 bits (498),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 94/171 (55%), Positives = 119/171 (70%), Gaps = 16/171 (9%)
 Frame = +3

Query  81   VAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKS  260
            +A + +++ ++  +ILQ+EIVK VNENP AGW A  N RF++ TV++FKRLLG K  PK+
Sbjct  26   IAAENLSEQKLTSRILQNEIVKEVNENPNAGWTAAFNDRFANSTVAEFKRLLGVKPTPKN  85

Query  261  LLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIH  440
                 PV      ++  K  D R+              GHCGSCWAFGAVESL+DRFCI 
Sbjct  86   EFLGVPVNCLVSVLQHWK--DPRS--------------GHCGSCWAFGAVESLSDRFCIK  129

Query  441  YGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            Y  N++LSVNDLLACCGF+CG+GC+GGYPI+AW+YF   GVVT ECDPYFD
Sbjct  130  YNMNISLSVNDLLACCGFLCGQGCNGGYPISAWRYFKHHGVVTEECDPYFD  180



>ref|XP_001753172.1| predicted protein [Physcomitrella patens]
 gb|EDQ82213.1| predicted protein [Physcomitrella patens]
Length=347

 Score =   195 bits (496),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/175 (53%), Positives = 117/175 (67%), Gaps = 9/175 (5%)
 Frame = +3

Query  96   VTQSEVDPKIL-------QDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAP  254
            V    ++P++L       Q  +V  VN +P A W A  N RF+  T+   K++ GA   P
Sbjct  24   VQAGRLEPELLGNNRLIHQQALVDKVNAHPGATWTAGFNERFAKHTIEHLKKMCGAILTP  83

Query  255  KSLLKRT--PVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDR  428
             + L+ +   ++   K++ LPK FDAR  W  C +I DIL QGHCGSCWAFGAVESLTDR
Sbjct  84   ANKLEPSIETISHKHKKLYLPKEFDARKQWSHCPTIGDILGQGHCGSCWAFGAVESLTDR  143

Query  429  FCIHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            FCIH   +V+LS NDLLACCGF CG GC+GGYPI AW+YF  +GVVT++CDPYFD
Sbjct  144  FCIHLNESVSLSENDLLACCGFECGYGCEGGYPIRAWKYFKHSGVVTNKCDPYFD  198



>gb|EPS69258.1| hypothetical protein M569_05509 [Genlisea aurea]
Length=339

 Score =   192 bits (488),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/165 (55%), Positives = 113/165 (68%), Gaps = 15/165 (9%)
 Frame = +3

Query  99   TQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSLLKRTP  278
            T S+++  ILQ+ IV  +N N +AGWKA +N RF++ TV QFK LLG K  P+  L   P
Sbjct  32   TSSKLEKNILQESIVNLINGNSKAGWKASLNTRFANHTVRQFKDLLGVKPLPEGDLANLP  91

Query  279  VATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYGTNVT  458
            V +H+K   LPK FDAR              +GHCG+CWAFGAVE L+DRFCIH+G NV+
Sbjct  92   VVSHNKVTALPKHFDAR--------------EGHCGACWAFGAVEVLSDRFCIHFGQNVS  137

Query  459  LSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            LS N+L++CC F CG+GC+GGYP  AW YF   GVVT +CDPYFD
Sbjct  138  LSPNELVSCCEF-CGDGCNGGYPSRAWNYFVSNGVVTEQCDPYFD  181



>gb|EMS60125.1| Cathepsin B [Triticum urartu]
Length=318

 Score =   188 bits (477),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 82/129 (64%), Positives = 98/129 (76%), Gaps = 2/129 (2%)
 Frame = +3

Query  213  VSQFKRLLGAKKAPKSLLKRTPVATHDK--QIELPKTFDARTAWPQCVSIADILDQGHCG  386
            + QFK +LG K  P  LL   P  T+ +  + +LPK FDAR+ W  C +I  ILDQGHCG
Sbjct  37   IEQFKHILGVKPTPPGLLAGVPTKTYSRSEKEDLPKEFDARSKWSGCTTIGKILDQGHCG  96

Query  387  SCWAFGAVESLTDRFCIHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVV  566
            +CWAFGAVE L DRFCIH+G NV+LSVND++ACCGF+CG+GCDGGYPI AWQYF   GVV
Sbjct  97   ACWAFGAVECLQDRFCIHHGVNVSLSVNDIVACCGFLCGDGCDGGYPIFAWQYFVENGVV  156

Query  567  TSECDPYFD  593
            T ECDP+FD
Sbjct  157  TDECDPFFD  165



>ref|XP_004494938.1| PREDICTED: cathepsin B-like [Cicer arietinum]
Length=446

 Score =   190 bits (483),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 100/160 (63%), Positives = 120/160 (75%), Gaps = 0/160 (0%)
 Frame = +3

Query  96   VTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSLLKRT  275
            +T+ +++  ILQ+ I K +N+N  AGWKA +NPRFS+FTV QF RLLG K+ P + L   
Sbjct  35   LTELKLNSHILQESIAKQINQNSGAGWKAAINPRFSNFTVGQFMRLLGVKQTPGNELISI  94

Query  276  PVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYGTNV  455
            PV TH K ++LPK FDARTAW QC +I  ILDQGHCGSCWAFGAVESL+DRFCIH   NV
Sbjct  95   PVVTHSKSLKLPKNFDARTAWSQCSTIGRILDQGHCGSCWAFGAVESLSDRFCIHLDVNV  154

Query  456  TLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSE  575
            +LSVND++ACCG +CG GC GG   AAW Y T  GVVT E
Sbjct  155  SLSVNDMVACCGLLCGAGCGGGELFAAWLYLTHHGVVTEE  194


 Score = 97.1 bits (240),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 55/77 (71%), Positives = 62/77 (81%), Gaps = 0/77 (0%)
 Frame = +3

Query  363  ILDQGHCGSCWAFGAVESLTDRFCIHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQ  542
            ++ QGHCGSCWAFGAVESL+DRFCIH   NV+LSVND++ACCG +CG GC GG   AAW 
Sbjct  210  MMIQGHCGSCWAFGAVESLSDRFCIHLDVNVSLSVNDMVACCGLLCGAGCGGGELFAAWL  269

Query  543  YFTRTGVVTSECDPYFD  593
            Y T  GVVT ECDPYFD
Sbjct  270  YLTHHGVVTEECDPYFD  286



>emb|CAO02548.1| putative cathepsin B-like cysteine protease,putative [Vigna unguiculata]
Length=195

 Score =   181 bits (460),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 76/108 (70%), Positives = 90/108 (83%), Gaps = 0/108 (0%)
 Frame = +3

Query  270  RTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYGT  449
              PV +H K ++LP  FDARTAW QC +I  ILDQGHCGSCWAFGAVESL+DRFCIH+  
Sbjct  6    EVPVISHPKSLKLPVNFDARTAWSQCSTIGRILDQGHCGSCWAFGAVESLSDRFCIHFDV  65

Query  450  NVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            N++LSVNDLLACCGF+CG GC+GGYP++AW+Y +  GVVT ECDPYFD
Sbjct  66   NISLSVNDLLACCGFLCGSGCNGGYPLSAWRYLSNHGVVTEECDPYFD  113



>emb|CDY64824.1| BnaCnng45130D [Brassica napus]
Length=175

 Score =   180 bits (457),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/166 (52%), Positives = 108/166 (65%), Gaps = 18/166 (11%)
 Frame = +3

Query  96   VTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSLLKRT  275
            +++ ++  +ILQ EIVK  NENP AGW A  N  F++ T+     L G K  PK+     
Sbjct  19   LSKQKLTSRILQHEIVKQFNENPNAGWTAAFNDGFANATI-----LSGVKPTPKNEFLGV  73

Query  276  PVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYGTNV  455
            PV +HD  ++L   FDARTAW  C SI  IL             VESL+DRFCI Y  N+
Sbjct  74   PVVSHDISLKLRNEFDARTAWSLCSSIGRIL-------------VESLSDRFCIKYNMNI  120

Query  456  TLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            +LSVNDLLACCGF+CG+GC+GGYPI+AW+YF   GVVT ECDPYFD
Sbjct  121  SLSVNDLLACCGFLCGQGCNGGYPISAWRYFKHHGVVTGECDPYFD  166



>gb|AAM00234.1|AF359422_1 cathepsin B-like cysteine proteinase [Nicotiana tabacum]
Length=110

 Score =   176 bits (446),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = +3

Query  180  ADMNPRFSDFTVSQFKRLLGAKKAPKSLLKRTPVATHDKQIELPKTFDARTAWPQCVSIA  359
            A +NPRFS+FTVSQFKRLLG K   K  LK  P+ TH K +ELP+ FDAR AWP C +I 
Sbjct  1    AALNPRFSNFTVSQFKRLLGVKPTRKGDLKGIPILTHPKLLELPQEFDARVAWPNCSTIG  60

Query  360  DILDQGHCGSCWAFGAVESLTDRFCIHYGTNVTLSVNDLLACCGFMCGEG  509
             ILDQGHCGSCWAFGAVESL+DRFCIHYG N++LS NDLLACCGF+CG+G
Sbjct  61   RILDQGHCGSCWAFGAVESLSDRFCIHYGLNISLSANDLLACCGFLCGDG  110



>emb|CAO02547.1| putative cathepsin B-like cysteine protease [Vigna unguiculata]
Length=201

 Score =   179 bits (453),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 75/105 (71%), Positives = 89/105 (85%), Gaps = 0/105 (0%)
 Frame = +3

Query  279  VATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYGTNVT  458
            V +H K ++LP  FDARTAW QC +I  ILDQGHCGSCWAFGAVESL+DRFCIH+  N++
Sbjct  9    VISHPKSLKLPVNFDARTAWSQCSTIGRILDQGHCGSCWAFGAVESLSDRFCIHFDVNIS  68

Query  459  LSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            LSVNDLLACCGF+CG GC+GGYP++AW+Y +  GVVT ECDPYFD
Sbjct  69   LSVNDLLACCGFLCGSGCNGGYPLSAWRYLSNHGVVTEECDPYFD  113



>ref|XP_007163269.1| hypothetical protein PHAVU_001G220100g [Phaseolus vulgaris]
 gb|ESW35263.1| hypothetical protein PHAVU_001G220100g [Phaseolus vulgaris]
Length=315

 Score =   169 bits (427),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 91/118 (77%), Gaps = 0/118 (0%)
 Frame = +3

Query  90   KPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSLLK  269
            +P+T   +   ILQ  I K +NENPEAGW+A +NPRFS++TV QFKRLLG K+ PK  L+
Sbjct  28   EPLTTLHLKSPILQKSIAKQINENPEAGWEAALNPRFSNYTVEQFKRLLGVKQTPKIELR  87

Query  270  RTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHY  443
             TPV +H K ++LP  FDAR AW QC +I  ILDQGHCGSCWAFGAVESL+DRFCIH+
Sbjct  88   STPVISHPKSLKLPVNFDARKAWSQCNTIGRILDQGHCGSCWAFGAVESLSDRFCIHF  145



>gb|KHG09617.1| Cathepsin B [Gossypium arboreum]
Length=316

 Score =   168 bits (425),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 77/136 (57%), Positives = 93/136 (68%), Gaps = 16/136 (12%)
 Frame = +3

Query  186  MNPRFSDFTVSQFKRLLGAKKAPKSLLKRTPVATHDKQIELPKTFDARTAWPQCVSIADI  365
            +N R     V +FK +LG K  PK  L   P+  HDK +++P  FDARTAWPQC +I  I
Sbjct  36   LNSRI--LQVGEFKHILGVKPTPKKELLGIPIIRHDKSLKMPANFDARTAWPQCSTIGRI  93

Query  366  LDQGHCGSCWAFGAVESLTDRFCIHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQY  545
            L              ESL+DRFCIH+G N++LSVNDLLACCGF+CG GCDGG PI+AW+Y
Sbjct  94   L--------------ESLSDRFCIHFGMNISLSVNDLLACCGFLCGSGCDGGVPISAWRY  139

Query  546  FTRTGVVTSECDPYFD  593
            F R+GVVT ECDPYFD
Sbjct  140  FVRSGVVTEECDPYFD  155



>emb|CAX83033.1| Cysteine PRotease related protein [Schistosoma japonicum]
Length=233

 Score =   149 bits (375),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 103/165 (62%), Gaps = 14/165 (8%)
 Frame = +3

Query  126  LQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSL-LKRTP-VATHDKQ  299
            L DE++  +NE+P+AGWKAD + RF   ++   + L+GA+K    +  KR P V  HD  
Sbjct  30   LSDEMISFINEHPDAGWKADKSDRF--HSLDDARILMGARKEDAEMKRKRRPTVDHHDLN  87

Query  300  IELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHY--GTNVTLSVND  473
            +E+P  FD+R  WP C SI+ I DQ  CGSCWAFGAVE++TDR CI    G +  LS  D
Sbjct  88   VEIPSQFDSRKKWPHCKSISQIRDQSRCGSCWAFGAVEAMTDRICIQSGGGQSAELSALD  147

Query  474  LLACCGFMCGEGCDGGYPIAAWQYFTRTGVVT-------SECDPY  587
            L++CC   CG+GC GG+P  AW Y+ + G+VT       + C PY
Sbjct  148  LISCCK-DCGDGCKGGFPGQAWDYWVKRGIVTGGSEENHTGCQPY  191



>gb|AAW27205.1| unknown [Schistosoma japonicum]
Length=279

 Score =   149 bits (377),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 103/165 (62%), Gaps = 14/165 (8%)
 Frame = +3

Query  126  LQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSL-LKRTP-VATHDKQ  299
            L DE++  +NE+P+AGWKAD + RF   ++   + L+GA+K    +  KR P V  HD  
Sbjct  30   LSDEMISFINEHPDAGWKADKSDRF--HSLDDARILMGARKEDAEMKRKRRPTVDHHDLN  87

Query  300  IELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYG--TNVTLSVND  473
            +E+P  FD+R  WP C SI+ I DQ  CGSCWAFGAVE++TDR CI  G   +  LS  D
Sbjct  88   VEIPSQFDSRKKWPHCKSISQIRDQSRCGSCWAFGAVEAMTDRICIQSGGQQSAELSALD  147

Query  474  LLACCGFMCGEGCDGGYPIAAWQYFTRTGVVT-------SECDPY  587
            L++CC   CG+GC GG+P  AW Y+ + G+VT       + C PY
Sbjct  148  LISCCE-DCGDGCQGGFPGVAWDYWVKRGIVTGGSKENHTGCQPY  191



>gb|AAW27462.1| unknown [Schistosoma japonicum]
Length=294

 Score =   149 bits (377),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 103/165 (62%), Gaps = 14/165 (8%)
 Frame = +3

Query  126  LQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSL-LKRTP-VATHDKQ  299
            L DE++  +NE+P+AGWKAD + RF   ++   + L+GA+K    +  KR P V  HD  
Sbjct  30   LSDEMISFINEHPDAGWKADKSDRF--HSLDDARILMGARKEDAEMKRKRRPTVDHHDLN  87

Query  300  IELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYG--TNVTLSVND  473
            +E+P  FD+R  WP C SI+ I DQ  CGSCWAFGAVE++TDR CI  G   +  LS  D
Sbjct  88   VEIPSQFDSRKKWPHCKSISQIRDQSRCGSCWAFGAVEAMTDRICIQSGGQQSAELSALD  147

Query  474  LLACCGFMCGEGCDGGYPIAAWQYFTRTGVVT-------SECDPY  587
            L++CC   CG+GC GG+P  AW Y+ + G+VT       + C PY
Sbjct  148  LISCCE-DCGDGCQGGFPGVAWDYWVKRGIVTGGSKENHTGCQPY  191



>sp|P43157.1|CYSP_SCHJA RecName: Full=Cathepsin B-like cysteine proteinase; AltName: 
Full=Antigen Sj31; Flags: Precursor [Schistosoma japonicum]
 emb|CAA50305.1| cathepsin B [Schistosoma japonicum]
Length=342

 Score =   149 bits (375),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 74/165 (45%), Positives = 102/165 (62%), Gaps = 14/165 (8%)
 Frame = +3

Query  126  LQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSLLK--RTPVATHDKQ  299
            L DE++  +NE+P+AGWKAD + RF   ++   + L+GA+K    + +  R  V  HD  
Sbjct  30   LSDEMISFINEHPDAGWKADKSDRF--HSLDDARILMGARKEDAEMKRNRRPTVDHHDLN  87

Query  300  IELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHY--GTNVTLSVND  473
            +E+P  FD+R  WP C SI+ I DQ  CGSCWAFGAVE++TDR CI    G +  LS  D
Sbjct  88   VEIPSQFDSRKKWPHCKSISQIRDQSRCGSCWAFGAVEAMTDRICIQSGGGQSAELSALD  147

Query  474  LLACCGFMCGEGCDGGYPIAAWQYFTRTGVVT-------SECDPY  587
            L++CC   CG+GC GG+P  AW Y+ + G+VT       + C PY
Sbjct  148  LISCCK-DCGDGCQGGFPGVAWDYWVKRGIVTGGSKENHTGCQPY  191



>gb|AAW26391.1| unknown [Schistosoma japonicum]
Length=342

 Score =   148 bits (374),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 102/165 (62%), Gaps = 14/165 (8%)
 Frame = +3

Query  126  LQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSL-LKRTP-VATHDKQ  299
            L DE++  +NE+P+AGWKAD + RF     ++   L+GA+K    +  KR P V  HD  
Sbjct  30   LSDEMISFINEHPDAGWKADKSDRFHSLDDARI--LMGARKEDAEMKRKRRPTVDHHDLN  87

Query  300  IELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYG--TNVTLSVND  473
            +E+P  FD+R  WP C SI+ I DQ  CGSCWAFGAVE++TDR CI  G   +  LS  D
Sbjct  88   VEIPSQFDSRKKWPHCKSISQIRDQSRCGSCWAFGAVEAMTDRICIQSGGQQSAELSALD  147

Query  474  LLACCGFMCGEGCDGGYPIAAWQYFTRTGVVT-------SECDPY  587
            L++CC   CG+GC GG+P  AW Y+ + G+VT       + C PY
Sbjct  148  LISCCE-DCGDGCKGGFPGQAWDYWVKRGIVTGGSEENHTGCQPY  191



>gb|KDO86713.1| hypothetical protein CISIN_1g018568mg [Citrus sinensis]
Length=249

 Score =   146 bits (368),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 60/77 (78%), Positives = 71/77 (92%), Gaps = 0/77 (0%)
 Frame = +3

Query  363  ILDQGHCGSCWAFGAVESLTDRFCIHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQ  542
            ++ QGHCGSCWAFGAVE+L+DRFCIH+G N++LSVNDLLACCGF+CG+GCDGGYPI+AW+
Sbjct  12   LVIQGHCGSCWAFGAVEALSDRFCIHFGMNLSLSVNDLLACCGFLCGDGCDGGYPISAWR  71

Query  543  YFTRTGVVTSECDPYFD  593
            YF   GVVT ECDPYFD
Sbjct  72   YFVHHGVVTEECDPYFD  88



>emb|CDP07747.1| unnamed protein product [Coffea canephora]
Length=244

 Score =   145 bits (366),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 61/75 (81%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = +3

Query  369  DQGHCGSCWAFGAVESLTDRFCIHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYF  548
            DQGHCGSCWAFGAVESL+DRFCI +G N++LS NDLLACCGF+CG+GCDGGYPIAAW+YF
Sbjct  7    DQGHCGSCWAFGAVESLSDRFCIQFGMNISLSANDLLACCGFLCGDGCDGGYPIAAWRYF  66

Query  549  TRTGVVTSECDPYFD  593
               GVVT ECDPYFD
Sbjct  67   RYAGVVTEECDPYFD  81



>emb|CDY64994.1| BnaC04g02450D [Brassica napus]
Length=248

 Score =   145 bits (366),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 60/79 (76%), Positives = 71/79 (90%), Gaps = 0/79 (0%)
 Frame = +3

Query  357  ADILDQGHCGSCWAFGAVESLTDRFCIHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAA  536
            + ++DQGHCGSCWAFGAVESL+DRFCI Y  N++LSVNDLLACCGF+CG+GC+GGYPI+A
Sbjct  9    SSVIDQGHCGSCWAFGAVESLSDRFCIKYNMNISLSVNDLLACCGFLCGQGCNGGYPISA  68

Query  537  WQYFTRTGVVTSECDPYFD  593
            W+YF   GVVT ECDPYFD
Sbjct  69   WRYFKHHGVVTEECDPYFD  87



>gb|AAW24925.1| unknown [Schistosoma japonicum]
Length=342

 Score =   147 bits (371),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 103/165 (62%), Gaps = 14/165 (8%)
 Frame = +3

Query  126  LQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSL-LKRTP-VATHDKQ  299
            L DE++  +N++P+AGWKAD + RF   ++   + L+GA+K    +  KR P V  HD  
Sbjct  30   LSDEMISFINKHPDAGWKADKSDRF--HSLDDARILMGARKEDAEMKRKRRPTVDHHDLN  87

Query  300  IELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYG--TNVTLSVND  473
            +E+P  FD+R  WP C SI+ I DQ  CGSCWAFGAVE++TDR CI  G   +  LS  D
Sbjct  88   VEIPSQFDSRKKWPHCKSISQIRDQSRCGSCWAFGAVEAMTDRICIQSGGQQSAELSALD  147

Query  474  LLACCGFMCGEGCDGGYPIAAWQYFTRTGVVT-------SECDPY  587
            L++CC   CG+GC GG+P  AW Y+ + G+VT       + C PY
Sbjct  148  LISCCE-DCGDGCQGGFPGVAWDYWVKRGIVTGGSKENHTGCQPY  191



>ref|XP_010382894.1| PREDICTED: cathepsin B [Rhinopithecus roxellana]
 ref|XP_010382895.1| PREDICTED: cathepsin B [Rhinopithecus roxellana]
 ref|XP_010382896.1| PREDICTED: cathepsin B [Rhinopithecus roxellana]
Length=339

 Score =   146 bits (369),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 80/179 (45%), Positives = 106/179 (59%), Gaps = 23/179 (13%)
 Frame = +3

Query  99   TQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRL----LGAKKAPKSLL  266
             QS      L DE+V  VN+     W+A  N  F +  VS  KRL    LG  K P+ ++
Sbjct  17   AQSRPSFHPLSDELVNYVNKR-NTTWQAGHN--FYNVDVSYLKRLCGTFLGGPKPPQRVM  73

Query  267  KRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYG  446
                     + +ELP++FDAR  WPQC +I +I DQG CGSCWAFGAVE+++DR CIH  
Sbjct  74   -------FTEDLELPESFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTN  126

Query  447  TNVTLSVN--DLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTS-------ECDPYFDP  596
             +V++ V+  DLL CCG MCG+GC+GGYP  AW ++TR G+V+         C PY  P
Sbjct  127  AHVSVEVSAEDLLTCCGIMCGDGCNGGYPAGAWNFWTRKGLVSGGLYDSHVGCRPYSIP  185



>dbj|BAE87131.1| unnamed protein product [Macaca fascicularis]
Length=296

 Score =   144 bits (363),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 77/170 (45%), Positives = 104/170 (61%), Gaps = 23/170 (14%)
 Frame = +3

Query  126  LQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRL----LGAKKAPKSLLKRTPVATHD  293
            L DE+V  VN+     W+A  N  F +  VS  KRL    LG  K P+ ++         
Sbjct  26   LSDELVNYVNKQ-NTTWQAGHN--FYNVDVSYLKRLCGTFLGGPKPPQRVM-------FT  75

Query  294  KQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYGTNVTLSVN-  470
            + ++LP++FDAR  WPQC +I +I DQG CGSCWAFGAVE+++DR CIH   +V++ V+ 
Sbjct  76   EDLKLPESFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSA  135

Query  471  -DLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTS-------ECDPYFDP  596
             DLL CCG MCG+GC+GGYP  AW ++TR G+V+         C PY  P
Sbjct  136  EDLLTCCGIMCGDGCNGGYPAGAWNFWTRKGLVSGGLYDSHVGCRPYSIP  185



>ref|XP_003479431.1| PREDICTED: cathepsin B [Cavia porcellus]
Length=340

 Score =   145 bits (366),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 77/166 (46%), Positives = 101/166 (61%), Gaps = 15/166 (9%)
 Frame = +3

Query  126  LQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSLLKRTPVATHDKQIE  305
            L DE+V  VN+     W+A  N  F +  +S  KRL G       L +R   A   + ++
Sbjct  26   LSDELVNYVNK-LNTTWQAGRN--FHNVDISYVKRLCGTYLGGPRLPQRVQFA---EDLD  79

Query  306  LPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYG--TNVTLSVNDLL  479
            LP++FDAR  WP C +I +I DQG CGSCWAFGAVE+++DR CIH     NV +S  DLL
Sbjct  80   LPESFDAREQWPNCPTIKEIRDQGSCGSCWAFGAVEAMSDRLCIHTNGHVNVEVSAEDLL  139

Query  480  ACCGFMCGEGCDGGYPIAAWQYFTRTGVVTS-------ECDPYFDP  596
            +CCG +CGEGC+GGYP  AW+Y+TR G+V+         C PY  P
Sbjct  140  SCCGPLCGEGCNGGYPTEAWKYWTRKGLVSGGLYGSHVGCRPYSIP  185



>ref|XP_007959824.1| PREDICTED: cathepsin B [Chlorocebus sabaeus]
Length=339

 Score =   145 bits (365),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 77/170 (45%), Positives = 104/170 (61%), Gaps = 23/170 (14%)
 Frame = +3

Query  126  LQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRL----LGAKKAPKSLLKRTPVATHD  293
            L DE+V  VN+     W+A  N  F +  VS  KRL    LG  K P+ ++         
Sbjct  26   LSDELVNYVNKR-NTTWQAGHN--FYNVDVSYLKRLCGTFLGGPKPPQRVM-------FT  75

Query  294  KQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYGTNVTLSVN-  470
            + ++LP++FDAR  WPQC +I +I DQG CGSCWAFGAVE+++DR CIH   +V++ V+ 
Sbjct  76   EDLKLPESFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSA  135

Query  471  -DLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTS-------ECDPYFDP  596
             DLL CCG MCG+GC+GGYP  AW ++TR G+V+         C PY  P
Sbjct  136  EDLLTCCGIMCGDGCNGGYPAGAWNFWTRKGLVSGGLYDSHVGCRPYSIP  185



>ref|NP_001181828.1| cathepsin B precursor [Macaca mulatta]
Length=339

 Score =   145 bits (365),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 77/170 (45%), Positives = 104/170 (61%), Gaps = 23/170 (14%)
 Frame = +3

Query  126  LQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRL----LGAKKAPKSLLKRTPVATHD  293
            L DE+V  VN+     W+A  N  F +  VS  KRL    LG  K P+ ++         
Sbjct  26   LSDELVNYVNKQ-NTTWQAGHN--FYNVDVSYLKRLCGTFLGGPKPPQRVM-------FT  75

Query  294  KQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYGTNVTLSVN-  470
            + ++LP++FDAR  WPQC +I +I DQG CGSCWAFGAVE+++DR CIH   +V++ V+ 
Sbjct  76   EDLKLPESFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSA  135

Query  471  -DLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTS-------ECDPYFDP  596
             DLL CCG MCG+GC+GGYP  AW ++TR G+V+         C PY  P
Sbjct  136  EDLLTCCGIMCGDGCNGGYPAGAWNFWTRKGLVSGGLYDSHVGCRPYSIP  185



>ref|XP_003902454.1| PREDICTED: cathepsin B [Papio anubis]
 ref|XP_009210752.1| PREDICTED: cathepsin B [Papio anubis]
 ref|XP_009210753.1| PREDICTED: cathepsin B [Papio anubis]
 ref|XP_009210754.1| PREDICTED: cathepsin B [Papio anubis]
 ref|XP_009210755.1| PREDICTED: cathepsin B [Papio anubis]
Length=339

 Score =   144 bits (364),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 77/170 (45%), Positives = 104/170 (61%), Gaps = 23/170 (14%)
 Frame = +3

Query  126  LQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRL----LGAKKAPKSLLKRTPVATHD  293
            L DE+V  VN+     W+A  N  F +  VS  KRL    LG  K P+ ++         
Sbjct  26   LSDELVNYVNKQ-NTTWQAGHN--FYNVDVSYLKRLCGTFLGGPKPPQRVM-------FT  75

Query  294  KQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYGTNVTLSVN-  470
            + ++LP++FDAR  WPQC +I +I DQG CGSCWAFGAVE+++DR CIH   +V++ V+ 
Sbjct  76   EDLKLPESFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSA  135

Query  471  -DLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTS-------ECDPYFDP  596
             DLL CCG MCG+GC+GGYP  AW ++TR G+V+         C PY  P
Sbjct  136  EDLLTCCGIMCGDGCNGGYPAGAWNFWTRKGLVSGGLYDSHVGCRPYSIP  185



>ref|NP_001270414.1| cathepsin B precursor [Macaca fascicularis]
 sp|Q4R5M2.1|CATB_MACFA RecName: Full=Cathepsin B; Contains: RecName: Full=Cathepsin 
B light chain; Contains: RecName: Full=Cathepsin B heavy chain; 
Flags: Precursor [Macaca fascicularis]
 dbj|BAE01603.1| unnamed protein product [Macaca fascicularis]
 gb|EHH63980.1| Cathepsin B [Macaca fascicularis]
Length=339

 Score =   144 bits (364),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 77/170 (45%), Positives = 104/170 (61%), Gaps = 23/170 (14%)
 Frame = +3

Query  126  LQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRL----LGAKKAPKSLLKRTPVATHD  293
            L DE+V  VN+     W+A  N  F +  VS  KRL    LG  K P+ ++         
Sbjct  26   LSDELVNYVNKQ-NTTWQAGHN--FYNVDVSYLKRLCGTFLGGPKPPQRVM-------FT  75

Query  294  KQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYGTNVTLSVN-  470
            + ++LP++FDAR  WPQC +I +I DQG CGSCWAFGAVE+++DR CIH   +V++ V+ 
Sbjct  76   EDLKLPESFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSA  135

Query  471  -DLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTS-------ECDPYFDP  596
             DLL CCG MCG+GC+GGYP  AW ++TR G+V+         C PY  P
Sbjct  136  EDLLTCCGIMCGDGCNGGYPAGAWNFWTRKGLVSGGLYDSHVGCRPYSIP  185



>gb|EHH28274.1| Cathepsin B [Macaca mulatta]
Length=339

 Score =   144 bits (364),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 77/170 (45%), Positives = 103/170 (61%), Gaps = 23/170 (14%)
 Frame = +3

Query  126  LQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRL----LGAKKAPKSLLKRTPVATHD  293
            L DE+V  VN+     W+A  N  F +  VS  KRL    LG  K P+ ++         
Sbjct  26   LSDELVNYVNKQ-NTTWQAGHN--FYNVDVSYLKRLCGTFLGGPKPPQRVM-------FT  75

Query  294  KQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYGTNVTLSVN-  470
            + ++LP++FDAR  WPQC +I +I DQG CGSCWAFGAVE+++DR CIH   +V++ V+ 
Sbjct  76   EDLKLPESFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSA  135

Query  471  -DLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTS-------ECDPYFDP  596
             DLL CCG MCG+GC+GGYP  AW + TR G+V+         C PY  P
Sbjct  136  EDLLTCCGIMCGDGCNGGYPAGAWNFLTRKGLVSGGLYDSHVGCRPYSIP  185



>ref|NP_001174338.1| Os05g0310500 [Oryza sativa Japonica Group]
 dbj|BAH93066.1| Os05g0310500, partial [Oryza sativa Japonica Group]
Length=234

 Score =   140 bits (353),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 59/73 (81%), Positives = 65/73 (89%), Gaps = 0/73 (0%)
 Frame = +3

Query  375  GHCGSCWAFGAVESLTDRFCIHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTR  554
            GHCGSCWAFGAVE L DRFCIH+  N++LSVNDL+ACCGFMCG+GCDGGYPI AW+YF R
Sbjct  1    GHCGSCWAFGAVECLQDRFCIHFNMNISLSVNDLVACCGFMCGDGCDGGYPIMAWRYFVR  60

Query  555  TGVVTSECDPYFD  593
             GVVT ECDPYFD
Sbjct  61   NGVVTDECDPYFD  73



>pdb|1PBH|A Chain A, Crystal Structure Of Human Recombinant Procathepsin 
B At 3.2 Angstrom Resolution
 pdb|2PBH|A Chain A, Crystal Structure Of Human Procathepsin B At 3.3 Angstrom 
Resolution
 pdb|3PBH|A Chain A, Refined Crystal Structure Of Human Procathepsin B At 
2.5 Angstrom Resolution
Length=317

 Score =   142 bits (358),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 76/170 (45%), Positives = 103/170 (61%), Gaps = 23/170 (14%)
 Frame = +3

Query  126  LQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRL----LGAKKAPKSLLKRTPVATHD  293
            L DE+V  VN+     W+A  N  F +  +S  KRL    LG  K P+ ++         
Sbjct  10   LSDELVNYVNKR-NTTWQAGHN--FYNVDMSYLKRLCGTFLGGPKPPQRVM-------FT  59

Query  294  KQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYGTNVTLSVN-  470
            + ++LP +FDAR  WPQC +I +I DQG CGSCWAFGAVE+++DR CIH   +V++ V+ 
Sbjct  60   EDLKLPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSA  119

Query  471  -DLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTS-------ECDPYFDP  596
             DLL CCG MCG+GC+GGYP  AW ++TR G+V+         C PY  P
Sbjct  120  EDLLTCCGSMCGDGCNGGYPAEAWNFWTRKGLVSGGLYESHVGCRPYSIP  169



>ref|XP_004630768.1| PREDICTED: cathepsin B [Octodon degus]
Length=340

 Score =   142 bits (359),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 77/166 (46%), Positives = 100/166 (60%), Gaps = 15/166 (9%)
 Frame = +3

Query  126  LQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSLLKRTPVATHDKQIE  305
            L DE+V  VN+     W+A  N  F +  +S  KRL G  +    L +R   A   + + 
Sbjct  26   LSDELVNYVNK-LNTTWQAGRN--FYNVDMSYVKRLCGTYQGGPRLPERVRFA---EDMN  79

Query  306  LPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYG--TNVTLSVNDLL  479
            LP++FDAR  WP C +I +I DQG CGSCWAFGAV +++DR CIH     NV LS  DLL
Sbjct  80   LPESFDAREQWPNCPTIKEIRDQGSCGSCWAFGAVGAMSDRVCIHTNGRVNVELSAEDLL  139

Query  480  ACCGFMCGEGCDGGYPIAAWQYFTRTGVVTS-------ECDPYFDP  596
            +CCG MCGEGC+GGYP  AW+Y+T+ G+V+         C PY  P
Sbjct  140  SCCGPMCGEGCNGGYPSQAWEYWTKKGLVSGGLYESHVGCRPYSIP  185



>ref|XP_008968041.1| PREDICTED: cathepsin B [Pan paniscus]
 ref|XP_008968048.1| PREDICTED: cathepsin B [Pan paniscus]
 ref|XP_008968050.1| PREDICTED: cathepsin B [Pan paniscus]
 ref|XP_008968055.1| PREDICTED: cathepsin B [Pan paniscus]
 ref|XP_008968061.1| PREDICTED: cathepsin B [Pan paniscus]
Length=339

 Score =   142 bits (359),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 76/170 (45%), Positives = 104/170 (61%), Gaps = 23/170 (14%)
 Frame = +3

Query  126  LQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRL----LGAKKAPKSLLKRTPVATHD  293
            L DE+V  VN+     W+A  N  F +  +S  KRL    LG  K P+ ++         
Sbjct  26   LSDELVNYVNKR-NTTWQAGHN--FYNVDMSYLKRLCGTFLGGPKPPQRVM-------FT  75

Query  294  KQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYGTNVTLSVN-  470
            + ++LP++FDAR  WPQC +I +I DQG CGSCWAFGAVE+++DR CIH   +V++ V+ 
Sbjct  76   EDLKLPESFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSA  135

Query  471  -DLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTS-------ECDPYFDP  596
             DLL CCG MCG+GC+GGYP  AW ++TR G+V+         C PY  P
Sbjct  136  EDLLTCCGSMCGDGCNGGYPAEAWNFWTRKGLVSGGLYESHVGCRPYSIP  185



>ref|XP_003317964.1| PREDICTED: cathepsin B [Pan troglodytes]
 ref|XP_003317965.1| PREDICTED: cathepsin B [Pan troglodytes]
 ref|XP_009438527.1| PREDICTED: cathepsin B [Pan troglodytes]
Length=339

 Score =   142 bits (358),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 76/170 (45%), Positives = 104/170 (61%), Gaps = 23/170 (14%)
 Frame = +3

Query  126  LQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRL----LGAKKAPKSLLKRTPVATHD  293
            L DE+V  VN+     W+A  N  F +  +S  KRL    LG  K P+ ++         
Sbjct  26   LSDELVNYVNKR-NTTWQAGHN--FYNVDMSYLKRLCGAFLGGPKPPQRVM-------FT  75

Query  294  KQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYGTNVTLSVN-  470
            + ++LP++FDAR  WPQC +I +I DQG CGSCWAFGAVE+++DR CIH   +V++ V+ 
Sbjct  76   EDLKLPESFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSA  135

Query  471  -DLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTS-------ECDPYFDP  596
             DLL CCG MCG+GC+GGYP  AW ++TR G+V+         C PY  P
Sbjct  136  EDLLTCCGSMCGDGCNGGYPAEAWNFWTRKGLVSGGLYESHVGCRPYSIP  185



>ref|NP_001126573.1| cathepsin B precursor [Pongo abelii]
 sp|Q5R6D1.1|CATB_PONAB RecName: Full=Cathepsin B; Contains: RecName: Full=Cathepsin 
B light chain; Contains: RecName: Full=Cathepsin B heavy chain; 
Flags: Precursor [Pongo abelii]
 emb|CAH92586.1| hypothetical protein [Pongo abelii]
 emb|CAH92685.1| hypothetical protein [Pongo abelii]
Length=339

 Score =   142 bits (357),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 76/170 (45%), Positives = 104/170 (61%), Gaps = 23/170 (14%)
 Frame = +3

Query  126  LQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRL----LGAKKAPKSLLKRTPVATHD  293
            L DE+V  VN+     W+A  N  F +  VS  K+L    LG  K P+ ++         
Sbjct  26   LSDELVNYVNKR-NTTWQAGHN--FYNVDVSYLKKLCGTFLGGPKPPQRVM-------FT  75

Query  294  KQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYGTNVTLSVN-  470
            + ++LP++FDAR  WPQC +I +I DQG CGSCWAFGAVE+++DR CIH   +V++ V+ 
Sbjct  76   EDLKLPESFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSA  135

Query  471  -DLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTS-------ECDPYFDP  596
             DLL CCG MCG+GC+GGYP  AW ++TR G+V+         C PY  P
Sbjct  136  EDLLTCCGSMCGDGCNGGYPAEAWNFWTRKGLVSGGLYESHVGCRPYSIP  185



>ref|XP_004046705.1| PREDICTED: cathepsin B isoform 1 [Gorilla gorilla gorilla]
 ref|XP_004046706.1| PREDICTED: cathepsin B isoform 2 [Gorilla gorilla gorilla]
 ref|XP_004046707.1| PREDICTED: cathepsin B isoform 3 [Gorilla gorilla gorilla]
Length=339

 Score =   142 bits (357),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 75/170 (44%), Positives = 104/170 (61%), Gaps = 23/170 (14%)
 Frame = +3

Query  126  LQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRL----LGAKKAPKSLLKRTPVATHD  293
            L DE+V  VN+     W+A  N  F +  +S  KRL    LG  K P+ ++         
Sbjct  26   LSDELVNYVNKR-NTTWQAGHN--FYNVDMSYLKRLCGTFLGGPKPPQRVM-------FT  75

Query  294  KQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYGTNVTLSVN-  470
            + ++LP++FDAR  WPQC ++ +I DQG CGSCWAFGAVE+++DR CIH   +V++ V+ 
Sbjct  76   EDLKLPESFDAREQWPQCPTVKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSA  135

Query  471  -DLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTS-------ECDPYFDP  596
             DLL CCG MCG+GC+GGYP  AW ++TR G+V+         C PY  P
Sbjct  136  EDLLTCCGSMCGDGCNGGYPAEAWNFWTRKGLVSGGLYESHVGCRPYSIP  185



>dbj|BAF82928.1| unnamed protein product [Homo sapiens]
Length=339

 Score =   142 bits (357),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 76/170 (45%), Positives = 103/170 (61%), Gaps = 23/170 (14%)
 Frame = +3

Query  126  LQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRL----LGAKKAPKSLLKRTPVATHD  293
            L DE+V  VN+     W+A  N  F +  +S  KRL    LG  K P+ ++         
Sbjct  26   LSDELVNYVNKR-NTTWQAGHN--FYNVDMSYLKRLCGTFLGGPKPPQRVM-------FT  75

Query  294  KQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYGTNVTLSVN-  470
            + ++LP +FDAR  WPQC +I +I DQG CGSCWAFGAVE+++DR CIH   +V++ V+ 
Sbjct  76   EDLKLPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSA  135

Query  471  -DLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTS-------ECDPYFDP  596
             DLL CCG MCG+GC+GGYP  AW ++TR G+V+         C PY  P
Sbjct  136  EDLLTCCGSMCGDGCNGGYPAEAWNFWTRKGLVSGGLYESHVGCRPYSIP  185



>ref|NP_001899.1| cathepsin B preproprotein [Homo sapiens]
 ref|NP_680090.1| cathepsin B preproprotein [Homo sapiens]
 ref|NP_680091.1| cathepsin B preproprotein [Homo sapiens]
 ref|NP_680092.1| cathepsin B preproprotein [Homo sapiens]
 ref|NP_680093.1| cathepsin B preproprotein [Homo sapiens]
 ref|XP_006716307.1| PREDICTED: cathepsin B isoform X1 [Homo sapiens]
 ref|XP_006716308.1| PREDICTED: cathepsin B isoform X2 [Homo sapiens]
 sp|P07858.3|CATB_HUMAN RecName: Full=Cathepsin B; AltName: Full=APP secretase; Short=APPS; 
AltName: Full=Cathepsin B1; Contains: RecName: Full=Cathepsin 
B light chain; Contains: RecName: Full=Cathepsin B 
heavy chain; Flags: Precursor [Homo sapiens]
 gb|AAC37547.1| cathepsin B [Homo sapiens]
 gb|AAH95408.1| Cathepsin B [Homo sapiens]
 gb|EAW65630.1| cathepsin B, isoform CRA_a [Homo sapiens]
 gb|EAW65632.1| cathepsin B, isoform CRA_a [Homo sapiens]
 gb|EAW65633.1| cathepsin B, isoform CRA_a [Homo sapiens]
 gb|EAW65634.1| cathepsin B, isoform CRA_a [Homo sapiens]
 gb|EAW65635.1| cathepsin B, isoform CRA_a [Homo sapiens]
 gb|EAW65636.1| cathepsin B, isoform CRA_a [Homo sapiens]
 dbj|BAG10955.1| cathepsin B precursor [synthetic construct]
 dbj|BAG52127.1| unnamed protein product [Homo sapiens]
Length=339

 Score =   142 bits (357),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 76/170 (45%), Positives = 103/170 (61%), Gaps = 23/170 (14%)
 Frame = +3

Query  126  LQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRL----LGAKKAPKSLLKRTPVATHD  293
            L DE+V  VN+     W+A  N  F +  +S  KRL    LG  K P+ ++         
Sbjct  26   LSDELVNYVNKR-NTTWQAGHN--FYNVDMSYLKRLCGTFLGGPKPPQRVM-------FT  75

Query  294  KQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYGTNVTLSVN-  470
            + ++LP +FDAR  WPQC +I +I DQG CGSCWAFGAVE+++DR CIH   +V++ V+ 
Sbjct  76   EDLKLPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSA  135

Query  471  -DLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTS-------ECDPYFDP  596
             DLL CCG MCG+GC+GGYP  AW ++TR G+V+         C PY  P
Sbjct  136  EDLLTCCGSMCGDGCNGGYPAEAWNFWTRKGLVSGGLYESHVGCRPYSIP  185



>ref|NP_001232104.1| putative cathepsin B variant 2 precursor [Taeniopygia guttata]
 gb|ACH45719.1| putative cathepsin B variant 2 [Taeniopygia guttata]
Length=261

 Score =   139 bits (351),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 99/166 (60%), Gaps = 15/166 (9%)
 Frame = +3

Query  126  LQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSLLKRTPVATHDKQIE  305
            L D++V  +N+     WKA  N  F +  +S  K+L G       L +R   A     +E
Sbjct  26   LSDDLVNHINKL-NTTWKAGHN--FHNADMSYVKKLCGTFLGGPKLPERVDFAA---DVE  79

Query  306  LPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYGTNVTLSVN--DLL  479
            LP  FD+RT WP C +I++I DQG CGSCWAFGAVE+++DR C+H    V++ V+  DLL
Sbjct  80   LPDNFDSRTQWPNCPTISEIRDQGSCGSCWAFGAVEAISDRICVHTNAKVSVEVSAEDLL  139

Query  480  ACCGFMCGEGCDGGYPIAAWQYFTRTGVVTS-------ECDPYFDP  596
            +CCGF CG GC+GGYP  AW+Y+T  G+V+         C PY  P
Sbjct  140  SCCGFECGMGCNGGYPSGAWRYWTERGLVSGGLYDSHVGCRPYSIP  185



>emb|CAD44624.1| cathepsin B1 isotype 1 [Schistosoma mansoni]
 emb|CCD74613.1| cathepsin B-like peptidase (C01 family) [Schistosoma mansoni]
Length=340

 Score =   141 bits (356),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 73/165 (44%), Positives = 101/165 (61%), Gaps = 14/165 (8%)
 Frame = +3

Query  126  LQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSLLK-RTPVATH-DKQ  299
            L D+I+  +NE+P AGW+A+ + RF     ++ +  +GA++    L + R P   H D  
Sbjct  29   LSDDIISYINEHPNAGWRAEKSNRFHSLDDARIQ--MGARREEPDLRRTRRPTVDHNDWN  86

Query  300  IELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYG--TNVTLSVND  473
            +E+P +FD+R  WP+C SIA I DQ  CGSCWAFGAVE+++DR CI  G   NV LS  D
Sbjct  87   VEIPSSFDSRKKWPRCKSIATIRDQSRCGSCWAFGAVEAMSDRSCIQSGGKQNVELSAVD  146

Query  474  LLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSE-------CDPY  587
            LL+CC   CG GC+GG    AW Y+ + G+VT         C+PY
Sbjct  147  LLSCCE-SCGLGCEGGILGPAWDYWVKEGIVTGSSKENHTGCEPY  190



>gb|ACH45720.1| putative cathepsin B variant 2 [Taeniopygia guttata]
Length=236

 Score =   138 bits (348),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 99/166 (60%), Gaps = 15/166 (9%)
 Frame = +3

Query  126  LQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSLLKRTPVATHDKQIE  305
            L D++V  +N+     WKA  N  F +  +S  K+L G       L +R   A     +E
Sbjct  26   LSDDLVNHINKL-NTTWKAGHN--FHNADMSYVKKLCGTFLGGPKLPERVDFAA---DVE  79

Query  306  LPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYGTNVTLSVN--DLL  479
            LP  FD+RT WP C +I++I DQG CGSCWAFGAVE+++DR C+H    V++ V+  DLL
Sbjct  80   LPDNFDSRTQWPNCPTISEIRDQGSCGSCWAFGAVEAISDRICVHTNAKVSVEVSAEDLL  139

Query  480  ACCGFMCGEGCDGGYPIAAWQYFTRTGVVTS-------ECDPYFDP  596
            +CCGF CG GC+GGYP  AW+Y+T  G+V+         C PY  P
Sbjct  140  SCCGFECGMGCNGGYPSGAWRYWTERGLVSGGLYDSHVGCRPYSIP  185



>ref|XP_002756833.2| PREDICTED: cathepsin B [Callithrix jacchus]
Length=339

 Score =   141 bits (355),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 75/166 (45%), Positives = 100/166 (60%), Gaps = 15/166 (9%)
 Frame = +3

Query  126  LQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSLLKRTPVATHDKQIE  305
            L DE+V  VN+     W+A  N  F +  +S  KRL G         +R   A   + + 
Sbjct  26   LSDELVNYVNKQ-NTTWQAGHN--FYNVDLSYLKRLCGTFLGGPKPPQRVKFA---EDLN  79

Query  306  LPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYGTNVTLSVN--DLL  479
            LP++FDAR  WPQC +I +I DQG CGSCWAFGAVE+++DR CIH   +V++ V+  DLL
Sbjct  80   LPESFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSAEDLL  139

Query  480  ACCGFMCGEGCDGGYPIAAWQYFTRTGVVTS-------ECDPYFDP  596
             CCG MCG+GC+GGYP  AW ++TR G+V+         C PY  P
Sbjct  140  TCCGSMCGDGCNGGYPAEAWNFWTRKGLVSGGLYDSHVGCRPYSIP  185



>ref|XP_005373887.1| PREDICTED: cathepsin B [Chinchilla lanigera]
Length=340

 Score =   141 bits (355),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/166 (46%), Positives = 99/166 (60%), Gaps = 15/166 (9%)
 Frame = +3

Query  126  LQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSLLKRTPVATHDKQIE  305
            L DE+V  VN+     W+A  N  F +  +S  KRL G       L +R   A   + + 
Sbjct  26   LSDELVTYVNK-LNTTWQAGRN--FYNVDMSYVKRLCGTYLGGPRLPQRVGFA---EDMN  79

Query  306  LPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYG--TNVTLSVNDLL  479
            LP++FDAR  WP C +I +I DQG CGSCWAFGAV +++DR CIH     NV LS  DLL
Sbjct  80   LPESFDAREQWPNCPTIKEIRDQGSCGSCWAFGAVGAMSDRVCIHTNGHVNVELSAEDLL  139

Query  480  ACCGFMCGEGCDGGYPIAAWQYFTRTGVVTS-------ECDPYFDP  596
            +CCG MCGEGC+GGYP  AW+Y+T+ G+V+         C PY  P
Sbjct  140  SCCGPMCGEGCNGGYPSEAWEYWTKKGLVSGGLYDSHVGCRPYSIP  185



>gb|AAA52129.1| preprocathepsin B [Homo sapiens]
 dbj|BAG52477.1| unnamed protein product [Homo sapiens]
Length=339

 Score =   140 bits (353),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 75/170 (44%), Positives = 103/170 (61%), Gaps = 23/170 (14%)
 Frame = +3

Query  126  LQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRL----LGAKKAPKSLLKRTPVATHD  293
            + DE+V  VN+     W+A  N  F +  +S  KRL    LG  K P+ ++         
Sbjct  26   VSDELVNYVNKR-NTTWQAGHN--FYNVDMSYLKRLCGTFLGGPKPPQRVM-------FT  75

Query  294  KQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYGTNVTLSVN-  470
            + ++LP +FDAR  WPQC +I +I DQG CGSCWAFGAVE+++DR CIH   +V++ V+ 
Sbjct  76   EDLKLPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSA  135

Query  471  -DLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTS-------ECDPYFDP  596
             DLL CCG MCG+GC+GGYP  AW ++TR G+V+         C PY  P
Sbjct  136  EDLLTCCGSMCGDGCNGGYPAEAWNFWTRKGLVSGGLYESHVGCRPYSIP  185



>gb|KFP80814.1| Cathepsin B, partial [Apaloderma vittatum]
Length=269

 Score =   139 bits (349),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 100/166 (60%), Gaps = 15/166 (9%)
 Frame = +3

Query  126  LQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSLLKRTPVATHDKQIE  305
            L +E+V  +N+     WKA  N  F +  +S  K+L G       L +R   A     +E
Sbjct  26   LSNELVNHINKL-NTTWKAGHN--FHNTDMSYVKKLCGTFLGGPKLPERVDFAA---DME  79

Query  306  LPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYGTNVTLSVN--DLL  479
            LP +FD+RT WP C +I++I DQG CGSCWAFGAVE+++DR C+H    V++ V+  DLL
Sbjct  80   LPDSFDSRTQWPNCPTISEIRDQGSCGSCWAFGAVEAISDRICVHTNAKVSVEVSAEDLL  139

Query  480  ACCGFMCGEGCDGGYPIAAWQYFTRTGVVTS-------ECDPYFDP  596
            +CCGF CG GC+GGYP  AW+Y+T  G+V+         C PY  P
Sbjct  140  SCCGFECGMGCNGGYPSGAWRYWTERGLVSGGLYDSHVGCRPYTIP  185



>ref|XP_009863384.1| PREDICTED: cathepsin B, partial [Apaloderma vittatum]
Length=276

 Score =   139 bits (349),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 100/166 (60%), Gaps = 15/166 (9%)
 Frame = +3

Query  126  LQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSLLKRTPVATHDKQIE  305
            L +E+V  +N+     WKA  N  F +  +S  K+L G       L +R   A     +E
Sbjct  26   LSNELVNHINKL-NTTWKAGHN--FHNTDMSYVKKLCGTFLGGPKLPERVDFAA---DME  79

Query  306  LPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYGTNVTLSVN--DLL  479
            LP +FD+RT WP C +I++I DQG CGSCWAFGAVE+++DR C+H    V++ V+  DLL
Sbjct  80   LPDSFDSRTQWPNCPTISEIRDQGSCGSCWAFGAVEAISDRICVHTNAKVSVEVSAEDLL  139

Query  480  ACCGFMCGEGCDGGYPIAAWQYFTRTGVVTS-------ECDPYFDP  596
            +CCGF CG GC+GGYP  AW+Y+T  G+V+         C PY  P
Sbjct  140  SCCGFECGMGCNGGYPSGAWRYWTERGLVSGGLYDSHVGCRPYTIP  185



>ref|XP_010620915.1| PREDICTED: cathepsin B [Fukomys damarensis]
 gb|KFO38051.1| Cathepsin B [Fukomys damarensis]
Length=340

 Score =   140 bits (353),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/166 (45%), Positives = 100/166 (60%), Gaps = 15/166 (9%)
 Frame = +3

Query  126  LQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSLLKRTPVATHDKQIE  305
            L DE+V  +N+     W+A  N  F +  +S  KRL G       L +R   A   + ++
Sbjct  26   LSDELVNYINKQ-NTTWQAGHN--FHNADMSYVKRLCGTYLGGPRLPQRVQFA---EDMD  79

Query  306  LPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYG--TNVTLSVNDLL  479
            LP++FDAR  WP C +I +I DQG CGSCWAFGAV +++DR CIH     NV +S  DLL
Sbjct  80   LPESFDAREQWPNCPTIKEIRDQGSCGSCWAFGAVGAMSDRVCIHTNGRVNVEVSAEDLL  139

Query  480  ACCGFMCGEGCDGGYPIAAWQYFTRTGVVTS-------ECDPYFDP  596
            +CCG  CG+GC+GGYP AAW+Y+T+ G+V+         C PY  P
Sbjct  140  SCCGLACGDGCNGGYPSAAWKYWTKKGLVSGGLYDSHVGCRPYSIP  185



>ref|XP_004877226.1| PREDICTED: cathepsin B [Heterocephalus glaber]
 ref|XP_004848516.1| PREDICTED: cathepsin B [Heterocephalus glaber]
 gb|EHA98213.1| Cathepsin B [Heterocephalus glaber]
Length=340

 Score =   140 bits (353),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 74/166 (45%), Positives = 100/166 (60%), Gaps = 15/166 (9%)
 Frame = +3

Query  126  LQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSLLKRTPVATHDKQIE  305
            L DE+V  +N+     W+A  N  F +  +S  KRL G       L +R   A   + ++
Sbjct  26   LSDELVNYINKQ-NTTWQAGHN--FHNVHLSYVKRLCGTYLGGPRLPQRIKFA---EIVD  79

Query  306  LPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYG--TNVTLSVNDLL  479
            LP++FDAR  WP C +I +I DQG CGSCWAFGAV +++DR CIH     NV +S  DLL
Sbjct  80   LPESFDARQQWPNCPTIKEIRDQGSCGSCWAFGAVGAMSDRVCIHTNGHVNVEVSAEDLL  139

Query  480  ACCGFMCGEGCDGGYPIAAWQYFTRTGVVTS-------ECDPYFDP  596
            +CCG  CG+GC+GGYP AAW+Y+T+ G+V+         C PY  P
Sbjct  140  SCCGLECGDGCNGGYPSAAWKYWTKKGLVSGGLYDSHVGCRPYSIP  185



>ref|XP_010993449.1| PREDICTED: cathepsin B [Camelus dromedarius]
Length=335

 Score =   140 bits (353),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 76/175 (43%), Positives = 102/175 (58%), Gaps = 15/175 (9%)
 Frame = +3

Query  99   TQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSLLKRTP  278
             QS V    + DE++  VN+     WKA  N R +D  +S  K+L G       L +R  
Sbjct  17   AQSSVRFPPMSDELIDYVNKR-NTTWKAGHNFRNAD--LSYVKKLCGTFLGGPKLPERVA  73

Query  279  VATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYG--TN  452
            +A +   + LPK+FDAR  WP C +I +I DQG CGSCWAFGAVE+++DR CIH     N
Sbjct  74   LAGN---MALPKSFDAREQWPNCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHSNGRVN  130

Query  453  VTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTS-------ECDPYFDP  596
            V +S  D+L CCG  CGEGC+GG+P  AW ++T+ G+V+         C PY  P
Sbjct  131  VEVSAEDMLTCCGLECGEGCNGGFPSGAWNFWTKQGLVSGGLYDSHVGCRPYSIP  185



>ref|XP_010971493.1| PREDICTED: LOW QUALITY PROTEIN: cathepsin B [Camelus bactrianus]
Length=335

 Score =   140 bits (353),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 76/175 (43%), Positives = 102/175 (58%), Gaps = 15/175 (9%)
 Frame = +3

Query  99   TQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSLLKRTP  278
             QS V    + DE++  VN+     WKA  N R +D  +S  K+L G       L +R  
Sbjct  17   AQSSVRFPPMSDELIDYVNKR-NTTWKAGHNFRNAD--LSYVKKLCGTFLGGPKLPERVA  73

Query  279  VATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYG--TN  452
            +A +   + LPK+FDAR  WP C +I +I DQG CGSCWAFGAVE+++DR CIH     N
Sbjct  74   LAGN---MALPKSFDAREQWPNCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHSNGRVN  130

Query  453  VTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTS-------ECDPYFDP  596
            V +S  D+L CCG  CGEGC+GG+P  AW ++T+ G+V+         C PY  P
Sbjct  131  VEVSAEDMLTCCGLECGEGCNGGFPSGAWNFWTKQGLVSGGLYDSHVGCRPYSIP  185



>ref|XP_006189621.1| PREDICTED: LOW QUALITY PROTEIN: cathepsin B [Camelus ferus]
Length=342

 Score =   140 bits (353),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 76/175 (43%), Positives = 102/175 (58%), Gaps = 15/175 (9%)
 Frame = +3

Query  99   TQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSLLKRTP  278
             QS V    + DE++  VN+     WKA  N R +D  +S  K+L G       L +R  
Sbjct  17   AQSSVRFPPMSDELIDYVNKR-NTTWKAGHNFRNAD--LSYVKKLCGTFLGGPKLPERVA  73

Query  279  VATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYG--TN  452
            +A +   + LPK+FDAR  WP C +I +I DQG CGSCWAFGAVE+++DR CIH     N
Sbjct  74   LAGN---MALPKSFDAREQWPNCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHSNGRVN  130

Query  453  VTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTS-------ECDPYFDP  596
            V +S  D+L CCG  CGEGC+GG+P  AW ++T+ G+V+         C PY  P
Sbjct  131  VEVSAEDMLTCCGLECGEGCNGGFPSGAWNFWTKQGLVSGGLYDSHVGCRPYSIP  185



>sp|P25792.1|CYSP_SCHMA RecName: Full=Cathepsin B-like cysteine proteinase; AltName: 
Full=Antigen Sm31; Flags: Precursor [Schistosoma mansoni]
 gb|AAA29865.1| cathepsin B [Schistosoma mansoni]
Length=340

 Score =   140 bits (352),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 73/165 (44%), Positives = 99/165 (60%), Gaps = 14/165 (8%)
 Frame = +3

Query  126  LQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKA-PKSLLKRTPVATH-DKQ  299
            L D+I+  +NE+P AGW+A+ + RF     ++ +  +GA++  P    KR P   H D  
Sbjct  29   LSDDIISYINEHPNAGWRAEKSNRFHSLDDARIQ--MGARREEPDLRRKRRPTVDHNDWN  86

Query  300  IELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYG--TNVTLSVND  473
            +E+P  FD+R  WP C SIA I DQ  CGSCW+FGAVE+++DR CI  G   NV LS  D
Sbjct  87   VEIPSNFDSRKKWPGCKSIATIRDQSRCGSCWSFGAVEAMSDRSCIQSGGKQNVELSAVD  146

Query  474  LLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSE-------CDPY  587
            LL CC   CG GC+GG    AW Y+ + G+VT+        C+PY
Sbjct  147  LLTCCE-SCGLGCEGGILGPAWDYWVKEGIVTASSKENHTGCEPY  190



>emb|CAD44625.1| cathepsin B1 isotype 2 [Schistosoma mansoni]
Length=340

 Score =   140 bits (352),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 73/167 (44%), Positives = 101/167 (60%), Gaps = 14/167 (8%)
 Frame = +3

Query  120  KILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKA-PKSLLKRTPVATHDK  296
            K L D+I+  +NE+P AGW+A+ + RF     ++ +  +GA++  P    KR P   H++
Sbjct  27   KPLSDDIISYINEHPNAGWRAEKSNRFHSLDDARIQ--MGARREEPDLRRKRRPTVDHNE  84

Query  297  -QIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYG--TNVTLSV  467
              +E+P  FD+R  WP C SIA I DQ  CGSCWAFGAVE+++DR CI  G   NV LS 
Sbjct  85   WNVEIPSNFDSRKKWPGCKSIATIRDQSRCGSCWAFGAVEAMSDRSCIQSGGKQNVELSA  144

Query  468  NDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSE-------CDPY  587
             DLL+CC   CG GC+GG    AW ++ + G+VT         C+PY
Sbjct  145  VDLLSCCE-SCGLGCEGGILGPAWDFWVKEGIVTGSSKENHTGCEPY  190



>emb|CCD74607.1| cathepsin B-like peptidase (C01 family) [Schistosoma mansoni]
Length=345

 Score =   139 bits (351),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 73/167 (44%), Positives = 101/167 (60%), Gaps = 14/167 (8%)
 Frame = +3

Query  120  KILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKA-PKSLLKRTPVATHDK  296
            K L D+I+  +NE+P AGW+A+ + RF     ++ +  +GA++  P    KR P   H++
Sbjct  32   KPLSDDIISYINEHPNAGWRAEKSNRFHSLDDARIQ--MGARREEPDLRRKRRPTVDHNE  89

Query  297  -QIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYG--TNVTLSV  467
              +E+P  FD+R  WP C SIA I DQ  CGSCWAFGAVE+++DR CI  G   NV LS 
Sbjct  90   WNVEIPSNFDSRKKWPGCKSIATIRDQSRCGSCWAFGAVEAMSDRSCIQSGGKQNVELSA  149

Query  468  NDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSE-------CDPY  587
             DLL+CC   CG GC+GG    AW ++ + G+VT         C+PY
Sbjct  150  VDLLSCCE-SCGLGCEGGILGPAWDFWVKEGIVTGSSKENHTGCEPY  195



>ref|XP_003757972.1| PREDICTED: cathepsin B [Sarcophilus harrisii]
Length=342

 Score =   139 bits (351),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 74/167 (44%), Positives = 102/167 (61%), Gaps = 15/167 (9%)
 Frame = +3

Query  126  LQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLG-AKKAPKSLLKRTPVATHDKQI  302
            L DE+V  VN+     WKA  N  F +  +S  K+L G      K L +R  +A  D  +
Sbjct  26   LSDEMVNYVNK-LNTTWKAGHN--FRNVDMSYVKKLCGTVMGGAKQLPQRVMLA--DDDM  80

Query  303  ELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYGTNVTLSVN--DL  476
            +LP+ FDAR  WP+C +I +I DQG CGSCWAFGAVE+++DR C+H    +T+ V+  DL
Sbjct  81   KLPENFDAREQWPKCPTIKEIRDQGSCGSCWAFGAVEAISDRICVHTNGYITIEVSAEDL  140

Query  477  LACCGFMCGEGCDGGYPIAAWQYFTRTGVVTS-------ECDPYFDP  596
            L+CCG  CGEGC+GG+P  AW+Y+ + G+V+         C PY  P
Sbjct  141  LSCCGLQCGEGCNGGFPAGAWKYWIKKGLVSGGLYDSHVGCRPYSIP  187



>gb|EYB87045.1| hypothetical protein Y032_0269g828 [Ancylostoma ceylanicum]
Length=399

 Score =   140 bits (353),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 72/162 (44%), Positives = 98/162 (60%), Gaps = 12/162 (7%)
 Frame = +3

Query  135  EIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSLLKRTPVATHD--KQIEL  308
            E+V+ VN+  +  +K  ++PRF+ +     KRL+G+K        R    THD  +   +
Sbjct  87   ELVEYVNK-AQNLFKTSLSPRFAQYPDEIKKRLMGSKHVAIPEEFRVNEKTHDDIEDAAI  145

Query  309  PKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHY--GTNVTLSVNDLLA  482
            P +FDART WPQC SI  I DQ  CGSCWAFGA E++TDR CI        T+S +D+L+
Sbjct  146  PDSFDARTNWPQCPSILSIRDQSSCGSCWAFGAAEAMTDRICIASKGKEQFTISADDILS  205

Query  483  CCGFMCGEGCDGGYPIAAWQYFTRTGVVTSE-------CDPY  587
            CCG +CG GC+GGYP+ AW+Y+ + GVVT         C PY
Sbjct  206  CCGMVCGNGCEGGYPLQAWKYWVKHGVVTGSNYTMKAGCKPY  247



>ref|XP_006219920.1| PREDICTED: cathepsin B-like cysteine proteinase 6-like, partial 
[Vicugna pacos]
Length=324

 Score =   139 bits (350),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 67/147 (46%), Positives = 92/147 (63%), Gaps = 11/147 (7%)
 Frame = +3

Query  180  ADMNPRFSDFTVSQFKRLLGAKKAPKSLLKRTPVATHD--KQIELPKTFDARTAWPQCVS  353
            A+++PRF+ +     KRL+G K      + R    THD      +P +FDART WPQC S
Sbjct  26   AELSPRFAQYPEEVKKRLMGVKHVAIPEVLRGNEKTHDDIADASIPDSFDARTNWPQCPS  85

Query  354  IADILDQGHCGSCWAFGAVESLTDRFCI--HYGTNVTLSVNDLLACCGFMCGEGCDGGYP  527
            I+ I DQ  CGSCWAFGA E++TDR CI  +     T+S +D+L+CCG +CG GC+GGYP
Sbjct  86   ISSIRDQSSCGSCWAFGAAEAMTDRICIASNGKEQFTISADDILSCCGLICGNGCEGGYP  145

Query  528  IAAWQYFTRTGVVT-------SECDPY  587
            + AW+++ + GVVT       + C PY
Sbjct  146  LEAWKFWVKHGVVTGGNYTSKAGCKPY  172



>ref|XP_010330375.1| PREDICTED: cathepsin B [Saimiri boliviensis boliviensis]
 ref|XP_010330376.1| PREDICTED: cathepsin B [Saimiri boliviensis boliviensis]
Length=339

 Score =   139 bits (350),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 74/166 (45%), Positives = 100/166 (60%), Gaps = 15/166 (9%)
 Frame = +3

Query  126  LQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSLLKRTPVATHDKQIE  305
            L +E+V  VN+     W+A  N  F +  +S  KRL G         +R   A   + + 
Sbjct  26   LSEELVNYVNKQ-NTTWQAGHN--FYNVDLSYLKRLCGTFLGGPKPPQRVKFA---EDLN  79

Query  306  LPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYGTNVTLSVN--DLL  479
            LP++FDAR  WPQC +I +I DQG CGSCWAFGAVE+++DR CIH   +V++ V+  DLL
Sbjct  80   LPESFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSAEDLL  139

Query  480  ACCGFMCGEGCDGGYPIAAWQYFTRTGVVTS-------ECDPYFDP  596
             CCG MCG+GC+GGYP  AW ++TR G+V+         C PY  P
Sbjct  140  TCCGSMCGDGCNGGYPAEAWNFWTRKGLVSGGLYDSHVGCRPYSIP  185



>ref|XP_006906367.1| PREDICTED: LOW QUALITY PROTEIN: cathepsin B [Pteropus alecto]
Length=340

 Score =   139 bits (350),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 75/166 (45%), Positives = 99/166 (60%), Gaps = 15/166 (9%)
 Frame = +3

Query  126  LQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSLLKRTPVATHDKQIE  305
            L DE+V  VN+     WKA  N  F +  +S  KRL G       L +R  +A   + + 
Sbjct  26   LSDELVNYVNKR-NTTWKAGHN--FHNVDLSYVKRLCGTILGGPKLPQRVWLA---EDLV  79

Query  306  LPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCI--HYGTNVTLSVNDLL  479
            LP++FDAR  WP C +I +I DQG CGSCWAFGAVE+++DR CI  +   NV +S  DLL
Sbjct  80   LPESFDAREQWPNCPTIKEIRDQGSCGSCWAFGAVEAISDRICILTNGNVNVEVSAEDLL  139

Query  480  ACCGFMCGEGCDGGYPIAAWQYFTRTGVVTS-------ECDPYFDP  596
             CCGF CGEGC+GG+P  AW ++T+ G+V+         C PY  P
Sbjct  140  TCCGFQCGEGCNGGFPSGAWNFWTKKGLVSGGLYDSHVGCRPYSIP  185



>gb|KFZ58860.1| Cathepsin B, partial [Podiceps cristatus]
Length=178

 Score =   135 bits (339),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 69/150 (46%), Positives = 94/150 (63%), Gaps = 8/150 (5%)
 Frame = +3

Query  126  LQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSLLKRTPVATHDKQIE  305
            L  ++V  +N+     WKA  N  F +  +S  K+L G       L +R   A     +E
Sbjct  26   LSSDLVNHINK-LNTTWKAGHN--FHNTDMSYVKKLCGTFLGGPKLPERVDFAA---DME  79

Query  306  LPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYGTNVTLSVN--DLL  479
            LP +FD+RT WP C +I +I DQG CGSCWAFGAVE+++DR CIH    V++ V+  DLL
Sbjct  80   LPDSFDSRTQWPNCPTINEIRDQGSCGSCWAFGAVEAISDRICIHTNAKVSVEVSAEDLL  139

Query  480  ACCGFMCGEGCDGGYPIAAWQYFTRTGVVT  569
            +CCGF CG GC+GGYP  AW+Y+T  G+V+
Sbjct  140  SCCGFECGMGCNGGYPSGAWRYWTERGLVS  169



>gb|ELK17542.1| Cathepsin B [Pteropus alecto]
Length=359

 Score =   139 bits (351),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 75/166 (45%), Positives = 99/166 (60%), Gaps = 15/166 (9%)
 Frame = +3

Query  126  LQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSLLKRTPVATHDKQIE  305
            L DE+V  VN+     WKA  N  F +  +S  KRL G       L +R  +A   + + 
Sbjct  49   LSDELVNYVNKR-NTTWKAGHN--FHNVDLSYVKRLCGTILGGPKLPQRVWLA---EDLV  102

Query  306  LPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCI--HYGTNVTLSVNDLL  479
            LP++FDAR  WP C +I +I DQG CGSCWAFGAVE+++DR CI  +   NV +S  DLL
Sbjct  103  LPESFDAREQWPNCPTIKEIRDQGSCGSCWAFGAVEAISDRICILTNGNVNVEVSAEDLL  162

Query  480  ACCGFMCGEGCDGGYPIAAWQYFTRTGVVTS-------ECDPYFDP  596
             CCGF CGEGC+GG+P  AW ++T+ G+V+         C PY  P
Sbjct  163  TCCGFQCGEGCNGGFPSGAWNFWTKKGLVSGGLYDSHVGCRPYSIP  208



>ref|XP_003412496.1| PREDICTED: cathepsin B [Loxodonta africana]
Length=340

 Score =   139 bits (350),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 77/181 (43%), Positives = 105/181 (58%), Gaps = 15/181 (8%)
 Frame = +3

Query  81   VAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKS  260
            + V    QS +  K L DE+V  VN+     W+A  N  F D  +S  KRL G       
Sbjct  11   LVVLTSAQSRLYFKPLSDELVNHVNK-LNTTWQAGHN--FYDVDMSYVKRLCGTLLNGPK  67

Query  261  LLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIH  440
            L +R  +A   ++++LP+ FDAR  WP C +I +I DQG CGSCWAFGAVE+++DR CIH
Sbjct  68   LPQRVHLA---EEMDLPENFDARENWPNCPTIKEIRDQGSCGSCWAFGAVEAISDRVCIH  124

Query  441  YGTNVTLSVN--DLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTS-------ECDPYFD  593
               NV + V+  DLL CC   CG+GC+GG+P  AW ++T+ G+V+         C PY  
Sbjct  125  TNGNVNVEVSAEDLLTCCHMECGDGCNGGFPAGAWNFWTKKGLVSGGLYDSHVGCRPYSI  184

Query  594  P  596
            P
Sbjct  185  P  185



>emb|CDP07745.1| unnamed protein product [Coffea canephora]
Length=258

 Score =   137 bits (345),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = +3

Query  372  QGHCGSCWAFGAVESLTDRFCIHYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFT  551
            QGHCGSCWAFGAVESL+DRFCI +G NV+LSVND+LACCGF CG+GC GG P AAW+YFT
Sbjct  23   QGHCGSCWAFGAVESLSDRFCIQFGMNVSLSVNDVLACCGFSCGDGCYGGSPFAAWEYFT  82

Query  552  RTGVVTSECDPYFD  593
             +GVVT ECDPYFD
Sbjct  83   YSGVVTEECDPYFD  96



>gb|AAH10240.1| Cathepsin B [Homo sapiens]
Length=339

 Score =   139 bits (350),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 74/170 (44%), Positives = 102/170 (60%), Gaps = 23/170 (14%)
 Frame = +3

Query  126  LQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRL----LGAKKAPKSLLKRTPVATHD  293
            + DE+V  VN+     W+A  N  F +  +   KRL    LG  K P+ ++         
Sbjct  26   VSDELVNYVNKR-NTTWQAGHN--FYNVDMGYLKRLCGTFLGGPKPPQRVM-------FT  75

Query  294  KQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYGTNVTLSVN-  470
            + ++LP +FDAR  WPQC +I +I DQG CGSCWAFGAVE+++DR CIH   +V++ V+ 
Sbjct  76   EDLKLPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSA  135

Query  471  -DLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTS-------ECDPYFDP  596
             DLL CCG MCG+GC+GGYP  AW ++TR G+V+         C PY  P
Sbjct  136  EDLLTCCGSMCGDGCNGGYPAEAWNFWTRKGLVSGGLYESHVGCRPYSIP  185



>gb|AAP36125.1| Homo sapiens cathepsin B [synthetic construct]
 gb|AAX43516.1| cathepsin B, partial [synthetic construct]
Length=340

 Score =   139 bits (349),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 74/170 (44%), Positives = 102/170 (60%), Gaps = 23/170 (14%)
 Frame = +3

Query  126  LQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRL----LGAKKAPKSLLKRTPVATHD  293
            + DE+V  VN+     W+A  N  F +  +   KRL    LG  K P+ ++         
Sbjct  26   VSDELVNYVNKR-NTTWQAGHN--FYNVDMGYLKRLCGTFLGGPKPPQRVM-------FT  75

Query  294  KQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYGTNVTLSVN-  470
            + ++LP +FDAR  WPQC +I +I DQG CGSCWAFGAVE+++DR CIH   +V++ V+ 
Sbjct  76   EDLKLPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSA  135

Query  471  -DLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTS-------ECDPYFDP  596
             DLL CCG MCG+GC+GGYP  AW ++TR G+V+         C PY  P
Sbjct  136  EDLLTCCGSMCGDGCNGGYPAEAWNFWTRKGLVSGGLYESHVGCRPYSIP  185



>gb|EMT13478.1| Cathepsin B [Aegilops tauschii]
Length=354

 Score =   139 bits (350),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 72/171 (42%), Positives = 98/171 (57%), Gaps = 19/171 (11%)
 Frame = +3

Query  99   TQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSLLKRTP  278
             ++E    I+Q +I++TVN++P AGW A  NP F+++T+ QFK +LG K  P  LL   P
Sbjct  29   AKAEHSLGIIQKDIIQTVNKHPNAGWTAGHNPYFANYTIEQFKHILGVKPTPPGLLAGVP  88

Query  279  VATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYGTNVT  458
            + TH + + LPK FDART W  C +I +IL         A G +  L +      G    
Sbjct  89   IKTHPESVGLPKEFDARTQWSSCSTIGNILG--------AQGIMYVLVNN-----GRVTV  135

Query  459  LSVNDLL------ACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
            + V  LL          F+   GC+GGYPI+AW+YF R+GVVT ECDPYFD
Sbjct  136  VPVGPLLPWKLSRIVSVFISTCGCNGGYPISAWRYFRRSGVVTEECDPYFD  186



>ref|XP_005495471.1| PREDICTED: cathepsin B isoform X1 [Zonotrichia albicollis]
 ref|XP_005495472.1| PREDICTED: cathepsin B isoform X2 [Zonotrichia albicollis]
Length=340

 Score =   139 bits (349),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 99/166 (60%), Gaps = 15/166 (9%)
 Frame = +3

Query  126  LQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSLLKRTPVATHDKQIE  305
            L D++V  +N+     WKA  N  F +  +S  K+L G       L +R   A     +E
Sbjct  26   LSDDLVNHINK-LNTTWKAGHN--FHNADMSYVKKLCGTFLGGPKLPERVDFAA---DVE  79

Query  306  LPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYGTNVTLSVN--DLL  479
            LP  FD+RT WP C +I++I DQG CGSCWAFGAVE+++DR C+H    V++ V+  DLL
Sbjct  80   LPDNFDSRTQWPNCPTISEIRDQGSCGSCWAFGAVEAISDRICVHTNAKVSVEVSAEDLL  139

Query  480  ACCGFMCGEGCDGGYPIAAWQYFTRTGVVTS-------ECDPYFDP  596
            +CCGF CG GC+GGYP  AW+Y+T  G+V+         C PY  P
Sbjct  140  SCCGFECGMGCNGGYPSGAWRYWTERGLVSGGLYDSHVGCRPYSIP  185



>ref|XP_005044491.1| PREDICTED: LOW QUALITY PROTEIN: cathepsin B [Ficedula albicollis]
Length=336

 Score =   139 bits (349),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 99/166 (60%), Gaps = 15/166 (9%)
 Frame = +3

Query  126  LQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSLLKRTPVATHDKQIE  305
            L D++V  +N+     WKA  N  F +  +S  K+L G       L +R   A     +E
Sbjct  26   LSDDLVNHINKL-NTTWKAGHN--FHNADMSYVKKLCGTFLGGPKLPERVDFAA---DVE  79

Query  306  LPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYGTNVTLSVN--DLL  479
            LP  FD+RT WP C +I++I DQG CGSCWAFGAVE+++DR C+H    V++ V+  DLL
Sbjct  80   LPDNFDSRTQWPNCPTISEIRDQGSCGSCWAFGAVEAISDRICVHTNAKVSVEVSAEDLL  139

Query  480  ACCGFMCGEGCDGGYPIAAWQYFTRTGVVTS-------ECDPYFDP  596
            +CCGF CG GC+GGYP  AW+Y+T  G+V+         C PY  P
Sbjct  140  SCCGFECGMGCNGGYPSGAWRYWTERGLVSGGLYDSHVGCRPYSIP  185



>gb|ACG50796.1| cathepsin B1 [Trichobilharzia szidati]
Length=342

 Score =   139 bits (349),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 76/184 (41%), Positives = 105/184 (57%), Gaps = 14/184 (8%)
 Frame = +3

Query  78   VVAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPK  257
            ++    +T +EV  + L DE++  +N++P+AGW A  + RF   +V   + LLGA    +
Sbjct  14   ILTAHILTDNEVQFEPLSDEMIAYINQHPDAGWTASRSDRFK--SVEDARILLGAMSEDE  71

Query  258  SLLK-RTPVATHDK-QIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRF  431
             L K R P   H    +E+P +FD+R  W QC SI++I DQ  CG CWAF AVE+++DR 
Sbjct  72   ELRKKRRPTVDHQNVSLEIPSSFDSRKKWRQCKSISNIRDQSRCGPCWAFAAVEAMSDRI  131

Query  432  CIHY--GTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSE-------CDP  584
            CI      +V LS  DLL+CC   CG GC GG+P AAW Y+   G+VT         C P
Sbjct  132  CIQSKGKKSVELSAVDLLSCC-TECGLGCQGGFPGAAWDYWVEEGIVTGSSKENHTGCQP  190

Query  585  YFDP  596
            Y  P
Sbjct  191  YPFP  194



>ref|XP_010409681.1| PREDICTED: cathepsin B [Corvus cornix cornix]
Length=340

 Score =   139 bits (349),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 99/166 (60%), Gaps = 15/166 (9%)
 Frame = +3

Query  126  LQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSLLKRTPVATHDKQIE  305
            L D++V  +N+     WKA  N  F +  +S  K+L G       L +R   A     +E
Sbjct  26   LSDDLVNHINK-LNTTWKAGHN--FHNADMSYVKKLCGTFLGGPKLPERVDFAA---DVE  79

Query  306  LPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYGTNVTLSVN--DLL  479
            LP  FD+RT WP C +I++I DQG CGSCWAFGAVE+++DR C+H    V++ V+  DLL
Sbjct  80   LPDNFDSRTQWPNCPTISEIRDQGSCGSCWAFGAVEAISDRICVHTNAKVSVEVSAEDLL  139

Query  480  ACCGFMCGEGCDGGYPIAAWQYFTRTGVVTS-------ECDPYFDP  596
            +CCGF CG GC+GGYP  AW+Y+T  G+V+         C PY  P
Sbjct  140  SCCGFECGMGCNGGYPSGAWRYWTERGLVSGGLYDSHVGCRPYSIP  185



>pdb|4I04|A Chain A, Structure Of Zymogen Of Cathepsin B1 From Schistosoma 
Mansoni
 pdb|4I04|B Chain B, Structure Of Zymogen Of Cathepsin B1 From Schistosoma 
Mansoni
 pdb|4I04|C Chain C, Structure Of Zymogen Of Cathepsin B1 From Schistosoma 
Mansoni
 pdb|4I04|D Chain D, Structure Of Zymogen Of Cathepsin B1 From Schistosoma 
Mansoni
Length=323

 Score =   138 bits (348),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 72/165 (44%), Positives = 100/165 (61%), Gaps = 14/165 (8%)
 Frame = +3

Query  126  LQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSLLK-RTPVATH-DKQ  299
            L D+I+  +NE+P AGW+A+ + RF     ++ +  +GA++    L + R P   H D  
Sbjct  12   LSDDIISYINEHPNAGWRAEKSNRFHSLDDARIQ--MGARREEPDLRRTRRPTVDHNDWN  69

Query  300  IELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYG--TNVTLSVND  473
            +E+P +FD+R  WP+C SIA I DQ  CGS WAFGAVE+++DR CI  G   NV LS  D
Sbjct  70   VEIPSSFDSRKKWPRCKSIATIRDQSRCGSSWAFGAVEAMSDRSCIQSGGKQNVELSAVD  129

Query  474  LLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSE-------CDPY  587
            LL+CC   CG GC+GG    AW Y+ + G+VT         C+PY
Sbjct  130  LLSCCE-SCGLGCEGGILGPAWDYWVKEGIVTGSSKENHAGCEPY  173



>ref|XP_008629247.1| PREDICTED: cathepsin B [Corvus brachyrhynchos]
 gb|KFO57096.1| Cathepsin B [Corvus brachyrhynchos]
Length=340

 Score =   139 bits (349),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 99/166 (60%), Gaps = 15/166 (9%)
 Frame = +3

Query  126  LQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSLLKRTPVATHDKQIE  305
            L D++V  +N+     WKA  N  F +  +S  K+L G       L +R   A     +E
Sbjct  26   LSDDLVNHINK-LNTTWKAGHN--FHNADMSYVKKLCGTFLGGPKLPERVDFAA---DVE  79

Query  306  LPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYGTNVTLSVN--DLL  479
            LP  FD+RT WP C +I++I DQG CGSCWAFGAVE+++DR C+H    V++ V+  DLL
Sbjct  80   LPDNFDSRTQWPNCPTISEIRDQGSCGSCWAFGAVEAISDRICVHTNAKVSVEVSAEDLL  139

Query  480  ACCGFMCGEGCDGGYPIAAWQYFTRTGVVTS-------ECDPYFDP  596
            +CCGF CG GC+GGYP  AW+Y+T  G+V+         C PY  P
Sbjct  140  SCCGFECGMGCNGGYPSGAWRYWTERGLVSGGLYDSHVGCRPYSIP  185



>ref|XP_004449108.1| PREDICTED: cathepsin B [Dasypus novemcinctus]
Length=340

 Score =   139 bits (349),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 100/166 (60%), Gaps = 15/166 (9%)
 Frame = +3

Query  126  LQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSLLKRTPVATHDKQIE  305
            L DE+V  +N      WKA  N  F +  +S  KRL G       L +R  +A   ++++
Sbjct  26   LSDELVTYINTR-NTTWKAGHN--FRNVDMSYVKRLCGTFLDGPRLPQRVRLA---EEMD  79

Query  306  LPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYG--TNVTLSVNDLL  479
            LP+ FD+R  WP C +I +I DQG CGSCWAFGAVE+++DR CIH     NV +S  DLL
Sbjct  80   LPENFDSREQWPNCPTIREIRDQGSCGSCWAFGAVEAISDRVCIHTNGKVNVEVSAEDLL  139

Query  480  ACCGFMCGEGCDGGYPIAAWQYFTRTGVVTS-------ECDPYFDP  596
            +CCG  CG+GC+GG+P AAW ++T+ G+V+         C PY  P
Sbjct  140  SCCGMACGDGCNGGFPAAAWNFWTKKGLVSGGLYNSHVGCRPYSIP  185



>ref|XP_009094371.1| PREDICTED: cathepsin B [Serinus canaria]
Length=340

 Score =   139 bits (349),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 99/166 (60%), Gaps = 15/166 (9%)
 Frame = +3

Query  126  LQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSLLKRTPVATHDKQIE  305
            L D++V  +N+     WKA  N  F +  +S  K+L G       L +R   A     +E
Sbjct  26   LSDDLVNHINK-LNTTWKAGHN--FHNADMSYVKKLCGTFLGGPKLPERVDFAA---DVE  79

Query  306  LPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYGTNVTLSVN--DLL  479
            LP  FD+RT WP C +I++I DQG CGSCWAFGAVE+++DR C+H    V++ V+  DLL
Sbjct  80   LPDNFDSRTQWPNCPTISEIRDQGSCGSCWAFGAVEAISDRICVHTNAKVSVEVSAEDLL  139

Query  480  ACCGFMCGEGCDGGYPIAAWQYFTRTGVVTS-------ECDPYFDP  596
            +CCGF CG GC+GGYP  AW+Y+T  G+V+         C PY  P
Sbjct  140  SCCGFECGMGCNGGYPSGAWRYWTERGLVSGGLYDSHVGCRPYSIP  185



>gb|EDL85315.1| rCG52258, isoform CRA_b [Rattus norvegicus]
Length=210

 Score =   135 bits (340),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 71/166 (43%), Positives = 96/166 (58%), Gaps = 15/166 (9%)
 Frame = +3

Query  126  LQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSLLKRTPVATHDKQIE  305
            L D+++  +N+     W+A  N  F +  +S  K+L G       L +R   +   + I 
Sbjct  26   LSDDMINYINKQ-NTTWQAGRN--FYNVDISYLKKLCGTVLGGPKLPERVGFS---EDIN  79

Query  306  LPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYG--TNVTLSVNDLL  479
            LP++FDAR  W  C +IA I DQG CGSCWAFGAVE+++DR CIH     NV +S  DLL
Sbjct  80   LPESFDAREQWSNCPTIAQIRDQGSCGSCWAFGAVEAMSDRICIHTNGRVNVEVSAEDLL  139

Query  480  ACCGFMCGEGCDGGYPIAAWQYFTRTGVVTS-------ECDPYFDP  596
             CCG  CG+GC+GGYP  AW ++TR G+V+         C PY  P
Sbjct  140  TCCGIQCGDGCNGGYPSGAWNFWTRKGLVSGGVYNSHIGCLPYTIP  185



>ref|XP_005425007.1| PREDICTED: cathepsin B [Geospiza fortis]
Length=340

 Score =   139 bits (349),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 99/166 (60%), Gaps = 15/166 (9%)
 Frame = +3

Query  126  LQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSLLKRTPVATHDKQIE  305
            L D++V  +N+     WKA  N  F +  +S  K+L G       L +R   A     +E
Sbjct  26   LSDDLVNHINKL-NTTWKAGHN--FHNADMSYVKKLCGTFLGGPKLPERVDFAA---DVE  79

Query  306  LPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYGTNVTLSVN--DLL  479
            LP  FD+RT WP C +I++I DQG CGSCWAFGAVE+++DR C+H    V++ V+  DLL
Sbjct  80   LPDNFDSRTQWPNCPTISEIRDQGSCGSCWAFGAVEAISDRICVHTNAKVSVEVSAEDLL  139

Query  480  ACCGFMCGEGCDGGYPIAAWQYFTRTGVVTS-------ECDPYFDP  596
            +CCGF CG GC+GGYP  AW+Y+T  G+V+         C PY  P
Sbjct  140  SCCGFECGMGCNGGYPSGAWRYWTERGLVSGGLYDSHVGCRPYSIP  185



>ref|NP_001080410.1| uncharacterized protein LOC380102 precursor [Xenopus laevis]
 gb|AAH46667.1| Cg10992 protein [Xenopus laevis]
Length=333

 Score =   138 bits (348),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/166 (45%), Positives = 98/166 (59%), Gaps = 15/166 (9%)
 Frame = +3

Query  126  LQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSLLKRTPVATHDKQIE  305
            L  ++V  +N+     WKA  N  F++  V   KRL G       L KR   A     ++
Sbjct  26   LSHDMVNYINK-VNTTWKAGHN--FANADVHYVKRLCGTHLNGPQLQKRFGFA---DDLD  79

Query  306  LPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYG--TNVTLSVNDLL  479
            LP +FD+R AWP C +I +I DQG CGSCWAFGAVE+++DR C+H     NV +S  DLL
Sbjct  80   LPDSFDSRAAWPNCPTIREIRDQGSCGSCWAFGAVEAISDRVCVHTNGKVNVEVSAEDLL  139

Query  480  ACCGFMCGEGCDGGYPIAAWQYFTRTGVVTS-------ECDPYFDP  596
            +CCGF CG GC+GGYP  AW+++T TG+V+         C PY  P
Sbjct  140  SCCGFKCGMGCNGGYPSGAWRFWTETGLVSGGLYDSHVGCRPYSIP  185



>ref|XP_008490612.1| PREDICTED: cathepsin B [Calypte anna]
 gb|KFO99756.1| Cathepsin B [Calypte anna]
Length=340

 Score =   138 bits (348),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 100/166 (60%), Gaps = 15/166 (9%)
 Frame = +3

Query  126  LQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSLLKRTPVATHDKQIE  305
            L +++V  +N+     WKA  N  F +  +S  K+L G       L +R   A     +E
Sbjct  26   LSNDLVNHINK-LNTTWKAGHN--FHNADMSYVKKLCGTFLGGPKLPERVEFAA---DME  79

Query  306  LPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYGTNVTLSVN--DLL  479
            LP +FD+RTAWP C +I +I DQG CGSCWAFGAVE+++DR C+H    V++ V+  DLL
Sbjct  80   LPDSFDSRTAWPNCPTINEIRDQGSCGSCWAFGAVEAISDRICVHSNAQVSVEVSAEDLL  139

Query  480  ACCGFMCGEGCDGGYPIAAWQYFTRTGVVTS-------ECDPYFDP  596
            +CCGF CG GC+GGYP  AW+Y+T  G+V+         C PY  P
Sbjct  140  SCCGFECGMGCNGGYPSGAWRYWTERGLVSGGLYDSHVGCRPYSIP  185



>gb|AAV65883.1| cathepsin B1 isotype 3 precursor [Trichobilharzia regenti]
Length=342

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 73/181 (40%), Positives = 105/181 (58%), Gaps = 14/181 (8%)
 Frame = +3

Query  78   VVAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPK  257
            ++    + ++E+  + L DE++  +N++P+AGW A  + RF     ++   LLGA +  +
Sbjct  14   ILTAHILPENEIQFEPLSDEMIAYINQHPDAGWTASRSDRFKSLEDARI--LLGAMREDE  71

Query  258  SLLK-RTPVATHDK-QIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRF  431
             L K R P   H    +E+P +FD+R  W QC SI++I DQ  CGSCWAF AVE+++DR 
Sbjct  72   ELRKKRRPTVDHQNVSLEIPSSFDSRKKWHQCKSISNIRDQSRCGSCWAFTAVEAMSDRI  131

Query  432  CIHY--GTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSE-------CDP  584
            CI      +V LS  DLL+CC   CG GC GG+P AAW Y+   G+VT         C P
Sbjct  132  CIESKGKKSVELSAVDLLSCC-TECGLGCQGGFPGAAWDYWVEDGIVTGSSKENHTGCQP  190

Query  585  Y  587
            Y
Sbjct  191  Y  191



>gb|AAV65884.1| cathepsin B1 isotype 4 precursor [Trichobilharzia regenti]
Length=342

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 73/181 (40%), Positives = 104/181 (57%), Gaps = 14/181 (8%)
 Frame = +3

Query  78   VVAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPK  257
            ++    + ++E+  + L DE++  +N++P+AGW A  + RF     ++   LLGA    +
Sbjct  14   ILTAHILPENEIQFEPLSDEMIAYINQHPDAGWTASRSDRFKSLEDARI--LLGAMHEDE  71

Query  258  SLLK-RTPVATHDK-QIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRF  431
             L K R P   H    +E+P +FD+R  W QC SI++I DQ  CGSCWAF AVE+++DR 
Sbjct  72   ELRKKRRPTVDHQNVSLEIPSSFDSRKKWHQCKSISNIRDQSRCGSCWAFAAVEAMSDRI  131

Query  432  CIHY--GTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSE-------CDP  584
            CI      +V LS  DLL+CC   CG GC GG+P AAW Y+   G+VT         C P
Sbjct  132  CIESKGKKSVELSAVDLLSCCT-ECGLGCQGGFPGAAWDYWVEDGIVTGSSKENHTGCQP  190

Query  585  Y  587
            Y
Sbjct  191  Y  191



>ref|XP_006993062.1| PREDICTED: cathepsin B [Peromyscus maniculatus bairdii]
Length=339

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 98/166 (59%), Gaps = 15/166 (9%)
 Frame = +3

Query  126  LQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSLLKRTPVATHDKQIE  305
            L D+++  +N+     W+A  N  F +  VS  KRL G       L +R   A   + ++
Sbjct  26   LSDDLINYINKQ-NTTWQAGRN--FYNVDVSYLKRLCGTILGGPKLPERVGFA---EDMD  79

Query  306  LPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIH-YG-TNVTLSVNDLL  479
            LP+TFDAR  WP C +I  I DQG CGSCWAFGA E+++DR CIH +G  NV +S  DLL
Sbjct  80   LPETFDAREQWPNCPTIKQIRDQGSCGSCWAFGAAEAMSDRLCIHTHGHVNVEVSAEDLL  139

Query  480  ACCGFMCGEGCDGGYPIAAWQYFTRTGVVTS-------ECDPYFDP  596
             CCGF CG+GC+GGYP  AW ++ + G+V+         C PY  P
Sbjct  140  TCCGFQCGDGCNGGYPSGAWNFWVKKGLVSGGLYNSHVGCLPYTIP  185



>ref|XP_005146463.1| PREDICTED: LOW QUALITY PROTEIN: cathepsin B [Melopsittacus undulatus]
Length=340

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 99/166 (60%), Gaps = 15/166 (9%)
 Frame = +3

Query  126  LQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSLLKRTPVATHDKQIE  305
            L  ++V  +N+     WKA  N  F +  +S  K+L G       L +R   A     +E
Sbjct  26   LSSDLVNHINK-LNTTWKAGHN--FHNTDMSYVKKLCGTFLGGPKLPERVDFAA---DME  79

Query  306  LPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYGTNVTLSVN--DLL  479
            LP TFD+RT WP C +I++I DQG CGSCWAFGAVE+++DR C+H    V++ V+  DLL
Sbjct  80   LPDTFDSRTQWPNCPTISEIRDQGSCGSCWAFGAVEAISDRICVHTNAKVSVEVSAEDLL  139

Query  480  ACCGFMCGEGCDGGYPIAAWQYFTRTGVVTS-------ECDPYFDP  596
            +CCGF CG GC+GGYP  AW+Y+T  G+V+         C PY  P
Sbjct  140  SCCGFECGMGCNGGYPAGAWRYWTERGLVSGGLYDSHVGCRPYSIP  185



>gb|AAV65881.1| cathepsin B1 isotype 1 precursor [Trichobilharzia regenti]
Length=342

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 73/181 (40%), Positives = 104/181 (57%), Gaps = 14/181 (8%)
 Frame = +3

Query  78   VVAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPK  257
            ++    + ++E+  + L DE++  +N++P+AGW A  + RF     ++   LLGA    +
Sbjct  14   ILTAHILPENEIQFEPLSDEMIAYINQHPDAGWTASRSDRFKSLEDARI--LLGAMHEDE  71

Query  258  SLLK-RTPVATHDK-QIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRF  431
             L K R P   H    +E+P +FD+R  W QC SI++I DQ  CGSCWAF AVE+++DR 
Sbjct  72   ELRKKRRPTVDHQNVSLEIPSSFDSRKKWHQCKSISNIRDQSRCGSCWAFAAVEAMSDRI  131

Query  432  CIHY--GTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSE-------CDP  584
            CI      +V LS  DLL+CC   CG GC GG+P AAW Y+   G+VT         C P
Sbjct  132  CIESKGKKSVELSAVDLLSCC-TECGLGCQGGFPGAAWDYWVEDGIVTGSSKENHTGCQP  190

Query  585  Y  587
            Y
Sbjct  191  Y  191



>gb|AAX36379.1| cathepsin B [synthetic construct]
 gb|AAX41546.1| cathepsin B [synthetic construct]
Length=339

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 74/170 (44%), Positives = 102/170 (60%), Gaps = 23/170 (14%)
 Frame = +3

Query  126  LQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRL----LGAKKAPKSLLKRTPVATHD  293
            + DE+V  VN+     W+A  N  F +  +S  KRL    LG  K P+ ++         
Sbjct  26   VSDELVNYVNKR-NTTWQAGHN--FYNVDMSYLKRLCGTFLGGPKPPQRVM-------FT  75

Query  294  KQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYGTNVTLSVN-  470
            + ++LP +FDAR  WPQC +I +I DQG CGSCWAFGAVE+++DR CIH   +V++ V+ 
Sbjct  76   EDLKLPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSA  135

Query  471  -DLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTS-------ECDPYFDP  596
             DLL CCG  CG+GC+GGYP  AW ++TR G+V+         C PY  P
Sbjct  136  EDLLTCCGSRCGDGCNGGYPAEAWNFWTRKGLVSGGLYESHVGCRPYSIP  185



>gb|KGB41272.1| Cathepsin B-like cysteine proteinase, partial [Schistosoma haematobium]
Length=351

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 72/165 (44%), Positives = 99/165 (60%), Gaps = 14/165 (8%)
 Frame = +3

Query  126  LQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSLLK-RTPVATH-DKQ  299
            L D+I+  +N++P A WKA+ + RF     ++   L+GA++    L K R P   H D  
Sbjct  40   LSDDIISYINQHPNAEWKAEKSNRFHSLDDARI--LMGARREESELRKKRRPTVDHNDLN  97

Query  300  IELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHY--GTNVTLSVND  473
            +E+P +FD+R  WP+C SIA I DQ  CGSCWAFGAVE+++DR CI      +V LS  D
Sbjct  98   VEIPSSFDSRMKWPRCKSIATIRDQSRCGSCWAFGAVEAMSDRTCIQSRGRQSVELSAVD  157

Query  474  LLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSE-------CDPY  587
            L++CC   CG GCDGG+   AW Y+ + G+VT         C PY
Sbjct  158  LMSCCS-DCGFGCDGGFLGHAWDYWVKEGIVTGSSKENHTGCQPY  201



>ref|XP_005528842.1| PREDICTED: cathepsin B [Pseudopodoces humilis]
Length=359

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 99/166 (60%), Gaps = 15/166 (9%)
 Frame = +3

Query  126  LQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSLLKRTPVATHDKQIE  305
            L D++V  +N+     WKA  N  F +  +S  K+L G       L +R   A     +E
Sbjct  45   LSDDLVNHINK-LNTTWKAGHN--FHNADMSYVKKLCGTFLGGPKLPERVDFAA---DME  98

Query  306  LPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYGTNVTLSVN--DLL  479
            LP  FD+RT WP C +I++I DQG CGSCWAFGAVE+++DR C+H    V++ V+  DLL
Sbjct  99   LPDNFDSRTQWPNCPTISEIRDQGSCGSCWAFGAVEAISDRICVHTNAKVSVEVSAEDLL  158

Query  480  ACCGFMCGEGCDGGYPIAAWQYFTRTGVVTS-------ECDPYFDP  596
            +CCGF CG GC+GGYP  AW+Y+T  G+V+         C PY  P
Sbjct  159  SCCGFECGMGCNGGYPSGAWRYWTERGLVSGGLYDSHVGCRPYSIP  204



>emb|CDJ95148.1| Peptidase C1A domain containing protein [Haemonchus contortus]
Length=287

 Score =   136 bits (343),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 69/162 (43%), Positives = 98/162 (60%), Gaps = 12/162 (7%)
 Frame = +3

Query  135  EIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSLLKRTPVATHD--KQIEL  308
            E+V+ +N + ++ +   ++PRF+ +     KRL+G K        R    THD  +   +
Sbjct  37   ELVEYIN-SVQSLFTTKLSPRFAQYPDEVKKRLMGVKHVAIPDEFRVDEKTHDDIEDAAI  95

Query  309  PKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYG--TNVTLSVNDLLA  482
            P +FDART WPQC SI  I DQ  CGSCWAFGA E++TDR CI        T+S +D+L+
Sbjct  96   PDSFDARTQWPQCPSIRSIRDQSSCGSCWAFGAAEAMTDRICIASNGKEQFTISADDILS  155

Query  483  CCGFMCGEGCDGGYPIAAWQYFTRTGVVT-------SECDPY  587
            CCG +CG GC+GGYP+ AW+++ + GVVT       + C PY
Sbjct  156  CCGIVCGNGCEGGYPLQAWKFWVKHGVVTGGNYTSKAGCKPY  197



>gb|AAV65882.1| cathepsin B1 isotype 2 precursor [Trichobilharzia regenti]
Length=342

 Score =   137 bits (346),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 73/181 (40%), Positives = 104/181 (57%), Gaps = 14/181 (8%)
 Frame = +3

Query  78   VVAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPK  257
            ++    + ++E+  + L DE++  +N++P+AGW A  + RF     ++   LLGA    +
Sbjct  14   ILTAHILPENEIQFEPLSDEMIAYINQHPDAGWTASRSDRFKSLEDARI--LLGAMHEDE  71

Query  258  SLLK-RTPVATHDK-QIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRF  431
             L K R P   H    +E+P +FD+R  W QC SI++I DQ  CGSCWAF AVE+++DR 
Sbjct  72   ELRKKRRPTVDHQNVSLEIPSSFDSRKKWRQCKSISNIRDQSRCGSCWAFAAVEAMSDRI  131

Query  432  CIHY--GTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTSE-------CDP  584
            CI      +V LS  DLL+CC   CG GC GG+P AAW Y+   G+VT         C P
Sbjct  132  CIESKGKKSVELSAVDLLSCC-TECGLGCQGGFPGAAWDYWVEDGIVTGSSKENHTGCQP  190

Query  585  Y  587
            Y
Sbjct  191  Y  191



>ref|XP_005355595.1| PREDICTED: cathepsin B [Microtus ochrogaster]
Length=340

 Score =   137 bits (346),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 71/166 (43%), Positives = 97/166 (58%), Gaps = 15/166 (9%)
 Frame = +3

Query  126  LQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSLLKRTPVATHDKQIE  305
            L D+++  +N+     W+A  N  F +  +S  K+L G       L +R   A   + ++
Sbjct  26   LSDDLINYINKR-NTTWQAGRN--FYNVDISYLKKLCGTILGGPKLPERVGFA---EDMD  79

Query  306  LPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYG--TNVTLSVNDLL  479
            LP+ FDAR  WP C +I  I DQG CGSCWAFGAVE+++DR CIH     NV +S  DLL
Sbjct  80   LPENFDAREQWPNCPTIKQIRDQGSCGSCWAFGAVEAMSDRICIHTNGHVNVEVSAQDLL  139

Query  480  ACCGFMCGEGCDGGYPIAAWQYFTRTGVVTS-------ECDPYFDP  596
             CCGF CG+GC+GGYP  AW ++T+ G+V+         C PY  P
Sbjct  140  TCCGFQCGDGCNGGYPSGAWNFWTKKGLVSGGLYNSHVGCLPYTIP  185



>ref|XP_008943972.1| PREDICTED: cathepsin B [Merops nubicus]
 gb|KFQ22810.1| Cathepsin B [Merops nubicus]
Length=340

 Score =   137 bits (346),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 72/166 (43%), Positives = 100/166 (60%), Gaps = 15/166 (9%)
 Frame = +3

Query  126  LQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSLLKRTPVATHDKQIE  305
            L +++V  +N+     WKA  N  F +  +S  K+L G       L +R   A     +E
Sbjct  26   LSNDLVNHINKL-NTTWKAGHN--FHNVDMSYVKKLCGTFLGGPKLPERVDFAA---DME  79

Query  306  LPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYGTNVTLSVN--DLL  479
            LP +FD+RT WP C +I++I DQG CGSCWAFGAVE+++DR C+H    V++ V+  DLL
Sbjct  80   LPDSFDSRTQWPNCPTISEIRDQGSCGSCWAFGAVEAISDRICVHTNAKVSVEVSAEDLL  139

Query  480  ACCGFMCGEGCDGGYPIAAWQYFTRTGVVTS-------ECDPYFDP  596
            +CCGF CG GC+GGYP  AW+Y+T  G+V+         C PY  P
Sbjct  140  SCCGFECGMGCNGGYPSGAWRYWTERGLVSGGLYDSHVGCRPYSIP  185



>ref|XP_010021694.1| PREDICTED: cathepsin B [Nestor notabilis]
 gb|KFQ43994.1| Cathepsin B [Nestor notabilis]
Length=340

 Score =   137 bits (346),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 99/166 (60%), Gaps = 15/166 (9%)
 Frame = +3

Query  126  LQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSLLKRTPVATHDKQIE  305
            L  ++V  +N+     WKA  N  F +  +S  K+L G       L +R   A     +E
Sbjct  26   LSSDLVNHINK-LNTTWKAGHN--FHNTDMSYVKKLCGTFLGGPKLPERVDFAA---DME  79

Query  306  LPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYGTNVTLSVN--DLL  479
            LP TFD+RT WP C +I++I DQG CGSCWAFGAVE+++DR C+H    V++ V+  DLL
Sbjct  80   LPDTFDSRTQWPNCPTISEIRDQGSCGSCWAFGAVEAISDRICVHTNAKVSVEVSAEDLL  139

Query  480  ACCGFMCGEGCDGGYPIAAWQYFTRTGVVTS-------ECDPYFDP  596
            +CCGF CG GC+GGYP  AW+Y+T  G+V+         C PY  P
Sbjct  140  SCCGFECGMGCNGGYPSGAWRYWTERGLVSGGLYDSHVGCRPYSIP  185



>gb|KFV51489.1| Cathepsin B, partial [Gavia stellata]
Length=266

 Score =   135 bits (341),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 98/166 (59%), Gaps = 15/166 (9%)
 Frame = +3

Query  126  LQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSLLKRTPVATHDKQIE  305
            L  ++V  +N+     WKA  N R +D  +S  K+L G       L +R   A     +E
Sbjct  26   LSSDLVNHINKL-NTTWKAGHNFRNTD--MSYVKKLCGTFLGGPKLPERVDFAA---DME  79

Query  306  LPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYGTNVTLSVN--DLL  479
            LP  FD+RT WP C +I +I DQG CGSCWAFGAVE+++DR C+H    V++ V+  DLL
Sbjct  80   LPDNFDSRTQWPNCPTINEIRDQGSCGSCWAFGAVEAISDRICVHTNAKVSVEVSAEDLL  139

Query  480  ACCGFMCGEGCDGGYPIAAWQYFTRTGVVTS-------ECDPYFDP  596
            +CCGF CG GC+GGYP  AW+Y+T  G+V+         C PY  P
Sbjct  140  SCCGFECGMGCNGGYPSGAWRYWTERGLVSGGLYDSHVGCRPYSIP  185



>ref|XP_009078810.1| PREDICTED: cathepsin B [Acanthisitta chloris]
Length=347

 Score =   137 bits (346),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 72/166 (43%), Positives = 99/166 (60%), Gaps = 15/166 (9%)
 Frame = +3

Query  126  LQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSLLKRTPVATHDKQIE  305
            L +++V  +N+     WKA  N  F +  +S  K+L G       L +R   A     +E
Sbjct  33   LSNDLVNHINK-LNTTWKAGHN--FHNADMSYVKKLCGTYLGGPKLPERVDFAA---DME  86

Query  306  LPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYGTNVTLSVN--DLL  479
            LP  FD+RT WP C +I++I DQG CGSCWAFGAVE+++DR C+H    V++ V+  DLL
Sbjct  87   LPDNFDSRTQWPNCPTISEIRDQGSCGSCWAFGAVEAISDRICVHTNAKVSVEVSAEDLL  146

Query  480  ACCGFMCGEGCDGGYPIAAWQYFTRTGVVTS-------ECDPYFDP  596
            +CCGF CG GC+GGYP  AW+Y+T  G+V+         C PY  P
Sbjct  147  SCCGFECGMGCNGGYPSGAWRYWTERGLVSGGLYDSHVGCRPYSIP  192



>ref|NP_989225.1| cathepsin B precursor [Xenopus (Silurana) tropicalis]
 gb|AAH63365.1| hypothetical protein MGC75969 [Xenopus (Silurana) tropicalis]
Length=333

 Score =   137 bits (345),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 98/166 (59%), Gaps = 15/166 (9%)
 Frame = +3

Query  126  LQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSLLKRTPVATHDKQIE  305
            L  ++V  +N+     WKA  N  F++  +   KRL G       L KR   A     +E
Sbjct  26   LSGDMVNYINKM-NTTWKAGHN--FANADLHYVKRLCGTHLNGPQLQKRFGFA---DGME  79

Query  306  LPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYG--TNVTLSVNDLL  479
            LP +FD+R AWP C +I ++ DQG CGSCWAFGAVE+++DR C+H     NV +S  DLL
Sbjct  80   LPDSFDSRAAWPNCPTIREVRDQGSCGSCWAFGAVEAISDRVCVHTNGKVNVEVSAEDLL  139

Query  480  ACCGFMCGEGCDGGYPIAAWQYFTRTGVVTS-------ECDPYFDP  596
            +CCGF CG GC+GGYP  AW+++T TG+V+         C PY  P
Sbjct  140  SCCGFECGMGCNGGYPSGAWKFWTETGLVSGGLYDSHLGCRPYSIP  185



>gb|KFW64114.1| Cathepsin B, partial [Pygoscelis adeliae]
Length=309

 Score =   137 bits (344),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 99/166 (60%), Gaps = 15/166 (9%)
 Frame = +3

Query  126  LQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSLLKRTPVATHDKQIE  305
            L  ++V  +N+     WKA  N R +D  +S  K+L G       L +R   A     +E
Sbjct  26   LSSDLVNHINK-LNTTWKAGHNFRNTD--MSYVKKLCGTFLGGPKLPERVDFAA---DME  79

Query  306  LPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYGTNVTLSVN--DLL  479
            LP  FD+RT WP C +I++I DQG CGSCWAFGAVE+++DR C+H    V++ V+  DLL
Sbjct  80   LPDNFDSRTQWPNCPTISEIRDQGSCGSCWAFGAVEAISDRICVHTNAKVSVEVSAEDLL  139

Query  480  ACCGFMCGEGCDGGYPIAAWQYFTRTGVVTS-------ECDPYFDP  596
            +CCGF CG GC+GGYP  AW+Y+T  G+V+         C PY  P
Sbjct  140  SCCGFECGMGCNGGYPSGAWRYWTERGLVSGGLYDSHVGCRPYSIP  185



>ref|XP_009318029.1| PREDICTED: cathepsin B [Pygoscelis adeliae]
Length=338

 Score =   137 bits (345),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 99/166 (60%), Gaps = 15/166 (9%)
 Frame = +3

Query  126  LQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSLLKRTPVATHDKQIE  305
            L  ++V  +N+     WKA  N R +D  +S  K+L G       L +R   A     +E
Sbjct  33   LSSDLVNHINK-LNTTWKAGHNFRNTD--MSYVKKLCGTFLGGPKLPERVDFAA---DME  86

Query  306  LPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYGTNVTLSVN--DLL  479
            LP  FD+RT WP C +I++I DQG CGSCWAFGAVE+++DR C+H    V++ V+  DLL
Sbjct  87   LPDNFDSRTQWPNCPTISEIRDQGSCGSCWAFGAVEAISDRICVHTNAKVSVEVSAEDLL  146

Query  480  ACCGFMCGEGCDGGYPIAAWQYFTRTGVVTS-------ECDPYFDP  596
            +CCGF CG GC+GGYP  AW+Y+T  G+V+         C PY  P
Sbjct  147  SCCGFECGMGCNGGYPSGAWRYWTERGLVSGGLYDSHVGCRPYSIP  192



>ref|XP_009807350.1| PREDICTED: cathepsin B [Gavia stellata]
Length=270

 Score =   135 bits (341),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 98/166 (59%), Gaps = 15/166 (9%)
 Frame = +3

Query  126  LQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSLLKRTPVATHDKQIE  305
            L  ++V  +N+     WKA  N R +D  +S  K+L G       L +R   A     +E
Sbjct  26   LSSDLVNHINKL-NTTWKAGHNFRNTD--MSYVKKLCGTFLGGPKLPERVDFAA---DME  79

Query  306  LPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYGTNVTLSVN--DLL  479
            LP  FD+RT WP C +I +I DQG CGSCWAFGAVE+++DR C+H    V++ V+  DLL
Sbjct  80   LPDNFDSRTQWPNCPTINEIRDQGSCGSCWAFGAVEAISDRICVHTNAKVSVEVSAEDLL  139

Query  480  ACCGFMCGEGCDGGYPIAAWQYFTRTGVVTS-------ECDPYFDP  596
            +CCGF CG GC+GGYP  AW+Y+T  G+V+         C PY  P
Sbjct  140  SCCGFECGMGCNGGYPSGAWRYWTERGLVSGGLYDSHVGCRPYSIP  185



>gb|KFP55740.1| Cathepsin B, partial [Cariama cristata]
Length=178

 Score =   133 bits (335),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 68/150 (45%), Positives = 94/150 (63%), Gaps = 8/150 (5%)
 Frame = +3

Query  126  LQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSLLKRTPVATHDKQIE  305
            L  ++V  +N+     WKA  N   +D  +S  K+L G       L +R   A     +E
Sbjct  26   LSTDLVNHINK-LNTTWKAGHNFYHAD--MSYVKKLCGTFLGGPRLPERVDFAA---DME  79

Query  306  LPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYGTNVTLSVN--DLL  479
            LP  FD+RT WP C +I++I DQG CGSCWAFGAVE+++DR C+H    V++ V+  DLL
Sbjct  80   LPDNFDSRTQWPNCPTISEIRDQGSCGSCWAFGAVEAISDRICVHTNAKVSVEVSAEDLL  139

Query  480  ACCGFMCGEGCDGGYPIAAWQYFTRTGVVT  569
            +CCGF CG GC+GGYP  AW+Y+T  G+V+
Sbjct  140  SCCGFECGMGCNGGYPSGAWRYWTERGLVS  169



>gb|KFP86330.1| Cathepsin B [Acanthisitta chloris]
Length=340

 Score =   137 bits (345),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 72/166 (43%), Positives = 99/166 (60%), Gaps = 15/166 (9%)
 Frame = +3

Query  126  LQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSLLKRTPVATHDKQIE  305
            L +++V  +N+     WKA  N  F +  +S  K+L G       L +R   A     +E
Sbjct  26   LSNDLVNHINK-LNTTWKAGHN--FHNADMSYVKKLCGTYLGGPKLPERVDFAA---DME  79

Query  306  LPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYGTNVTLSVN--DLL  479
            LP  FD+RT WP C +I++I DQG CGSCWAFGAVE+++DR C+H    V++ V+  DLL
Sbjct  80   LPDNFDSRTQWPNCPTISEIRDQGSCGSCWAFGAVEAISDRICVHTNAKVSVEVSAEDLL  139

Query  480  ACCGFMCGEGCDGGYPIAAWQYFTRTGVVTS-------ECDPYFDP  596
            +CCGF CG GC+GGYP  AW+Y+T  G+V+         C PY  P
Sbjct  140  SCCGFECGMGCNGGYPSGAWRYWTERGLVSGGLYDSHVGCRPYSIP  185



>ref|XP_005859690.1| PREDICTED: cathepsin B [Myotis brandtii]
Length=340

 Score =   137 bits (345),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 76/182 (42%), Positives = 105/182 (58%), Gaps = 17/182 (9%)
 Frame = +3

Query  78   VVAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPK  257
            VV     ++  + P  L DE+V  +N+   + WKA  N  F +  +S  + L G K    
Sbjct  12   VVLTSARSRPSLQP--LSDELVHYINKR-NSTWKAGHN--FRNVDMSYVRTLCGTKLGGP  66

Query  258  SLLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCI  437
             L ++  +A   + I LP+ FDAR  WP C +I +I DQG CGSCWAFGAVE+++DR CI
Sbjct  67   KLPEKVWLA---EDITLPENFDARENWPNCPTIKEIRDQGSCGSCWAFGAVEAISDRICI  123

Query  438  --HYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTS-------ECDPYF  590
              +   NV +S  DLL CCGF CGEGC+GG+P  AW ++T+ G+V+         C PY 
Sbjct  124  LTNGHVNVEVSAEDLLTCCGFQCGEGCNGGFPSGAWNFWTKKGLVSGGLYDSHVGCRPYS  183

Query  591  DP  596
             P
Sbjct  184  IP  185



>ref|XP_009706626.1| PREDICTED: cathepsin B-like, partial [Cariama cristata]
Length=182

 Score =   133 bits (335),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 68/150 (45%), Positives = 94/150 (63%), Gaps = 8/150 (5%)
 Frame = +3

Query  126  LQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSLLKRTPVATHDKQIE  305
            L  ++V  +N+     WKA  N   +D  +S  K+L G       L +R   A     +E
Sbjct  26   LSTDLVNHINK-LNTTWKAGHNFYHAD--MSYVKKLCGTFLGGPRLPERVDFAA---DME  79

Query  306  LPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYGTNVTLSVN--DLL  479
            LP  FD+RT WP C +I++I DQG CGSCWAFGAVE+++DR C+H    V++ V+  DLL
Sbjct  80   LPDNFDSRTQWPNCPTISEIRDQGSCGSCWAFGAVEAISDRICVHTNAKVSVEVSAEDLL  139

Query  480  ACCGFMCGEGCDGGYPIAAWQYFTRTGVVT  569
            +CCGF CG GC+GGYP  AW+Y+T  G+V+
Sbjct  140  SCCGFECGMGCNGGYPSGAWRYWTERGLVS  169



>ref|XP_010305166.1| PREDICTED: cathepsin B [Balearica regulorum gibbericeps]
 gb|KFO13054.1| Cathepsin B [Balearica regulorum gibbericeps]
Length=340

 Score =   137 bits (345),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 98/166 (59%), Gaps = 15/166 (9%)
 Frame = +3

Query  126  LQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSLLKRTPVATHDKQIE  305
            L +E+V  +N+     WKA  N  F +  +S  K+L G       L +R   A     +E
Sbjct  26   LSNELVNHINK-LNTTWKAGHN--FHNTDMSYVKKLCGTFLGGPKLPERVDFAA---DME  79

Query  306  LPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYGTNVTLSVN--DLL  479
            LP  FD+RT WP C +I +I DQG CGSCWAFGAVE+++DR C+H    V++ V+  DLL
Sbjct  80   LPDNFDSRTQWPNCPTINEIRDQGSCGSCWAFGAVEAISDRICVHTNAKVSVEVSAEDLL  139

Query  480  ACCGFMCGEGCDGGYPIAAWQYFTRTGVVTS-------ECDPYFDP  596
            +CCGF CG GC+GGYP  AW+Y+T  G+V+         C PY  P
Sbjct  140  SCCGFECGMGCNGGYPSGAWRYWTERGLVSGGLYDSHVGCRPYSIP  185



>gb|KHJ75862.1| papain family cysteine protease [Oesophagostomum dentatum]
Length=349

 Score =   137 bits (345),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 68/148 (46%), Positives = 88/148 (59%), Gaps = 11/148 (7%)
 Frame = +3

Query  186  MNPRFSDFTVSQFKRLLGAKKAPKSLLKRTPVATHD--KQIELPKTFDARTAWPQCVSIA  359
            ++PRF+ +  +   RL+G+K        R    THD      +P +FDART WPQC SI 
Sbjct  53   LSPRFAQYPDAIKSRLMGSKHVAVPAEFRANEKTHDDISDATIPDSFDARTNWPQCPSIL  112

Query  360  DILDQGHCGSCWAFGAVESLTDRFCIHYG--TNVTLSVNDLLACCGFMCGEGCDGGYPIA  533
             I DQ  CGSCWAFGA E++TDR CI        T+S +D+L+CCG +CG GC+GGYPI 
Sbjct  113  SIRDQSSCGSCWAFGAAEAMTDRICIASNGKEQFTMSADDILSCCGMICGNGCEGGYPIQ  172

Query  534  AWQYFTRTGVVTSE-------CDPYFDP  596
            AW+Y+ + GVVT         C PY  P
Sbjct  173  AWKYWVKHGVVTGSNYTMKAGCKPYPYP  200



>ref|XP_004382268.1| PREDICTED: cathepsin B [Trichechus manatus latirostris]
Length=340

 Score =   137 bits (345),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 75/175 (43%), Positives = 101/175 (58%), Gaps = 15/175 (9%)
 Frame = +3

Query  99   TQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSLLKRTP  278
             QS +    L DE+V  VN++    W+A  N  F +  +S  KRL G       L +R  
Sbjct  17   AQSRLYFNPLSDELVNHVNKH-NTTWQAGHN--FYNVDMSYVKRLCGTLLNGPKLPQRVH  73

Query  279  VATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYGTNVT  458
             A   K+++LP+ FDAR  WP C +I +I DQG CGSCWAFGAVE+++DR CIH   NV 
Sbjct  74   FA---KEMDLPENFDARENWPNCPTIKEIRDQGSCGSCWAFGAVEAISDRVCIHTSENVN  130

Query  459  LSVN--DLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTS-------ECDPYFDP  596
            + V+  DLL CC   CG+GC+GG+P  AW ++T  G+V+         C PY  P
Sbjct  131  VEVSAEDLLTCCHMECGDGCNGGFPAGAWNFWTEKGLVSGGLYDSHVGCRPYSIP  185



>gb|EMS65947.1| Cathepsin B [Triticum urartu]
Length=306

 Score =   136 bits (343),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 72/170 (42%), Positives = 99/170 (58%), Gaps = 20/170 (12%)
 Frame = +3

Query  102  QSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSLLKRTPV  281
            ++E    I+Q +I++TVN++P AGW A  NP F+++T+ QFK +LG K  P  LL   P+
Sbjct  30   KAEHSLGIIQKDIIQTVNKHPNAGWTAGHNPYFANYTIEQFKHILGVKPTPPGLLAGVPI  89

Query  282  ATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYGTNVTL  461
              H  +++LPK FDART W  C +I +ILD        A G +  L +      G    +
Sbjct  90   KIH-PEMDLPKEFDARTQWSSCSTIGNILD--------AQGIMYVLVNN-----GRVTVV  135

Query  462  SVNDLLA------CCGFMCGEGCDGGYPIAAWQYFTRTGVVTSECDPYFD  593
             V  LL          F+   GC+GGYPI+AW+YF R+GVVT ECDPYFD
Sbjct  136  PVGPLLPWKLSRIVSVFISTCGCNGGYPISAWRYFRRSGVVTEECDPYFD  185



>emb|CAX70257.1| Cathepsin B-like cysteine proteinase precursor [Schistosoma japonicum]
Length=342

 Score =   137 bits (344),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 73/165 (44%), Positives = 99/165 (60%), Gaps = 14/165 (8%)
 Frame = +3

Query  126  LQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKA-PKSLLKRTP-VATHDKQ  299
            L DE++  +N++P AGWKAD + RF   +V   + LLG ++  P    KR P V  HD +
Sbjct  30   LSDEMISFINKHPNAGWKADKSDRF--HSVDDARILLGGRREDPNLREKRRPTVDHHDLK  87

Query  300  IELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYG--TNVTLSVND  473
            +E+P  FD+R  WP+C SI+ I DQ  CGS WA  AV +++DR CI  G   +V LS  D
Sbjct  88   VEIPSHFDSRKKWPRCKSISQIRDQSRCGSSWAVSAVGAISDRICIQSGGKQSVELSAID  147

Query  474  LLACCGFMCGEGCDGGYPIAAWQYFTRTGVVT-------SECDPY  587
            L++CC   CG GCDGG+P  AW Y+   G+VT       + C PY
Sbjct  148  LISCCE-NCGSGCDGGFPGPAWDYWVSHGIVTGGSKENHTGCQPY  191



>gb|KFQ68035.1| Cathepsin B, partial [Phaethon lepturus]
Length=270

 Score =   135 bits (340),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 72/166 (43%), Positives = 97/166 (58%), Gaps = 15/166 (9%)
 Frame = +3

Query  126  LQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSLLKRTPVATHDKQIE  305
            L  ++V  +N+     WKA  N  F +  +S  K+L G       L +R   A     +E
Sbjct  26   LSSDLVNHINKL-NTTWKAGHN--FHNTDMSYVKKLCGTFLGGPKLPERVDFAA---DME  79

Query  306  LPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYGTNVTLSVN--DLL  479
            LP  FD+RT WP C +I +I DQG CGSCWAFGAVE+++DR C+H    V++ V+  DLL
Sbjct  80   LPDNFDSRTQWPNCPTINEIRDQGSCGSCWAFGAVEAISDRICVHTNAKVSVEVSAEDLL  139

Query  480  ACCGFMCGEGCDGGYPIAAWQYFTRTGVVTS-------ECDPYFDP  596
            +CCGF CG GC+GGYP  AW+Y+T  G+V+         C PY  P
Sbjct  140  SCCGFECGMGCNGGYPSGAWRYWTERGLVSGGLYDSHVGCRPYSIP  185



>ref|XP_010146010.1| PREDICTED: cathepsin B [Eurypyga helias]
 gb|KFW01544.1| Cathepsin B [Eurypyga helias]
Length=340

 Score =   137 bits (344),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 72/166 (43%), Positives = 99/166 (60%), Gaps = 15/166 (9%)
 Frame = +3

Query  126  LQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKSLLKRTPVATHDKQIE  305
            L ++++  +N+     WKA  N  F +  +S  K+L G       L +R   A     +E
Sbjct  26   LSNDLINHINK-LNTTWKAGHN--FHNTDMSYVKKLCGTFLGGPKLPERVDFAA---DME  79

Query  306  LPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYGTNVTLSVN--DLL  479
            LP  FD+RT WP C +I +I DQG CGSCWAFGAVE+++DR C+H  T V++ V+  DLL
Sbjct  80   LPDNFDSRTQWPNCPTINEIRDQGSCGSCWAFGAVEAISDRICVHTNTKVSVEVSAEDLL  139

Query  480  ACCGFMCGEGCDGGYPIAAWQYFTRTGVVTS-------ECDPYFDP  596
            +CCGF CG GC+GGYP  AW+Y+T  G+V+         C PY  P
Sbjct  140  SCCGFECGMGCNGGYPSGAWRYWTERGLVSGGLYDSHVGCRPYSIP  185



>ref|XP_008148990.1| PREDICTED: cathepsin B [Eptesicus fuscus]
Length=340

 Score =   137 bits (344),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 75/181 (41%), Positives = 105/181 (58%), Gaps = 15/181 (8%)
 Frame = +3

Query  81   VAVKPVTQSEVDPKILQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKAPKS  260
            + V    +S +  + L DE+V  +N+   + WKA  N  F +  +S  + L G K     
Sbjct  11   LVVLTSARSRLGLQPLSDELVHYLNKR-NSTWKAGHN--FRNVDMSYVRTLCGTKLGGPK  67

Query  261  LLKRTPVATHDKQIELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCI-  437
            L ++  +A   + I LP+ FDAR  WP C +I +I DQG CGSCWAFGAVE+++DR CI 
Sbjct  68   LPEKVWLA---EDIILPENFDAREQWPNCPTIKEIRDQGSCGSCWAFGAVEAISDRICIL  124

Query  438  -HYGTNVTLSVNDLLACCGFMCGEGCDGGYPIAAWQYFTRTGVVTS-------ECDPYFD  593
             +   NV +S  DLL CCGF CGEGC+GG+P  AW ++T+ G+V+         C PY  
Sbjct  125  TNGHVNVEVSAEDLLTCCGFQCGEGCNGGFPSGAWNFWTKKGLVSGGLYDSHVGCRPYSI  184

Query  594  P  596
            P
Sbjct  185  P  185



>emb|CAX71578.1| Cathepsin B-like cysteine proteinase precursor [Schistosoma japonicum]
Length=342

 Score =   137 bits (344),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 73/165 (44%), Positives = 98/165 (59%), Gaps = 14/165 (8%)
 Frame = +3

Query  126  LQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKA-PKSLLKRTP-VATHDKQ  299
            L DE++  +NE+P AGWKAD + RF     ++F  LLG +K  P    KR P V  HD  
Sbjct  30   LSDEMISFINEHPNAGWKADKSDRFHSVDDARF--LLGGRKEDPNLREKRRPTVDHHDLN  87

Query  300  IELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYG--TNVTLSVND  473
            +E+P  FD+R  WP+C SI+ I DQ  CGS WA  AV +++DR CI  G   +V LS  D
Sbjct  88   VEIPSHFDSRKKWPRCKSISQIRDQSQCGSSWAVSAVGAMSDRICIQSGGKQSVELSAVD  147

Query  474  LLACCGFMCGEGCDGGYPIAAWQYFTRTGVVT-------SECDPY  587
            L++CC + CG GCDGG+   +W Y+   G+VT       + C PY
Sbjct  148  LISCCKY-CGSGCDGGFLGPSWDYWVLRGIVTGGSKENHTGCRPY  191



>emb|CAX71574.1| Cathepsin B-like cysteine proteinase precursor [Schistosoma japonicum]
Length=342

 Score =   137 bits (344),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 73/165 (44%), Positives = 98/165 (59%), Gaps = 14/165 (8%)
 Frame = +3

Query  126  LQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKA-PKSLLKRTP-VATHDKQ  299
            L DE++  +NE+P AGWKAD + RF     ++F  LLG +K  P    KR P V  HD  
Sbjct  30   LSDEMISFINEHPNAGWKADKSDRFHSVDDARF--LLGGRKEDPNLREKRRPTVDHHDLN  87

Query  300  IELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYG--TNVTLSVND  473
            +E+P  FD+R  WP+C SI+ I DQ  CGS WA  AV +++DR CI  G   +V LS  D
Sbjct  88   VEIPSHFDSRKKWPRCKSISQIRDQSQCGSSWAVSAVGAMSDRICIQSGGKQSVELSAVD  147

Query  474  LLACCGFMCGEGCDGGYPIAAWQYFTRTGVVT-------SECDPY  587
            L++CC + CG GCDGG+   +W Y+   G+VT       + C PY
Sbjct  148  LISCCKY-CGSGCDGGFLGPSWDYWVLRGIVTGGSKENHTGCRPY  191



>emb|CAX71570.1| Cathepsin B-like cysteine proteinase precursor [Schistosoma japonicum]
Length=342

 Score =   137 bits (344),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 73/165 (44%), Positives = 98/165 (59%), Gaps = 14/165 (8%)
 Frame = +3

Query  126  LQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKA-PKSLLKRTP-VATHDKQ  299
            L DE++  +NE+P AGWKAD + RF     ++F  LLG +K  P    KR P V  HD  
Sbjct  30   LSDEMISFINEHPNAGWKADKSDRFHSVDDARF--LLGGRKEDPNLREKRRPTVDHHDLN  87

Query  300  IELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYG--TNVTLSVND  473
            +E+P  FD+R  WP+C SI+ I DQ  CGS WA  AV +++DR CI  G   +V LS  D
Sbjct  88   VEIPSHFDSRKKWPRCKSISQIRDQSQCGSSWAVSAVGAMSDRICIQSGGKQSVELSAVD  147

Query  474  LLACCGFMCGEGCDGGYPIAAWQYFTRTGVVT-------SECDPY  587
            L++CC + CG GCDGG+   +W Y+   G+VT       + C PY
Sbjct  148  LISCCKY-CGSGCDGGFLGPSWDYWVLRGIVTGGSKENHTGCRPY  191



>gb|AAW27375.1| unknown [Schistosoma japonicum]
Length=217

 Score =   134 bits (336),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 71/165 (43%), Positives = 98/165 (59%), Gaps = 14/165 (8%)
 Frame = +3

Query  126  LQDEIVKTVNENPEAGWKADMNPRFSDFTVSQFKRLLGAKKA-PKSLLKRTP-VATHDKQ  299
            L DE++  +N++P AGWKAD + RF   +V   + LLG ++  P    KR P V  HD  
Sbjct  30   LSDEMISFINKHPNAGWKADKSDRF--HSVDDARILLGGRREDPNLREKRRPTVDHHDLN  87

Query  300  IELPKTFDARTAWPQCVSIADILDQGHCGSCWAFGAVESLTDRFCIHYG--TNVTLSVND  473
            +E+P  FD+R  WP+C SI+ I DQ  CGS WA  AV +++DR CI  G   +V LS  D
Sbjct  88   VEIPSHFDSRKKWPRCKSISQIRDQSQCGSSWAVSAVGAMSDRICIQSGGKQSVELSAVD  147

Query  474  LLACCGFMCGEGCDGGYPIAAWQYFTRTGVVT-------SECDPY  587
            L++CC + CG GCDGG+   +W Y+   G+VT       + C PY
Sbjct  148  LISCCKY-CGSGCDGGFLGPSWDYWVLRGIVTGGSKENHTGCRPY  191



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 788578232940