BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002A03

Length=551
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_002276380.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  68.9    1e-15   Vitis vinifera
gb|ABK35086.1|  EIL2                                                  64.3    2e-15   Prunus persica
gb|KDO53815.1|  hypothetical protein CISIN_1g007174mg                 73.6    1e-14   Citrus sinensis [apfelsine]
ref|XP_006432540.1|  hypothetical protein CICLE_v10000617mg           73.6    1e-14   Citrus clementina [clementine]
ref|XP_008231879.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  64.3    1e-14   Prunus mume [ume]
ref|XP_004140927.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-li...  67.4    7e-14   Cucumis sativus [cucumbers]
gb|KGN46075.1|  hypothetical protein Csa_6G051520                     67.8    7e-14   Cucumis sativus [cucumbers]
ref|XP_002315400.1|  EIN3-like family protein                         63.5    8e-14   
ref|XP_004172838.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like   67.4    8e-14   
ref|XP_010247605.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like   70.5    1e-13   Nelumbo nucifera [Indian lotus]
gb|KDO53820.1|  hypothetical protein CISIN_1g007174mg                 73.2    1e-13   Citrus sinensis [apfelsine]
ref|XP_009355060.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  62.0    1e-13   Pyrus x bretschneideri [bai li]
ref|XP_008456656.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  67.4    2e-13   Cucumis melo [Oriental melon]
ref|NP_001284429.1|  ETHYLENE INSENSITIVE 3-like 1 protein            67.4    2e-13   Cucumis melo [Oriental melon]
ref|XP_004306440.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  63.9    3e-13   Fragaria vesca subsp. vesca
ref|XP_010243659.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like   68.9    4e-13   Nelumbo nucifera [Indian lotus]
ref|XP_006347695.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like   63.9    4e-13   Solanum tuberosum [potatoes]
ref|NP_001234546.1|  EIL3 protein                                     65.1    5e-13   Solanum lycopersicum
ref|XP_002310961.1|  hypothetical protein POPTR_0008s01200g           61.6    1e-12   
ref|XP_008346133.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  60.1    1e-12   
ref|XP_008357657.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  64.3    1e-12   
gb|AGI41325.1|  EIN3-like protein                                     64.3    2e-12   Malus domestica [apple tree]
gb|ADE41155.1|  ethylene insensitive 3 class transcription factor     64.3    2e-12   Malus domestica [apple tree]
ref|XP_009355361.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  62.0    2e-12   Pyrus x bretschneideri [bai li]
dbj|BAI44821.1|  ethylene insensitive 3-like                          68.2    3e-12   Daucus carota [carrots]
ref|XP_008379003.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like   64.3    3e-12   
ref|XP_009339245.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  60.5    4e-12   
ref|XP_011012998.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  62.4    4e-12   Populus euphratica
ref|XP_011046481.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  62.4    5e-12   Populus euphratica
gb|ADE41154.1|  ethylene insensitive 3 class transcription factor     60.1    5e-12   Malus domestica [apple tree]
gb|AGI41324.1|  EIN3-like protein                                     60.1    5e-12   Malus domestica [apple tree]
ref|XP_008364747.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  60.1    5e-12   
ref|XP_011032978.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  62.0    8e-12   Populus euphratica
gb|AIS20827.1|  EIL                                                   60.1    8e-12   Pyrus x bretschneideri [bai li]
ref|XP_009759370.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  64.3    2e-11   Nicotiana sylvestris
gb|AAP04001.1|  EIL5                                                  64.3    2e-11   Nicotiana tabacum [American tobacco]
gb|KDP42896.1|  hypothetical protein JCGZ_23838                       67.4    2e-11   Jatropha curcas
ref|XP_010106127.1|  Protein ETHYLENE INSENSITIVE 3                   67.4    2e-11   Morus notabilis
ref|XP_009595535.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  64.3    2e-11   Nicotiana tomentosiformis
gb|ADZ97022.2|  EIL6                                                  64.3    2e-11   Nicotiana tabacum [American tobacco]
ref|XP_008231880.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  64.7    2e-11   Prunus mume [ume]
gb|EYU26910.1|  hypothetical protein MIMGU_mgv1a026901mg              62.4    3e-11   Erythranthe guttata [common monkey flower]
ref|XP_004288382.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3        60.5    4e-11   Fragaria vesca subsp. vesca
ref|XP_007218956.1|  hypothetical protein PRUPE_ppa003550mg           62.4    5e-11   
ref|XP_006432536.1|  hypothetical protein CICLE_v10000608mg           65.1    8e-11   
gb|AFH56407.1|  EIN3-like protein EIL1                                70.5    8e-11   Diospyros kaki [Japanese persimmon]
gb|AAP03999.1|  EIL3                                                  68.6    1e-10   Nicotiana tabacum [American tobacco]
gb|KJB83827.1|  hypothetical protein B456_013G266300                  70.1    1e-10   Gossypium raimondii
ref|XP_010106128.1|  Protein ETHYLENE INSENSITIVE 3                   68.6    1e-10   
gb|KHG09663.1|  ethylene insensitive 3 -like protein                  69.7    1e-10   Gossypium arboreum [tree cotton]
ref|XP_009341360.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  63.2    2e-10   Pyrus x bretschneideri [bai li]
ref|XP_002530192.1|  ETHYLENE-INSENSITIVE3 protein, putative          67.0    2e-10   Ricinus communis
gb|AGK07288.1|  EIN3-3                                                58.5    2e-10   Rosa hybrid cultivar
gb|AAP04000.1|  EIL4                                                  68.9    3e-10   Nicotiana tabacum [American tobacco]
ref|XP_010694878.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  68.9    3e-10   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009607986.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  68.9    3e-10   Nicotiana tomentosiformis
ref|XP_009798829.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  68.6    3e-10   Nicotiana sylvestris
ref|XP_009607827.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like   68.6    3e-10   Nicotiana tomentosiformis
ref|XP_008368189.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  65.1    3e-10   
gb|KDO53812.1|  hypothetical protein CISIN_1g009144mg                 64.7    3e-10   Citrus sinensis [apfelsine]
emb|CDP19134.1|  unnamed protein product                              68.6    3e-10   Coffea canephora [robusta coffee]
gb|AHA93899.1|  ethylene insensitive 3                                68.6    3e-10   Coffea arabica [arabica coffee]
gb|ADE41153.1|  ethylene insensitive 3 class transcription factor     65.1    4e-10   Malus domestica [apple tree]
ref|XP_006297205.1|  hypothetical protein CARUB_v10013213mg           67.8    5e-10   Capsella rubella
ref|XP_010509323.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3 is...  67.8    6e-10   Camelina sativa [gold-of-pleasure]
ref|XP_010521603.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-li...  67.8    7e-10   
ref|XP_010521602.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-li...  67.8    7e-10   
ref|XP_011080514.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3        67.4    9e-10   Sesamum indicum [beniseed]
gb|KHG04095.1|  ethylene insensitive 3 -like protein                  67.0    9e-10   Gossypium arboreum [tree cotton]
ref|XP_006406351.1|  hypothetical protein EUTSA_v10020292mg           67.0    1e-09   Eutrema salsugineum [saltwater cress]
gb|KFK39393.1|  protein ethylene insensitive 3-like                   67.0    1e-09   Arabis alpina [alpine rockcress]
ref|XP_010509301.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3 is...  67.0    1e-09   
dbj|BAJ33948.1|  unnamed protein product                              67.0    1e-09   Eutrema halophilum
ref|XP_010488063.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like   67.0    1e-09   Camelina sativa [gold-of-pleasure]
ref|XP_002885403.1|  ethylene-insensitive3                            67.0    1e-09   
ref|XP_010943685.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  67.0    1e-09   Elaeis guineensis
ref|XP_010466283.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like   67.0    1e-09   Camelina sativa [gold-of-pleasure]
emb|CAC87091.1|  ethylene-insensitive 3 protein                       67.0    1e-09   Phalaenopsis equestris
gb|AGI41323.1|  EIN3-like protein                                     63.5    1e-09   Malus domestica [apple tree]
gb|KDP42895.1|  hypothetical protein JCGZ_23837                       63.9    1e-09   Jatropha curcas
ref|XP_010031647.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like   66.6    1e-09   Eucalyptus grandis [rose gum]
gb|KJB20248.1|  hypothetical protein B456_003G140600                  66.6    1e-09   Gossypium raimondii
gb|AAV68141.1|  ethylene insensitive 3-like 3                         66.2    2e-09   Dianthus caryophyllus [carnation]
ref|XP_008809629.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  66.2    2e-09   Phoenix dactylifera
ref|XP_007016682.1|  Ethylene insensitive 3 family protein            66.2    2e-09   
ref|XP_008790465.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  66.2    2e-09   Phoenix dactylifera
gb|KHN26027.1|  Protein ETHYLENE INSENSITIVE 3                        66.2    2e-09   Glycine soja [wild soybean]
emb|CDY06379.1|  BnaC05g31510D                                        65.9    2e-09   
ref|XP_003545483.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3        66.2    2e-09   Glycine max [soybeans]
ref|XP_010510821.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  65.9    2e-09   Camelina sativa [gold-of-pleasure]
ref|XP_009145590.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3 is...  66.2    2e-09   
ref|XP_004491182.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-li...  66.2    2e-09   Cicer arietinum [garbanzo]
emb|CDY19606.1|  BnaA05g20140D                                        65.9    2e-09   Brassica napus [oilseed rape]
ref|XP_006361129.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-li...  65.9    2e-09   Solanum tuberosum [potatoes]
ref|NP_001234541.1|  EIL1 protein                                     65.9    2e-09   Solanum lycopersicum
ref|NP_188713.1|  protein ethylene insensitive 3                      65.9    2e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009145591.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3 is...  65.9    3e-09   Brassica rapa
ref|XP_010521598.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like   65.5    3e-09   Tarenaya hassleriana [spider flower]
gb|AAL76272.1|AF467784_1  transcription factor EIL1                   65.5    3e-09   Vigna radiata [mung bean]
ref|XP_010544311.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like   65.5    3e-09   Tarenaya hassleriana [spider flower]
ref|XP_007146084.1|  hypothetical protein PHAVU_006G011300g           65.5    3e-09   Phaseolus vulgaris [French bean]
ref|XP_003638449.1|  Ethylene insensitive 3-like protein              65.5    3e-09   
gb|ACX54782.1|  ethylene insensitive-like protein 1                   65.5    3e-09   Medicago truncatula
gb|AFI61908.1|  ethylene insensitive 3-like 2 protein                 65.5    3e-09   Paeonia suffruticosa [moutan peony]
ref|XP_003543154.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3        65.5    3e-09   Glycine max [soybeans]
ref|NP_001275851.1|  ethylene-insensitive 3-like 1 protein            65.1    4e-09   Citrus sinensis [apfelsine]
ref|XP_010557480.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like   64.7    4e-09   Tarenaya hassleriana [spider flower]
gb|AID55343.1|  EIN3-like protein EIL1                                62.8    4e-09   Actinidia chinensis
ref|XP_009801714.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like   62.8    4e-09   Nicotiana sylvestris
ref|XP_011043514.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3        65.1    4e-09   Populus euphratica
ref|XP_011006497.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like   65.1    4e-09   Populus euphratica
gb|KDO53810.1|  hypothetical protein CISIN_1g009144mg                 65.1    4e-09   Citrus sinensis [apfelsine]
gb|ACD87815.1|  putative ethylene insensitive transcription factor    65.1    5e-09   Vicia faba [broad bean]
gb|KHN38437.1|  Protein ETHYLENE INSENSITIVE 3                        64.7    5e-09   Glycine soja [wild soybean]
dbj|BAA74714.1|  transcription factor TEIL                            62.8    5e-09   Nicotiana tabacum [American tobacco]
gb|AID55344.1|  EIN3-like protein EIL2                                64.7    5e-09   Actinidia chinensis
gb|ACJ85584.1|  unknown                                               64.7    6e-09   Medicago truncatula
ref|XP_003617086.1|  Ethylene insensitive 3-like protein              64.7    6e-09   Medicago truncatula
ref|XP_002312841.2|  EIN3-like family protein                         64.7    6e-09   
gb|AHB18380.1|  ethylene insensitive 3                                64.7    6e-09   Momordica charantia [balsam pear]
ref|XP_006408669.1|  hypothetical protein EUTSA_v10001938mg           64.7    6e-09   Eutrema salsugineum [saltwater cress]
gb|KHG00335.1|  ethylene insensitive 3 -like protein                  64.3    6e-09   Gossypium arboreum [tree cotton]
ref|XP_003519487.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3        64.7    6e-09   Glycine max [soybeans]
gb|KJB56070.1|  hypothetical protein B456_009G105400                  64.7    6e-09   Gossypium raimondii
ref|XP_007146083.1|  hypothetical protein PHAVU_006G011200g           64.7    6e-09   Phaseolus vulgaris [French bean]
ref|XP_009414231.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  64.7    6e-09   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002879041.1|  hypothetical protein ARALYDRAFT_481586           64.3    6e-09   
gb|AAL76271.1|AF467783_1  transcription factor EIL2                   64.7    7e-09   Vigna radiata [mung bean]
ref|NP_180273.1|  ethylene insensitive 3-like 1 protein               64.3    7e-09   Arabidopsis thaliana [mouse-ear cress]
gb|ABY28269.1|  EIN3-like protein EIL1                                64.3    7e-09   Actinidia deliciosa [Chinese gooseberry]
ref|NP_001233931.1|  EIN3-like protein                                60.5    8e-09   Solanum lycopersicum
gb|AEK84143.1|  ethylene insensitive 3-like protein                   64.3    9e-09   Oncidium hybrid cultivar
gb|KJB26156.1|  hypothetical protein B456_004G227800                  63.9    9e-09   Gossypium raimondii
gb|AGV54673.1|  ethylene insensitive protein 3                        63.9    9e-09   Phaseolus vulgaris [French bean]
ref|XP_006364491.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like   63.9    1e-08   Solanum tuberosum [potatoes]
ref|NP_001234721.1|  EIL2 protein                                     63.9    1e-08   Solanum lycopersicum
dbj|BAF44108.1|  ethylene signal transcription factor                 63.9    1e-08   Musa acuminata AAA Group [Cavendish banana]
ref|XP_009420955.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  63.9    1e-08   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006384758.1|  EIN3-like family protein                         63.9    1e-08   Populus trichocarpa [western balsam poplar]
ref|XP_007141570.1|  hypothetical protein PHAVU_008G207000g           63.9    1e-08   Phaseolus vulgaris [French bean]
ref|XP_003555660.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3        63.9    1e-08   Glycine max [soybeans]
ref|XP_010544313.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like   63.5    1e-08   Tarenaya hassleriana [spider flower]
ref|XP_003543159.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3        63.5    1e-08   Glycine max [soybeans]
gb|KHN33829.1|  Protein ETHYLENE INSENSITIVE 3                        63.5    1e-08   Glycine soja [wild soybean]
gb|AAF69017.1|AF261654_1  ethylene-insensitive 3-like protein 1       63.5    1e-08   Dianthus caryophyllus [carnation]
gb|AEK84144.1|  ethylene insensitive 3-like protein                   63.5    1e-08   Oncidium hybrid cultivar
ref|XP_006361131.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like   60.5    2e-08   Solanum tuberosum [potatoes]
gb|AGV54306.1|  transcription factor EIL1                             63.2    2e-08   Phaseolus vulgaris [French bean]
ref|XP_009798827.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  63.2    2e-08   Nicotiana sylvestris
gb|ABG89103.1|  ethylene insensitive-like protein 4                   63.2    2e-08   Musa acuminata [banana]
gb|AAC49746.1|  ethylene-insensitive3-like1                           63.2    2e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009404687.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  63.2    2e-08   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002275284.2|  PREDICTED: protein ETHYLENE INSENSITIVE 3        63.2    2e-08   Vitis vinifera
dbj|BAF44109.1|  ethylene signal transcription factor                 63.2    2e-08   Musa acuminata AAA Group [Cavendish banana]
gb|AFU90136.4|  ethylene-insensitive 3                                63.2    2e-08   Paeonia lactiflora [common garden peony]
gb|AFI61909.1|  ethylene insensitive 3-like 3 protein                 63.2    2e-08   Paeonia suffruticosa [moutan peony]
ref|XP_010067064.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  61.2    2e-08   Eucalyptus grandis [rose gum]
ref|XP_009355062.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like   61.2    2e-08   Pyrus x bretschneideri [bai li]
gb|AAY45885.1|  EIN3-like protein                                     61.2    2e-08   Cucurbita moschata [ayote]
ref|XP_009587969.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like   62.8    2e-08   Nicotiana tomentosiformis
gb|ACP56697.1|  EIN3-like protein                                     62.8    3e-08   Lithospermum erythrorhizon
gb|KDO66381.1|  hypothetical protein CISIN_1g0070172mg                62.4    3e-08   Citrus sinensis [apfelsine]
ref|XP_007220648.1|  hypothetical protein PRUPE_ppa003493mg           62.4    3e-08   
ref|XP_006446380.1|  hypothetical protein CICLE_v10014617mg           62.4    3e-08   
ref|XP_006446382.1|  hypothetical protein CICLE_v10014617mg           62.4    3e-08   Citrus clementina [clementine]
ref|XP_006470438.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-li...  62.4    3e-08   Citrus sinensis [apfelsine]
gb|KDO66378.1|  hypothetical protein CISIN_1g0070172mg                62.4    3e-08   Citrus sinensis [apfelsine]
ref|XP_006293460.1|  hypothetical protein CARUB_v10022879mg           62.4    3e-08   Capsella rubella
gb|KDO66375.1|  hypothetical protein CISIN_1g0070172mg                62.4    3e-08   Citrus sinensis [apfelsine]
gb|AHC70432.1|  ethylene insensitive 3-like protein                   62.0    4e-08   Cucurbita pepo subsp. pepo [field pumpkin]
ref|XP_010943654.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  62.0    4e-08   
gb|ACJ70675.1|  EIN3-like protein EIL2                                61.6    6e-08   Actinidia deliciosa [Chinese gooseberry]
gb|KJB10127.1|  hypothetical protein B456_001G192700                  58.2    6e-08   Gossypium raimondii
ref|XP_004501972.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-li...  61.6    6e-08   Cicer arietinum [garbanzo]
ref|XP_010417850.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  61.2    6e-08   Camelina sativa [gold-of-pleasure]
gb|AAX84043.1|  EIN3-like protein                                     59.7    7e-08   Cucumis sativus [cucumbers]
gb|AAY45886.1|  EIN3-like protein                                     59.7    7e-08   Citrullus lanatus [wild melon]
gb|AAY45884.1|  EIN3-like protein                                     59.7    7e-08   Cucurbita maxima [Boston marrow]
ref|XP_010473094.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  61.2    7e-08   Camelina sativa [gold-of-pleasure]
gb|EYU35998.1|  hypothetical protein MIMGU_mgv1a003505mg              61.2    7e-08   Erythranthe guttata [common monkey flower]
gb|EPS63662.1|  hypothetical protein M569_11122                       61.2    7e-08   Genlisea aurea
ref|XP_010417849.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  61.2    8e-08   Camelina sativa [gold-of-pleasure]
emb|CDY60391.1|  BnaA01g36840D                                        60.8    8e-08   Brassica napus [oilseed rape]
ref|XP_006829848.1|  hypothetical protein AMTR_s00119p00117410        61.2    8e-08   
ref|XP_011090234.1|  PREDICTED: LOW QUALITY PROTEIN: protein ETHY...  61.2    8e-08   
emb|CDY38540.1|  BnaC03g26570D                                        60.8    1e-07   Brassica napus [oilseed rape]
emb|CDY27563.1|  BnaC01g32460D                                        60.8    1e-07   Brassica napus [oilseed rape]
ref|XP_009110178.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like   60.8    1e-07   Brassica rapa
gb|AAV68140.1|  ethylene insensitive 3-like 2                         60.5    1e-07   Dianthus caryophyllus [carnation]
dbj|BAB64344.1|  EIN3-like protein                                    60.1    2e-07   Cucumis melo [Oriental melon]
ref|XP_008451093.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3        60.1    2e-07   Cucumis melo [Oriental melon]
ref|XP_004144109.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like   60.1    2e-07   
gb|KGN66413.1|  EIN3-like protein                                     60.1    2e-07   Cucumis sativus [cucumbers]
gb|AAK67355.1|AF387795_1  transcription factor                        60.1    2e-07   Cucumis melo [Oriental melon]
ref|XP_004171661.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like   60.1    2e-07   
gb|AFK80347.1|  ethylene-insensitive 3                                60.1    2e-07   Cucumis sativus [cucumbers]
emb|CDY32390.1|  BnaC03g41740D                                        59.3    3e-07   Brassica napus [oilseed rape]
ref|XP_009133914.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  59.3    3e-07   Brassica rapa
gb|AHC70433.1|  ethylene insensitive 3 protein                        59.3    3e-07   Cucurbita pepo subsp. pepo [field pumpkin]
ref|XP_006650014.1|  PREDICTED: LOW QUALITY PROTEIN: ETHYLENE INS...  59.3    3e-07   Oryza brachyantha
gb|AGE45505.1|  ethylene insensitive like protein                     59.3    3e-07   Musa acuminata AAA Group [Cavendish banana]
ref|XP_002980161.1|  hypothetical protein SELMODRAFT_112063           57.8    4e-07   
ref|XP_009135708.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like   58.5    5e-07   Brassica rapa
ref|XP_009389151.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  58.5    6e-07   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAV68142.1|  ethylene insensitive 3-like 4                         58.5    6e-07   Dianthus caryophyllus [carnation]
ref|XP_008354838.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like   56.2    7e-07   
ref|XP_009402439.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  58.2    8e-07   Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU46131.1|  hypothetical protein MIMGU_mgv1a003270mg              58.2    8e-07   Erythranthe guttata [common monkey flower]
gb|EYU40168.1|  hypothetical protein MIMGU_mgv1a022392mg              55.8    9e-07   Erythranthe guttata [common monkey flower]
gb|EYU40148.1|  hypothetical protein MIMGU_mgv1a023186mg              55.8    9e-07   Erythranthe guttata [common monkey flower]
emb|CDX82228.1|  BnaA03g35930D                                        57.8    9e-07   
gb|EAY89823.1|  hypothetical protein OsI_11369                        57.8    1e-06   Oryza sativa Indica Group [Indian rice]
gb|AAZ78349.1|  EIN3-like protein 1                                   57.8    1e-06   Oryza sativa Japonica Group [Japonica rice]
dbj|BAB78462.2|  ethylene-insensitive-3-like protein                  57.8    1e-06   Oryza sativa Japonica Group [Japonica rice]
gb|ABF95697.1|  ETHYLENE-INSENSITIVE3-like 1 protein, putative, e...  57.8    1e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004984528.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like   57.4    1e-06   Setaria italica
ref|XP_009339243.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  56.2    1e-06   Pyrus x bretschneideri [bai li]
emb|CDX83250.1|  BnaA03g22560D                                        57.4    1e-06   
ref|NP_001049978.1|  Os03g0324300                                     57.4    1e-06   
ref|XP_009339244.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  55.8    1e-06   
ref|XP_009417872.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  57.4    1e-06   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010557481.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like   57.0    2e-06   Tarenaya hassleriana [spider flower]
ref|XP_011091876.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like   57.0    2e-06   
ref|NP_001146219.1|  uncharacterized protein LOC100279789             57.0    2e-06   Zea mays [maize]
gb|ACM89299.1|  EIN3-like protein EIL1                                56.6    2e-06   Eriobotrya japonica [loquat]
gb|AGY30671.1|  ethylene insensitive 3                                56.6    2e-06   Saccharum hybrid cultivar [sugarcane]
gb|ACN31333.1|  unknown                                               56.6    2e-06   Zea mays [maize]
ref|XP_002467935.1|  hypothetical protein SORBIDRAFT_01g036740        56.6    2e-06   Sorghum bicolor [broomcorn]
ref|NP_001152035.1|  ETHYLENE-INSENSITIVE3-like 1 protein             56.6    2e-06   
gb|ACN27664.1|  unknown                                               56.6    2e-06   Zea mays [maize]
emb|CDP16004.1|  unnamed protein product                              56.6    2e-06   Coffea canephora [robusta coffee]
ref|XP_010689360.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  56.6    3e-06   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_001753917.1|  EIN3b transcription factor                       55.1    4e-06   
ref|XP_009406830.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  55.8    5e-06   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_001766792.1|  EIN3a transcription factor                       54.7    6e-06   
ref|XP_008653495.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like   54.7    9e-06   Zea mays [maize]
ref|XP_008670668.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  54.7    1e-05   Zea mays [maize]
dbj|BAJ95094.1|  predicted protein                                    54.7    1e-05   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT14050.1|  Protein ETHYLENE INSENSITIVE 3                        54.7    1e-05   
ref|XP_008375510.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like   53.5    1e-05   
ref|XP_003558012.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  54.3    1e-05   Brachypodium distachyon [annual false brome]
ref|XP_002979886.1|  hypothetical protein SELMODRAFT_16064            53.5    1e-05   
ref|XP_004958734.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  53.9    2e-05   Setaria italica
ref|NP_001060678.1|  Os07g0685700                                     53.5    2e-05   
gb|EEC82710.1|  hypothetical protein OsI_27382                        53.5    2e-05   Oryza sativa Indica Group [Indian rice]
ref|XP_009602832.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 3 pro...  51.6    1e-04   Nicotiana tomentosiformis
ref|XP_009602831.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 3 pro...  51.6    1e-04   Nicotiana tomentosiformis
ref|XP_009788578.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 3 pro...  51.2    1e-04   Nicotiana sylvestris
ref|XP_009788577.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 3 pro...  51.2    1e-04   Nicotiana sylvestris
gb|KHN33326.1|  ETHYLENE INSENSITIVE 3-like 3 protein                 50.8    2e-04   Glycine soja [wild soybean]
dbj|BAF44110.1|  ethylene signal transcription factor                 50.8    2e-04   Musa acuminata AAA Group [Cavendish banana]
ref|XP_006597241.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 3 pro...  50.8    2e-04   Glycine max [soybeans]
gb|ACD87814.1|  putative ethylene insensitive transcription factor    50.8    2e-04   Vicia faba [broad bean]
ref|XP_003543551.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 3 pro...  50.4    2e-04   Glycine max [soybeans]
gb|KHN30114.1|  ETHYLENE INSENSITIVE 3-like 3 protein                 50.4    2e-04   Glycine soja [wild soybean]
ref|XP_004486935.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 3 pro...  50.4    2e-04   Cicer arietinum [garbanzo]
ref|XP_007150399.1|  hypothetical protein PHAVU_005G150100g           50.4    3e-04   Phaseolus vulgaris [French bean]
ref|XP_009609268.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like   49.7    3e-04   Nicotiana tomentosiformis
ref|XP_009391636.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  50.1    3e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003597476.1|  ETHYLENE INSENSITIVE 3-like 3 protein            49.7    5e-04   Medicago truncatula
ref|XP_006850080.1|  hypothetical protein AMTR_s00022p00216890        49.7    5e-04   Amborella trichopoda
ref|XP_004295232.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 3 pro...  49.3    7e-04   Fragaria vesca subsp. vesca
ref|XP_008798325.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 3 pro...  48.9    8e-04   Phoenix dactylifera
emb|CDP14093.1|  unnamed protein product                              48.9    0.001   Coffea canephora [robusta coffee]
ref|XP_008450448.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 3 pro...  48.5    0.001   Cucumis melo [Oriental melon]



>ref|XP_002276380.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Vitis vinifera]
 ref|XP_010659025.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Vitis vinifera]
Length=616

 Score = 68.9 bits (167),  Expect(2) = 1e-15, Method: Composition-based stats.
 Identities = 33/40 (83%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            +NK K+G D+AK RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  66   QNKGKEGVDNAKQRQSQEQARRKKMSRAQDGILKYMLKMM  105


 Score = 40.4 bits (93),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 26/36 (72%), Gaps = 3/36 (8%)
 Frame = +3

Query  213  MGMFEDMANMGFCENLDFLSESPGCTEMAPEVETKA  320
            MG+FE+M   GFC NLDFLS  PG  E+APE E +A
Sbjct  1    MGIFEEM---GFCGNLDFLSAPPGEGEVAPENEPEA  33



>gb|ABK35086.1| EIL2 [Prunus persica]
Length=601

 Score = 64.3 bits (155),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            ++K K+G D+A+ RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  66   QSKGKEGVDNARQRQSQEQARRKKMSRAQDGILKYMLKMM  105


 Score = 43.9 bits (102),  Expect(2) = 2e-15, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 25/36 (69%), Gaps = 3/36 (8%)
 Frame = +3

Query  213  MGMFEDMANMGFCENLDFLSESPGCTEMAPEVETKA  320
            MGMFEDM   GFC NLDFLS  PG  E APE + +A
Sbjct  1    MGMFEDM---GFCGNLDFLSAPPGEGEAAPEHDPEA  33



>gb|KDO53815.1| hypothetical protein CISIN_1g007174mg [Citrus sinensis]
 gb|KDO53816.1| hypothetical protein CISIN_1g007174mg [Citrus sinensis]
 gb|KDO53817.1| hypothetical protein CISIN_1g007174mg [Citrus sinensis]
 gb|KDO53818.1| hypothetical protein CISIN_1g007174mg [Citrus sinensis]
 gb|KDO53819.1| hypothetical protein CISIN_1g007174mg [Citrus sinensis]
Length=614

 Score = 73.6 bits (179),  Expect(2) = 1e-14, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            +NK+K+G DSAKHRQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  66   QNKSKEGVDSAKHRQSQEQARRKKMSRAQDGILKYMLKMM  105


 Score = 32.3 bits (72),  Expect(2) = 1e-14, Method: Composition-based stats.
 Identities = 19/36 (53%), Positives = 23/36 (64%), Gaps = 5/36 (14%)
 Frame = +3

Query  213  MGMFEDMANMGFCENLDFLSESPGCTE--MAPEVET  314
            MG+FE+M   GFC NL+F S  PG  E  M  E+ET
Sbjct  1    MGIFEEM---GFCGNLEFFSALPGEGEAVMGHEMET  33



>ref|XP_006432540.1| hypothetical protein CICLE_v10000617mg [Citrus clementina]
 ref|XP_006432541.1| hypothetical protein CICLE_v10000617mg [Citrus clementina]
 ref|XP_006471295.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like isoform X1 [Citrus 
sinensis]
 ref|XP_006471296.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like isoform X2 [Citrus 
sinensis]
 ref|XP_006471297.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like isoform X3 [Citrus 
sinensis]
 ref|XP_006471298.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like isoform X4 [Citrus 
sinensis]
 gb|ESR45780.1| hypothetical protein CICLE_v10000617mg [Citrus clementina]
 gb|ESR45781.1| hypothetical protein CICLE_v10000617mg [Citrus clementina]
Length=614

 Score = 73.6 bits (179),  Expect(2) = 1e-14, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            +NK+K+G DSAKHRQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  66   QNKSKEGVDSAKHRQSQEQARRKKMSRAQDGILKYMLKMM  105


 Score = 32.3 bits (72),  Expect(2) = 1e-14, Method: Composition-based stats.
 Identities = 19/36 (53%), Positives = 23/36 (64%), Gaps = 5/36 (14%)
 Frame = +3

Query  213  MGMFEDMANMGFCENLDFLSESPGCTE--MAPEVET  314
            MG+FE+M   GFC NL+F S  PG  E  M  E+ET
Sbjct  1    MGIFEEM---GFCGNLEFFSALPGEGEAVMGHEMET  33



>ref|XP_008231879.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Prunus mume]
Length=601

 Score = 64.3 bits (155),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            ++K K+G D+A+ RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  66   QSKGKEGVDNARQRQSQEQARRKKMSRAQDGILKYMLKMM  105


 Score = 41.6 bits (96),  Expect(2) = 1e-14, Method: Composition-based stats.
 Identities = 21/36 (58%), Positives = 26/36 (72%), Gaps = 3/36 (8%)
 Frame = +3

Query  213  MGMFEDMANMGFCENLDFLSESPGCTEMAPEVETKA  320
            MG+FE+M   GFC NLDFLS +PG  E APE + +A
Sbjct  1    MGIFEEM---GFCGNLDFLSAAPGEGEAAPEHDPEA  33



>ref|XP_004140927.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like isoform 1 [Cucumis 
sativus]
 ref|XP_004140928.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like isoform 2 [Cucumis 
sativus]
Length=615

 Score = 67.4 bits (163),  Expect(2) = 7e-14, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            ++K K+GADS+K RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  69   QSKEKEGADSSKQRQSQEQARRKKMSRAQDGILKYMLKMM  108


 Score = 35.8 bits (81),  Expect(2) = 7e-14, Method: Composition-based stats.
 Identities = 18/36 (50%), Positives = 23/36 (64%), Gaps = 3/36 (8%)
 Frame = +3

Query  213  MGMFEDMANMGFCENLDFLSESPGCTEMAPEVETKA  320
            MG+FED+   GFC NL++ S  PG  E A E E +A
Sbjct  4    MGIFEDI---GFCRNLEYFSAPPGEQETAQEHEAEA  36



>gb|KGN46075.1| hypothetical protein Csa_6G051520 [Cucumis sativus]
Length=431

 Score = 67.8 bits (164),  Expect(2) = 7e-14, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            ++K K+GADS+K RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  69   QSKEKEGADSSKQRQSQEQARRKKMSRAQDGILKYMLKMM  108


 Score = 35.4 bits (80),  Expect(2) = 7e-14, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 23/36 (64%), Gaps = 3/36 (8%)
 Frame = +3

Query  213  MGMFEDMANMGFCENLDFLSESPGCTEMAPEVETKA  320
            MG+FED+   GFC NL++ S  PG  E A E E +A
Sbjct  4    MGIFEDI---GFCRNLEYFSAPPGEQETAQEHEAEA  36



>ref|XP_002315400.1| EIN3-like family protein [Populus trichocarpa]
 gb|EEF01571.1| EIN3-like family protein [Populus trichocarpa]
Length=603

 Score = 63.5 bits (153),  Expect(2) = 8e-14, Method: Composition-based stats.
 Identities = 31/40 (78%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            + K  +  D AKHRQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  66   QGKNTEVVDHAKHRQSQEQARRKKMSRAQDGILKYMLKMM  105


 Score = 39.7 bits (91),  Expect(2) = 8e-14, Method: Composition-based stats.
 Identities = 21/42 (50%), Positives = 25/42 (60%), Gaps = 6/42 (14%)
 Frame = +3

Query  213  MGMFEDMANMGFCENLDFLSESPGCTEMAPEVETKAPGVGVE  338
            MG+FE+M   GFC NLDF S  PG  +  PE E   PG  +E
Sbjct  1    MGIFEEM---GFCNNLDFFSAPPGEMDAVPERE---PGATIE  36



>ref|XP_004172838.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like, partial [Cucumis 
sativus]
Length=511

 Score = 67.4 bits (163),  Expect(2) = 8e-14, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            ++K K+GADS+K RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  69   QSKEKEGADSSKQRQSQEQARRKKMSRAQDGILKYMLKMM  108


 Score = 35.8 bits (81),  Expect(2) = 8e-14, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 23/36 (64%), Gaps = 3/36 (8%)
 Frame = +3

Query  213  MGMFEDMANMGFCENLDFLSESPGCTEMAPEVETKA  320
            MG+FED+   GFC NL++ S  PG  E A E E +A
Sbjct  4    MGIFEDI---GFCRNLEYFSAPPGEQETAQEHEAEA  36



>ref|XP_010247605.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Nelumbo nucifera]
Length=618

 Score = 70.5 bits (171),  Expect(2) = 1e-13, Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            +NK+KDG D+AK RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  69   QNKSKDGVDTAKQRQSQEQARRKKMSRAQDGILKYMLKMM  108


 Score = 32.0 bits (71),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 22/35 (63%), Gaps = 3/35 (9%)
 Frame = +3

Query  210  LMGMFEDMANMGFCENLDFLSESPGCTEMAPEVET  314
            +MGMFE+M   GFC NLDFL+ S    E  P  ET
Sbjct  1    MMGMFEEM---GFCGNLDFLAPSVTTGEGDPVPET  32



>gb|KDO53820.1| hypothetical protein CISIN_1g007174mg [Citrus sinensis]
Length=466

 Score = 73.2 bits (178),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            +NK+K+G DSAKHRQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  66   QNKSKEGVDSAKHRQSQEQARRKKMSRAQDGILKYMLKMM  105


 Score = 29.6 bits (65),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 19/36 (53%), Positives = 23/36 (64%), Gaps = 5/36 (14%)
 Frame = +3

Query  213  MGMFEDMANMGFCENLDFLSESPGCTE--MAPEVET  314
            MG+FE+M   GFC NL+F S  PG  E  M  E+ET
Sbjct  1    MGIFEEM---GFCGNLEFFSALPGEGEAVMGHEMET  33



>ref|XP_009355060.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Pyrus x bretschneideri]
 ref|XP_009355061.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Pyrus x bretschneideri]
Length=606

 Score = 62.0 bits (149),  Expect(2) = 1e-13, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            + K K+  D+A+ RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  66   QTKGKERVDNARQRQSQEQARRKKMSRAQDGILKYMLKMM  105


 Score = 40.4 bits (93),  Expect(2) = 1e-13, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 25/38 (66%), Gaps = 3/38 (8%)
 Frame = +3

Query  213  MGMFEDMANMGFCENLDFLSESPGCTEMAPEVETKAPG  326
            MG+FE+M   GFC NLDFLS   G  E APE E +A G
Sbjct  1    MGIFEEM---GFCGNLDFLSAPSGEGEAAPEHEPEATG  35



>ref|XP_008456656.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Cucumis melo]
 ref|XP_008456657.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Cucumis melo]
Length=615

 Score = 67.4 bits (163),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            ++K K+GADS+K RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  69   QSKEKEGADSSKQRQSQEQARRKKMSRAQDGILKYMLKMM  108


 Score = 34.3 bits (77),  Expect(2) = 2e-13, Method: Composition-based stats.
 Identities = 17/36 (47%), Positives = 23/36 (64%), Gaps = 3/36 (8%)
 Frame = +3

Query  213  MGMFEDMANMGFCENLDFLSESPGCTEMAPEVETKA  320
            MG+FED++   FC NL++ S  PG  E A E E +A
Sbjct  4    MGIFEDIS---FCRNLEYFSAPPGEQETAQEHEAEA  36



>ref|NP_001284429.1| ETHYLENE INSENSITIVE 3-like 1 protein [Cucumis melo]
 dbj|BAB64345.1| EIN3-like protein [Cucumis melo]
Length=615

 Score = 67.4 bits (163),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            ++K K+GADS+K RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  69   QSKEKEGADSSKQRQSQEQARRKKMSRAQDGILKYMLKMM  108


 Score = 34.3 bits (77),  Expect(2) = 2e-13, Method: Composition-based stats.
 Identities = 17/36 (47%), Positives = 23/36 (64%), Gaps = 3/36 (8%)
 Frame = +3

Query  213  MGMFEDMANMGFCENLDFLSESPGCTEMAPEVETKA  320
            MG+FED++   FC NL++ S  PG  E A E E +A
Sbjct  4    MGIFEDIS---FCRNLEYFSAPPGEQETAQEHEAEA  36



>ref|XP_004306440.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Fragaria vesca 
subsp. vesca]
Length=604

 Score = 63.9 bits (154),  Expect(2) = 3e-13, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            + + K+ AD+A+ RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  64   QTRGKEAADNARQRQSQEQARRKKMSRAQDGILKYMLKMM  103


 Score = 37.0 bits (84),  Expect(2) = 3e-13, Method: Composition-based stats.
 Identities = 19/33 (58%), Positives = 21/33 (64%), Gaps = 3/33 (9%)
 Frame = +3

Query  213  MGMFEDMANMGFCENLDFLSESPGCTEMAPEVE  311
            MG+FEDM   GFC NLDF S   G  E+ PE E
Sbjct  1    MGIFEDM---GFCGNLDFFSAPAGEGEVVPEPE  30



>ref|XP_010243659.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Nelumbo nucifera]
Length=615

 Score = 68.9 bits (167),  Expect(2) = 4e-13, Method: Composition-based stats.
 Identities = 33/40 (83%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            +NK K+G D+AK RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  69   QNKGKEGVDTAKQRQSQEQARRKKMSRAQDGILKYMLKMM  108


 Score = 32.0 bits (71),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 19/39 (49%), Positives = 26/39 (67%), Gaps = 5/39 (13%)
 Frame = +3

Query  210  LMGMFEDMANMGFCENLDFLS--ESPGCTEMAPEVETKA  320
            +MGM E+M   GFC NLDF +  E+ G  ++APE E +A
Sbjct  1    MMGMLEEM---GFCGNLDFFAPPETIGEGDLAPEAEPEA  36



>ref|XP_006347695.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Solanum tuberosum]
Length=604

 Score = 63.9 bits (154),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            KNK K+  D  K RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  69   KNKNKEVGDGVKQRQSQEQARRKKMSRAQDGILKYMLKMM  108


 Score = 36.6 bits (83),  Expect(2) = 4e-13, Method: Composition-based stats.
 Identities = 22/43 (51%), Positives = 28/43 (65%), Gaps = 4/43 (9%)
 Frame = +3

Query  213  MGMFEDMANMGFCENLDFLSESPGC-TEMAPEVETKAPGVGVE  338
            MG+FEDM   GF  N +FLS+S GC  ++A EVE K  G+  E
Sbjct  1    MGIFEDM---GFSGNFEFLSDSMGCGGDVAQEVEDKPVGLEEE  40



>ref|NP_001234546.1| EIL3 protein [Solanum lycopersicum]
 gb|AAK58859.1|AF328786_1 EIL3 [Solanum lycopersicum]
Length=601

 Score = 65.1 bits (157),  Expect(2) = 5e-13, Method: Composition-based stats.
 Identities = 33/40 (83%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            KNK K   D AK RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  66   KNKNKVVGDGAKQRQSQEQARRKKMSRAQDGILKYMLKMM  105


 Score = 35.4 bits (80),  Expect(2) = 5e-13, Method: Composition-based stats.
 Identities = 21/39 (54%), Positives = 25/39 (64%), Gaps = 5/39 (13%)
 Frame = +3

Query  213  MGMFEDMANMGFCENLDFLSESPGCTEMAPEVETKAPGV  329
            MG+FEDM   GF  N +FLS+S GC   A EVE K  G+
Sbjct  1    MGIFEDM---GFSGNFEFLSDSMGCG--AQEVEHKPVGL  34



>ref|XP_002310961.1| hypothetical protein POPTR_0008s01200g [Populus trichocarpa]
 ref|XP_006379422.1| EIN3-like family protein [Populus trichocarpa]
 gb|EEE88328.1| hypothetical protein POPTR_0008s01200g [Populus trichocarpa]
 gb|ERP57219.1| EIN3-like family protein [Populus trichocarpa]
Length=603

 Score = 61.6 bits (148),  Expect(2) = 1e-12, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            ++K  +  D+AK RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  66   QSKNTEVVDNAKQRQSQEQARRKKMSRAQDGILKYMLKMM  105


 Score = 37.7 bits (86),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 19/36 (53%), Positives = 24/36 (67%), Gaps = 3/36 (8%)
 Frame = +3

Query  213  MGMFEDMANMGFCENLDFLSESPGCTEMAPEVETKA  320
            MG+FE+M   GFC NLDF S  PG  ++ PE E +A
Sbjct  1    MGIFEEM---GFCNNLDFFSAPPGEMDVVPECEPEA  33



>ref|XP_008346133.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Malus domestica]
 ref|XP_008346139.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Malus domestica]
Length=606

 Score = 60.1 bits (144),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            + K K+  D+A+ RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  66   QTKGKERVDNARQRQSQEQARRKKMSRAQDGILKYMLKMM  105


 Score = 38.9 bits (89),  Expect(2) = 1e-12, Method: Composition-based stats.
 Identities = 21/36 (58%), Positives = 24/36 (67%), Gaps = 3/36 (8%)
 Frame = +3

Query  213  MGMFEDMANMGFCENLDFLSESPGCTEMAPEVETKA  320
            MG+FE+M   GFC NLDFLS   G  E APE E +A
Sbjct  1    MGIFEEM---GFCGNLDFLSAPSGEGEAAPEHEPEA  33



>ref|XP_008357657.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Malus domestica]
Length=625

 Score = 64.3 bits (155),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            + K K+G D+A+ RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  66   QTKGKEGVDNARQRQSQEQARRKKMSRAQDGILKYMLKMM  105


 Score = 34.7 bits (78),  Expect(2) = 1e-12, Method: Composition-based stats.
 Identities = 18/36 (50%), Positives = 24/36 (67%), Gaps = 3/36 (8%)
 Frame = +3

Query  213  MGMFEDMANMGFCENLDFLSESPGCTEMAPEVETKA  320
            MG+FE++   GFC+NLDFLS      + APE E +A
Sbjct  1    MGIFEEL---GFCDNLDFLSAPSXEGDAAPEHEPEA  33



>gb|AGI41325.1| EIN3-like protein [Malus domestica]
Length=625

 Score = 64.3 bits (155),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            + K K+G D+A+ RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  66   QTKGKEGVDNARQRQSQEQARRKKMSRAQDGILKYMLKMM  105


 Score = 34.7 bits (78),  Expect(2) = 2e-12, Method: Composition-based stats.
 Identities = 18/36 (50%), Positives = 24/36 (67%), Gaps = 3/36 (8%)
 Frame = +3

Query  213  MGMFEDMANMGFCENLDFLSESPGCTEMAPEVETKA  320
            MG+FE++   GFC+NLDFLS      + APE E +A
Sbjct  1    MGIFEEL---GFCDNLDFLSAPSEEGDAAPEHEPEA  33



>gb|ADE41155.1| ethylene insensitive 3 class transcription factor [Malus domestica]
Length=625

 Score = 64.3 bits (155),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            + K K+G D+A+ RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  66   QTKGKEGVDNARQRQSQEQARRKKMSRAQDGILKYMLKMM  105


 Score = 34.7 bits (78),  Expect(2) = 2e-12, Method: Composition-based stats.
 Identities = 18/36 (50%), Positives = 24/36 (67%), Gaps = 3/36 (8%)
 Frame = +3

Query  213  MGMFEDMANMGFCENLDFLSESPGCTEMAPEVETKA  320
            MG+FE++   GFC+NLDFLS      + APE E +A
Sbjct  1    MGIFEEL---GFCDNLDFLSAPSEEGDAAPEHEPEA  33



>ref|XP_009355361.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Pyrus x bretschneideri]
Length=627

 Score = 62.0 bits (149),  Expect(2) = 2e-12, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            + K K+G D+A+  QSQEQARRKKMSRA DGILKYMLKMM
Sbjct  67   QTKGKEGVDNARQCQSQEQARRKKMSRAQDGILKYMLKMM  106


 Score = 36.2 bits (82),  Expect(2) = 2e-12, Method: Composition-based stats.
 Identities = 19/36 (53%), Positives = 24/36 (67%), Gaps = 3/36 (8%)
 Frame = +3

Query  213  MGMFEDMANMGFCENLDFLSESPGCTEMAPEVETKA  320
            MG+FE++   GFC NLDFLS   G  + APE E +A
Sbjct  1    MGIFEEL---GFCGNLDFLSAPSGEGDAAPEHELEA  33



>dbj|BAI44821.1| ethylene insensitive 3-like [Daucus carota]
Length=619

 Score = 68.2 bits (165),  Expect(2) = 3e-12, Method: Composition-based stats.
 Identities = 33/40 (83%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            + K K+G DSAK RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  65   EQKGKEGVDSAKQRQSQEQARRKKMSRAQDGILKYMLKMM  104


 Score = 29.6 bits (65),  Expect(2) = 3e-12, Method: Composition-based stats.
 Identities = 17/36 (47%), Positives = 20/36 (56%), Gaps = 3/36 (8%)
 Frame = +3

Query  213  MGMFEDMANMGFCENLDFLSESPGCTEMAPEVETKA  320
            MG+FE+M    F  NLDF S   G  E+ PE E  A
Sbjct  1    MGIFEEM---NFSGNLDFFSAPMGEGEVVPESEHDA  33



>ref|XP_008379003.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Malus domestica]
Length=391

 Score = 64.3 bits (155),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            + K K+G D+A+ RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  66   QTKGKEGVDNARQRQSQEQARRKKMSRAQDGILKYMLKMM  105


 Score = 33.9 bits (76),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 24/36 (67%), Gaps = 3/36 (8%)
 Frame = +3

Query  213  MGMFEDMANMGFCENLDFLSESPGCTEMAPEVETKA  320
            MG+FE++   GFC+NLDFLS      + APE E +A
Sbjct  1    MGIFEEL---GFCDNLDFLSAPSXEGDAAPEHEPEA  33



>ref|XP_009339245.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Pyrus x bretschneideri]
 ref|XP_009339246.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Pyrus x bretschneideri]
 ref|XP_009339249.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Pyrus x bretschneideri]
 ref|XP_009339251.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Pyrus x bretschneideri]
Length=611

 Score = 60.5 bits (145),  Expect(2) = 4e-12, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            + K K+  D+A+ RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  66   QTKGKEKVDNARQRQSQEQARRKKMSRAQDGILKYMLKMM  105


 Score = 37.0 bits (84),  Expect(2) = 4e-12, Method: Composition-based stats.
 Identities = 19/36 (53%), Positives = 24/36 (67%), Gaps = 3/36 (8%)
 Frame = +3

Query  213  MGMFEDMANMGFCENLDFLSESPGCTEMAPEVETKA  320
            MG+FE+M   GFC NLDFL+   G  + APE E +A
Sbjct  1    MGIFEEM---GFCGNLDFLTAPSGEGDAAPEHEPEA  33



>ref|XP_011012998.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Populus euphratica]
 ref|XP_011012999.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Populus euphratica]
 ref|XP_011013000.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Populus euphratica]
 ref|XP_011013001.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Populus euphratica]
Length=658

 Score = 62.4 bits (150),  Expect(2) = 4e-12, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            + K  +  D AKHRQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  65   QGKNTEVVDHAKHRQSQEQARRKKMSRAQDGILKYMLKMM  104


 Score = 34.7 bits (78),  Expect(2) = 4e-12, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 26/42 (62%), Gaps = 7/42 (17%)
 Frame = +3

Query  213  MGMFEDMANMGFCENLDFLSESPGCTEMAPEVETKAPGVGVE  338
            MG+FE+M   GFC NLDF S +PG  +  PE E   PG  +E
Sbjct  1    MGIFEEM---GFCNNLDFFS-APGEMDAVPERE---PGATIE  35



>ref|XP_011046481.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Populus euphratica]
 ref|XP_011046482.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Populus euphratica]
Length=658

 Score = 62.4 bits (150),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            + K  +  D AKHRQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  65   QGKNTEVVDHAKHRQSQEQARRKKMSRAQDGILKYMLKMM  104


 Score = 34.7 bits (78),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 26/42 (62%), Gaps = 7/42 (17%)
 Frame = +3

Query  213  MGMFEDMANMGFCENLDFLSESPGCTEMAPEVETKAPGVGVE  338
            MG+FE+M   GFC NLDF S +PG  +  PE E   PG  +E
Sbjct  1    MGIFEEM---GFCNNLDFFS-APGEMDAVPERE---PGATIE  35



>gb|ADE41154.1| ethylene insensitive 3 class transcription factor [Malus domestica]
Length=611

 Score = 60.1 bits (144),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            + K K+  D+A+ RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  66   QTKGKERVDNARQRQSQEQARRKKMSRAQDGILKYMLKMM  105


 Score = 37.0 bits (84),  Expect(2) = 5e-12, Method: Composition-based stats.
 Identities = 19/36 (53%), Positives = 24/36 (67%), Gaps = 3/36 (8%)
 Frame = +3

Query  213  MGMFEDMANMGFCENLDFLSESPGCTEMAPEVETKA  320
            MG+FE+M   GFC NLDFL+   G  + APE E +A
Sbjct  1    MGIFEEM---GFCGNLDFLTAPSGEGDAAPEHEPEA  33



>gb|AGI41324.1| EIN3-like protein [Malus domestica]
Length=611

 Score = 60.1 bits (144),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            + K K+  D+A+ RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  66   QTKGKERVDNARQRQSQEQARRKKMSRAQDGILKYMLKMM  105


 Score = 37.0 bits (84),  Expect(2) = 5e-12, Method: Composition-based stats.
 Identities = 19/36 (53%), Positives = 24/36 (67%), Gaps = 3/36 (8%)
 Frame = +3

Query  213  MGMFEDMANMGFCENLDFLSESPGCTEMAPEVETKA  320
            MG+FE+M   GFC NLDFL+   G  + APE E +A
Sbjct  1    MGIFEEM---GFCGNLDFLTAPSGEGDAAPEHEPEA  33



>ref|XP_008364747.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Malus domestica]
Length=611

 Score = 60.1 bits (144),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            + K K+  D+A+ RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  66   QTKGKERVDNARQRQSQEQARRKKMSRAQDGILKYMLKMM  105


 Score = 37.0 bits (84),  Expect(2) = 5e-12, Method: Composition-based stats.
 Identities = 19/36 (53%), Positives = 24/36 (67%), Gaps = 3/36 (8%)
 Frame = +3

Query  213  MGMFEDMANMGFCENLDFLSESPGCTEMAPEVETKA  320
            MG+FE+M   GFC NLDFL+   G  + APE E +A
Sbjct  1    MGIFEEM---GFCGNLDFLTAPSGEGDAAPEHEPEA  33



>ref|XP_011032978.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Populus euphratica]
Length=662

 Score = 62.0 bits (149),  Expect(2) = 8e-12, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            ++K  +  D+AK RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  66   QSKNTEVVDNAKQRQSQEQARRKKMSRAQDGILKYMLKMM  105


 Score = 34.3 bits (77),  Expect(2) = 8e-12, Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 23/36 (64%), Gaps = 3/36 (8%)
 Frame = +3

Query  213  MGMFEDMANMGFCENLDFLSESPGCTEMAPEVETKA  320
            MG++E+M    FC NLDF S  PG  ++ PE E +A
Sbjct  1    MGIYEEME---FCNNLDFFSAPPGEMDVVPEREPEA  33



>gb|AIS20827.1| EIL [Pyrus x bretschneideri]
Length=600

 Score = 60.1 bits (144),  Expect(2) = 8e-12, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            + K K+  D+A+ RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  60   QTKGKERVDNARQRQSQEQARRKKMSRAQDGILKYMLKMM  99


 Score = 36.2 bits (82),  Expect(2) = 8e-12, Method: Composition-based stats.
 Identities = 18/29 (62%), Positives = 19/29 (66%), Gaps = 0/29 (0%)
 Frame = +3

Query  240  MGFCENLDFLSESPGCTEMAPEVETKAPG  326
            MGFC NLDFLS   G  E APE E +A G
Sbjct  1    MGFCGNLDFLSAPSGEGEAAPEHEPEATG  29



>ref|XP_009759370.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Nicotiana sylvestris]
Length=608

 Score = 64.3 bits (155),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 35/41 (85%), Gaps = 1/41 (2%)
 Frame = +1

Query  430  KNKTKD-GADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            KNK K+ G D AK RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  68   KNKNKEVGGDGAKQRQSQEQARRKKMSRAQDGILKYMLKMM  108


 Score = 30.8 bits (68),  Expect(2) = 2e-11, Method: Composition-based stats.
 Identities = 19/40 (48%), Positives = 25/40 (63%), Gaps = 4/40 (10%)
 Frame = +3

Query  213  MGMFEDMANMGFCENLDFLSESPGC-TEMAPEVETKAPGV  329
            M MFE+M   GF  N +F+S+  GC  ++A EVE K  GV
Sbjct  1    MMMFEEM---GFPGNFEFMSDPLGCGGDVAQEVEHKPTGV  37



>gb|AAP04001.1| EIL5 [Nicotiana tabacum]
Length=608

 Score = 64.3 bits (155),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 35/41 (85%), Gaps = 1/41 (2%)
 Frame = +1

Query  430  KNKTKD-GADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            KNK K+ G D AK RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  68   KNKNKEVGGDGAKQRQSQEQARRKKMSRAQDGILKYMLKMM  108


 Score = 30.8 bits (68),  Expect(2) = 2e-11, Method: Composition-based stats.
 Identities = 19/40 (48%), Positives = 25/40 (63%), Gaps = 4/40 (10%)
 Frame = +3

Query  213  MGMFEDMANMGFCENLDFLSESPGC-TEMAPEVETKAPGV  329
            M MFE+M   GF  N +F+S+  GC  ++A EVE K  GV
Sbjct  1    MMMFEEM---GFPGNFEFMSDPLGCGGDVAQEVEHKPTGV  37



>gb|KDP42896.1| hypothetical protein JCGZ_23838 [Jatropha curcas]
Length=619

 Score = 67.4 bits (163),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            +NK+K+G D AK RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  66   QNKSKEGIDIAKQRQSQEQARRKKMSRAQDGILKYMLKMM  105


 Score = 27.7 bits (60),  Expect(2) = 2e-11, Method: Composition-based stats.
 Identities = 14/33 (42%), Positives = 19/33 (58%), Gaps = 3/33 (9%)
 Frame = +3

Query  213  MGMFEDMANMGFCENLDFLSESPGCTEMAPEVE  311
            M MF++M   GFC ++DF S   G    AP+ E
Sbjct  1    MMMFDEM---GFCSDMDFFSAPFGEDVAAPQAE  30



>ref|XP_010106127.1| Protein ETHYLENE INSENSITIVE 3 [Morus notabilis]
 gb|EXC07787.1| Protein ETHYLENE INSENSITIVE 3 [Morus notabilis]
Length=617

 Score = 67.4 bits (163),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            +NK K GAD+A+ RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  67   QNKGKQGADNARQRQSQEQARRKKMSRAQDGILKYMLKMM  106


 Score = 27.7 bits (60),  Expect(2) = 2e-11, Method: Composition-based stats.
 Identities = 17/39 (44%), Positives = 22/39 (56%), Gaps = 3/39 (8%)
 Frame = +3

Query  213  MGMFEDMANMGFCENLDFLSESPGCTEMAPEVETKAPGV  329
            MG+FE++   GF  N +FLS  P   E A E E +A  V
Sbjct  1    MGIFEEL---GFSGNFEFLSAPPREAEEALEHEPEATTV  36



>ref|XP_009595535.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Nicotiana tomentosiformis]
Length=609

 Score = 64.3 bits (155),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 35/41 (85%), Gaps = 1/41 (2%)
 Frame = +1

Query  430  KNKTKD-GADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            KNK K+ G D AK RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  69   KNKNKEVGGDGAKQRQSQEQARRKKMSRAQDGILKYMLKMM  109


 Score = 30.8 bits (68),  Expect(2) = 2e-11, Method: Composition-based stats.
 Identities = 19/43 (44%), Positives = 26/43 (60%), Gaps = 4/43 (9%)
 Frame = +3

Query  213  MGMFEDMANMGFCENLDFLSESPGC-TEMAPEVETKAPGVGVE  338
            M MFE+M   GF  N +F+S+  GC  ++A E+E K  GV  E
Sbjct  1    MMMFEEM---GFPGNFEFMSDPLGCGGDVAQEIEHKPTGVEEE  40



>gb|ADZ97022.2| EIL6, partial [Nicotiana tabacum]
Length=607

 Score = 64.3 bits (155),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 35/41 (85%), Gaps = 1/41 (2%)
 Frame = +1

Query  430  KNKTKD-GADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            KNK K+ G D AK RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  69   KNKNKEVGGDGAKQRQSQEQARRKKMSRAQDGILKYMLKMM  109


 Score = 30.4 bits (67),  Expect(2) = 2e-11, Method: Composition-based stats.
 Identities = 19/43 (44%), Positives = 26/43 (60%), Gaps = 4/43 (9%)
 Frame = +3

Query  213  MGMFEDMANMGFCENLDFLSESPGC-TEMAPEVETKAPGVGVE  338
            M MFE+M   GF  N +F+S+  GC  ++A E+E K  GV  E
Sbjct  1    MMMFEEM---GFPGNFEFMSDPLGCGGDVAQEIEHKPTGVEEE  40



>ref|XP_008231880.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Prunus mume]
Length=622

 Score = 64.7 bits (156),  Expect(2) = 2e-11, Method: Composition-based stats.
 Identities = 31/40 (78%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            +NK K+  D+A+ RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  69   QNKGKERVDNARQRQSQEQARRKKMSRAQDGILKYMLKMM  108


 Score = 30.0 bits (66),  Expect(2) = 2e-11, Method: Composition-based stats.
 Identities = 18/36 (50%), Positives = 22/36 (61%), Gaps = 6/36 (17%)
 Frame = +3

Query  213  MGMFEDMANMGFCENLDFLSESPG---CTEMAPEVE  311
            MG+FE+M   GFC  LDFLS + G     + APE E
Sbjct  1    MGIFEEM---GFCGELDFLSTTSGEGDGVDAAPEHE  33



>gb|EYU26910.1| hypothetical protein MIMGU_mgv1a026901mg [Erythranthe guttata]
Length=561

 Score = 62.4 bits (150),  Expect(2) = 3e-11, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            +NKT  G  +  HR SQEQARRKKMSRA DGILKYMLKMM
Sbjct  63   QNKTNGGGVARPHRNSQEQARRKKMSRAQDGILKYMLKMM  102


 Score = 32.3 bits (72),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 23/33 (70%), Gaps = 5/33 (15%)
 Frame = +3

Query  213  MGMFEDMANMGFCENLDFLSESPGCTEMAPEVE  311
            MG+FE+M   GF +NLDFL  SP   E+ PEV+
Sbjct  1    MGIFEEM---GFSDNLDFL--SPREVEITPEVD  28



>ref|XP_004288382.1| PREDICTED: protein ETHYLENE INSENSITIVE 3 [Fragaria vesca subsp. 
vesca]
Length=618

 Score = 60.5 bits (145),  Expect(2) = 4e-11, Method: Composition-based stats.
 Identities = 32/43 (74%), Positives = 34/43 (79%), Gaps = 3/43 (7%)
 Frame = +1

Query  430  KNKTKDGAD---SAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            +  TK G D   +AK RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  66   EQTTKGGKDVIVTAKQRQSQEQARRKKMSRAQDGILKYMLKMM  108


 Score = 33.5 bits (75),  Expect(2) = 4e-11, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 25/37 (68%), Gaps = 3/37 (8%)
 Frame = +3

Query  210  LMGMFEDMANMGFCENLDFLSESPGCTEMAPEVETKA  320
            +M MF++M   GFC +LDF+S +PG     P+ ET+A
Sbjct  1    MMMMFDEM---GFCGDLDFISATPGGEVAIPQAETEA  34



>ref|XP_007218956.1| hypothetical protein PRUPE_ppa003550mg [Prunus persica]
 gb|EMJ20155.1| hypothetical protein PRUPE_ppa003550mg [Prunus persica]
Length=566

 Score = 62.4 bits (150),  Expect(2) = 5e-11, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            +NK K+  D+A+ RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  71   QNKGKERVDNARQRQSQEQARRKKMSRAQDGILKYMLKMM  110


 Score = 31.2 bits (69),  Expect(2) = 5e-11, Method: Composition-based stats.
 Identities = 19/41 (46%), Positives = 24/41 (59%), Gaps = 8/41 (20%)
 Frame = +3

Query  213  MGMFEDMANMGFCENLDFLSESPG-----CTEMAPEVETKA  320
            MG+FE+M   GFC  LDFLS + G       + APE E +A
Sbjct  1    MGIFEEM---GFCGELDFLSTTSGEGDGDGVDAAPEHEPEA  38



>ref|XP_006432536.1| hypothetical protein CICLE_v10000608mg [Citrus clementina]
 ref|XP_006432537.1| hypothetical protein CICLE_v10000608mg [Citrus clementina]
 ref|XP_006432538.1| hypothetical protein CICLE_v10000608mg [Citrus clementina]
 ref|XP_006432539.1| hypothetical protein CICLE_v10000608mg [Citrus clementina]
 ref|XP_006471293.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like isoform X1 [Citrus 
sinensis]
 gb|ESR45776.1| hypothetical protein CICLE_v10000608mg [Citrus clementina]
 gb|ESR45777.1| hypothetical protein CICLE_v10000608mg [Citrus clementina]
 gb|ESR45778.1| hypothetical protein CICLE_v10000608mg [Citrus clementina]
 gb|ESR45779.1| hypothetical protein CICLE_v10000608mg [Citrus clementina]
Length=617

 Score = 65.1 bits (157),  Expect(2) = 8e-11, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            ++K+K+  DSAK RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  66   QSKSKECVDSAKQRQSQEQARRKKMSRAQDGILKYMLKMM  105


 Score = 28.1 bits (61),  Expect(2) = 8e-11, Method: Composition-based stats.
 Identities = 18/38 (47%), Positives = 22/38 (58%), Gaps = 5/38 (13%)
 Frame = +3

Query  213  MGMFEDMANMGFCENLDFLSESPGCTE--MAPEVETKA  320
            MG+FE+M   GFC NL+F S   G  E  +  E ET A
Sbjct  1    MGIFEEM---GFCGNLEFFSSPHGEGEAFLEHEQETAA  35



>gb|AFH56407.1| EIN3-like protein EIL1, partial [Diospyros kaki]
Length=594

 Score = 70.5 bits (171),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +1

Query  433  NKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            NK K+G D+AKHRQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  56   NKGKEGVDAAKHRQSQEQARRKKMSRAQDGILKYMLKMM  94



>gb|AAP03999.1| EIL3 [Nicotiana tabacum]
Length=300

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +1

Query  433  NKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
             K+K+G D AKHRQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  70   TKSKEGVDPAKHRQSQEQARRKKMSRAQDGILKYMLKMM  108



>gb|KJB83827.1| hypothetical protein B456_013G266300 [Gossypium raimondii]
 gb|KJB83828.1| hypothetical protein B456_013G266300 [Gossypium raimondii]
Length=594

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 33/40 (83%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            ++K KDG D+AK RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  67   QSKGKDGVDTAKQRQSQEQARRKKMSRAQDGILKYMLKMM  106



>ref|XP_010106128.1| Protein ETHYLENE INSENSITIVE 3 [Morus notabilis]
 gb|EXC07788.1| Protein ETHYLENE INSENSITIVE 3 [Morus notabilis]
Length=607

 Score = 68.6 bits (166),  Expect(2) = 1e-10, Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            +NK K GAD+AK RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  60   QNKGKQGADNAKQRQSQEQARRKKMSRAQDGILKYMLKMM  99


 Score = 23.9 bits (50),  Expect(2) = 1e-10, Method: Composition-based stats.
 Identities = 13/27 (48%), Positives = 14/27 (52%), Gaps = 0/27 (0%)
 Frame = +3

Query  240  MGFCENLDFLSESPGCTEMAPEVETKA  320
            MGF  N DFLS  P   E   E E +A
Sbjct  1    MGFSGNFDFLSAPPREGEEVMEHEAEA  27



>gb|KHG09663.1| ethylene insensitive 3 -like protein [Gossypium arboreum]
Length=634

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 33/40 (83%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            ++K KDG D+AK RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  106  QSKGKDGVDTAKQRQSQEQARRKKMSRAQDGILKYMLKMM  145



>ref|XP_009341360.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Pyrus x bretschneideri]
Length=659

 Score = 63.2 bits (152),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            + K ++G D+A+ RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  66   QTKGREGVDNARQRQSQEQARRKKMSRAQDGILKYMLKMM  105


 Score = 28.9 bits (63),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 16/36 (44%), Positives = 22/36 (61%), Gaps = 3/36 (8%)
 Frame = +3

Query  213  MGMFEDMANMGFCENLDFLSESPGCTEMAPEVETKA  320
            MG+FE++   GF  NLD+L    G  + APE E +A
Sbjct  1    MGIFEEL---GFSGNLDYLLAPSGEGDAAPEHEQEA  33



>ref|XP_002530192.1| ETHYLENE-INSENSITIVE3 protein, putative [Ricinus communis]
 gb|EEF32182.1| ETHYLENE-INSENSITIVE3 protein, putative [Ricinus communis]
Length=617

 Score = 67.0 bits (162),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            +NK+K+G D AK RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  66   QNKSKEGIDMAKQRQSQEQARRKKMSRAQDGILKYMLKMM  105


 Score = 24.3 bits (51),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 13/33 (39%), Positives = 19/33 (58%), Gaps = 3/33 (9%)
 Frame = +3

Query  213  MGMFEDMANMGFCENLDFLSESPGCTEMAPEVE  311
            M MF+++   GFC ++DF S S G    A + E
Sbjct  1    MMMFDEI---GFCGDMDFFSSSLGEDVAAQQAE  30



>gb|AGK07288.1| EIN3-3 [Rosa hybrid cultivar]
Length=618

 Score = 58.5 bits (140),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 31/43 (72%), Positives = 34/43 (79%), Gaps = 3/43 (7%)
 Frame = +1

Query  430  KNKTKDGAD---SAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            +  TK G +   +AK RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  66   EQTTKGGKEVIVTAKQRQSQEQARRKKMSRAQDGILKYMLKMM  108


 Score = 32.7 bits (73),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 14/27 (52%), Positives = 19/27 (70%), Gaps = 0/27 (0%)
 Frame = +3

Query  240  MGFCENLDFLSESPGCTEMAPEVETKA  320
            MGFC +LDF+S +PG     P+ ET+A
Sbjct  8    MGFCGDLDFISTTPGGEVAIPQAETEA  34



>gb|AAP04000.1| EIL4 [Nicotiana tabacum]
Length=603

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +1

Query  436  KTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            K+K+G D AKHRQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  71   KSKEGVDPAKHRQSQEQARRKKMSRAQDGILKYMLKMM  108



>ref|XP_010694878.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Beta vulgaris 
subsp. vulgaris]
Length=705

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 33/40 (83%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            K+K K+G D+AK RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  78   KDKAKEGVDAAKQRQSQEQARRKKMSRAQDGILKYMLKMM  117



>ref|XP_009607986.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Nicotiana tomentosiformis]
 ref|XP_009607987.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Nicotiana tomentosiformis]
Length=615

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +1

Query  433  NKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
             K+K+G D AKHRQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  70   TKSKEGVDPAKHRQSQEQARRKKMSRAQDGILKYMLKMM  108



>ref|XP_009798829.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Nicotiana sylvestris]
 ref|XP_009798831.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Nicotiana sylvestris]
Length=603

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +1

Query  436  KTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            K+K+G D AKHRQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  71   KSKEGVDPAKHRQSQEQARRKKMSRAQDGILKYMLKMM  108



>ref|XP_009607827.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Nicotiana tomentosiformis]
 ref|XP_009607828.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Nicotiana tomentosiformis]
Length=600

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +1

Query  436  KTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            K+K+G D AKHRQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  71   KSKEGVDPAKHRQSQEQARRKKMSRAQDGILKYMLKMM  108



>ref|XP_008368189.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Malus domestica]
Length=659

 Score = 65.1 bits (157),  Expect(2) = 3e-10, Method: Composition-based stats.
 Identities = 31/40 (78%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            + K K+G D+A+ RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  66   QTKGKEGVDNARQRQSQEQARRKKMSRAQDGILKYMLKMM  105


 Score = 26.2 bits (56),  Expect(2) = 3e-10, Method: Composition-based stats.
 Identities = 15/36 (42%), Positives = 21/36 (58%), Gaps = 3/36 (8%)
 Frame = +3

Query  213  MGMFEDMANMGFCENLDFLSESPGCTEMAPEVETKA  320
            M +FE++   GF  NLD+L    G  + APE E +A
Sbjct  1    MVIFEEL---GFSGNLDYLLAPSGXGDAAPEHEQEA  33



>gb|KDO53812.1| hypothetical protein CISIN_1g009144mg [Citrus sinensis]
Length=381

 Score = 64.7 bits (156),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            ++K+K+  DSAK RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  66   QSKSKECVDSAKQRQSQEQARRKKMSRAQDGILKYMLKMM  105


 Score = 26.2 bits (56),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 22/38 (58%), Gaps = 5/38 (13%)
 Frame = +3

Query  213  MGMFEDMANMGFCENLDFLSESPGCTE--MAPEVETKA  320
            MG+FE+M   GFC NL+F S   G  E  +  E ET A
Sbjct  1    MGIFEEM---GFCGNLEFFSSPHGEGEAFLEHEQETAA  35



>emb|CDP19134.1| unnamed protein product [Coffea canephora]
Length=634

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +1

Query  433  NKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            NK KDG D AK RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  70   NKGKDGVDVAKQRQSQEQARRKKMSRAQDGILKYMLKMM  108



>gb|AHA93899.1| ethylene insensitive 3 [Coffea arabica]
Length=589

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +1

Query  433  NKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            NK KDG D AK RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  15   NKGKDGVDVAKQRQSQEQARRKKMSRAQDGILKYMLKMM  53



>gb|ADE41153.1| ethylene insensitive 3 class transcription factor [Malus domestica]
Length=659

 Score = 65.1 bits (157),  Expect(2) = 4e-10, Method: Composition-based stats.
 Identities = 31/40 (78%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            + K K+G D+A+ RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  66   QTKGKEGVDNARQRQSQEQARRKKMSRAQDGILKYMLKMM  105


 Score = 25.4 bits (54),  Expect(2) = 4e-10, Method: Composition-based stats.
 Identities = 15/36 (42%), Positives = 21/36 (58%), Gaps = 3/36 (8%)
 Frame = +3

Query  213  MGMFEDMANMGFCENLDFLSESPGCTEMAPEVETKA  320
            M +FE++   GF  NLD+L    G  + APE E +A
Sbjct  1    MVIFEEL---GFSGNLDYLLAPSGEGDAAPEHEQEA  33



>ref|XP_006297205.1| hypothetical protein CARUB_v10013213mg [Capsella rubella]
 gb|EOA30103.1| hypothetical protein CARUB_v10013213mg [Capsella rubella]
Length=627

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 32/40 (80%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            ++K+K+G D+AK RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  68   QDKSKEGVDAAKQRQSQEQARRKKMSRAQDGILKYMLKMM  107



>ref|XP_010509323.1| PREDICTED: protein ETHYLENE INSENSITIVE 3 isoform X4 [Camelina 
sativa]
Length=630

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 32/40 (80%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            ++K+K+G D+AK RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  69   QDKSKEGVDAAKQRQSQEQARRKKMSRAQDGILKYMLKMM  108



>ref|XP_010521603.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like isoform X2 [Tarenaya 
hassleriana]
Length=665

 Score = 67.8 bits (164),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            + KT +GAD+AK RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  91   QTKTPEGADAAKRRQSQEQARRKKMSRAQDGILKYMLKMM  130



>ref|XP_010521602.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like isoform X1 [Tarenaya 
hassleriana]
Length=692

 Score = 67.8 bits (164),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            + KT +GAD+AK RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  118  QTKTPEGADAAKRRQSQEQARRKKMSRAQDGILKYMLKMM  157



>ref|XP_011080514.1| PREDICTED: protein ETHYLENE INSENSITIVE 3 [Sesamum indicum]
 ref|XP_011080515.1| PREDICTED: protein ETHYLENE INSENSITIVE 3 [Sesamum indicum]
Length=616

 Score = 67.4 bits (163),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +1

Query  433  NKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            NK K+G D+AK RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  70   NKGKEGIDAAKQRQSQEQARRKKMSRAQDGILKYMLKMM  108



>gb|KHG04095.1| ethylene insensitive 3 -like protein [Gossypium arboreum]
Length=469

 Score = 67.0 bits (162),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            +NK+KDG D  K RQSQEQAR+KKMSRA DGILKYMLKMM
Sbjct  95   QNKSKDGVDIVKQRQSQEQARKKKMSRAQDGILKYMLKMM  134



>ref|XP_006406351.1| hypothetical protein EUTSA_v10020292mg [Eutrema salsugineum]
 gb|ESQ47804.1| hypothetical protein EUTSA_v10020292mg [Eutrema salsugineum]
Length=629

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            ++K+K+G D+AK RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  68   QDKSKEGVDAAKQRQSQEQARRKKMSRAQDGILKYMLKMM  107



>gb|KFK39393.1| protein ethylene insensitive 3-like [Arabis alpina]
Length=632

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            ++K+K+G D+AK RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  68   QDKSKEGVDAAKQRQSQEQARRKKMSRAQDGILKYMLKMM  107



>ref|XP_010509301.1| PREDICTED: protein ETHYLENE INSENSITIVE 3 isoform X1 [Camelina 
sativa]
 ref|XP_010509308.1| PREDICTED: protein ETHYLENE INSENSITIVE 3 isoform X2 [Camelina 
sativa]
 ref|XP_010509316.1| PREDICTED: protein ETHYLENE INSENSITIVE 3 isoform X3 [Camelina 
sativa]
Length=629

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            ++K+K+G D+AK RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  69   QDKSKEGVDAAKQRQSQEQARRKKMSRAQDGILKYMLKMM  108



>dbj|BAJ33948.1| unnamed protein product [Thellungiella halophila]
Length=629

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            ++K+K+G D+AK RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  68   QDKSKEGVDAAKQRQSQEQARRKKMSRAQDGILKYMLKMM  107



>ref|XP_010488063.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Camelina sativa]
Length=632

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            ++K+K+G D+AK RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  70   QDKSKEGVDAAKQRQSQEQARRKKMSRAQDGILKYMLKMM  109



>ref|XP_002885403.1| ethylene-insensitive3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61662.1| ethylene-insensitive3 [Arabidopsis lyrata subsp. lyrata]
Length=617

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            ++K+K+G D+AK RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  57   QDKSKEGVDAAKQRQSQEQARRKKMSRAQDGILKYMLKMM  96



>ref|XP_010943685.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Elaeis guineensis]
Length=636

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 35/41 (85%), Positives = 37/41 (90%), Gaps = 1/41 (2%)
 Frame = +1

Query  430  KNKTKD-GADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            +NK K+ GADSAK RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  93   QNKNKEQGADSAKQRQSQEQARRKKMSRAQDGILKYMLKMM  133



>ref|XP_010466283.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Camelina sativa]
Length=629

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            ++K+K+G D+AK RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  70   QDKSKEGVDAAKQRQSQEQARRKKMSRAQDGILKYMLKMM  109



>emb|CAC87091.1| ethylene-insensitive 3 protein [Phalaenopsis equestris]
Length=621

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 32/38 (84%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +1

Query  436  KTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            K +D +DS KHRQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  102  KNRDFSDSVKHRQSQEQARRKKMSRAQDGILKYMLKMM  139



>gb|AGI41323.1| EIN3-like protein [Malus domestica]
Length=659

 Score = 63.5 bits (153),  Expect(2) = 1e-09, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            + K K+G D+A+ RQSQEQARRKKMSRA DGILKYML+MM
Sbjct  66   QTKGKEGVDNARQRQSQEQARRKKMSRAQDGILKYMLEMM  105


 Score = 25.4 bits (54),  Expect(2) = 1e-09, Method: Composition-based stats.
 Identities = 15/36 (42%), Positives = 21/36 (58%), Gaps = 3/36 (8%)
 Frame = +3

Query  213  MGMFEDMANMGFCENLDFLSESPGCTEMAPEVETKA  320
            M +FE++   GF  NLD+L    G  + APE E +A
Sbjct  1    MVIFEEL---GFSGNLDYLLAPSGEGDAAPEHEQEA  33



>gb|KDP42895.1| hypothetical protein JCGZ_23837 [Jatropha curcas]
Length=197

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +1

Query  436  KTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            K+K+G D AK RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  68   KSKEGIDIAKQRQSQEQARRKKMSRAQDGILKYMLKMM  105



>ref|XP_010031647.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Eucalyptus grandis]
 ref|XP_010031648.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Eucalyptus grandis]
 ref|XP_010031649.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Eucalyptus grandis]
 gb|KCW51004.1| hypothetical protein EUGRSUZ_J00631 [Eucalyptus grandis]
Length=611

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            +NK K+G D AK RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  67   QNKGKEGVDIAKQRQSQEQARRKKMSRAQDGILKYMLKMM  106



>gb|KJB20248.1| hypothetical protein B456_003G140600 [Gossypium raimondii]
 gb|KJB20249.1| hypothetical protein B456_003G140600 [Gossypium raimondii]
 gb|KJB20250.1| hypothetical protein B456_003G140600 [Gossypium raimondii]
Length=615

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 32/40 (80%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            +NK+KDG D  K RQSQEQAR+KKMSRA DGILKYMLKMM
Sbjct  72   QNKSKDGVDIVKQRQSQEQARKKKMSRAQDGILKYMLKMM  111



>gb|AAV68141.1| ethylene insensitive 3-like 3 [Dianthus caryophyllus]
Length=591

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 32/40 (80%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            ++K K+G D AK RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  71   QSKVKEGVDVAKQRQSQEQARRKKMSRAQDGILKYMLKMM  110



>ref|XP_008809629.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Phoenix dactylifera]
 ref|XP_008809630.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Phoenix dactylifera]
Length=640

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 34/41 (83%), Positives = 37/41 (90%), Gaps = 1/41 (2%)
 Frame = +1

Query  430  KNKTKD-GADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            +NK K+ GADS+K RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  96   QNKNKEQGADSSKQRQSQEQARRKKMSRAQDGILKYMLKMM  136



>ref|XP_007016682.1| Ethylene insensitive 3 family protein [Theobroma cacao]
 gb|EOY34301.1| Ethylene insensitive 3 family protein [Theobroma cacao]
Length=615

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 33/40 (83%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            +NK K+G D AK RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  67   QNKGKEGIDIAKQRQSQEQARRKKMSRAQDGILKYMLKMM  106



>ref|XP_008790465.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Phoenix dactylifera]
Length=651

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            KNK +  ADSA+ RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  98   KNKEQGAADSARQRQSQEQARRKKMSRAQDGILKYMLKMM  137



>gb|KHN26027.1| Protein ETHYLENE INSENSITIVE 3 [Glycine soja]
Length=614

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            + K+K+G D+AK RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  67   QTKSKEGTDAAKQRQSQEQARRKKMSRAQDGILKYMLKMM  106



>emb|CDY06379.1| BnaC05g31510D [Brassica napus]
Length=487

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            K+ +K+G D+AK RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  87   KSGSKEGVDAAKQRQSQEQARRKKMSRAQDGILKYMLKMM  126



>ref|XP_003545483.1| PREDICTED: protein ETHYLENE INSENSITIVE 3 [Glycine max]
Length=610

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            + K+K+G D+AK RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  67   QTKSKEGTDAAKQRQSQEQARRKKMSRAQDGILKYMLKMM  106



>ref|XP_010510821.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Camelina sativa]
 ref|XP_010510822.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Camelina sativa]
Length=580

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            ++K KDG D +K RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  69   QSKCKDGVDGSKQRQSQEQARRKKMSRAQDGILKYMLKMM  108



>ref|XP_009145590.1| PREDICTED: protein ETHYLENE INSENSITIVE 3 isoform X1 [Brassica 
rapa]
Length=614

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 32/40 (80%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            K+ +K+G D+AK RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  71   KSGSKEGVDAAKQRQSQEQARRKKMSRAQDGILKYMLKMM  110



>ref|XP_004491182.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like isoform X1 [Cicer 
arietinum]
 ref|XP_004491183.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like isoform X2 [Cicer 
arietinum]
Length=611

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 32/40 (80%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            + K K+G D+AK RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  67   QTKAKEGIDAAKARQSQEQARRKKMSRAQDGILKYMLKMM  106



>emb|CDY19606.1| BnaA05g20140D [Brassica napus]
Length=460

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            K+ +K+G D+AK RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  71   KSGSKEGVDAAKQRQSQEQARRKKMSRAQDGILKYMLKMM  110



>ref|XP_006361129.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006361130.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like isoform X2 [Solanum 
tuberosum]
Length=616

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +1

Query  433  NKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            +K+K+G D AK RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  73   SKSKEGVDPAKQRQSQEQARRKKMSRAQDGILKYMLKMM  111



>ref|NP_001234541.1| EIL1 protein [Solanum lycopersicum]
 gb|AAK58857.1|AF328784_1 EIL1 [Solanum lycopersicum]
Length=610

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +1

Query  433  NKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            +K+K+G D AK RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  71   SKSKEGVDPAKQRQSQEQARRKKMSRAQDGILKYMLKMM  109



>ref|NP_188713.1| protein ethylene insensitive 3 [Arabidopsis thaliana]
 sp|O24606.1|EIN3_ARATH RecName: Full=Protein ETHYLENE INSENSITIVE 3 [Arabidopsis thaliana]
 gb|AAC49749.1| ethylene-insensitive3 [Arabidopsis thaliana]
 gb|AAC49750.1| ethylene-insensitive3 [Arabidopsis thaliana]
 dbj|BAB02485.1| ethylene-insensitive3 [Arabidopsis thaliana]
 gb|AAL47431.2| AT3g20770/MOE17_6 [Arabidopsis thaliana]
 gb|AEE76421.1| protein ethylene insensitive 3 [Arabidopsis thaliana]
Length=628

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            ++K K+G D+AK RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  68   QDKGKEGVDAAKQRQSQEQARRKKMSRAQDGILKYMLKMM  107



>ref|XP_009145591.1| PREDICTED: protein ETHYLENE INSENSITIVE 3 isoform X2 [Brassica 
rapa]
Length=613

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            K+ +K+G D+AK RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  71   KSGSKEGVDAAKQRQSQEQARRKKMSRAQDGILKYMLKMM  110



>ref|XP_010521598.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Tarenaya hassleriana]
 ref|XP_010521599.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Tarenaya hassleriana]
 ref|XP_010521601.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Tarenaya hassleriana]
Length=608

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 32/40 (80%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            ++K+K+G DSAK RQS+EQARRKKMSRA DGILKYMLKMM
Sbjct  60   QSKSKEGVDSAKLRQSREQARRKKMSRAQDGILKYMLKMM  99



>gb|AAL76272.1|AF467784_1 transcription factor EIL1 [Vigna radiata]
Length=609

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 31/40 (78%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            + K K+G D+ K RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  68   QQKAKEGTDAVKQRQSQEQARRKKMSRAQDGILKYMLKMM  107



>ref|XP_010544311.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Tarenaya hassleriana]
 ref|XP_010544312.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Tarenaya hassleriana]
Length=632

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 32/40 (80%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            ++K+K+G DSAK RQSQE ARRKKMSRA DGILKYMLKMM
Sbjct  69   QSKSKEGVDSAKQRQSQELARRKKMSRAQDGILKYMLKMM  108



>ref|XP_007146084.1| hypothetical protein PHAVU_006G011300g [Phaseolus vulgaris]
 gb|ESW18078.1| hypothetical protein PHAVU_006G011300g [Phaseolus vulgaris]
Length=624

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 31/40 (78%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            ++K+K+G D+ K RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  69   QSKSKEGIDAVKQRQSQEQARRKKMSRAQDGILKYMLKMM  108



>ref|XP_003638449.1| Ethylene insensitive 3-like protein [Medicago truncatula]
Length=654

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +1

Query  436  KTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            K K+G+D+AK RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  73   KPKEGSDAAKQRQSQEQARRKKMSRAQDGILKYMLKMM  110



>gb|ACX54782.1| ethylene insensitive-like protein 1 [Medicago truncatula]
 gb|KEH35106.1| ethylene insensitive transcription factor [Medicago truncatula]
Length=629

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +1

Query  436  KTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            K K+G+D+AK RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  73   KPKEGSDAAKQRQSQEQARRKKMSRAQDGILKYMLKMM  110



>gb|AFI61908.1| ethylene insensitive 3-like 2 protein [Paeonia suffruticosa]
Length=607

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            + K+K+G DS K RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  67   QGKSKEGVDSTKQRQSQEQARRKKMSRAQDGILKYMLKMM  106



>ref|XP_003543154.1| PREDICTED: protein ETHYLENE INSENSITIVE 3 [Glycine max]
 gb|KHN33830.1| Protein ETHYLENE INSENSITIVE 3 [Glycine soja]
Length=618

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 31/40 (78%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            ++K+K+G D+ K RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  68   QSKSKEGIDAVKQRQSQEQARRKKMSRAQDGILKYMLKMM  107



>ref|NP_001275851.1| ethylene-insensitive 3-like 1 protein [Citrus sinensis]
 gb|ADI40102.1| ethylene-insensitive 3-like 1 protein [Citrus sinensis]
Length=614

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            ++K+K+  DSAK RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  66   QSKSKECVDSAKQRQSQEQARRKKMSRAQDGILKYMLKMM  105



>ref|XP_010557480.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Tarenaya hassleriana]
Length=609

 Score = 64.7 bits (156),  Expect(2) = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            ++K K+G D AK RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  68   QSKGKEGVDPAKQRQSQEQARRKKMSRAQDGILKYMLKMM  107


 Score = 22.3 bits (46),  Expect(2) = 4e-09, Method: Composition-based stats.
 Identities = 13/39 (33%), Positives = 19/39 (49%), Gaps = 3/39 (8%)
 Frame = +3

Query  213  MGMFEDMANMGFCENLDFLSESPGCTEMAPEVETKAPGV  329
            M MF +M   G C  +DF S S G  ++ P  + +   V
Sbjct  1    MMMFNEM---GMCGGMDFSSASFGEMDICPPPQAEPESV  36



>gb|AID55343.1| EIN3-like protein EIL1 [Actinidia chinensis]
Length=620

 Score = 62.8 bits (151),  Expect(2) = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +1

Query  436  KTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            K K+  D+AK RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  69   KGKECVDTAKQRQSQEQARRKKMSRAQDGILKYMLKMM  106


 Score = 24.3 bits (51),  Expect(2) = 4e-09, Method: Composition-based stats.
 Identities = 12/28 (43%), Positives = 18/28 (64%), Gaps = 1/28 (4%)
 Frame = +3

Query  240  MGFCENLDFLSESPGCTEM-APEVETKA  320
            MGFC ++DF S   G  ++ AP+ E +A
Sbjct  7    MGFCGDVDFFSAPLGEGDVTAPQTEQEA  34



>ref|XP_009801714.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Nicotiana sylvestris]
 gb|AAP03998.1| EIL2 [Nicotiana tabacum]
Length=616

 Score = 62.8 bits (151),  Expect(2) = 4e-09, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +1

Query  442  KDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            K+G D+ K RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  74   KEGVDAVKQRQSQEQARRKKMSRAQDGILKYMLKMM  109


 Score = 24.3 bits (51),  Expect(2) = 4e-09, Method: Composition-based stats.
 Identities = 19/44 (43%), Positives = 22/44 (50%), Gaps = 13/44 (30%)
 Frame = +3

Query  213  MGMFEDMANMGFCENLDFLSESPGCTEMAP--EVETKAPGVGVE  338
            M MFE+M   GFC +LDF          AP  EVET A  +  E
Sbjct  1    MMMFEEM---GFCGDLDFFP--------APLKEVETAASQIEQE  33



>ref|XP_011043514.1| PREDICTED: protein ETHYLENE INSENSITIVE 3 [Populus euphratica]
Length=632

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 32/40 (80%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            + K+K+G D AK RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  68   QTKSKEGIDIAKQRQSQEQARRKKMSRAQDGILKYMLKMM  107



>ref|XP_011006497.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Populus euphratica]
 ref|XP_011006504.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Populus euphratica]
Length=617

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            + K+K+G D AK RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  68   QTKSKEGIDIAKQRQSQEQARRKKMSRAQDGILKYMLKMM  107



>gb|KDO53810.1| hypothetical protein CISIN_1g009144mg [Citrus sinensis]
 gb|KDO53811.1| hypothetical protein CISIN_1g009144mg [Citrus sinensis]
Length=542

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            ++K+K+  DSAK RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  66   QSKSKECVDSAKQRQSQEQARRKKMSRAQDGILKYMLKMM  105



>gb|ACD87815.1| putative ethylene insensitive transcription factor [Vicia faba]
Length=638

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            + K K+G D+AK RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  67   QTKAKEGIDAAKARQSQEQARRKKMSRAQDGILKYMLKMM  106



>gb|KHN38437.1| Protein ETHYLENE INSENSITIVE 3 [Glycine soja]
Length=469

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            + K+K+G D+ K RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  67   QTKSKEGTDATKQRQSQEQARRKKMSRAQDGILKYMLKMM  106



>dbj|BAA74714.1| transcription factor TEIL [Nicotiana tabacum]
Length=615

 Score = 62.8 bits (151),  Expect(2) = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +1

Query  442  KDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            K+G D+ K RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  74   KEGVDAVKQRQSQEQARRKKMSRAQDGILKYMLKMM  109


 Score = 23.9 bits (50),  Expect(2) = 5e-09, Method: Composition-based stats.
 Identities = 19/44 (43%), Positives = 22/44 (50%), Gaps = 13/44 (30%)
 Frame = +3

Query  213  MGMFEDMANMGFCENLDFLSESPGCTEMAP--EVETKAPGVGVE  338
            M MFE+M   GFC +LDF          AP  EVET A  +  E
Sbjct  1    MMMFEEM---GFCGDLDFFP--------APLKEVETAASQIEQE  33



>gb|AID55344.1| EIN3-like protein EIL2 [Actinidia chinensis]
Length=618

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +1

Query  433  NKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            NK K+  D+AK RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  68   NKGKECVDAAKQRQSQEQARRKKMSRAQDGILKYMLKMM  106



>gb|ACJ85584.1| unknown [Medicago truncatula]
 gb|AFK35026.1| unknown [Medicago truncatula]
Length=615

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            + K K+G D+AK RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  68   QTKAKEGIDAAKARQSQEQARRKKMSRAQDGILKYMLKMM  107



>ref|XP_003617086.1| Ethylene insensitive 3-like protein [Medicago truncatula]
 gb|AET00045.1| ethylene insensitive transcription factor [Medicago truncatula]
Length=615

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            + K K+G D+AK RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  68   QTKAKEGIDAAKARQSQEQARRKKMSRAQDGILKYMLKMM  107



>ref|XP_002312841.2| EIN3-like family protein [Populus trichocarpa]
 gb|EEE86796.2| EIN3-like family protein [Populus trichocarpa]
Length=625

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 32/40 (80%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            + K+K+G D AK RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  61   QTKSKEGIDIAKQRQSQEQARRKKMSRAQDGILKYMLKMM  100



>gb|AHB18380.1| ethylene insensitive 3 [Momordica charantia]
Length=629

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 32/40 (80%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            ++K K+G D AK RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  68   QSKGKEGIDIAKQRQSQEQARRKKMSRAQDGILKYMLKMM  107



>ref|XP_006408669.1| hypothetical protein EUTSA_v10001938mg [Eutrema salsugineum]
 dbj|BAJ33951.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ50122.1| hypothetical protein EUTSA_v10001938mg [Eutrema salsugineum]
Length=581

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            + K K+G D++K RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  71   QGKCKEGVDASKQRQSQEQARRKKMSRAQDGILKYMLKMM  110



>gb|KHG00335.1| ethylene insensitive 3 -like protein [Gossypium arboreum]
Length=397

 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            +NK K+G D AK R SQEQARRKKMSRA DGILKYMLKMM
Sbjct  14   QNKCKEGIDIAKQRLSQEQARRKKMSRAQDGILKYMLKMM  53



>ref|XP_003519487.1| PREDICTED: protein ETHYLENE INSENSITIVE 3 [Glycine max]
Length=614

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            + K+K+G D+ K RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  67   QTKSKEGTDATKQRQSQEQARRKKMSRAQDGILKYMLKMM  106



>gb|KJB56070.1| hypothetical protein B456_009G105400 [Gossypium raimondii]
Length=612

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 32/40 (80%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            ++K K+G D AK RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  66   QHKGKEGIDIAKQRQSQEQARRKKMSRAQDGILKYMLKMM  105



>ref|XP_007146083.1| hypothetical protein PHAVU_006G011200g [Phaseolus vulgaris]
 gb|ESW18077.1| hypothetical protein PHAVU_006G011200g [Phaseolus vulgaris]
Length=619

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            ++K+K+G D+ K RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  68   QSKSKEGIDAVKQRQSQEQARRKKMSRAQDGILKYMLKMM  107



>ref|XP_009414231.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Musa acuminata 
subsp. malaccensis]
Length=635

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            +NK K+  DSAK RQSQEQARRK MSRA DGILKYMLKMM
Sbjct  92   QNKNKEQVDSAKQRQSQEQARRKTMSRAQDGILKYMLKMM  131



>ref|XP_002879041.1| hypothetical protein ARALYDRAFT_481586 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55300.1| hypothetical protein ARALYDRAFT_481586 [Arabidopsis lyrata subsp. 
lyrata]
Length=579

 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            ++K K+G D +K RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  69   QSKCKEGVDGSKQRQSQEQARRKKMSRAQDGILKYMLKMM  108



>gb|AAL76271.1|AF467783_1 transcription factor EIL2 [Vigna radiata]
Length=622

 Score = 64.7 bits (156),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            ++K+K+G D+ K RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  69   QSKSKEGIDAVKQRQSQEQARRKKMSRAQDGILKYMLKMM  108



>ref|NP_180273.1| ethylene insensitive 3-like 1 protein [Arabidopsis thaliana]
 sp|Q9SLH0.1|EIL1_ARATH RecName: Full=ETHYLENE INSENSITIVE 3-like 1 protein [Arabidopsis 
thaliana]
 gb|AAC77863.1| ethylene-insensitive3-like1 (EIL1) [Arabidopsis thaliana]
 gb|AAL38367.1| ethylene-insensitive3-like1 (EIL1) [Arabidopsis thaliana]
 gb|AAO29962.1| ethylene-insensitive3-like1 (EIL1) [Arabidopsis thaliana]
 gb|AEC07930.1| ethylene insensitive 3-like 1 protein [Arabidopsis thaliana]
Length=584

 Score = 64.3 bits (155),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            ++K K+G D +K RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  69   QSKCKEGVDGSKQRQSQEQARRKKMSRAQDGILKYMLKMM  108



>gb|ABY28269.1| EIN3-like protein EIL1 [Actinidia deliciosa]
Length=570

 Score = 64.3 bits (155),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +1

Query  433  NKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            NK K+  D+AK RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  18   NKGKECIDAAKQRQSQEQARRKKMSRAQDGILKYMLKMM  56



>ref|NP_001233931.1| EIN3-like protein [Solanum lycopersicum]
 dbj|BAC99307.1| EIN3-like protein [Solanum lycopersicum]
Length=605

 Score = 60.5 bits (145),  Expect(2) = 8e-09, Method: Composition-based stats.
 Identities = 30/39 (77%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +1

Query  433  NKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            N+  +  DS K RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  68   NQGMEDVDSVKRRQSQEQARRKKMSRAQDGILKYMLKMM  106


 Score = 25.8 bits (55),  Expect(2) = 8e-09, Method: Composition-based stats.
 Identities = 19/44 (43%), Positives = 21/44 (48%), Gaps = 13/44 (30%)
 Frame = +3

Query  213  MGMFEDMANMGFCENLDFLSESPGCTEMAP--EVETKAPGVGVE  338
            M MFE+M   GFC +LDF          AP  EVE  AP    E
Sbjct  1    MMMFEEM---GFCGDLDFFP--------APLKEVEVAAPQTEAE  33



>gb|AEK84143.1| ethylene insensitive 3-like protein [Oncidium hybrid cultivar]
Length=645

 Score = 64.3 bits (155),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            +NK K+  DS K RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  102  QNKNKELGDSTKQRQSQEQARRKKMSRAQDGILKYMLKMM  141



>gb|KJB26156.1| hypothetical protein B456_004G227800 [Gossypium raimondii]
 gb|KJB26157.1| hypothetical protein B456_004G227800 [Gossypium raimondii]
Length=614

 Score = 63.9 bits (154),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            +NK K+G D AK R SQEQARRKKMSRA DGILKYMLKMM
Sbjct  67   QNKCKEGIDIAKQRLSQEQARRKKMSRAQDGILKYMLKMM  106



>gb|AGV54673.1| ethylene insensitive protein 3 [Phaseolus vulgaris]
Length=609

 Score = 63.9 bits (154),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 30/38 (79%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +1

Query  436  KTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            K K+G D+ + RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  69   KAKEGTDAVRQRQSQEQARRKKMSRAQDGILKYMLKMM  106



>ref|XP_006364491.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Solanum tuberosum]
Length=614

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +1

Query  433  NKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            +K K+G D+ K RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  70   SKGKEGVDAVKQRQSQEQARRKKMSRAQDGILKYMLKMM  108



>ref|NP_001234721.1| EIL2 protein [Solanum lycopersicum]
 gb|AAK58858.1|AF328785_1 EIL2 [Solanum lycopersicum]
Length=614

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +1

Query  433  NKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            +K K+G D+ K RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  70   SKGKEGVDAVKQRQSQEQARRKKMSRAQDGILKYMLKMM  108



>dbj|BAF44108.1| ethylene signal transcription factor [Musa acuminata AAA Group]
Length=637

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 31/40 (78%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            +NK K+  D+AK  QSQEQARRKKMSRA DGILKYMLKMM
Sbjct  93   QNKNKEQGDAAKQWQSQEQARRKKMSRAQDGILKYMLKMM  132



>ref|XP_009420955.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Musa acuminata 
subsp. malaccensis]
Length=637

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 31/40 (78%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            +NK K+  D+AK  QSQEQARRKKMSRA DGILKYMLKMM
Sbjct  93   QNKNKEQGDAAKQWQSQEQARRKKMSRAQDGILKYMLKMM  132



>ref|XP_006384758.1| EIN3-like family protein [Populus trichocarpa]
 gb|ERP62555.1| EIN3-like family protein [Populus trichocarpa]
Length=617

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            + ++K+G D AK RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  68   QTRSKEGIDIAKQRQSQEQARRKKMSRAQDGILKYMLKMM  107



>ref|XP_007141570.1| hypothetical protein PHAVU_008G207000g [Phaseolus vulgaris]
 gb|ESW13564.1| hypothetical protein PHAVU_008G207000g [Phaseolus vulgaris]
Length=611

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 30/38 (79%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +1

Query  436  KTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            K K+G D+ + RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  69   KAKEGTDAVRQRQSQEQARRKKMSRAQDGILKYMLKMM  106



>ref|XP_003555660.1| PREDICTED: protein ETHYLENE INSENSITIVE 3 [Glycine max]
 gb|KHN46383.1| Protein ETHYLENE INSENSITIVE 3 [Glycine soja]
Length=624

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            ++K K+G D+ K RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  67   QSKPKEGIDAVKQRQSQEQARRKKMSRAQDGILKYMLKMM  106



>ref|XP_010544313.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Tarenaya hassleriana]
Length=615

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            ++K+++G DSAK R SQEQARRKKMSRA DGILKYMLKMM
Sbjct  71   QSKSREGVDSAKQRLSQEQARRKKMSRAQDGILKYMLKMM  110



>ref|XP_003543159.1| PREDICTED: protein ETHYLENE INSENSITIVE 3 [Glycine max]
Length=621

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            ++K K+G D+ K RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  68   QSKPKEGFDAVKQRQSQEQARRKKMSRAQDGILKYMLKMM  107



>gb|KHN33829.1| Protein ETHYLENE INSENSITIVE 3 [Glycine soja]
Length=621

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            ++K K+G D+ K RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  68   QSKPKEGFDAVKQRQSQEQARRKKMSRAQDGILKYMLKMM  107



>gb|AAF69017.1|AF261654_1 ethylene-insensitive 3-like protein 1 [Dianthus caryophyllus]
Length=662

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            K++ ++G D+ K RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  69   KDRCREGIDNVKKRQSQEQARRKKMSRAQDGILKYMLKMM  108



>gb|AEK84144.1| ethylene insensitive 3-like protein [Oncidium hybrid cultivar]
Length=597

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +1

Query  436  KTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            K +D  DS +HRQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  91   KNRDHGDSLEHRQSQEQARRKKMSRAQDGILKYMLKMM  128



>ref|XP_006361131.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Solanum tuberosum]
Length=605

 Score = 60.5 bits (145),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +1

Query  433  NKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            N+  +  DS K RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  68   NQGMEDVDSVKRRQSQEQARRKKMSRAQDGILKYMLKMM  106


 Score = 24.6 bits (52),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 15/36 (42%), Positives = 20/36 (56%), Gaps = 4/36 (11%)
 Frame = +3

Query  213  MGMFEDMANMGFCENLDFLSESPGCTEM-APEVETK  317
            M MFE+M   GFC +LDF        E+ AP+ E +
Sbjct  1    MMMFEEM---GFCGDLDFFPAPLKDVEVAAPQTEAE  33



>gb|AGV54306.1| transcription factor EIL1 [Phaseolus vulgaris]
Length=610

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 30/38 (79%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +1

Query  436  KTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            K K+G D+ + RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  69   KAKEGTDAVRQRQSQEQARRKKMSRAQDGILKYMLKMM  106



>ref|XP_009798827.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Nicotiana sylvestris]
 ref|XP_009798828.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Nicotiana sylvestris]
Length=615

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +1

Query  433  NKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            N+ K+  DSAK RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  70   NQGKEDIDSAKRRQSQEQARRKKMSRAQDGILKYMLKMM  108



>gb|ABG89103.1| ethylene insensitive-like protein 4 [Musa acuminata]
Length=635

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            +NK K+  D+AK  QSQEQARRKKMSRA DGILKYMLKMM
Sbjct  95   QNKNKEQGDTAKQHQSQEQARRKKMSRAQDGILKYMLKMM  134



>gb|AAC49746.1| ethylene-insensitive3-like1 [Arabidopsis thaliana]
Length=584

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            ++K K G D +K RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  69   QSKCKGGVDGSKQRQSQEQARRKKMSRAQDGILKYMLKMM  108



>ref|XP_009404687.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Musa acuminata 
subsp. malaccensis]
Length=635

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            +NK K+  D+AK  QSQEQARRKKMSRA DGILKYMLKMM
Sbjct  95   QNKNKEQGDTAKQHQSQEQARRKKMSRAQDGILKYMLKMM  134



>ref|XP_002275284.2| PREDICTED: protein ETHYLENE INSENSITIVE 3 [Vitis vinifera]
 ref|XP_010651613.1| PREDICTED: protein ETHYLENE INSENSITIVE 3 [Vitis vinifera]
Length=610

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +1

Query  442  KDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            ++GAD+ K RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  71   QNGADTVKQRQSQEQARRKKMSRAQDGILKYMLKMM  106



>dbj|BAF44109.1| ethylene signal transcription factor [Musa acuminata AAA Group]
Length=592

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            +NK K+  D+AK  QSQEQARRKKMSRA DGILKYMLKMM
Sbjct  95   QNKNKEQGDTAKQHQSQEQARRKKMSRAQDGILKYMLKMM  134



>gb|AFU90136.4| ethylene-insensitive 3 [Paeonia lactiflora]
Length=653

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +1

Query  442  KDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            K+G D  K RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  75   KEGVDIVKQRQSQEQARRKKMSRAQDGILKYMLKMM  110



>gb|AFI61909.1| ethylene insensitive 3-like 3 protein [Paeonia suffruticosa]
Length=652

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +1

Query  442  KDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            K+G D  K RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  76   KEGVDIVKQRQSQEQARRKKMSRAQDGILKYMLKMM  111



>ref|XP_010067064.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Eucalyptus 
grandis]
 ref|XP_010067065.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Eucalyptus 
grandis]
 ref|XP_010067066.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Eucalyptus 
grandis]
 gb|KCW65129.1| hypothetical protein EUGRSUZ_G02632 [Eucalyptus grandis]
Length=617

 Score = 61.2 bits (147),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            ++K K+  D AK RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  66   QSKNKEVLDGAKQRQSQEQARRKKMSRAQDGILKYMLKMM  105


 Score = 23.5 bits (49),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 15/36 (42%), Positives = 21/36 (58%), Gaps = 5/36 (14%)
 Frame = +3

Query  213  MGMFEDMANMGFCENLDFLSESPGCTEMAPEVETKA  320
            MG+ E+M   GF  ++DF S +P   E   E ET+A
Sbjct  1    MGILEEM---GFGSSIDFSSANP--QEADAEQETEA  31



>ref|XP_009355062.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Pyrus x bretschneideri]
Length=614

 Score = 61.2 bits (147),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            +NK  +GAD+A+  Q QEQARRK+MSRA DGILKYMLKMM
Sbjct  66   QNKGTEGADNARQCQPQEQARRKRMSRAQDGILKYMLKMM  105


 Score = 23.5 bits (49),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 14/36 (39%), Positives = 20/36 (56%), Gaps = 3/36 (8%)
 Frame = +3

Query  213  MGMFEDMANMGFCENLDFLSESPGCTEMAPEVETKA  320
            M + E++    F E+LDFL   P   E APE + +A
Sbjct  1    MAIIEELE---FIEDLDFLLALPEEGEAAPEHDPEA  33



>gb|AAY45885.1| EIN3-like protein [Cucurbita moschata]
Length=241

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            ++K K+G D AK RQSQ+QARRKKMSRA DGILKYMLK+M
Sbjct  18   QSKVKEGIDIAKQRQSQDQARRKKMSRAHDGILKYMLKIM  57



>ref|XP_009587969.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Nicotiana tomentosiformis]
 gb|AAP03997.1| EIL1 [Nicotiana tabacum]
Length=618

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +1

Query  442  KDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            K+G D+ K RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  76   KEGVDAVKQRQSQEQARRKKMSRAQDGILKYMLKMM  111



>gb|ACP56697.1| EIN3-like protein [Lithospermum erythrorhizon]
Length=635

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 31/39 (79%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +1

Query  433  NKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            +K K+  D+AK RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  71   SKGKECVDAAKQRQSQEQARRKKMSRAQDGILKYMLKMM  109



>gb|KDO66381.1| hypothetical protein CISIN_1g0070172mg [Citrus sinensis]
Length=465

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            +++ K+G D AK RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  68   QSRGKEGIDMAKQRQSQEQARRKKMSRAQDGILKYMLKMM  107



>ref|XP_007220648.1| hypothetical protein PRUPE_ppa003493mg [Prunus persica]
 gb|EMJ21847.1| hypothetical protein PRUPE_ppa003493mg [Prunus persica]
Length=570

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 29/35 (83%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +1

Query  445  DGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            +G D+A+ RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  40   EGVDNARQRQSQEQARRKKMSRAQDGILKYMLKMM  74



>ref|XP_006446380.1| hypothetical protein CICLE_v10014617mg [Citrus clementina]
 ref|XP_006446381.1| hypothetical protein CICLE_v10014617mg [Citrus clementina]
 gb|ESR59620.1| hypothetical protein CICLE_v10014617mg [Citrus clementina]
 gb|ESR59621.1| hypothetical protein CICLE_v10014617mg [Citrus clementina]
Length=596

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            +++ K+G D AK RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  43   QSRGKEGIDMAKQRQSQEQARRKKMSRAQDGILKYMLKMM  82



>ref|XP_006446382.1| hypothetical protein CICLE_v10014617mg [Citrus clementina]
 ref|XP_006446383.1| hypothetical protein CICLE_v10014617mg [Citrus clementina]
 gb|ESR59622.1| hypothetical protein CICLE_v10014617mg [Citrus clementina]
 gb|ESR59623.1| hypothetical protein CICLE_v10014617mg [Citrus clementina]
Length=621

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            +++ K+G D AK RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  68   QSRGKEGIDMAKQRQSQEQARRKKMSRAQDGILKYMLKMM  107



>ref|XP_006470438.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like isoform X1 [Citrus 
sinensis]
 ref|XP_006470439.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like isoform X2 [Citrus 
sinensis]
Length=621

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            +++ K+G D AK RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  68   QSRGKEGIDMAKQRQSQEQARRKKMSRAQDGILKYMLKMM  107



>gb|KDO66378.1| hypothetical protein CISIN_1g0070172mg [Citrus sinensis]
 gb|KDO66379.1| hypothetical protein CISIN_1g0070172mg [Citrus sinensis]
 gb|KDO66380.1| hypothetical protein CISIN_1g0070172mg [Citrus sinensis]
Length=621

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            +++ K+G D AK RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  68   QSRGKEGIDMAKQRQSQEQARRKKMSRAQDGILKYMLKMM  107



>ref|XP_006293460.1| hypothetical protein CARUB_v10022879mg [Capsella rubella]
 gb|EOA26358.1| hypothetical protein CARUB_v10022879mg [Capsella rubella]
Length=587

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 30/37 (81%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +1

Query  439  TKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            +K+G D +K RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  73   SKEGVDGSKQRQSQEQARRKKMSRAQDGILKYMLKMM  109



>gb|KDO66375.1| hypothetical protein CISIN_1g0070172mg [Citrus sinensis]
 gb|KDO66376.1| hypothetical protein CISIN_1g0070172mg [Citrus sinensis]
 gb|KDO66377.1| hypothetical protein CISIN_1g0070172mg [Citrus sinensis]
Length=582

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            +++ K+G D AK RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  68   QSRGKEGIDMAKQRQSQEQARRKKMSRAQDGILKYMLKMM  107



>gb|AHC70432.1| ethylene insensitive 3-like protein [Cucurbita pepo subsp. pepo]
Length=599

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            ++K K+G D AK RQSQ+QARRKKMSRA DGILKYMLK+M
Sbjct  67   QSKVKEGVDIAKQRQSQDQARRKKMSRAHDGILKYMLKIM  106



>ref|XP_010943654.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Elaeis guineensis]
Length=649

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 32/41 (78%), Positives = 35/41 (85%), Gaps = 1/41 (2%)
 Frame = +1

Query  430  KNKTKD-GADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            +NK K+ G D +K RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  96   QNKNKEQGGDLSKQRQSQEQARRKKMSRAQDGILKYMLKMM  136



>gb|ACJ70675.1| EIN3-like protein EIL2 [Actinidia deliciosa]
Length=618

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +1

Query  433  NKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            NK K+   +AK RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  68   NKGKECVAAAKQRQSQEQARRKKMSRAQDGILKYMLKMM  106



>gb|KJB10127.1| hypothetical protein B456_001G192700 [Gossypium raimondii]
Length=120

 Score = 58.2 bits (139),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 33/40 (83%), Gaps = 1/40 (3%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            +NK K+G D AK R SQEQARRK MSRA DGILKYMLKMM
Sbjct  67   QNKCKEGIDIAKQRLSQEQARRK-MSRAQDGILKYMLKMM  105



>ref|XP_004501972.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like isoform X1 [Cicer 
arietinum]
 ref|XP_004501973.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like isoform X2 [Cicer 
arietinum]
Length=624

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +1

Query  436  KTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            K K+  D+AK RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  70   KPKEEFDAAKQRQSQEQARRKKMSRAQDGILKYMLKMM  107



>ref|XP_010417850.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein isoform X2 [Camelina 
sativa]
Length=575

 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +1

Query  442  KDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            ++G D +K RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  74   EEGVDGSKQRQSQEQARRKKMSRAQDGILKYMLKMM  109



>gb|AAX84043.1| EIN3-like protein [Cucumis sativus]
Length=241

 Score = 59.7 bits (143),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            ++K K+G D  K RQSQ+QARRKKMSRA DGILKYMLK+M
Sbjct  18   QSKVKEGIDIVKQRQSQDQARRKKMSRAHDGILKYMLKIM  57



>gb|AAY45886.1| EIN3-like protein [Citrullus lanatus]
Length=241

 Score = 59.7 bits (143),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            ++K K+G D  K RQSQ+QARRKKMSRA DGILKYMLK+M
Sbjct  18   QSKVKEGIDIVKQRQSQDQARRKKMSRAHDGILKYMLKIM  57



>gb|AAY45884.1| EIN3-like protein [Cucurbita maxima]
Length=241

 Score = 59.7 bits (143),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            ++K K+G D  K RQSQ+QARRKKMSRA DGILKYMLK+M
Sbjct  18   QSKVKEGIDIVKQRQSQDQARRKKMSRAHDGILKYMLKIM  57



>ref|XP_010473094.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Camelina sativa]
Length=578

 Score = 61.2 bits (147),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +1

Query  442  KDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            ++G D +K RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  75   EEGVDGSKQRQSQEQARRKKMSRAQDGILKYMLKMM  110



>gb|EYU35998.1| hypothetical protein MIMGU_mgv1a003505mg [Erythranthe guttata]
Length=581

 Score = 61.2 bits (147),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 30/39 (77%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +1

Query  433  NKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            N   +  DS K RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  81   NSNANTDDSTKQRQSQEQARRKKMSRAQDGILKYMLKMM  119



>gb|EPS63662.1| hypothetical protein M569_11122 [Genlisea aurea]
Length=563

 Score = 61.2 bits (147),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 36/42 (86%), Gaps = 3/42 (7%)
 Frame = +1

Query  433  NKTKDG---ADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            +++KDG    D+AK RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  85   SRSKDGGAVVDTAKQRQSQEQARRKKMSRAQDGILKYMLKMM  126



>ref|XP_010417849.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein isoform X1 [Camelina 
sativa]
Length=590

 Score = 61.2 bits (147),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +1

Query  442  KDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            ++G D +K RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  89   EEGVDGSKQRQSQEQARRKKMSRAQDGILKYMLKMM  124



>emb|CDY60391.1| BnaA01g36840D [Brassica napus]
Length=425

 Score = 60.8 bits (146),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +1

Query  454  DSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            DSAK RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  80   DSAKQRQSQEQARRKKMSRAQDGILKYMLKMM  111



>ref|XP_006829848.1| hypothetical protein AMTR_s00119p00117410 [Amborella trichopoda]
 gb|ERM97264.1| hypothetical protein AMTR_s00119p00117410 [Amborella trichopoda]
Length=637

 Score = 61.2 bits (147),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            K K   G D AK RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  70   KGKEAMGGDLAKQRQSQEQARRKKMSRAQDGILKYMLKMM  109



>ref|XP_011090234.1| PREDICTED: LOW QUALITY PROTEIN: protein ETHYLENE INSENSITIVE 
3 [Sesamum indicum]
Length=598

 Score = 61.2 bits (147),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 34/40 (85%), Gaps = 1/40 (3%)
 Frame = +1

Query  433  NKTKDGA-DSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            NK K G  D+AK RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  70   NKGKVGVTDAAKQRQSQEQARRKKMSRAQDGILKYMLKMM  109



>emb|CDY38540.1| BnaC03g26570D [Brassica napus]
Length=563

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 36/41 (88%), Gaps = 1/41 (2%)
 Frame = +1

Query  430  KNKTKDGADSAKH-RQSQEQARRKKMSRAXDGILKYMLKMM  549
            ++K K+G D++K  RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  68   QSKCKEGVDASKQQRQSQEQARRKKMSRAQDGILKYMLKMM  108



>emb|CDY27563.1| BnaC01g32460D [Brassica napus]
Length=587

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +1

Query  454  DSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            DSAK RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  84   DSAKQRQSQEQARRKKMSRAQDGILKYMLKMM  115



>ref|XP_009110178.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Brassica rapa]
Length=605

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +1

Query  454  DSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            DSAK RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  81   DSAKQRQSQEQARRKKMSRAQDGILKYMLKMM  112



>gb|AAV68140.1| ethylene insensitive 3-like 2 [Dianthus caryophyllus]
Length=662

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 29/40 (73%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            K++ ++  D+ K RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  69   KDRCREWIDNVKKRQSQEQARRKKMSRAQDGILKYMLKMM  108



>dbj|BAB64344.1| EIN3-like protein [Cucumis melo]
Length=693

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            ++K K+G D  K RQSQ+QARRKKMSRA DGILKYMLK+M
Sbjct  68   QSKVKEGIDIVKQRQSQDQARRKKMSRAHDGILKYMLKIM  107



>ref|XP_008451093.1| PREDICTED: protein ETHYLENE INSENSITIVE 3 [Cucumis melo]
Length=625

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            ++K K+G D  K RQSQ+QARRKKMSRA DGILKYMLK+M
Sbjct  68   QSKVKEGIDIVKQRQSQDQARRKKMSRAHDGILKYMLKIM  107



>ref|XP_004144109.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Cucumis sativus]
Length=622

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            ++K K+G D  K RQSQ+QARRKKMSRA DGILKYMLK+M
Sbjct  68   QSKVKEGIDIVKQRQSQDQARRKKMSRAHDGILKYMLKIM  107



>gb|KGN66413.1| EIN3-like protein [Cucumis sativus]
Length=630

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            ++K K+G D  K RQSQ+QARRKKMSRA DGILKYMLK+M
Sbjct  68   QSKVKEGIDIVKQRQSQDQARRKKMSRAHDGILKYMLKIM  107



>gb|AAK67355.1|AF387795_1 transcription factor [Cucumis melo]
Length=621

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            ++K K+G D  K RQSQ+QARRKKMSRA DGILKYMLK+M
Sbjct  66   QSKVKEGIDIVKQRQSQDQARRKKMSRAHDGILKYMLKIM  105



>ref|XP_004171661.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Cucumis sativus]
Length=632

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            ++K K+G D  K RQSQ+QARRKKMSRA DGILKYMLK+M
Sbjct  68   QSKVKEGIDIVKQRQSQDQARRKKMSRAHDGILKYMLKIM  107



>gb|AFK80347.1| ethylene-insensitive 3 [Cucumis sativus]
Length=635

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            ++K K+G D  K RQSQ+QARRKKMSRA DGILKYMLK+M
Sbjct  68   QSKVKEGIDIVKQRQSQDQARRKKMSRAHDGILKYMLKIM  107



>emb|CDY32390.1| BnaC03g41740D [Brassica napus]
Length=549

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 38/42 (90%), Gaps = 2/42 (5%)
 Frame = +1

Query  430  KNKTKDGA-DSAKHRQS-QEQARRKKMSRAXDGILKYMLKMM  549
            K+K+++GA D+AK RQS QEQARRKKMSRA DGILKYMLKMM
Sbjct  63   KDKSREGAVDAAKQRQSSQEQARRKKMSRAQDGILKYMLKMM  104



>ref|XP_009133914.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Brassica rapa]
 ref|XP_009133915.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Brassica rapa]
 ref|XP_009133916.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Brassica rapa]
 ref|XP_009133918.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Brassica rapa]
Length=571

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 31/41 (76%), Positives = 36/41 (88%), Gaps = 1/41 (2%)
 Frame = +1

Query  430  KNKTKDGADSAKH-RQSQEQARRKKMSRAXDGILKYMLKMM  549
            ++K K+G D++K  RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  68   QSKCKEGVDASKQQRQSQEQARRKKMSRAQDGILKYMLKMM  108



>gb|AHC70433.1| ethylene insensitive 3 protein [Cucurbita pepo subsp. pepo]
Length=618

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            ++K K+G D AK RQS++QARRKKMSRA DGILKYMLK+M
Sbjct  68   QSKVKEGIDIAKQRQSRDQARRKKMSRAHDGILKYMLKIM  107



>ref|XP_006650014.1| PREDICTED: LOW QUALITY PROTEIN: ETHYLENE INSENSITIVE 3-like 1 
protein-like [Oryza brachyantha]
Length=639

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            K+    G D +K RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  104  KDPAGGGGDLSKPRQSQEQARRKKMSRAQDGILKYMLKMM  143



>gb|AGE45505.1| ethylene insensitive like protein [Musa acuminata AAA Group]
Length=627

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 29/40 (73%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            ++K K+  D+ K  QSQEQARRKKMSRA DGILKYMLKMM
Sbjct  93   QSKNKEQGDAEKQCQSQEQARRKKMSRAQDGILKYMLKMM  132



>ref|XP_002980161.1| hypothetical protein SELMODRAFT_112063, partial [Selaginella 
moellendorffii]
 ref|XP_002992899.1| hypothetical protein SELMODRAFT_136229, partial [Selaginella 
moellendorffii]
 gb|EFJ05988.1| hypothetical protein SELMODRAFT_136229, partial [Selaginella 
moellendorffii]
 gb|EFJ19031.1| hypothetical protein SELMODRAFT_112063, partial [Selaginella 
moellendorffii]
Length=250

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            K K ++  +  KH+QSQEQARRKKMSRA DGILKYMLKMM
Sbjct  23   KQKARNLGNLPKHKQSQEQARRKKMSRAQDGILKYMLKMM  62



>ref|XP_009135708.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Brassica rapa]
 ref|XP_009135709.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Brassica rapa]
Length=581

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 32/42 (76%), Positives = 37/42 (88%), Gaps = 2/42 (5%)
 Frame = +1

Query  430  KNKTKDGA-DSAKHRQS-QEQARRKKMSRAXDGILKYMLKMM  549
            K+K+++G  D+AK RQS QEQARRKKMSRA DGILKYMLKMM
Sbjct  63   KDKSREGGVDAAKQRQSSQEQARRKKMSRAQDGILKYMLKMM  104



>ref|XP_009389151.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Musa acuminata 
subsp. malaccensis]
 ref|XP_009389152.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Musa acuminata 
subsp. malaccensis]
Length=604

 Score = 58.5 bits (140),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            +NK K+  D++K  QS EQARRKKMSRA DGILKYMLKMM
Sbjct  93   QNKNKEQGDASKQYQSLEQARRKKMSRAQDGILKYMLKMM  132



>gb|AAV68142.1| ethylene insensitive 3-like 4 [Dianthus caryophyllus]
Length=704

 Score = 58.5 bits (140),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 29/40 (73%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            K+K     D  K  QSQEQARRKKMSRA DGILKYMLKMM
Sbjct  63   KDKCATEVDCGKKHQSQEQARRKKMSRAQDGILKYMLKMM  102



>ref|XP_008354838.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Malus domestica]
Length=610

 Score = 56.2 bits (134),  Expect(2) = 7e-07, Method: Composition-based stats.
 Identities = 27/40 (68%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            +N   + AD+A   Q QEQARRK+MSRA DGILKYMLKMM
Sbjct  66   QNXGTEAADNAXQCQPQEQARRKRMSRAQDGILKYMLKMM  105


 Score = 23.5 bits (49),  Expect(2) = 7e-07, Method: Composition-based stats.
 Identities = 13/36 (36%), Positives = 20/36 (56%), Gaps = 3/36 (8%)
 Frame = +3

Query  213  MGMFEDMANMGFCENLDFLSESPGCTEMAPEVETKA  320
            M + E++    F ++LDFL   P   E APE + +A
Sbjct  1    MAIIEELE---FSDDLDFLLAXPEEGEAAPENDPEA  33



>ref|XP_009402439.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Musa acuminata 
subsp. malaccensis]
Length=627

 Score = 58.2 bits (139),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            ++K K+  D+ K  QSQEQARRKKMSRA DGILKYMLKMM
Sbjct  93   QSKNKEQGDAEKQCQSQEQARRKKMSRAQDGILKYMLKMM  132



>gb|EYU46131.1| hypothetical protein MIMGU_mgv1a003270mg [Erythranthe guttata]
Length=595

 Score = 58.2 bits (139),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +1

Query  454  DSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            D AK RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  91   DLAKQRQSQEQARRKKMSRAQDGILKYMLKMM  122



>gb|EYU40168.1| hypothetical protein MIMGU_mgv1a022392mg [Erythranthe guttata]
Length=190

 Score = 55.8 bits (133),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 28/31 (90%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +1

Query  454  DSAKHRQSQEQARRKKMSRAXDGILKYMLKM  546
            D AK RQSQEQARRKKMSRA DGILKYMLKM
Sbjct  92   DLAKQRQSQEQARRKKMSRAQDGILKYMLKM  122



>gb|EYU40148.1| hypothetical protein MIMGU_mgv1a023186mg [Erythranthe guttata]
Length=188

 Score = 55.8 bits (133),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 28/31 (90%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +1

Query  454  DSAKHRQSQEQARRKKMSRAXDGILKYMLKM  546
            D AK RQSQEQARRKKMSRA DGILKYMLKM
Sbjct  90   DLAKQRQSQEQARRKKMSRAQDGILKYMLKM  120



>emb|CDX82228.1| BnaA03g35930D [Brassica napus]
Length=541

 Score = 57.8 bits (138),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 37/42 (88%), Gaps = 2/42 (5%)
 Frame = +1

Query  430  KNKTKDG-ADSAKHRQS-QEQARRKKMSRAXDGILKYMLKMM  549
            K+K+++G  D+AK RQS QEQARRKKMSRA DGILKYMLKMM
Sbjct  63   KDKSREGGVDAAKQRQSSQEQARRKKMSRAQDGILKYMLKMM  104



>gb|EAY89823.1| hypothetical protein OsI_11369 [Oryza sativa Indica Group]
Length=640

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/33 (85%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +1

Query  451  ADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
             D +K RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  111  GDPSKPRQSQEQARRKKMSRAQDGILKYMLKMM  143



>gb|AAZ78349.1| EIN3-like protein 1 [Oryza sativa Japonica Group]
 gb|EAZ26760.1| hypothetical protein OsJ_10672 [Oryza sativa Japonica Group]
Length=640

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/33 (85%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +1

Query  451  ADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
             D +K RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  111  GDPSKPRQSQEQARRKKMSRAQDGILKYMLKMM  143



>dbj|BAB78462.2| ethylene-insensitive-3-like protein [Oryza sativa Japonica Group]
 gb|ABF95695.1| ETHYLENE-INSENSITIVE3-like 1 protein, putative, expressed [Oryza 
sativa Japonica Group]
 gb|ABF95696.1| ETHYLENE-INSENSITIVE3-like 1 protein, putative, expressed [Oryza 
sativa Japonica Group]
Length=644

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/33 (85%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +1

Query  451  ADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
             D +K RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  112  GDPSKPRQSQEQARRKKMSRAQDGILKYMLKMM  144



>gb|ABF95697.1| ETHYLENE-INSENSITIVE3-like 1 protein, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAG95963.1| unnamed protein product [Oryza sativa Japonica Group]
Length=641

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/33 (85%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +1

Query  451  ADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
             D +K RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  112  GDPSKPRQSQEQARRKKMSRAQDGILKYMLKMM  144



>ref|XP_004984528.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Setaria italica]
Length=647

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/34 (85%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  448  GADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            G  S+K RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  113  GDGSSKPRQSQEQARRKKMSRAQDGILKYMLKMM  146



>ref|XP_009339243.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009339252.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein isoform X1 [Pyrus 
x bretschneideri]
Length=923

 Score = 56.2 bits (134),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 25/40 (63%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            +NK  +GAD+A+  Q +EQ+ RKKMSRA D ILKYML+MM
Sbjct  66   QNKGTEGADNARQCQPKEQSHRKKMSRAQDAILKYMLRMM  105


 Score = 22.7 bits (47),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 15/36 (42%), Positives = 21/36 (58%), Gaps = 3/36 (8%)
 Frame = +3

Query  213  MGMFEDMANMGFCENLDFLSESPGCTEMAPEVETKA  320
            M +FE++   GF  +LDFLS      E APE + +A
Sbjct  1    MEIFEEL---GFSGDLDFLSAPLEEDEAAPEHDPEA  33



>emb|CDX83250.1| BnaA03g22560D [Brassica napus]
Length=570

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 35/41 (85%), Gaps = 1/41 (2%)
 Frame = +1

Query  430  KNKTKDGADSAKH-RQSQEQARRKKMSRAXDGILKYMLKMM  549
            ++K K+  D++K  RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  68   QSKCKEEVDASKQQRQSQEQARRKKMSRAQDGILKYMLKMM  108



>ref|NP_001049978.1| Os03g0324300 [Oryza sativa Japonica Group]
 dbj|BAF11892.1| Os03g0324300 [Oryza sativa Japonica Group]
Length=528

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/33 (85%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +1

Query  451  ADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
             D +K RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  112  GDPSKPRQSQEQARRKKMSRAQDGILKYMLKMM  144



>ref|XP_009339244.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein isoform X2 [Pyrus 
x bretschneideri]
 ref|XP_009339253.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein isoform X2 [Pyrus 
x bretschneideri]
Length=892

 Score = 55.8 bits (133),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 25/40 (63%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            +NK  +GAD+A+  Q +EQ+ RKKMSRA D ILKYML+MM
Sbjct  66   QNKGTEGADNARQCQPKEQSHRKKMSRAQDAILKYMLRMM  105


 Score = 22.7 bits (47),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 15/36 (42%), Positives = 21/36 (58%), Gaps = 3/36 (8%)
 Frame = +3

Query  213  MGMFEDMANMGFCENLDFLSESPGCTEMAPEVETKA  320
            M +FE++   GF  +LDFLS      E APE + +A
Sbjct  1    MEIFEEL---GFSGDLDFLSAPLEEDEAAPEHDPEA  33



>ref|XP_009417872.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Musa acuminata 
subsp. malaccensis]
 ref|XP_009417873.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Musa acuminata 
subsp. malaccensis]
Length=622

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            K+K K+  DSAK RQ  +QA RKKMSRA DGILKYMLKMM
Sbjct  92   KSKNKEQGDSAKQRQCHDQALRKKMSRAQDGILKYMLKMM  131



>ref|XP_010557481.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Tarenaya hassleriana]
 ref|XP_010557482.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Tarenaya hassleriana]
 ref|XP_010557483.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Tarenaya hassleriana]
Length=570

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 35/41 (85%), Gaps = 1/41 (2%)
 Frame = +1

Query  430  KNKTKDGADSAKHR-QSQEQARRKKMSRAXDGILKYMLKMM  549
            ++++K+G DS K R Q QEQ+RRKKMSRA DGILKYMLKMM
Sbjct  60   QSRSKEGVDSFKQRRQPQEQSRRKKMSRAQDGILKYMLKMM  100



>ref|XP_011091876.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Sesamum indicum]
Length=580

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 32/39 (82%), Gaps = 1/39 (3%)
 Frame = +1

Query  436  KTKDGAD-SAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            KTK+  D S K R SQEQARRKKMSRA DGILKYMLKMM
Sbjct  37   KTKNEIDGSTKQRHSQEQARRKKMSRAQDGILKYMLKMM  75



>ref|NP_001146219.1| uncharacterized protein LOC100279789 [Zea mays]
 gb|ACL53490.1| unknown [Zea mays]
 gb|AFW88507.1| hypothetical protein ZEAMMB73_148027 [Zea mays]
Length=642

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/31 (90%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +1

Query  457  SAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            S+K RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  116  SSKPRQSQEQARRKKMSRAQDGILKYMLKMM  146



>gb|ACM89299.1| EIN3-like protein EIL1 [Eriobotrya japonica]
Length=558

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            + K ++  D  + RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  18   QTKGRERVDIVRQRQSQEQARRKKMSRAQDGILKYMLKMM  57



>gb|AGY30671.1| ethylene insensitive 3, partial [Saccharum hybrid cultivar]
Length=639

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/31 (90%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +1

Query  457  SAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            S+K RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  109  SSKPRQSQEQARRKKMSRAQDGILKYMLKMM  139



>gb|ACN31333.1| unknown [Zea mays]
Length=647

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/31 (90%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +1

Query  457  SAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            S+K RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  116  SSKPRQSQEQARRKKMSRAQDGILKYMLKMM  146



>ref|XP_002467935.1| hypothetical protein SORBIDRAFT_01g036740 [Sorghum bicolor]
 gb|EER94933.1| hypothetical protein SORBIDRAFT_01g036740 [Sorghum bicolor]
Length=643

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/31 (90%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +1

Query  457  SAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            S+K RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  116  SSKPRQSQEQARRKKMSRAQDGILKYMLKMM  146



>ref|NP_001152035.1| ETHYLENE-INSENSITIVE3-like 1 protein [Zea mays]
 gb|ACG45492.1| ETHYLENE-INSENSITIVE3-like 1 protein [Zea mays]
Length=646

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/31 (90%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +1

Query  457  SAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            S+K RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  116  SSKPRQSQEQARRKKMSRAQDGILKYMLKMM  146



>gb|ACN27664.1| unknown [Zea mays]
 gb|ACN28151.1| unknown [Zea mays]
 gb|ADX60075.1| EIL transcription factor [Zea mays]
 tpg|DAA45119.1| TPA: ETHYLENE-INSENSITIVE3-like 1 protein [Zea mays]
Length=647

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/31 (90%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +1

Query  457  SAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            S+K RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  116  SSKPRQSQEQARRKKMSRAQDGILKYMLKMM  146



>emb|CDP16004.1| unnamed protein product [Coffea canephora]
Length=608

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 31/39 (79%), Gaps = 1/39 (3%)
 Frame = +1

Query  436  KTKDGADSA-KHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            K K+G D   K  QSQEQARRKKMSRA DGILKYMLKMM
Sbjct  66   KIKEGVDDGMKQHQSQEQARRKKMSRAQDGILKYMLKMM  104



>ref|XP_010689360.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Beta vulgaris 
subsp. vulgaris]
Length=619

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            +N+   G D+ K+ QSQEQ+RRKKMSR  DGILKYMLKMM
Sbjct  67   QNRVNKGFDARKNHQSQEQSRRKKMSRVQDGILKYMLKMM  106



>ref|XP_001753917.1| EIN3b transcription factor [Physcomitrella patens]
 gb|EDQ81239.1| EIN3b transcription factor, partial [Physcomitrella patens]
Length=264

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/30 (87%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +1

Query  460  AKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
             +H+QSQEQARRKKMSRA DGILKYMLKMM
Sbjct  43   GQHKQSQEQARRKKMSRAQDGILKYMLKMM  72



>ref|XP_009406830.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Musa acuminata 
subsp. malaccensis]
Length=615

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 27/40 (68%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            ++K+++  D+ K  QS EQARRKKMSRA DGILKYMLKMM
Sbjct  93   QSKSREQGDAFKQCQSLEQARRKKMSRAQDGILKYMLKMM  132



>ref|XP_001766792.1| EIN3a transcription factor [Physcomitrella patens]
 gb|EDQ68423.1| EIN3a transcription factor, partial [Physcomitrella patens]
Length=265

 Score = 54.7 bits (130),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/28 (93%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = +1

Query  466  HRQSQEQARRKKMSRAXDGILKYMLKMM  549
            H+QSQEQARRKKMSRA DGILKYMLKMM
Sbjct  46   HKQSQEQARRKKMSRAQDGILKYMLKMM  73



>ref|XP_008653495.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Zea mays]
 tpg|DAA64176.1| TPA: hypothetical protein ZEAMMB73_182677 [Zea mays]
 gb|AIB05505.1| EIL transcription factor, partial [Zea mays]
Length=586

 Score = 54.7 bits (130),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +1

Query  451  ADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            A  ++ RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  102  ASRSRQRQSQEQARRKKMSRAQDGILKYMLKMM  134



>ref|XP_008670668.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Zea mays]
 tpg|DAA41787.1| TPA: hypothetical protein ZEAMMB73_265069 [Zea mays]
 gb|AIB04949.1| EIL transcription factor, partial [Zea mays]
Length=595

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +1

Query  451  ADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            A S++ RQSQEQARRKKMSRA  GILKYMLKMM
Sbjct  101  ASSSRQRQSQEQARRKKMSRAQGGILKYMLKMM  133



>dbj|BAJ95094.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=651

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/29 (93%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  463  KHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            K RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  120  KPRQSQEQARRKKMSRAQDGILKYMLKMM  148



>gb|EMT14050.1| Protein ETHYLENE INSENSITIVE 3 [Aegilops tauschii]
Length=648

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/29 (93%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  463  KHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            K RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  118  KPRQSQEQARRKKMSRAQDGILKYMLKMM  146



>ref|XP_008375510.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Malus domestica]
Length=581

 Score = 53.5 bits (127),  Expect(2) = 1e-05, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  KNKTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            ++K  +GAD+A+  Q +EQ++RKKMSRA D ILKYML+MM
Sbjct  66   QDKGTEGADNARQCQPKEQSQRKKMSRAQDAILKYMLRMM  105


 Score = 21.9 bits (45),  Expect(2) = 1e-05, Method: Composition-based stats.
 Identities = 14/36 (39%), Positives = 20/36 (56%), Gaps = 3/36 (8%)
 Frame = +3

Query  213  MGMFEDMANMGFCENLDFLSESPGCTEMAPEVETKA  320
            M +FE++   G   +LDFLS      E APE + +A
Sbjct  1    MEIFEEL---GLSGDLDFLSAPLEEDEAAPEHDPEA  33



>ref|XP_003558012.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Brachypodium 
distachyon]
 ref|XP_010228682.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Brachypodium 
distachyon]
Length=650

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/29 (93%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  463  KHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            K RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  119  KPRQSQEQARRKKMSRAQDGILKYMLKMM  147



>ref|XP_002979886.1| hypothetical protein SELMODRAFT_16064, partial [Selaginella moellendorffii]
 ref|XP_002988454.1| hypothetical protein SELMODRAFT_16065, partial [Selaginella moellendorffii]
 gb|EFJ10544.1| hypothetical protein SELMODRAFT_16065, partial [Selaginella moellendorffii]
 gb|EFJ19288.1| hypothetical protein SELMODRAFT_16064, partial [Selaginella moellendorffii]
Length=249

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  448  GADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            G D AK +QS EQARRKKM+RA DGILKYMLKM+
Sbjct  27   GKDRAKQKQSPEQARRKKMARAQDGILKYMLKMV  60



>ref|XP_004958734.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein-like [Setaria 
italica]
Length=624

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/27 (96%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = +1

Query  469  RQSQEQARRKKMSRAXDGILKYMLKMM  549
            RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  107  RQSQEQARRKKMSRAQDGILKYMLKMM  133



>ref|NP_001060678.1| Os07g0685700 [Oryza sativa Japonica Group]
 dbj|BAC10338.1| putative transcription factor OsEIL2 [Oryza sativa Japonica Group]
 dbj|BAB78463.2| ethylene-insensitive-3-like protein [Oryza sativa Japonica Group]
 dbj|BAF22592.1| Os07g0685700 [Oryza sativa Japonica Group]
 dbj|BAG87565.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE67841.1| hypothetical protein OsJ_25629 [Oryza sativa Japonica Group]
 gb|ADX60245.1| EIL transcription factor [Oryza sativa Japonica Group]
Length=593

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/27 (96%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = +1

Query  469  RQSQEQARRKKMSRAXDGILKYMLKMM  549
            RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  122  RQSQEQARRKKMSRAQDGILKYMLKMM  148



>gb|EEC82710.1| hypothetical protein OsI_27382 [Oryza sativa Indica Group]
Length=592

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/27 (96%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = +1

Query  469  RQSQEQARRKKMSRAXDGILKYMLKMM  549
            RQSQEQARRKKMSRA DGILKYMLKMM
Sbjct  121  RQSQEQARRKKMSRAQDGILKYMLKMM  147



>ref|XP_009602832.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 3 protein isoform X2 [Nicotiana 
tomentosiformis]
Length=663

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  448  GADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
             AD  K++Q+ +QARRKKMSRA DGILKYMLK+M
Sbjct  65   AADKQKNKQTTDQARRKKMSRAQDGILKYMLKLM  98



>ref|XP_009602831.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 3 protein isoform X1 [Nicotiana 
tomentosiformis]
Length=665

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  448  GADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
             AD  K++Q+ +QARRKKMSRA DGILKYMLK+M
Sbjct  67   AADKQKNKQTTDQARRKKMSRAQDGILKYMLKLM  100



>ref|XP_009788578.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 3 protein isoform X2 [Nicotiana 
sylvestris]
Length=659

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  448  GADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
             AD  K++Q+ +QARRKKMSRA DGILKYMLK+M
Sbjct  65   AADKQKNKQTTDQARRKKMSRAQDGILKYMLKLM  98



>ref|XP_009788577.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 3 protein isoform X1 [Nicotiana 
sylvestris]
Length=661

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  448  GADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
             AD  K++Q+ +QARRKKMSRA DGILKYMLK+M
Sbjct  67   AADKQKNKQTTDQARRKKMSRAQDGILKYMLKLM  100



>gb|KHN33326.1| ETHYLENE INSENSITIVE 3-like 3 protein [Glycine soja]
Length=468

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +1

Query  436  KTKDGADSAKHRQSQEQARRKKMSRAXDGILKYMLKMM  549
            + +  A+  K RQS +QARRKKMSRA DGILKYMLK+M
Sbjct  61   EAQQAAEKQKPRQSSDQARRKKMSRAQDGILKYMLKLM  98



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 590079713720