BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001P24

Length=516
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KJB23937.1|  hypothetical protein B456_004G122300                    236   2e-74   Gossypium raimondii
gb|KJB23939.1|  hypothetical protein B456_004G122300                    236   1e-73   Gossypium raimondii
gb|KJB23938.1|  hypothetical protein B456_004G122300                    236   2e-73   Gossypium raimondii
ref|XP_009757796.1|  PREDICTED: molybdate-anion transporter             239   2e-73   Nicotiana sylvestris
ref|XP_009599532.1|  PREDICTED: molybdate-anion transporter             239   2e-73   Nicotiana tomentosiformis
gb|KJB52531.1|  hypothetical protein B456_008G266400                    236   4e-73   Gossypium raimondii
ref|XP_002318449.1|  hypothetical protein POPTR_0012s02730g             238   4e-73   Populus trichocarpa [western balsam poplar]
ref|XP_006849199.1|  hypothetical protein AMTR_s00027p00219390          238   7e-73   Amborella trichopoda
ref|XP_011044697.1|  PREDICTED: molybdate-anion transporter-like        238   8e-73   Populus euphratica
gb|KDP27322.1|  hypothetical protein JCGZ_20823                         237   1e-72   Jatropha curcas
ref|XP_002515682.1|  conserved hypothetical protein                     237   1e-72   Ricinus communis
gb|KDO59676.1|  hypothetical protein CISIN_1g012629mg                   233   2e-72   Citrus sinensis [apfelsine]
gb|KJB52532.1|  hypothetical protein B456_008G266400                    235   2e-72   Gossypium raimondii
ref|XP_011043683.1|  PREDICTED: molybdate-anion transporter-like        236   3e-72   Populus euphratica
ref|XP_011043684.1|  PREDICTED: molybdate-anion transporter-like        236   3e-72   Populus euphratica
ref|XP_010474625.1|  PREDICTED: molybdate-anion transporter-like        233   3e-72   Camelina sativa [gold-of-pleasure]
gb|KJB37398.1|  hypothetical protein B456_006G202900                    232   4e-72   Gossypium raimondii
ref|XP_002321382.1|  hypothetical protein POPTR_0015s01050g             236   4e-72   Populus trichocarpa [western balsam poplar]
gb|KJB39450.1|  hypothetical protein B456_007G016500                    233   4e-72   Gossypium raimondii
gb|KJB23940.1|  hypothetical protein B456_004G122300                    235   4e-72   Gossypium raimondii
gb|KJB52533.1|  hypothetical protein B456_008G266400                    235   4e-72   Gossypium raimondii
gb|KHG07536.1|  Major facilitator superfamily domain-containing p...    236   4e-72   Gossypium arboreum [tree cotton]
gb|KDO59675.1|  hypothetical protein CISIN_1g012629mg                   233   5e-72   Citrus sinensis [apfelsine]
gb|KJB23936.1|  hypothetical protein B456_004G122300                    236   5e-72   Gossypium raimondii
ref|XP_007039147.1|  Major facilitator superfamily protein              236   5e-72   
gb|KHG12073.1|  Major facilitator superfamily domain-containing p...    236   5e-72   Gossypium arboreum [tree cotton]
gb|KJB52530.1|  hypothetical protein B456_008G266400                    235   6e-72   Gossypium raimondii
ref|XP_006359771.1|  PREDICTED: major facilitator superfamily dom...    235   7e-72   Solanum tuberosum [potatoes]
ref|XP_004245175.1|  PREDICTED: molybdate-anion transporter             235   8e-72   
emb|CAB38284.1|  putative protein                                       234   1e-71   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011075930.1|  PREDICTED: molybdate-anion transporter             234   2e-71   Sesamum indicum [beniseed]
ref|XP_009351951.1|  PREDICTED: molybdate-anion transporter-like        234   2e-71   Pyrus x bretschneideri [bai li]
ref|XP_008234689.1|  PREDICTED: molybdate-anion transporter             234   2e-71   Prunus mume [ume]
gb|KDO59674.1|  hypothetical protein CISIN_1g012629mg                   233   2e-71   Citrus sinensis [apfelsine]
ref|XP_002869545.1|  hypothetical protein ARALYDRAFT_913755             234   2e-71   Arabidopsis lyrata subsp. lyrata
ref|XP_010448086.1|  PREDICTED: molybdate-anion transporter-like        234   3e-71   Camelina sativa [gold-of-pleasure]
ref|XP_010438562.1|  PREDICTED: molybdate-anion transporter-like        234   3e-71   Camelina sativa [gold-of-pleasure]
ref|XP_010433324.1|  PREDICTED: molybdate-anion transporter-like        234   3e-71   Camelina sativa [gold-of-pleasure]
ref|XP_006413035.1|  hypothetical protein EUTSA_v10025154mg             233   3e-71   Eutrema salsugineum [saltwater cress]
ref|XP_003602306.1|  Major facilitator superfamily domain-contain...    230   3e-71   
ref|XP_010671392.1|  PREDICTED: molybdate-anion transporter-like        233   3e-71   Beta vulgaris subsp. vulgaris [field beet]
gb|KDO59672.1|  hypothetical protein CISIN_1g012629mg                   233   4e-71   Citrus sinensis [apfelsine]
ref|NP_567786.1|  major facilitator protein                             233   4e-71   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006441178.1|  hypothetical protein CICLE_v10020083mg             233   4e-71   
ref|XP_002280860.1|  PREDICTED: molybdate-anion transporter             233   4e-71   Vitis vinifera
ref|XP_006290944.1|  hypothetical protein CARUB_v10017059mg             234   4e-71   
gb|KDO59673.1|  hypothetical protein CISIN_1g012629mg                   233   4e-71   Citrus sinensis [apfelsine]
ref|XP_006285090.1|  hypothetical protein CARUB_v10006423mg             233   4e-71   
gb|AFI41203.1|  major facilitator protein                               233   4e-71   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007217984.1|  hypothetical protein PRUPE_ppa005463mg             233   5e-71   Prunus persica
ref|XP_002518895.1|  conserved hypothetical protein                     233   5e-71   Ricinus communis
ref|XP_006441179.1|  hypothetical protein CICLE_v10020083mg             233   5e-71   Citrus clementina [clementine]
gb|KDO59671.1|  hypothetical protein CISIN_1g012629mg                   233   5e-71   Citrus sinensis [apfelsine]
ref|XP_008672796.1|  PREDICTED: hypothetical protein isoform X1         233   6e-71   Zea mays [maize]
gb|KHG25593.1|  Major facilitator superfamily domain-containing p...    233   7e-71   Gossypium arboreum [tree cotton]
ref|XP_008381287.1|  PREDICTED: molybdate-anion transporter-like        233   7e-71   
gb|KJB37395.1|  hypothetical protein B456_006G202900                    233   7e-71   Gossypium raimondii
gb|KJB37396.1|  hypothetical protein B456_006G202900                    233   7e-71   Gossypium raimondii
gb|EYU19669.1|  hypothetical protein MIMGU_mgv1a006017mg                233   7e-71   Erythranthe guttata [common monkey flower]
ref|NP_190500.2|  major facilitator protein                             233   8e-71   Arabidopsis thaliana [mouse-ear cress]
gb|KJB39448.1|  hypothetical protein B456_007G016500                    231   8e-71   Gossypium raimondii
dbj|BAF00743.1|  hypothetical protein                                   233   8e-71   Arabidopsis thaliana [mouse-ear cress]
gb|KDP25194.1|  hypothetical protein JCGZ_20350                         232   9e-71   Jatropha curcas
gb|KJB37397.1|  hypothetical protein B456_006G202900                    232   9e-71   Gossypium raimondii
ref|XP_010412660.1|  PREDICTED: molybdate-anion transporter-like        231   1e-70   
ref|XP_004145939.1|  PREDICTED: major facilitator superfamily dom...    232   1e-70   Cucumis sativus [cucumbers]
ref|XP_002274807.1|  PREDICTED: molybdate-anion transporter             232   1e-70   Vitis vinifera
ref|XP_006404158.1|  hypothetical protein EUTSA_v10010332mg             232   1e-70   Eutrema salsugineum [saltwater cress]
gb|KJB39447.1|  hypothetical protein B456_007G016500                    231   2e-70   Gossypium raimondii
ref|XP_010533550.1|  PREDICTED: molybdate-anion transporter             232   2e-70   Tarenaya hassleriana [spider flower]
emb|CAB66410.1|  putative protein                                       232   2e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008437621.1|  PREDICTED: molybdate-anion transporter             231   2e-70   Cucumis melo [Oriental melon]
ref|XP_011084541.1|  PREDICTED: molybdate-anion transporter-like        231   2e-70   Sesamum indicum [beniseed]
gb|KJB39452.1|  hypothetical protein B456_007G016500                    231   2e-70   Gossypium raimondii
ref|XP_010555746.1|  PREDICTED: molybdate-anion transporter-like        231   2e-70   Tarenaya hassleriana [spider flower]
ref|XP_009143909.1|  PREDICTED: molybdate-anion transporter-like        231   2e-70   Brassica rapa
ref|XP_009398088.1|  PREDICTED: molybdate-anion transporter-like        231   2e-70   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY55350.1|  BnaAnng13850D                                          231   2e-70   Brassica napus [oilseed rape]
ref|XP_010496627.1|  PREDICTED: molybdate-anion transporter-like        231   3e-70   Camelina sativa [gold-of-pleasure]
emb|CDY19032.1|  BnaC01g20360D                                          231   3e-70   Brassica napus [oilseed rape]
emb|CDY19031.1|  BnaC01g20370D                                          231   3e-70   Brassica napus [oilseed rape]
ref|XP_009143901.1|  PREDICTED: molybdate-anion transporter-like        231   3e-70   Brassica rapa
ref|XP_008376777.1|  PREDICTED: molybdate-anion transporter             231   3e-70   Malus domestica [apple tree]
ref|XP_010426440.1|  PREDICTED: molybdate-anion transporter             231   3e-70   Camelina sativa [gold-of-pleasure]
gb|ACU20900.1|  unknown                                                 226   3e-70   Glycine max [soybeans]
ref|XP_009361322.1|  PREDICTED: molybdate-anion transporter-like        231   4e-70   Pyrus x bretschneideri [bai li]
gb|KJB39449.1|  hypothetical protein B456_007G016500                    231   4e-70   Gossypium raimondii
ref|XP_010537061.1|  PREDICTED: molybdate-anion transporter             231   4e-70   Tarenaya hassleriana [spider flower]
gb|KHN19524.1|  Major facilitator superfamily domain-containing p...    231   4e-70   Glycine soja [wild soybean]
ref|XP_002877664.1|  hypothetical protein ARALYDRAFT_906210             230   5e-70   Arabidopsis lyrata subsp. lyrata
ref|XP_010541494.1|  PREDICTED: molybdate-anion transporter             230   5e-70   Tarenaya hassleriana [spider flower]
gb|KHG26960.1|  Major facilitator superfamily domain-containing p...    230   6e-70   Gossypium arboreum [tree cotton]
ref|XP_004502700.1|  PREDICTED: major facilitator superfamily dom...    230   6e-70   Cicer arietinum [garbanzo]
ref|XP_007136474.1|  hypothetical protein PHAVU_009G048300g             230   7e-70   Phaseolus vulgaris [French bean]
ref|XP_003602307.1|  Major facilitator superfamily domain-contain...    229   8e-70   
ref|XP_003523346.1|  PREDICTED: molybdate-anion transporter-like        229   9e-70   Glycine max [soybeans]
ref|XP_006661963.1|  PREDICTED: molybdate-anion transporter-like        229   1e-69   Oryza brachyantha
gb|KFK27713.1|  hypothetical protein AALP_AA8G420100                    229   1e-69   Arabis alpina [alpine rockcress]
ref|XP_003602305.1|  Major facilitator superfamily domain-contain...    229   1e-69   Medicago truncatula
ref|XP_010676884.1|  PREDICTED: molybdate-anion transporter             229   2e-69   Beta vulgaris subsp. vulgaris [field beet]
gb|ABR16784.1|  unknown                                                 228   2e-69   Picea sitchensis
gb|ACN26835.1|  unknown                                                 222   3e-69   Zea mays [maize]
gb|ABR17540.1|  unknown                                                 228   4e-69   Picea sitchensis
ref|XP_007039420.1|  Major facilitator superfamily protein              230   4e-69   
ref|XP_003526731.1|  PREDICTED: molybdate-anion transporter isofo...    228   5e-69   Glycine max [soybeans]
ref|XP_010252496.1|  PREDICTED: molybdate-anion transporter-like        228   5e-69   Nelumbo nucifera [Indian lotus]
gb|AFP55541.1|  major facilitator superfamily domain                    229   5e-69   Rosa rugosa [Japanese rose]
ref|XP_009387043.1|  PREDICTED: molybdate-anion transporter-like        228   6e-69   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB24150.1|  hypothetical protein B456_004G130100                    228   7e-69   Gossypium raimondii
ref|XP_010934492.1|  PREDICTED: molybdate-anion transporter             228   7e-69   Elaeis guineensis
gb|AFK42358.1|  unknown                                                 227   7e-69   Medicago truncatula
gb|ABB47893.2|  Major Facilitator Superfamily protein, expressed        227   7e-69   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001065080.1|  Os10g0519600                                       227   8e-69   
ref|XP_006302235.1|  hypothetical protein CARUB_v10020258mg             227   8e-69   Capsella rubella
dbj|BAF00766.1|  hypothetical protein                                   227   9e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010430611.1|  PREDICTED: molybdate-anion transporter             227   9e-69   Camelina sativa [gold-of-pleasure]
ref|NP_176646.1|  general substrate transporter-like protein            227   1e-68   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002886332.1|  hypothetical protein ARALYDRAFT_474876             227   1e-68   
gb|AAF19685.1|AC009519_19  F1N19.22                                     227   1e-68   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008806366.1|  PREDICTED: molybdate-anion transporter             226   1e-68   Phoenix dactylifera
gb|KHN23335.1|  Major facilitator superfamily domain-containing p...    228   2e-68   Glycine soja [wild soybean]
gb|KHG17688.1|  Major facilitator superfamily domain-containing p...    226   2e-68   Gossypium arboreum [tree cotton]
ref|XP_004307944.1|  PREDICTED: molybdate-anion transporter             226   2e-68   Fragaria vesca subsp. vesca
ref|XP_010252339.1|  PREDICTED: molybdate-anion transporter-like        226   2e-68   Nelumbo nucifera [Indian lotus]
ref|XP_002466934.1|  hypothetical protein SORBIDRAFT_01g016960          226   2e-68   Sorghum bicolor [broomcorn]
ref|XP_008803061.1|  PREDICTED: molybdate-anion transporter-like        226   2e-68   Phoenix dactylifera
ref|XP_008439575.1|  PREDICTED: molybdate-anion transporter-like        226   3e-68   Cucumis melo [Oriental melon]
ref|XP_004982589.1|  PREDICTED: major facilitator superfamily dom...    226   3e-68   Setaria italica
ref|XP_006350499.1|  PREDICTED: major facilitator superfamily dom...    226   4e-68   Solanum tuberosum [potatoes]
ref|XP_010109217.1|  hypothetical protein L484_011839                   225   4e-68   Morus notabilis
ref|XP_010318046.1|  PREDICTED: molybdate-anion transporter             226   4e-68   Solanum lycopersicum
emb|CDP05020.1|  unnamed protein product                                225   4e-68   Coffea canephora [robusta coffee]
ref|XP_004982588.1|  PREDICTED: major facilitator superfamily dom...    226   4e-68   
gb|KCW89110.1|  hypothetical protein EUGRSUZ_A01432                     224   5e-68   Eucalyptus grandis [rose gum]
gb|KFK32961.1|  hypothetical protein AALP_AA6G312100                    225   5e-68   Arabis alpina [alpine rockcress]
gb|EMS67574.1|  hypothetical protein TRIUR3_28243                       224   5e-68   Triticum urartu
gb|KFK29292.1|  hypothetical protein AALP_AA7G114400                    225   5e-68   Arabis alpina [alpine rockcress]
ref|XP_004982587.1|  PREDICTED: major facilitator superfamily dom...    226   6e-68   
ref|XP_006391594.1|  hypothetical protein EUTSA_v10023452mg             225   7e-68   Eutrema salsugineum [saltwater cress]
ref|XP_004982586.1|  PREDICTED: major facilitator superfamily dom...    226   7e-68   
ref|XP_010941032.1|  PREDICTED: molybdate-anion transporter-like        225   8e-68   Elaeis guineensis
ref|XP_010048797.1|  PREDICTED: molybdate-anion transporter-like        224   8e-68   Eucalyptus grandis [rose gum]
gb|ABF93637.1|  expressed protein                                       223   2e-67   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001048746.1|  Os03g0114800                                       224   2e-67   
dbj|BAJ89044.1|  predicted protein                                      224   2e-67   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EAY88269.1|  hypothetical protein OsI_09722                          224   2e-67   Oryza sativa Indica Group [Indian rice]
ref|XP_003558980.1|  PREDICTED: molybdate-anion transporter-like        224   2e-67   Brachypodium distachyon [annual false brome]
dbj|BAJ88961.1|  predicted protein                                      224   2e-67   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS52358.1|  hypothetical protein TRIUR3_20211                       223   2e-67   Triticum urartu
gb|ACN31979.1|  unknown                                                 222   3e-67   Zea mays [maize]
ref|XP_009415826.1|  PREDICTED: molybdate-anion transporter-like        223   3e-67   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006649263.1|  PREDICTED: molybdate-anion transporter-like        223   3e-67   
ref|XP_003574207.1|  PREDICTED: molybdate-anion transporter-like        223   4e-67   Brachypodium distachyon [annual false brome]
gb|ACG34533.1|  major Facilitator superfamily protein                   223   5e-67   Zea mays [maize]
gb|AFW89813.1|  hypothetical protein ZEAMMB73_054877                    223   5e-67   
ref|NP_001149961.1|  LOC100283588 precursor                             223   6e-67   Zea mays [maize]
ref|XP_008650038.1|  PREDICTED: molybdate-anion transporter             222   1e-66   
ref|XP_004986003.1|  PREDICTED: major facilitator superfamily dom...    222   1e-66   Setaria italica
ref|XP_009796128.1|  PREDICTED: molybdate-anion transporter-like        221   1e-66   Nicotiana sylvestris
ref|XP_004986002.1|  PREDICTED: major facilitator superfamily dom...    221   1e-66   
ref|XP_006404159.1|  hypothetical protein EUTSA_v10010332mg             222   2e-66   
ref|XP_011022428.1|  PREDICTED: molybdate-anion transporter-like        221   2e-66   Populus euphratica
ref|XP_009629563.1|  PREDICTED: molybdate-anion transporter-like        221   3e-66   Nicotiana tomentosiformis
ref|XP_004309548.1|  PREDICTED: molybdate-anion transporter-like        221   3e-66   Fragaria vesca subsp. vesca
ref|XP_008806966.1|  PREDICTED: molybdate-anion transporter-like ...    221   3e-66   Phoenix dactylifera
ref|XP_002304575.2|  hypothetical protein POPTR_0003s14550g             220   4e-66   Populus trichocarpa [western balsam poplar]
ref|XP_010919323.1|  PREDICTED: molybdate-anion transporter-like        220   4e-66   Elaeis guineensis
ref|XP_008239240.1|  PREDICTED: molybdate-anion transporter-like        220   4e-66   Prunus mume [ume]
ref|XP_008374105.1|  PREDICTED: molybdate-anion transporter-like        220   4e-66   Malus domestica [apple tree]
ref|XP_007211182.1|  hypothetical protein PRUPE_ppa005436mg             220   4e-66   Prunus persica
ref|XP_009358691.1|  PREDICTED: molybdate-anion transporter-like        220   6e-66   Pyrus x bretschneideri [bai li]
ref|XP_008806965.1|  PREDICTED: molybdate-anion transporter-like ...    220   7e-66   Phoenix dactylifera
ref|XP_006439246.1|  hypothetical protein CICLE_v10020066mg             219   9e-66   Citrus clementina [clementine]
ref|XP_004134591.1|  PREDICTED: major facilitator superfamily dom...    218   3e-65   Cucumis sativus [cucumbers]
emb|CDX86981.1|  BnaC03g52510D                                          218   6e-65   
ref|XP_009393576.1|  PREDICTED: molybdate-anion transporter             216   2e-64   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY08126.1|  BnaA06g16000D                                          216   2e-64   Brassica napus [oilseed rape]
ref|XP_009389334.1|  PREDICTED: molybdate-anion transporter-like        214   6e-64   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009149745.1|  PREDICTED: molybdate-anion transporter             214   6e-64   Brassica rapa
ref|XP_001753342.1|  predicted protein                                  213   4e-63   
ref|XP_010507346.1|  PREDICTED: molybdate-anion transporter-like        211   5e-62   
ref|XP_001760679.1|  predicted protein                                  209   5e-62   
ref|XP_010090586.1|  Translocase of chloroplast 132                     214   1e-61   
ref|XP_001755472.1|  predicted protein                                  208   1e-61   
ref|XP_002977775.1|  hypothetical protein SELMODRAFT_176583             207   4e-61   Selaginella moellendorffii
gb|EMT22205.1|  hypothetical protein F775_28807                         206   1e-60   
ref|XP_006368797.1|  hypothetical protein POPTR_0001s11250g             201   2e-59   
gb|KDO37229.1|  hypothetical protein CISIN_1g014905mg                   199   2e-58   Citrus sinensis [apfelsine]
ref|XP_006476306.1|  PREDICTED: molybdate-anion transporter-like        199   4e-58   Citrus sinensis [apfelsine]
ref|XP_003062454.1|  major facilitator superfamily                      175   5e-49   Micromonas pusilla CCMP1545
emb|CDY05924.1|  BnaC08g21010D                                          173   5e-48   
ref|XP_002506106.1|  major facilitator superfamily                      169   1e-46   Micromonas commoda
gb|EPS57272.1|  hypothetical protein M569_17548                         160   9e-46   Genlisea aurea
emb|CDX73755.1|  BnaC08g22480D                                          155   5e-45   
ref|XP_001699326.1|  hypothetical protein CHLREDRAFT_82040              164   6e-45   Chlamydomonas reinhardtii
ref|NP_001077772.1|  general substrate transporter-like protein         163   1e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001416912.1|  predicted protein                                  163   2e-44   Ostreococcus lucimarinus CCE9901
emb|CEF97079.1|  Major facilitator superfamily domain, general su...    162   3e-44   Ostreococcus tauri
ref|XP_003078107.1|  putative transporter (ISS)                         162   6e-44   
ref|XP_005843441.1|  hypothetical protein CHLNCDRAFT_33124              161   8e-44   Chlorella variabilis
ref|XP_007510912.1|  predicted protein                                  161   9e-44   Bathycoccus prasinos
ref|XP_005647097.1|  DUF791-domain-containing protein                   161   1e-43   Coccomyxa subellipsoidea C-169
ref|XP_002949049.1|  hypothetical protein VOLCADRAFT_58801              160   2e-43   Volvox carteri f. nagariensis
gb|KDD74397.1|  DUF791 hypothetical protein                             153   1e-42   Helicosporidium sp. ATCC 50920
gb|EMT11170.1|  hypothetical protein F775_20203                         150   2e-39   
ref|XP_011398587.1|  Major facilitator superfamily domain-contain...    149   2e-39   Auxenochlorella protothecoides
ref|XP_005711678.1|  unnamed protein product                            148   7e-39   Chondrus crispus [carageen]
ref|XP_002948878.1|  hypothetical protein VOLCADRAFT_58628              144   2e-37   Volvox carteri f. nagariensis
gb|AEY68285.1|  MOT2                                                    143   6e-37   Chlamydomonas reinhardtii
ref|XP_001629395.1|  predicted protein                                  142   8e-37   Nematostella vectensis
gb|KIZ05289.1|  Major facilitator superfamily domain-containing p...    133   1e-35   Monoraphidium neglectum
gb|KIZ07268.1|  Major facilitator superfamily domain-containing p...    138   3e-35   Monoraphidium neglectum
ref|XP_009066968.1|  hypothetical protein LOTGIDRAFT_134790             136   1e-34   Lottia gigantea
ref|XP_005760520.1|  hypothetical protein EMIHUDRAFT_55298              130   1e-34   Emiliania huxleyi CCMP1516
gb|EYB98848.1|  hypothetical protein Y032_0127g1379                     133   1e-34   Ancylostoma ceylanicum
ref|XP_005645928.1|  DUF791-domain-containing protein                   136   2e-34   Coccomyxa subellipsoidea C-169
ref|XP_009028431.1|  hypothetical protein HELRODRAFT_88702              134   4e-34   Helobdella robusta
ref|XP_002129829.1|  PREDICTED: molybdate-anion transporter             133   2e-33   Ciona intestinalis [sea vase]
gb|ELT90330.1|  hypothetical protein CAPTEDRAFT_161785                  133   2e-33   Capitella teleta
ref|XP_002613663.1|  hypothetical protein BRAFLDRAFT_251617             130   9e-33   Branchiostoma floridae
gb|EAY88268.1|  hypothetical protein OsI_09721                          123   2e-32   Oryza sativa Indica Group [Indian rice]
ref|XP_005095963.1|  PREDICTED: major facilitator superfamily dom...    130   2e-32   
ref|XP_005712300.1|  unnamed protein product                            129   5e-32   Chondrus crispus [carageen]
ref|NP_500274.2|  Protein Y54G2A.4                                      129   6e-32   Caenorhabditis elegans [roundworm]
ref|XP_009310066.1|  hypothetical protein DQ04_02361000                 128   8e-32   Trypanosoma grayi
ref|XP_003091996.1|  hypothetical protein CRE_02678                     128   9e-32   Caenorhabditis remanei
ref|XP_005839624.1|  hypothetical protein GUITHDRAFT_161244             128   1e-31   Guillardia theta CCMP2712
gb|EGT53812.1|  hypothetical protein CAEBREN_10853                      127   2e-31   Caenorhabditis brenneri
emb|CDJ86726.1|  Protein of unknown function DUF791 domain contai...    126   6e-31   Haemonchus contortus [red stomach worm]
gb|ERG81318.1|  major facilitator superfamily domain-containing p...    125   1e-30   
gb|KHN75465.1|  Major facilitator superfamily domain-containing p...    125   1e-30   Toxocara canis
ref|XP_005537599.1|  hypothetical protein, conserved                    125   1e-30   Cyanidioschyzon merolae strain 10D
ref|XP_011417659.1|  PREDICTED: molybdate-anion transporter-like ...    124   2e-30   Crassostrea gigas
ref|XP_011417660.1|  PREDICTED: molybdate-anion transporter-like ...    124   2e-30   Crassostrea gigas
ref|XP_011417662.1|  PREDICTED: molybdate-anion transporter-like ...    124   2e-30   
gb|KHJ97825.1|  hypothetical protein OESDEN_02190                       122   3e-30   Oesophagostomum dentatum [nodule worm]
ref|XP_006674896.1|  hypothetical protein BATDEDRAFT_3104               123   4e-30   Batrachochytrium dendrobatidis JAM81
ref|XP_002680886.1|  DUF791 domain-containing protein                   124   4e-30   Naegleria gruberi strain NEG-M
ref|XP_001693567.1|  predicted protein                                  123   8e-30   Chlamydomonas reinhardtii
ref|XP_009011883.1|  hypothetical protein HELRODRAFT_73100              122   1e-29   Helobdella robusta
dbj|GAM17291.1|  hypothetical protein SAMD00019534_004660               122   2e-29   Acytostelium subglobosum LB1
ref|XP_002634990.1|  Hypothetical protein CBG13530                      121   3e-29   Caenorhabditis briggsae
ref|XP_004996271.1|  hypothetical protein PTSG_02768                    121   3e-29   Salpingoeca rosetta
ref|XP_001743669.1|  hypothetical protein                               119   1e-28   Monosiga brevicollis MX1
ref|XP_004994920.1|  hypothetical protein PTSG_04024                    118   3e-28   Salpingoeca rosetta
ref|XP_006822017.1|  PREDICTED: molybdate-anion transporter-like        118   4e-28   Saccoglossus kowalevskii
gb|KIZ07414.1|  Putative 2-oxoglutarate/malatecarrier protein           120   6e-28   Monoraphidium neglectum
ref|XP_004345242.1|  hypothetical protein CAOG_06493                    117   1e-27   Capsaspora owczarzaki ATCC 30864
ref|XP_006593767.1|  PREDICTED: molybdate-anion transporter-like ...    111   2e-27   
ref|XP_002598588.1|  hypothetical protein BRAFLDRAFT_118340             116   2e-27   Branchiostoma floridae
gb|KHN38992.1|  Major facilitator superfamily domain-containing p...    110   5e-27   Glycine soja [wild soybean]
ref|XP_005986190.1|  PREDICTED: major facilitator superfamily dom...    114   1e-26   Latimeria chalumnae
ref|XP_002296244.1|  possible transporter                               113   2e-26   Thalassiosira pseudonana CCMP1335
ref|XP_008910011.1|  hypothetical protein PPTG_14452                    112   2e-26   Phytophthora parasitica INRA-310
ref|XP_638927.1|  hypothetical protein DDB_G0283633                     113   4e-26   Dictyostelium discoideum AX4
gb|ETI40063.1|  hypothetical protein, variant                           112   4e-26   Phytophthora parasitica P1569
gb|ETP38042.1|  hypothetical protein, variant                           112   4e-26   Phytophthora parasitica P10297
ref|XP_003725529.1|  PREDICTED: major facilitator superfamily dom...    112   4e-26   
ref|XP_002785378.1|  conserved hypothetical protein                     112   6e-26   Perkinsus marinus ATCC 50983
gb|ETI40062.1|  hypothetical protein F443_14383                         112   8e-26   Phytophthora parasitica P1569
gb|KDR16031.1|  Major facilitator superfamily domain-containing p...    111   1e-25   Zootermopsis nevadensis
ref|XP_004351938.1|  hypothetical protein DFA_10048                     112   1e-25   Cavenderia fasciculata
ref|XP_008869688.1|  hypothetical protein H310_06411                    109   4e-25   Aphanomyces invadans
gb|EXX58336.1|  hypothetical protein RirG_198950                        109   4e-25   Rhizophagus irregularis DAOM 197198w
ref|XP_009035360.1|  hypothetical protein AURANDRAFT_2371               108   5e-25   Aureococcus anophagefferens
ref|XP_002906254.1|  Major Facilitator Superfamily (MFS)                109   5e-25   Phytophthora infestans T30-4
ref|XP_005767799.1|  hypothetical protein EMIHUDRAFT_52888              109   5e-25   Emiliania huxleyi CCMP1516
ref|XP_007518249.1|  PREDICTED: molybdate-anion transporter             109   6e-25   Erinaceus europaeus [common hedgehog]
gb|ESA03209.1|  hypothetical protein GLOINDRAFT_336864                  109   6e-25   
ref|XP_006904595.1|  PREDICTED: molybdate-anion transporter             108   9e-25   Pteropus alecto
ref|XP_004583240.1|  PREDICTED: major facilitator superfamily dom...    108   1e-24   Ochotona princeps [southern American pika]
ref|XP_003939279.1|  PREDICTED: molybdate-anion transporter             108   1e-24   Saimiri boliviensis boliviensis
ref|XP_008138967.1|  PREDICTED: molybdate-anion transporter             108   2e-24   Eptesicus fuscus
ref|XP_003216709.1|  PREDICTED: molybdate-anion transporter             107   2e-24   Anolis carolinensis [Carolina anole]
ref|XP_003285690.1|  hypothetical protein DICPUDRAFT_7152               107   2e-24   Dictyostelium purpureum
ref|XP_011374127.1|  PREDICTED: molybdate-anion transporter             107   2e-24   Pteropus vampyrus
ref|XP_005869250.1|  PREDICTED: major facilitator superfamily dom...    107   2e-24   Myotis brandtii
ref|XP_008254730.1|  PREDICTED: molybdate-anion transporter             107   3e-24   Oryctolagus cuniculus [domestic rabbit]
gb|EFA75523.1|  hypothetical protein PPL_11027                          107   3e-24   Heterostelium album PN500
ref|XP_004406286.1|  PREDICTED: major facilitator superfamily dom...    107   4e-24   
ref|XP_006741641.1|  PREDICTED: molybdate-anion transporter isofo...    107   4e-24   
gb|KIH47384.1|  hypothetical protein ANCDUO_22557                       106   4e-24   
ref|XP_009839473.1|  hypothetical protein H257_13601                    106   5e-24   
ref|XP_003790473.1|  PREDICTED: major facilitator superfamily dom...    107   5e-24   
ref|XP_002752566.1|  PREDICTED: molybdate-anion transporter             107   5e-24   
ref|XP_008531209.1|  PREDICTED: molybdate-anion transporter isofo...    106   6e-24   
ref|XP_010856219.1|  PREDICTED: molybdate-anion transporter             106   6e-24   
ref|NP_001068808.1|  molybdate-anion transporter precursor              106   6e-24   
ref|XP_008531208.1|  PREDICTED: molybdate-anion transporter isofo...    106   6e-24   
ref|XP_004006357.1|  PREDICTED: major facilitator superfamily dom...    106   6e-24   
gb|ELV10466.1|  Major facilitator superfamily domain-containing p...    107   7e-24   
ref|XP_006046698.1|  PREDICTED: major facilitator superfamily dom...    106   7e-24   
ref|XP_005611285.1|  PREDICTED: major facilitator superfamily dom...    106   7e-24   
ref|XP_009423598.1|  PREDICTED: molybdate-anion transporter isofo...    107   7e-24   
ref|XP_006095789.1|  PREDICTED: major facilitator superfamily dom...    107   8e-24   
ref|XP_004429161.1|  PREDICTED: major facilitator superfamily dom...    106   8e-24   
ref|XP_849836.2|  PREDICTED: major facilitator superfamily domain...    106   8e-24   
ref|XP_004053266.1|  PREDICTED: major facilitator superfamily dom...    107   8e-24   
ref|XP_001926545.3|  PREDICTED: major facilitator superfamily dom...    106   9e-24   
ref|XP_007448319.1|  PREDICTED: molybdate-anion transporter             106   9e-24   
ref|XP_008469914.1|  PREDICTED: molybdate-anion transporter-like        106   9e-24   
ref|XP_004374039.1|  PREDICTED: major facilitator superfamily dom...    106   9e-24   
ref|XP_005708147.1|  MFS transporter                                    105   1e-23   
ref|NP_598861.1|  molybdate-anion transporter precursor                 105   1e-23   
ref|XP_006182512.1|  PREDICTED: major facilitator superfamily dom...    105   1e-23   
ref|XP_004274312.1|  PREDICTED: major facilitator superfamily dom...    105   1e-23   
ref|XP_004894234.1|  PREDICTED: major facilitator superfamily dom...    105   1e-23   
ref|XP_005325080.1|  PREDICTED: major facilitator superfamily dom...    105   1e-23   
gb|EDL86851.1|  similar to expressed sequence AW556797 (predicted)      105   1e-23   
ref|XP_003831071.1|  PREDICTED: molybdate-anion transporter isofo...    107   1e-23   
ref|XP_010607606.1|  PREDICTED: molybdate-anion transporter             105   1e-23   
ref|XP_006203102.1|  PREDICTED: major facilitator superfamily dom...    105   1e-23   
ref|NP_001119754.1|  molybdate-anion transporter precursor              105   1e-23   
ref|XP_007947716.1|  PREDICTED: molybdate-anion transporter             105   1e-23   
ref|XP_009685832.1|  PREDICTED: molybdate-anion transporter             105   1e-23   
ref|XP_003252118.1|  PREDICTED: LOW QUALITY PROTEIN: major facili...    107   1e-23   
ref|XP_002923297.1|  PREDICTED: molybdate-anion transporter             105   1e-23   
ref|XP_008070242.1|  PREDICTED: molybdate-anion transporter             105   1e-23   
ref|XP_008702856.1|  PREDICTED: molybdate-anion transporter             105   1e-23   
ref|XP_004637935.1|  PREDICTED: major facilitator superfamily dom...    105   1e-23   
ref|XP_003988805.1|  PREDICTED: molybdate-anion transporter             105   1e-23   
ref|XP_005397220.1|  PREDICTED: major facilitator superfamily dom...    105   1e-23   
ref|XP_004774689.1|  PREDICTED: major facilitator superfamily dom...    105   1e-23   
ref|XP_003476311.1|  PREDICTED: major facilitator superfamily dom...    105   1e-23   
ref|XP_006981913.1|  PREDICTED: molybdate-anion transporter             105   1e-23   
ref|XP_009515240.1|  hypothetical protein PHYSODRAFT_467901             105   1e-23   
ref|XP_009179084.1|  PREDICTED: molybdate-anion transporter isofo...    106   1e-23   
ref|XP_005571048.1|  PREDICTED: major facilitator superfamily dom...    106   2e-23   
ref|XP_007125830.1|  PREDICTED: molybdate-anion transporter             105   2e-23   
ref|XP_006169122.1|  PREDICTED: major facilitator superfamily dom...    105   2e-23   
ref|XP_004711396.1|  PREDICTED: major facilitator superfamily dom...    105   2e-23   
ref|NP_001164261.1|  molybdate-anion transporter isoform 1              106   2e-23   
ref|XP_008001597.1|  PREDICTED: molybdate-anion transporter isofo...    106   2e-23   
gb|KFQ93931.1|  Major facilitator superfamily domain-containing p...    103   2e-23   
ref|XP_008573068.1|  PREDICTED: molybdate-anion transporter             105   2e-23   
ref|XP_007179495.1|  PREDICTED: molybdate-anion transporter isofo...    105   2e-23   
ref|XP_010372235.1|  PREDICTED: molybdate-anion transporter isofo...    106   2e-23   
gb|KFV74249.1|  Major facilitator superfamily domain-containing p...    103   2e-23   
ref|XP_008836744.1|  PREDICTED: molybdate-anion transporter             105   2e-23   
ref|XP_005067359.1|  PREDICTED: major facilitator superfamily dom...    105   2e-23   
ref|XP_007645970.1|  PREDICTED: molybdate-anion transporter             105   2e-23   
ref|XP_010282057.1|  PREDICTED: molybdate-anion transporter             104   2e-23   
ref|XP_005353877.1|  PREDICTED: major facilitator superfamily dom...    105   2e-23   
ref|XP_006030660.1|  PREDICTED: major facilitator superfamily dom...    104   3e-23   
gb|EPY82978.1|  major facilitator superfamily domain-containing p...    105   3e-23   
ref|XP_007058581.1|  PREDICTED: molybdate-anion transporter             104   3e-23   
ref|XP_006278710.1|  PREDICTED: major facilitator superfamily dom...    104   3e-23   
ref|XP_010595387.1|  PREDICTED: molybdate-anion transporter isofo...    104   3e-23   
ref|NP_116278.3|  molybdate-anion transporter isoform 2 precursor       104   3e-23   
dbj|BAC11137.1|  unnamed protein product                                104   3e-23   
gb|KFQ66548.1|  Major facilitator superfamily domain-containing p...    103   3e-23   
ref|XP_008001596.1|  PREDICTED: molybdate-anion transporter isofo...    104   3e-23   
ref|XP_009459399.1|  PREDICTED: molybdate-anion transporter             104   3e-23   
ref|XP_522401.3|  PREDICTED: molybdate-anion transporter isoform X1     104   3e-23   
ref|NP_001247568.1|  major facilitator superfamily domain-contain...    104   3e-23   
ref|XP_005291947.1|  PREDICTED: molybdate-anion transporter             104   3e-23   
ref|XP_010372234.1|  PREDICTED: molybdate-anion transporter isofo...    104   3e-23   
ref|XP_006139129.1|  PREDICTED: major facilitator superfamily dom...    104   4e-23   
ref|XP_004053265.1|  PREDICTED: major facilitator superfamily dom...    104   4e-23   
emb|CAH92509.1|  hypothetical protein                                   104   4e-23   
gb|ETE71704.1|  Major facilitator superfamily domain-containing p...    104   4e-23   
ref|XP_004467492.1|  PREDICTED: major facilitator superfamily dom...    104   4e-23   
ref|XP_008001595.1|  PREDICTED: molybdate-anion transporter isofo...    104   4e-23   
ref|XP_007909732.1|  PREDICTED: molybdate-anion transporter             104   4e-23   
ref|XP_010569788.1|  PREDICTED: LOW QUALITY PROTEIN: molybdate-an...    104   4e-23   
ref|XP_010595381.1|  PREDICTED: molybdate-anion transporter isofo...    104   4e-23   
ref|XP_010372233.1|  PREDICTED: molybdate-anion transporter isofo...    104   4e-23   
ref|XP_005954397.1|  PREDICTED: major facilitator superfamily dom...    103   5e-23   
ref|XP_002769054.1|  conserved hypothetical protein                     103   5e-23   
dbj|BAC05108.1|  unnamed protein product                                103   6e-23   
ref|XP_004601576.1|  PREDICTED: major facilitator superfamily dom...    103   6e-23   
emb|CAE45795.1|  hypothetical protein                                   104   6e-23   
gb|AAH67795.1|  Major facilitator superfamily domain containing 5       103   6e-23   
ref|XP_006870033.1|  PREDICTED: molybdate-anion transporter             103   7e-23   
ref|XP_003906502.2|  PREDICTED: molybdate-anion transporter isofo...    104   7e-23   
ref|XP_007424849.1|  PREDICTED: molybdate-anion transporter isofo...    103   7e-23   
ref|XP_004692764.1|  PREDICTED: major facilitator superfamily dom...    103   8e-23   
gb|EJK59034.1|  hypothetical protein THAOC_20800                        104   9e-23   
ref|XP_001639832.1|  predicted protein                                  102   1e-22   
ref|XP_001364537.3|  PREDICTED: molybdate-anion transporter             102   2e-22   
ref|XP_004649946.1|  PREDICTED: major facilitator superfamily dom...    102   2e-22   
gb|KFO79820.1|  Major facilitator superfamily domain-containing p...    100   2e-22   
gb|KIM91338.1|  hypothetical protein PILCRDRAFT_810609                  102   2e-22   
gb|EPS98353.1|  hypothetical protein FOMPIDRAFT_1042543                 102   2e-22   
ref|XP_008806813.1|  PREDICTED: uncharacterized protein LOC103719381    100   3e-22   
ref|XP_009564170.1|  PREDICTED: molybdate-anion transporter             101   4e-22   
ref|XP_007314099.1|  hypothetical protein SERLADRAFT_354256             101   4e-22   
ref|NP_001126474.1|  molybdate-anion transporter precursor              101   6e-22   
gb|ESL05096.1|  hypothetical protein TRSC58_07293                       100   6e-22   
gb|KIM37051.1|  hypothetical protein M413DRAFT_448770                   101   7e-22   
gb|EFX76944.1|  hypothetical protein DAPPUDRAFT_321809                  100   7e-22   
gb|KIJ53591.1|  hypothetical protein M422DRAFT_73890                    100   8e-22   
ref|XP_011415636.1|  PREDICTED: molybdate-anion transporter-like        100   9e-22   
ref|XP_011445033.1|  PREDICTED: molybdate-anion transporter-like        100   9e-22   
emb|CCD35046.1|  similar to MFS transporter                             100   1e-21   
ref|XP_001551091.1|  hypothetical protein BC1G_10348                    100   1e-21   
gb|EMR85126.1|  putative major facilitator superfamily domain-con...    100   1e-21   
gb|KII87680.1|  hypothetical protein PLICRDRAFT_42186                   100   1e-21   
dbj|BAN21078.1|  unkown protein                                         100   1e-21   
gb|KDQ27002.1|  hypothetical protein PLEOSDRAFT_1077776                 100   2e-21   
gb|EFQ34963.1|  major facilitator superfamily transporter               100   2e-21   
ref|XP_002765274.1|  conserved hypothetical protein                     102   2e-21   
gb|KIK68623.1|  hypothetical protein GYMLUDRAFT_215372                99.4    2e-21   
ref|XP_002287342.1|  hypothetical protein THAPSDRAFT_261403           99.0    2e-21   
gb|ESZ94295.1|  hypothetical protein SBOR_5291                        99.8    2e-21   
gb|KFM79688.1|  hypothetical protein X975_13749                       99.8    3e-21   
ref|XP_003141646.1|  hypothetical protein LOAG_06062                  99.8    3e-21   
ref|XP_008544406.1|  PREDICTED: molybdate-anion transporter-like      99.0    3e-21   
gb|EFO22427.2|  hypothetical protein LOAG_06062                       99.8    3e-21   
ref|XP_009052059.1|  hypothetical protein LOTGIDRAFT_115058           99.0    4e-21   
ref|XP_006757074.1|  PREDICTED: molybdate-anion transporter           98.6    5e-21   
gb|KFA77473.1|  hypothetical protein S40288_08706                     98.2    7e-21   
emb|CEG65490.1|  hypothetical protein RMATCC62417_02271               97.8    7e-21   
gb|KDO26128.1|  hypothetical protein SPRG_08489                       97.8    9e-21   
emb|CEI88625.1|  hypothetical protein RMCBS344292_03007               97.4    9e-21   
gb|KDQ18716.1|  hypothetical protein BOTBODRAFT_29092                 98.2    9e-21   
ref|XP_009932444.1|  PREDICTED: separin-like                            100   1e-20   
ref|XP_001885546.1|  predicted protein                                97.4    1e-20   
ref|XP_001943101.2|  PREDICTED: molybdate-anion transporter-like      98.2    1e-20   
gb|KIJ95073.1|  hypothetical protein K443DRAFT_683321                 98.2    1e-20   
ref|XP_007280468.1|  major facilitator superfamily domain contain...  97.1    1e-20   
gb|KDN59950.1|  putative major facilitator superfamily transporter    97.1    2e-20   
gb|EMD35660.1|  hypothetical protein CERSUDRAFT_53292                 96.7    2e-20   
ref|XP_007272064.1|  DUF791-domain-containing protein                 97.4    2e-20   
gb|KDR79837.1|  hypothetical protein GALMADRAFT_62352                 96.3    2e-20   
gb|EQB47341.1|  major facilitator superfamily transporter             96.7    3e-20   
gb|KDN72042.1|  putative major facilitator superfamily transporter    96.3    3e-20   
ref|XP_008610385.1|  hypothetical protein SDRG_06384                  95.9    4e-20   
gb|KIM70903.1|  hypothetical protein SCLCIDRAFT_1207094               96.3    5e-20   
emb|CEG69277.1|  hypothetical protein RMATCC62417_05377               95.5    5e-20   
gb|KIK21982.1|  hypothetical protein PISMIDRAFT_680734                95.9    5e-20   
ref|XP_007601358.1|  major facilitator superfamily transporter        95.5    6e-20   
gb|KFA73020.1|  hypothetical protein S40288_03286                     95.5    6e-20   
gb|KFA60243.1|  hypothetical protein S40285_08076                     95.5    7e-20   
ref|XP_003027448.1|  hypothetical protein SCHCODRAFT_40127            95.1    7e-20   
ref|XP_006967447.1|  predicted protein                                95.1    7e-20   
ref|XP_003643503.1|  PREDICTED: major facilitator superfamily dom...  95.1    8e-20   
ref|XP_005822964.1|  hypothetical protein GUITHDRAFT_50886            94.4    1e-19   
emb|CCF33927.1|  major facilitator superfamily transporter            94.7    1e-19   
ref|XP_009549626.1|  MFS sugar transporter                            94.0    1e-19   
gb|KIK34185.1|  hypothetical protein CY34DRAFT_98443                  94.7    1e-19   
gb|KIP07207.1|  hypothetical protein PHLGIDRAFT_19221                 94.7    1e-19   
gb|KFR10316.1|  Major facilitator superfamily domain-containing p...  92.8    2e-19   
gb|KIH90337.1|  hypothetical protein SPBR_00536                       95.1    2e-19   
ref|XP_007301874.1|  DUF791-domain-containing protein                 95.5    2e-19   
ref|XP_007593001.1|  major facilitator superfamily transporter        94.4    2e-19   
gb|EHK16966.1|  hypothetical protein TRIVIDRAFT_14632                 94.0    2e-19   
gb|KEY75016.1|  hypothetical protein S7711_01357                      94.4    3e-19   
ref|XP_007848248.1|  major facilitator superfamily transporter do...  94.0    3e-19   
gb|EFQ33535.1|  major facilitator superfamily transporter             93.6    3e-19   
gb|ERS97936.1|  hypothetical protein HMPREF1624_06107                 94.4    3e-19   
ref|XP_007835477.1|  hypothetical protein PFICI_08705                 92.0    3e-19   
gb|ETO11902.1|  hypothetical protein RFI_25472                        94.4    4e-19   
ref|XP_007235801.1|  PREDICTED: molybdate-anion transporter-like      93.6    4e-19   
gb|ENH85993.1|  major facilitator superfamily domain containing p...  93.6    4e-19   
emb|CEP07653.1|  hypothetical protein                                 92.4    4e-19   
ref|XP_001596052.1|  hypothetical protein SS1G_02268                  93.2    5e-19   
ref|XP_007276689.1|  major facilitator superfamily transporter do...  92.8    5e-19   
ref|XP_002177156.1|  predicted protein                                93.6    6e-19   
gb|EQB53973.1|  major facilitator superfamily transporter             92.4    7e-19   
gb|KFA51840.1|  hypothetical protein S40293_04116                     92.8    8e-19   
gb|KFZ03297.1|  hypothetical protein V502_11070                       94.0    8e-19   
ref|XP_006758173.1|  PREDICTED: molybdate-anion transporter-like      92.4    9e-19   
emb|CAP32314.2|  Protein CBG13530                                     92.4    9e-19   
gb|KEZ42983.1|  Major facilitator superfamily transporter             92.0    9e-19   
gb|ELK34573.1|  Major facilitator superfamily domain-containing p...  92.0    9e-19   
ref|XP_002178226.1|  transport protein                                93.2    9e-19   
ref|NP_001002713.1|  molybdate-anion transporter precursor            92.8    1e-18   
gb|KFO04556.1|  Major facilitator superfamily domain-containing p...  90.5    1e-18   
gb|EMF12748.1|  DUF791-domain-containing protein                      91.3    1e-18   
gb|KIK98067.1|  hypothetical protein PAXRUDRAFT_134967                92.4    1e-18   
emb|CDQ89926.1|  unnamed protein product                              92.8    1e-18   
ref|XP_007294327.1|  putative major facilitator superfamily domai...  92.0    1e-18   
gb|EQK98084.1|  major facilitator superfamily domain containing p...  92.0    1e-18   
ref|XP_007671766.1|  hypothetical protein BAUCODRAFT_144233           91.7    1e-18   
ref|XP_003718418.1|  hypothetical protein MGG_00612                   91.7    1e-18   
gb|KIO25270.1|  hypothetical protein M407DRAFT_75927                  92.0    2e-18   
emb|CDS05439.1|  hypothetical protein LRAMOSA07967                    91.3    2e-18   
gb|ENH84052.1|  major facilitator superfamily domain-containing p...  91.7    2e-18   
ref|XP_010298719.1|  PREDICTED: molybdate-anion transporter           90.5    2e-18   
gb|KIJ14636.1|  hypothetical protein PAXINDRAFT_169581                91.7    2e-18   
emb|CDQ59494.1|  unnamed protein product                              91.3    2e-18   
ref|XP_003963205.1|  PREDICTED: major facilitator superfamily dom...  91.7    2e-18   
sp|Q1KKV8.1|MFSD5_TAKRU  RecName: Full=Molybdate-anion transporte...  91.7    2e-18   
ref|XP_010873591.1|  PREDICTED: molybdate-anion transporter           91.7    3e-18   
gb|EPB84903.1|  hypothetical protein HMPREF1544_08338                 90.9    3e-18   
emb|CAG07395.1|  unnamed protein product                              91.3    3e-18   
ref|XP_006463513.1|  hypothetical protein AGABI2DRAFT_225360          91.3    3e-18   
gb|ENH72779.1|  Major facilitator superfamily domain-containing p...  90.5    3e-18   
ref|XP_005914793.1|  PREDICTED: major facilitator superfamily dom...  90.5    6e-18   
ref|XP_004558848.1|  PREDICTED: major facilitator superfamily dom...  90.5    6e-18   
ref|XP_006785718.1|  PREDICTED: molybdate-anion transporter-like      90.5    6e-18   
ref|XP_003015498.1|  hypothetical protein ARB_06624                   88.2    6e-18   
gb|EHK47415.1|  hypothetical protein TRIATDRAFT_216290                89.7    6e-18   
ref|XP_007836648.1|  hypothetical protein PFICI_09876                 90.1    6e-18   
ref|XP_002163438.1|  PREDICTED: major facilitator superfamily dom...  90.1    6e-18   
gb|EGD96180.1|  hypothetical protein TESG_03633                       90.1    7e-18   
gb|EZF29049.1|  hypothetical protein H101_07267                       90.1    7e-18   
ref|XP_003023886.1|  hypothetical protein TRV_01936                   88.2    7e-18   
gb|ELR02269.1|  hypothetical protein GMDG_05339                       90.1    7e-18   



>gb|KJB23937.1| hypothetical protein B456_004G122300 [Gossypium raimondii]
Length=257

 Score =   236 bits (601),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 135/151 (89%), Positives = 149/151 (99%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME+FY++VFGAL AVVAA+ELSKTSKDRI+TSP FN+FKNNYL+VYSLMMAGDWLQGPYV
Sbjct  1    MELFYFVVFGALGAVVAALELSKTSKDRINTSPAFNSFKNNYLLVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+TYG+GKGEIGQLFIAGFGSSMLFGTIVGSLADKQGR+RACVTYCITYILSCITKH
Sbjct  61   YYLYSTYGFGKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRRRACVTYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SP+YKVLM+GR+LGGIATSLLFS+FESWLVA
Sbjct  121  SPEYKVLMIGRVLGGIATSLLFSAFESWLVA  151



>gb|KJB23939.1| hypothetical protein B456_004G122300 [Gossypium raimondii]
Length=349

 Score =   236 bits (603),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 135/151 (89%), Positives = 149/151 (99%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME+FY++VFGAL AVVAA+ELSKTSKDRI+TSP FN+FKNNYL+VYSLMMAGDWLQGPYV
Sbjct  1    MELFYFVVFGALGAVVAALELSKTSKDRINTSPAFNSFKNNYLLVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+TYG+GKGEIGQLFIAGFGSSMLFGTIVGSLADKQGR+RACVTYCITYILSCITKH
Sbjct  61   YYLYSTYGFGKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRRRACVTYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SP+YKVLM+GR+LGGIATSLLFS+FESWLVA
Sbjct  121  SPEYKVLMIGRVLGGIATSLLFSAFESWLVA  151



>gb|KJB23938.1| hypothetical protein B456_004G122300 [Gossypium raimondii]
Length=356

 Score =   236 bits (602),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 135/151 (89%), Positives = 149/151 (99%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME+FY++VFGAL AVVAA+ELSKTSKDRI+TSP FN+FKNNYL+VYSLMMAGDWLQGPYV
Sbjct  1    MELFYFVVFGALGAVVAALELSKTSKDRINTSPAFNSFKNNYLLVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+TYG+GKGEIGQLFIAGFGSSMLFGTIVGSLADKQGR+RACVTYCITYILSCITKH
Sbjct  61   YYLYSTYGFGKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRRRACVTYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SP+YKVLM+GR+LGGIATSLLFS+FESWLVA
Sbjct  121  SPEYKVLMIGRVLGGIATSLLFSAFESWLVA  151



>ref|XP_009757796.1| PREDICTED: molybdate-anion transporter [Nicotiana sylvestris]
Length=462

 Score =   239 bits (610),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 139/151 (92%), Positives = 148/151 (98%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME FY+LVFGAL+AVVAA+ELSKTSKDRI+TSP FN+FKNNY++VYSLMMAGDWLQGPYV
Sbjct  1    MEAFYFLVFGALSAVVAALELSKTSKDRITTSPAFNSFKNNYILVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLYTTYGYGKGEIG LFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH
Sbjct  61   YYLYTTYGYGKGEIGHLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQYK+LMLGRILGGIATSLLFS+FESWLVA
Sbjct  121  SPQYKILMLGRILGGIATSLLFSAFESWLVA  151



>ref|XP_009599532.1| PREDICTED: molybdate-anion transporter [Nicotiana tomentosiformis]
Length=460

 Score =   239 bits (610),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 139/151 (92%), Positives = 148/151 (98%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME FY+LVFGAL+AVVAA+ELSKTSKDRI+TSP FN+FKNNY++VYSLMMAGDWLQGPYV
Sbjct  1    MEAFYFLVFGALSAVVAALELSKTSKDRITTSPAFNSFKNNYILVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLYTTYGYGKGEIG LFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH
Sbjct  61   YYLYTTYGYGKGEIGHLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQYK+LMLGRILGGIATSLLFS+FESWLVA
Sbjct  121  SPQYKILMLGRILGGIATSLLFSAFESWLVA  151



>gb|KJB52531.1| hypothetical protein B456_008G266400 [Gossypium raimondii]
Length=362

 Score =   236 bits (601),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 134/151 (89%), Positives = 148/151 (98%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME+FY++VFGAL AVVAA+ELSK SKDRI+TSP FN+FKNNYL+VYSLMMAGDWLQGPYV
Sbjct  1    MELFYFMVFGALGAVVAALELSKNSKDRINTSPAFNSFKNNYLVVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+TYG+GKGEIGQLFIAGFGSSMLFGTIVGSLADKQGR+RACVTYCITYILSCITKH
Sbjct  61   YYLYSTYGFGKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRRRACVTYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQYK+LM+GR+LGGIATSLLFS+FESWLVA
Sbjct  121  SPQYKILMIGRVLGGIATSLLFSAFESWLVA  151



>ref|XP_002318449.1| hypothetical protein POPTR_0012s02730g [Populus trichocarpa]
 gb|ABK93582.1| unknown [Populus trichocarpa]
 gb|EEE96669.1| hypothetical protein POPTR_0012s02730g [Populus trichocarpa]
Length=459

 Score =   238 bits (608),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 135/151 (89%), Positives = 147/151 (97%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME FYYLVFGAL+AVV  IELSKT+KDRI+TSP FN+FKNNYL+VYSLMMAGDWLQGPYV
Sbjct  1    MEAFYYLVFGALSAVVLGIELSKTTKDRINTSPAFNSFKNNYLVVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            Y+LYTTYG+GKG+IGQLFIAGFGSSMLFGTIVGSLADKQGR+RACVTYCITYILSCITKH
Sbjct  61   YFLYTTYGFGKGDIGQLFIAGFGSSMLFGTIVGSLADKQGRRRACVTYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQY++LM+GRILGGIATSLLFSSFESWLVA
Sbjct  121  SPQYRILMIGRILGGIATSLLFSSFESWLVA  151



>ref|XP_006849199.1| hypothetical protein AMTR_s00027p00219390 [Amborella trichopoda]
 gb|ERN10780.1| hypothetical protein AMTR_s00027p00219390 [Amborella trichopoda]
Length=461

 Score =   238 bits (606),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 132/151 (87%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            MEVFYYLVFG L+ VVA +ELSKTSKDRI+TS  FN+FKNNYL+VYSLMMAGDWLQGPYV
Sbjct  1    MEVFYYLVFGVLSVVVAVLELSKTSKDRITTSSAFNSFKNNYLVVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            Y+LY+ YG+ KGEIG+LFIAGFGSSMLFGT+VGSLADKQGRKRAC+TYCITYILSCITKH
Sbjct  61   YFLYSQYGFSKGEIGRLFIAGFGSSMLFGTVVGSLADKQGRKRACITYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQYKVLMLGRILGGIATSLLFS+FESWLVA
Sbjct  121  SPQYKVLMLGRILGGIATSLLFSAFESWLVA  151



>ref|XP_011044697.1| PREDICTED: molybdate-anion transporter-like [Populus euphratica]
Length=459

 Score =   238 bits (606),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 134/151 (89%), Positives = 147/151 (97%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME FYYLVFGAL+AVV  +E+SKT+KDRI+TSP FN+FKNNYL+VYSLMMAGDWLQGPYV
Sbjct  1    MEAFYYLVFGALSAVVFGVEISKTTKDRINTSPAFNSFKNNYLVVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            Y+LYTTYG+GKGEIGQLFIAGFGSSMLFGTIVGSLADKQGR+RACVTYCITYILSCITKH
Sbjct  61   YFLYTTYGFGKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRRRACVTYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQY+VLM+GR+LGGIATSLLFSSFESWLVA
Sbjct  121  SPQYRVLMIGRVLGGIATSLLFSSFESWLVA  151



>gb|KDP27322.1| hypothetical protein JCGZ_20823 [Jatropha curcas]
Length=459

 Score =   237 bits (604),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 132/151 (87%), Positives = 146/151 (97%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            MEVFYYLVFG L AVVA +ELSK++KDRI+TSP FN+FKNNYL+VYSLMMAGDWLQGPYV
Sbjct  1    MEVFYYLVFGGLGAVVALLELSKSTKDRINTSPAFNSFKNNYLVVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            Y+LY+ YG+GKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRAC+TYCITYILSCITKH
Sbjct  61   YFLYSQYGFGKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACITYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQY+VLM+GR+LGGIATSLLFS+FESWLVA
Sbjct  121  SPQYRVLMVGRVLGGIATSLLFSAFESWLVA  151



>ref|XP_002515682.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF46734.1| conserved hypothetical protein [Ricinus communis]
Length=460

 Score =   237 bits (604),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 134/151 (89%), Positives = 148/151 (98%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            MEVF+Y+VFG L AVVAA+ELSKT+KDRI+TSP FN+FKNNYL+VYSLMMAGDWLQGPYV
Sbjct  1    MEVFFYMVFGGLGAVVAALELSKTNKDRINTSPAFNSFKNNYLLVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            Y+LY+TYG+GKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRAC+TYCITYILSCITKH
Sbjct  61   YFLYSTYGFGKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACITYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQYKVLM+GR+LGGIATSLLFS+FESWLVA
Sbjct  121  SPQYKVLMIGRVLGGIATSLLFSAFESWLVA  151



>gb|KDO59676.1| hypothetical protein CISIN_1g012629mg [Citrus sinensis]
Length=340

 Score =   233 bits (595),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 135/151 (89%), Positives = 148/151 (98%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME+F+YLVFGAL AVVAA+ELSKT+KDRI+TS  FN+FKNNYL+VYSLMMAGDWLQGPYV
Sbjct  1    MEMFFYLVFGALGAVVAALELSKTNKDRINTSSAFNSFKNNYLLVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+TYG+GKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYC+TYILSCITKH
Sbjct  61   YYLYSTYGFGKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCLTYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQYK+LM+GRILGGIATSLLFS+FESWLVA
Sbjct  121  SPQYKILMIGRILGGIATSLLFSAFESWLVA  151



>gb|KJB52532.1| hypothetical protein B456_008G266400 [Gossypium raimondii]
Length=417

 Score =   235 bits (600),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 134/151 (89%), Positives = 148/151 (98%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME+FY++VFGAL AVVAA+ELSK SKDRI+TSP FN+FKNNYL+VYSLMMAGDWLQGPYV
Sbjct  1    MELFYFMVFGALGAVVAALELSKNSKDRINTSPAFNSFKNNYLVVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+TYG+GKGEIGQLFIAGFGSSMLFGTIVGSLADKQGR+RACVTYCITYILSCITKH
Sbjct  61   YYLYSTYGFGKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRRRACVTYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQYK+LM+GR+LGGIATSLLFS+FESWLVA
Sbjct  121  SPQYKILMIGRVLGGIATSLLFSAFESWLVA  151



>ref|XP_011043683.1| PREDICTED: molybdate-anion transporter-like [Populus euphratica]
Length=459

 Score =   236 bits (603),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 134/151 (89%), Positives = 147/151 (97%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME FYYLVFGAL+AVV  IELSKT+KDRI+TSP FN+FKNNYL+VYSLMMAGDWLQGPYV
Sbjct  1    MEAFYYLVFGALSAVVLGIELSKTTKDRINTSPAFNSFKNNYLVVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            Y+LYTTYG+GKG+IG+LFIAGFGSSMLFGTIVGSLADKQGR+RACVTYCITYILSCITKH
Sbjct  61   YFLYTTYGFGKGDIGRLFIAGFGSSMLFGTIVGSLADKQGRRRACVTYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQY+VLM+GR+LGGIATSLLFSSFESWLVA
Sbjct  121  SPQYRVLMIGRVLGGIATSLLFSSFESWLVA  151



>ref|XP_011043684.1| PREDICTED: molybdate-anion transporter-like [Populus euphratica]
Length=459

 Score =   236 bits (602),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 134/151 (89%), Positives = 147/151 (97%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME FYYLVFGAL+AVV  IELSKT+KDRI+TSP FN+FKNNYL+VYSLMMAGDWLQGPYV
Sbjct  1    MEAFYYLVFGALSAVVLGIELSKTTKDRINTSPAFNSFKNNYLVVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            Y+LYTTYG+GKG+IG+LFIAGFGSSMLFGTIVGSLADKQGR+RACVTYCITYILSCITKH
Sbjct  61   YFLYTTYGFGKGDIGRLFIAGFGSSMLFGTIVGSLADKQGRRRACVTYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQY++LM+GRILGGIATSLLFSSFESWLVA
Sbjct  121  SPQYRILMIGRILGGIATSLLFSSFESWLVA  151



>ref|XP_010474625.1| PREDICTED: molybdate-anion transporter-like, partial [Camelina 
sativa]
Length=338

 Score =   233 bits (593),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 131/151 (87%), Positives = 147/151 (97%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME+FY++VFG LAA+VA +ELSK++KDRI+TSP FN+FKNNYL+VYSLMMAGDWLQGPYV
Sbjct  1    MEIFYFVVFGGLAAIVAGLELSKSNKDRINTSPAFNSFKNNYLLVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+TYG+GKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRA +TYCITYILSCITKH
Sbjct  61   YYLYSTYGFGKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRASITYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQYKVLM+GR+LGGIATSLLFS+FESWLVA
Sbjct  121  SPQYKVLMVGRVLGGIATSLLFSAFESWLVA  151



>gb|KJB37398.1| hypothetical protein B456_006G202900 [Gossypium raimondii]
Length=321

 Score =   232 bits (591),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 131/151 (87%), Positives = 149/151 (99%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME+FY++VFGAL+AVVAA+ELSK SKDRI+TSP FN+FKNNYL+VYSLMMAGDWLQGPYV
Sbjct  1    MELFYFMVFGALSAVVAALELSKNSKDRINTSPAFNSFKNNYLVVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+TYG+GKG+IGQLFIAGFGSSMLFGTIVGSLADKQGRKRAC+TYCITYILSCITKH
Sbjct  61   YYLYSTYGFGKGDIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACITYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SP+Y++LM+GR+LGGIATSLLFS+FESWLVA
Sbjct  121  SPEYRILMIGRVLGGIATSLLFSAFESWLVA  151



>ref|XP_002321382.1| hypothetical protein POPTR_0015s01050g [Populus trichocarpa]
 gb|EEF05509.1| hypothetical protein POPTR_0015s01050g [Populus trichocarpa]
Length=459

 Score =   236 bits (601),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 133/151 (88%), Positives = 146/151 (97%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME FYYLVF AL+AVV  +E+SKT+KDRI+TSP FN+FKNNYL+VYSLMMAGDWLQGPYV
Sbjct  1    MEAFYYLVFAALSAVVFGVEISKTTKDRINTSPAFNSFKNNYLVVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            Y+LYTTYG+GKGEIGQLFIAGFGSSMLFGTIVGSLADKQGR+RACVTYCITYILSCITKH
Sbjct  61   YFLYTTYGFGKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRRRACVTYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQY+VLM+GR+LGGIATSLLFSSFESWLVA
Sbjct  121  SPQYRVLMIGRVLGGIATSLLFSSFESWLVA  151



>gb|KJB39450.1| hypothetical protein B456_007G016500 [Gossypium raimondii]
Length=347

 Score =   233 bits (593),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 133/151 (88%), Positives = 147/151 (97%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME+FY++VFGAL AVVAA+ELSK SKDRI+TS  FN+FKNNYL+VYSLMMAGDWLQGPYV
Sbjct  1    MELFYFVVFGALGAVVAALELSKNSKDRINTSSAFNSFKNNYLVVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+TYG+GKGEIGQLFIAGFGSSMLFGTIVGSLADKQGR+RACVTYCITYILSCITKH
Sbjct  61   YYLYSTYGFGKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRRRACVTYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQYK+LM+GR+LGGIATSLLFS+FESWLVA
Sbjct  121  SPQYKILMVGRVLGGIATSLLFSAFESWLVA  151



>gb|KJB23940.1| hypothetical protein B456_004G122300 [Gossypium raimondii]
Length=448

 Score =   235 bits (600),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 135/151 (89%), Positives = 149/151 (99%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME+FY++VFGAL AVVAA+ELSKTSKDRI+TSP FN+FKNNYL+VYSLMMAGDWLQGPYV
Sbjct  1    MELFYFVVFGALGAVVAALELSKTSKDRINTSPAFNSFKNNYLLVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+TYG+GKGEIGQLFIAGFGSSMLFGTIVGSLADKQGR+RACVTYCITYILSCITKH
Sbjct  61   YYLYSTYGFGKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRRRACVTYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SP+YKVLM+GR+LGGIATSLLFS+FESWLVA
Sbjct  121  SPEYKVLMIGRVLGGIATSLLFSAFESWLVA  151



>gb|KJB52533.1| hypothetical protein B456_008G266400 [Gossypium raimondii]
Length=448

 Score =   235 bits (600),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 134/151 (89%), Positives = 148/151 (98%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME+FY++VFGAL AVVAA+ELSK SKDRI+TSP FN+FKNNYL+VYSLMMAGDWLQGPYV
Sbjct  1    MELFYFMVFGALGAVVAALELSKNSKDRINTSPAFNSFKNNYLVVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+TYG+GKGEIGQLFIAGFGSSMLFGTIVGSLADKQGR+RACVTYCITYILSCITKH
Sbjct  61   YYLYSTYGFGKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRRRACVTYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQYK+LM+GR+LGGIATSLLFS+FESWLVA
Sbjct  121  SPQYKILMIGRVLGGIATSLLFSAFESWLVA  151



>gb|KHG07536.1| Major facilitator superfamily domain-containing protein 5 [Gossypium 
arboreum]
Length=460

 Score =   236 bits (601),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 135/151 (89%), Positives = 149/151 (99%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME+FY++VFGAL AVVAA+ELSKTSKDRI+TSP FN+FKNNYL+VYSLMMAGDWLQGPYV
Sbjct  1    MELFYFVVFGALGAVVAALELSKTSKDRINTSPAFNSFKNNYLLVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+TYG+GKGEIGQLFIAGFGSSMLFGTIVGSLADKQGR+RACVTYCITYILSCITKH
Sbjct  61   YYLYSTYGFGKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRRRACVTYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SP+YKVLM+GR+LGGIATSLLFS+FESWLVA
Sbjct  121  SPEYKVLMIGRVLGGIATSLLFSAFESWLVA  151



>gb|KDO59675.1| hypothetical protein CISIN_1g012629mg [Citrus sinensis]
Length=360

 Score =   233 bits (593),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 135/151 (89%), Positives = 148/151 (98%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME+F+YLVFGAL AVVAA+ELSKT+KDRI+TS  FN+FKNNYL+VYSLMMAGDWLQGPYV
Sbjct  1    MEMFFYLVFGALGAVVAALELSKTNKDRINTSSAFNSFKNNYLLVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+TYG+GKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYC+TYILSCITKH
Sbjct  61   YYLYSTYGFGKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCLTYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQYK+LM+GRILGGIATSLLFS+FESWLVA
Sbjct  121  SPQYKILMIGRILGGIATSLLFSAFESWLVA  151



>gb|KJB23936.1| hypothetical protein B456_004G122300 [Gossypium raimondii]
Length=460

 Score =   236 bits (601),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 135/151 (89%), Positives = 149/151 (99%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME+FY++VFGAL AVVAA+ELSKTSKDRI+TSP FN+FKNNYL+VYSLMMAGDWLQGPYV
Sbjct  1    MELFYFVVFGALGAVVAALELSKTSKDRINTSPAFNSFKNNYLLVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+TYG+GKGEIGQLFIAGFGSSMLFGTIVGSLADKQGR+RACVTYCITYILSCITKH
Sbjct  61   YYLYSTYGFGKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRRRACVTYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SP+YKVLM+GR+LGGIATSLLFS+FESWLVA
Sbjct  121  SPEYKVLMIGRVLGGIATSLLFSAFESWLVA  151



>ref|XP_007039147.1| Major facilitator superfamily protein [Theobroma cacao]
 gb|EOY23648.1| Major facilitator superfamily protein [Theobroma cacao]
Length=460

 Score =   236 bits (601),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 135/151 (89%), Positives = 149/151 (99%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME+F++LVFGAL AVVAA+ELSKTSKDRI+TSP FN+FKNNYL+VYSLMMAGDWLQGPYV
Sbjct  1    MELFFFLVFGALGAVVAALELSKTSKDRINTSPAFNSFKNNYLVVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+TYG+GKG+IGQLFIAGFGSSMLFGTIVGSLADKQGR+RACVTYCITYILSCITKH
Sbjct  61   YYLYSTYGFGKGDIGQLFIAGFGSSMLFGTIVGSLADKQGRRRACVTYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQYKVLM+GR+LGGIATSLLFS+FESWLVA
Sbjct  121  SPQYKVLMIGRVLGGIATSLLFSAFESWLVA  151



>gb|KHG12073.1| Major facilitator superfamily domain-containing protein 5 [Gossypium 
arboreum]
Length=460

 Score =   236 bits (601),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 134/151 (89%), Positives = 148/151 (98%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME+FY++VFGAL AVVAA+ELSK SKDRI+TSP FN+FKNNYL+VYSLMMAGDWLQGPYV
Sbjct  1    MELFYFMVFGALGAVVAALELSKNSKDRINTSPAFNSFKNNYLVVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+TYG+GKGEIGQLFIAGFGSSMLFGTIVGSLADKQGR+RACVTYCITYILSCITKH
Sbjct  61   YYLYSTYGFGKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRRRACVTYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQYK+LM+GR+LGGIATSLLFS+FESWLVA
Sbjct  121  SPQYKILMIGRVLGGIATSLLFSAFESWLVA  151



>gb|KJB52530.1| hypothetical protein B456_008G266400 [Gossypium raimondii]
Length=460

 Score =   235 bits (600),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 134/151 (89%), Positives = 148/151 (98%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME+FY++VFGAL AVVAA+ELSK SKDRI+TSP FN+FKNNYL+VYSLMMAGDWLQGPYV
Sbjct  1    MELFYFMVFGALGAVVAALELSKNSKDRINTSPAFNSFKNNYLVVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+TYG+GKGEIGQLFIAGFGSSMLFGTIVGSLADKQGR+RACVTYCITYILSCITKH
Sbjct  61   YYLYSTYGFGKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRRRACVTYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQYK+LM+GR+LGGIATSLLFS+FESWLVA
Sbjct  121  SPQYKILMIGRVLGGIATSLLFSAFESWLVA  151



>ref|XP_006359771.1| PREDICTED: major facilitator superfamily domain-containing protein 
5-like isoform X1 [Solanum tuberosum]
Length=460

 Score =   235 bits (600),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 136/151 (90%), Positives = 147/151 (97%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME FY+LVFGAL+AVVAA+E SKTSKDRI+T+P FN+FKNNY++VYSLMMAGDWLQGPYV
Sbjct  1    MEAFYFLVFGALSAVVAALEFSKTSKDRITTTPAFNSFKNNYILVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLYTTYGYGKG+IG LFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH
Sbjct  61   YYLYTTYGYGKGDIGHLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQYK+LM+GRILGGIATSLLFSSFESWLVA
Sbjct  121  SPQYKILMVGRILGGIATSLLFSSFESWLVA  151



>ref|XP_004245175.1| PREDICTED: molybdate-anion transporter [Solanum lycopersicum]
Length=460

 Score =   235 bits (599),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 136/151 (90%), Positives = 147/151 (97%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME FY+LVFGAL+AVVAA+E SKTSKDRI+T+P FN+FKNNY++VYSLMMAGDWLQGPYV
Sbjct  1    MEAFYFLVFGALSAVVAALEFSKTSKDRITTTPAFNSFKNNYILVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLYTTYGYGKG+IG LFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH
Sbjct  61   YYLYTTYGYGKGDIGHLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQYK+LM+GRILGGIATSLLFSSFESWLVA
Sbjct  121  SPQYKILMVGRILGGIATSLLFSSFESWLVA  151



>emb|CAB38284.1| putative protein [Arabidopsis thaliana]
 emb|CAB81422.1| putative protein [Arabidopsis thaliana]
Length=420

 Score =   234 bits (596),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 134/151 (89%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME+FYYLVFG L  VVAA+ELSK +KDRI+TS  FN+FKNNYL+VYSLMMAGDWLQGPYV
Sbjct  1    MEIFYYLVFGVLGLVVAALELSKNNKDRINTSSAFNSFKNNYLLVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+TYG+GKG+IGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH
Sbjct  61   YYLYSTYGFGKGDIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQYKVLM+GR+LGGIATSLLFSSFESWLVA
Sbjct  121  SPQYKVLMVGRVLGGIATSLLFSSFESWLVA  151



>ref|XP_011075930.1| PREDICTED: molybdate-anion transporter [Sesamum indicum]
Length=459

 Score =   234 bits (597),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 135/151 (89%), Positives = 148/151 (98%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME+FYY+VFGALAAVVA +ELSK++KDRI+TS  FN+FKNNYL+VYSLMMAGDWLQGPYV
Sbjct  1    MEIFYYMVFGALAAVVAGLELSKSNKDRINTSSAFNSFKNNYLLVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+TYG+GKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH
Sbjct  61   YYLYSTYGFGKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQYKVLM+GR+LGGIATSLLFS+FESWLVA
Sbjct  121  SPQYKVLMIGRVLGGIATSLLFSAFESWLVA  151



>ref|XP_009351951.1| PREDICTED: molybdate-anion transporter-like [Pyrus x bretschneideri]
Length=460

 Score =   234 bits (597),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 137/151 (91%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            MEVFYY+VFG LA VVAA ELSK++KDRI+T  TFN FKNNYL VYSLMMAGDWLQGPYV
Sbjct  1    MEVFYYMVFGILAVVVAAAELSKSNKDRINTPSTFNVFKNNYLFVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLYTTYGYGKG+IGQLFIAGFGSSMLFGTIVGSLADKQGRKRAC+TYCITYILSCITKH
Sbjct  61   YYLYTTYGYGKGDIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACITYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQYKVLMLGRILGGIATSLLFS+FESWLVA
Sbjct  121  SPQYKVLMLGRILGGIATSLLFSAFESWLVA  151



>ref|XP_008234689.1| PREDICTED: molybdate-anion transporter [Prunus mume]
Length=460

 Score =   234 bits (597),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 137/151 (91%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            MEVFYY+VFG L  VVAA ELSK++KDRI+TS TFN+FKNNYL VYSLMMAGDWLQGPYV
Sbjct  1    MEVFYYMVFGILGVVVAATELSKSNKDRINTSSTFNSFKNNYLFVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+TYGYGKG+IGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH
Sbjct  61   YYLYSTYGYGKGDIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQYKVLMLGRILGGIATSLLFS+FESWLVA
Sbjct  121  SPQYKVLMLGRILGGIATSLLFSAFESWLVA  151



>gb|KDO59674.1| hypothetical protein CISIN_1g012629mg [Citrus sinensis]
Length=417

 Score =   233 bits (593),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 135/151 (89%), Positives = 148/151 (98%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME+F+YLVFGAL AVVAA+ELSKT+KDRI+TS  FN+FKNNYL+VYSLMMAGDWLQGPYV
Sbjct  1    MEMFFYLVFGALGAVVAALELSKTNKDRINTSSAFNSFKNNYLLVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+TYG+GKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYC+TYILSCITKH
Sbjct  61   YYLYSTYGFGKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCLTYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQYK+LM+GRILGGIATSLLFS+FESWLVA
Sbjct  121  SPQYKILMIGRILGGIATSLLFSAFESWLVA  151



>ref|XP_002869545.1| hypothetical protein ARALYDRAFT_913755 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45804.1| hypothetical protein ARALYDRAFT_913755 [Arabidopsis lyrata subsp. 
lyrata]
Length=460

 Score =   234 bits (596),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 135/151 (89%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            MEVFYYLVFG L  VVAA+ELSK +KDRI+TS  FN+FKNNYL+VYSLMMAGDWLQGPYV
Sbjct  1    MEVFYYLVFGVLGLVVAALELSKNNKDRINTSSAFNSFKNNYLLVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+TYG+GKG+IGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH
Sbjct  61   YYLYSTYGFGKGDIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQYKVLM+GR+LGGIATSLLFSSFESWLVA
Sbjct  121  SPQYKVLMVGRVLGGIATSLLFSSFESWLVA  151



>ref|XP_010448086.1| PREDICTED: molybdate-anion transporter-like [Camelina sativa]
Length=460

 Score =   234 bits (596),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 134/151 (89%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            MEVFYYLVFG L  VVAA+ELSK +KDR++TS  FN+FKNNYLIVYSLMMAGDWLQGPYV
Sbjct  1    MEVFYYLVFGVLGLVVAALELSKNNKDRVNTSSAFNSFKNNYLIVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+TYG+GKG+IGQLFIAGFGSSMLFGTIVGSLADKQGRKRAC+TYCITYILSCITKH
Sbjct  61   YYLYSTYGFGKGDIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACITYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQYKVLM+GR+LGGIATSLLFSSFESWLVA
Sbjct  121  SPQYKVLMVGRVLGGIATSLLFSSFESWLVA  151



>ref|XP_010438562.1| PREDICTED: molybdate-anion transporter-like [Camelina sativa]
Length=460

 Score =   234 bits (596),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 134/151 (89%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            MEVFYYLVFG L  VVAA+ELSK +KDR++TS  FN+FKNNYLIVYSLMMAGDWLQGPYV
Sbjct  1    MEVFYYLVFGVLGLVVAALELSKNNKDRVNTSSAFNSFKNNYLIVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+TYG+GKG+IGQLFIAGFGSSMLFGTIVGSLADKQGRKRAC+TYCITYILSCITKH
Sbjct  61   YYLYSTYGFGKGDIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACITYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQYKVLM+GR+LGGIATSLLFSSFESWLVA
Sbjct  121  SPQYKVLMVGRVLGGIATSLLFSSFESWLVA  151



>ref|XP_010433324.1| PREDICTED: molybdate-anion transporter-like [Camelina sativa]
Length=460

 Score =   234 bits (596),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 134/151 (89%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            MEVFYYLVFG L  VVAA+ELSK +KDR++TS  FN+FKNNYLIVYSLMMAGDWLQGPYV
Sbjct  1    MEVFYYLVFGVLGLVVAALELSKNNKDRVNTSSAFNSFKNNYLIVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+TYG+GKG+IGQLFIAGFGSSMLFGTIVGSLADKQGRKRAC+TYCITYILSCITKH
Sbjct  61   YYLYSTYGFGKGDIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACITYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQYKVLM+GR+LGGIATSLLFSSFESWLVA
Sbjct  121  SPQYKVLMVGRVLGGIATSLLFSSFESWLVA  151



>ref|XP_006413035.1| hypothetical protein EUTSA_v10025154mg [Eutrema salsugineum]
 gb|ESQ54488.1| hypothetical protein EUTSA_v10025154mg [Eutrema salsugineum]
Length=460

 Score =   233 bits (595),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 133/151 (88%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME+FYY+VFG L  VVAA+ELSK +KDRI+TS  FN+FKNNYL+VYSLMMAGDWLQGPYV
Sbjct  1    MELFYYMVFGVLGLVVAALELSKNNKDRINTSSAFNSFKNNYLLVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+TYG+ KGEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH
Sbjct  61   YYLYSTYGFSKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQYKVLM+GR+LGGIATSLLFSSFESWLVA
Sbjct  121  SPQYKVLMVGRVLGGIATSLLFSSFESWLVA  151



>ref|XP_003602306.1| Major facilitator superfamily domain-containing protein [Medicago 
truncatula]
 gb|AES72557.1| MFS transporter [Medicago truncatula]
Length=346

 Score =   230 bits (587),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 134/151 (89%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME+F+YLVFG LAAVVA +ELSK +KDRI+TS  FN+FKNNYL++YSLMMAGDWLQGPYV
Sbjct  1    MELFFYLVFGGLAAVVAVLELSKNNKDRINTSSLFNSFKNNYLLIYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+TYGYGKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYI SCITKH
Sbjct  61   YYLYSTYGYGKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYIASCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQY+VLMLGRILGGIATSLLFS+FESWLVA
Sbjct  121  SPQYRVLMLGRILGGIATSLLFSAFESWLVA  151



>ref|XP_010671392.1| PREDICTED: molybdate-anion transporter-like [Beta vulgaris subsp. 
vulgaris]
Length=459

 Score =   233 bits (595),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 136/151 (90%), Positives = 146/151 (97%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME FYYLVFG+LAAVVA +ELSK++KDRI+TS  FNAFKNNY +VYSLMMAGDWLQGPYV
Sbjct  1    MEAFYYLVFGSLAAVVAVLELSKSNKDRINTSSAFNAFKNNYCLVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+TYG+GKG+IGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH
Sbjct  61   YYLYSTYGFGKGDIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQYKVLMLGRILGGIATSLLFS+FESWLVA
Sbjct  121  SPQYKVLMLGRILGGIATSLLFSAFESWLVA  151



>gb|KDO59672.1| hypothetical protein CISIN_1g012629mg [Citrus sinensis]
Length=447

 Score =   233 bits (594),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 135/151 (89%), Positives = 148/151 (98%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME+F+YLVFGAL AVVAA+ELSKT+KDRI+TS  FN+FKNNYL+VYSLMMAGDWLQGPYV
Sbjct  1    MEMFFYLVFGALGAVVAALELSKTNKDRINTSSAFNSFKNNYLLVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+TYG+GKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYC+TYILSCITKH
Sbjct  61   YYLYSTYGFGKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCLTYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQYK+LM+GRILGGIATSLLFS+FESWLVA
Sbjct  121  SPQYKILMIGRILGGIATSLLFSAFESWLVA  151



>ref|NP_567786.1| major facilitator protein [Arabidopsis thaliana]
 gb|AAK17175.1|AF325107_1 putative protein [Arabidopsis thaliana]
 gb|AAL31905.1|AF419573_1 AT4g27720/T29A15_210 [Arabidopsis thaliana]
 gb|AAL08264.1| AT4g27720/T29A15_210 [Arabidopsis thaliana]
 gb|AAM61184.1| putative transporter [Arabidopsis thaliana]
 gb|AAO23588.1| At4g27720/T29A15_210 [Arabidopsis thaliana]
 gb|AEE85385.1| major facilitator protein [Arabidopsis thaliana]
Length=460

 Score =   233 bits (595),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 134/151 (89%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME+FYYLVFG L  VVAA+ELSK +KDRI+TS  FN+FKNNYL+VYSLMMAGDWLQGPYV
Sbjct  1    MEIFYYLVFGVLGLVVAALELSKNNKDRINTSSAFNSFKNNYLLVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+TYG+GKG+IGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH
Sbjct  61   YYLYSTYGFGKGDIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQYKVLM+GR+LGGIATSLLFSSFESWLVA
Sbjct  121  SPQYKVLMVGRVLGGIATSLLFSSFESWLVA  151



>ref|XP_006441178.1| hypothetical protein CICLE_v10020083mg [Citrus clementina]
 gb|ESR54418.1| hypothetical protein CICLE_v10020083mg [Citrus clementina]
Length=452

 Score =   233 bits (594),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 135/151 (89%), Positives = 148/151 (98%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME+F+YLVFGAL AVVAA+ELSKT+KDRI+TS  FN+FKNNYL+VYSLMMAGDWLQGPYV
Sbjct  1    MEMFFYLVFGALGAVVAALELSKTNKDRINTSSAFNSFKNNYLLVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+TYG+GKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYC+TYILSCITKH
Sbjct  61   YYLYSTYGFGKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCLTYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQYK+LM+GRILGGIATSLLFS+FESWLVA
Sbjct  121  SPQYKILMIGRILGGIATSLLFSAFESWLVA  151



>ref|XP_002280860.1| PREDICTED: molybdate-anion transporter [Vitis vinifera]
 emb|CBI34573.3| unnamed protein product [Vitis vinifera]
Length=459

 Score =   233 bits (595),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 137/151 (91%), Positives = 146/151 (97%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            MEVFY+LVFG LAAVVAA+ELSKTSKDRI+TS  F +FKNNYL+VYSLMMAGDWLQGPYV
Sbjct  1    MEVFYFLVFGGLAAVVAALELSKTSKDRINTSTAFTSFKNNYLLVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+ YGYGKG+IGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH
Sbjct  61   YYLYSQYGYGKGDIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQYK+LMLGRILGGIATSLLFS+FESWLVA
Sbjct  121  SPQYKILMLGRILGGIATSLLFSAFESWLVA  151



>ref|XP_006290944.1| hypothetical protein CARUB_v10017059mg, partial [Capsella rubella]
 gb|EOA23842.1| hypothetical protein CARUB_v10017059mg, partial [Capsella rubella]
Length=503

 Score =   234 bits (598),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 133/154 (86%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = +1

Query  55   ETKMEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQg  234
            E  MEVFYYLVFGA+AA+VAA+ELSKT+KDRI+TS +FN+FKNNYL+V+S+MMAGDWLQG
Sbjct  41   EATMEVFYYLVFGAMAAIVAALELSKTNKDRINTSSSFNSFKNNYLLVFSIMMAGDWLQG  100

Query  235  pyvyylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCI  414
            PYVYYLY+TYG+GKG+IGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCI YILSCI
Sbjct  101  PYVYYLYSTYGFGKGDIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCIVYILSCI  160

Query  415  TKHSPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            TKHSPQY+VLM+GRILGGIATSLLFS+FESWL+A
Sbjct  161  TKHSPQYRVLMVGRILGGIATSLLFSAFESWLIA  194



>gb|KDO59673.1| hypothetical protein CISIN_1g012629mg [Citrus sinensis]
Length=452

 Score =   233 bits (594),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 135/151 (89%), Positives = 148/151 (98%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME+F+YLVFGAL AVVAA+ELSKT+KDRI+TS  FN+FKNNYL+VYSLMMAGDWLQGPYV
Sbjct  1    MEMFFYLVFGALGAVVAALELSKTNKDRINTSSAFNSFKNNYLLVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+TYG+GKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYC+TYILSCITKH
Sbjct  61   YYLYSTYGFGKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCLTYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQYK+LM+GRILGGIATSLLFS+FESWLVA
Sbjct  121  SPQYKILMIGRILGGIATSLLFSAFESWLVA  151



>ref|XP_006285090.1| hypothetical protein CARUB_v10006423mg, partial [Capsella rubella]
 gb|EOA17988.1| hypothetical protein CARUB_v10006423mg, partial [Capsella rubella]
Length=440

 Score =   233 bits (593),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 134/151 (89%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            MEVFYYLVFG L  VVAA+ELSK +KDR++TS  FN+FKNNYLIVYSLMMAGDWLQGPYV
Sbjct  1    MEVFYYLVFGVLGLVVAALELSKNNKDRVNTSSAFNSFKNNYLIVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+TYG+GKG+IGQLFIAGFGSSMLFGTIVGSLADK+GRKRACVTYCITYILSCITKH
Sbjct  61   YYLYSTYGFGKGDIGQLFIAGFGSSMLFGTIVGSLADKRGRKRACVTYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQYKVLM+GR+LGGIATSLLFSSFESWLVA
Sbjct  121  SPQYKVLMVGRVLGGIATSLLFSSFESWLVA  151



>gb|AFI41203.1| major facilitator protein, partial [Arabidopsis thaliana]
Length=460

 Score =   233 bits (594),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 134/151 (89%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME+FYYLVFG L  VVAA+ELSK +KDRI+TS  FN+FKNNYL+VYSLMMAGDWLQGPYV
Sbjct  1    MEIFYYLVFGVLGLVVAALELSKNNKDRINTSSAFNSFKNNYLLVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+TYG+GKG+IGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH
Sbjct  61   YYLYSTYGFGKGDIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQYKVLM+GR+LGGIATSLLFSSFESWLVA
Sbjct  121  SPQYKVLMVGRVLGGIATSLLFSSFESWLVA  151



>ref|XP_007217984.1| hypothetical protein PRUPE_ppa005463mg [Prunus persica]
 gb|EMJ19183.1| hypothetical protein PRUPE_ppa005463mg [Prunus persica]
Length=460

 Score =   233 bits (594),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 136/151 (90%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            MEVFYY+VFG L  VVAA ELSK++KDRI TS TFN+FKNNYL VYSLMMAGDWLQGPYV
Sbjct  1    MEVFYYMVFGILGVVVAATELSKSNKDRIHTSSTFNSFKNNYLFVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+TYGYGKG+IGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH
Sbjct  61   YYLYSTYGYGKGDIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQYK+LMLGRILGGIATSLLFS+FESWLVA
Sbjct  121  SPQYKILMLGRILGGIATSLLFSAFESWLVA  151



>ref|XP_002518895.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF43428.1| conserved hypothetical protein [Ricinus communis]
Length=460

 Score =   233 bits (594),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 134/151 (89%), Positives = 148/151 (98%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME+FY++VFG LAAVVAAIELSKTS+DR++T+  FNAFKNNYL+VYSLMMAGDWLQGPYV
Sbjct  1    MEMFYFMVFGGLAAVVAAIELSKTSRDRVNTTSAFNAFKNNYLLVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+TYG+GKGEIGQLFIAGFGSSMLFGTIVGSLADKQGR+RACVTYCITYILSCITKH
Sbjct  61   YYLYSTYGFGKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRRRACVTYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SP+YKVLMLGR+LGGIATSLLFS+FESWLVA
Sbjct  121  SPEYKVLMLGRVLGGIATSLLFSAFESWLVA  151



>ref|XP_006441179.1| hypothetical protein CICLE_v10020083mg [Citrus clementina]
 ref|XP_006491960.1| PREDICTED: molybdate-anion transporter-like [Citrus sinensis]
 gb|ESR54419.1| hypothetical protein CICLE_v10020083mg [Citrus clementina]
Length=459

 Score =   233 bits (594),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 135/151 (89%), Positives = 148/151 (98%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME+F+YLVFGAL AVVAA+ELSKT+KDRI+TS  FN+FKNNYL+VYSLMMAGDWLQGPYV
Sbjct  1    MEMFFYLVFGALGAVVAALELSKTNKDRINTSSAFNSFKNNYLLVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+TYG+GKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYC+TYILSCITKH
Sbjct  61   YYLYSTYGFGKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCLTYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQYK+LM+GRILGGIATSLLFS+FESWLVA
Sbjct  121  SPQYKILMIGRILGGIATSLLFSAFESWLVA  151



>gb|KDO59671.1| hypothetical protein CISIN_1g012629mg [Citrus sinensis]
Length=459

 Score =   233 bits (594),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 135/151 (89%), Positives = 148/151 (98%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME+F+YLVFGAL AVVAA+ELSKT+KDRI+TS  FN+FKNNYL+VYSLMMAGDWLQGPYV
Sbjct  1    MEMFFYLVFGALGAVVAALELSKTNKDRINTSSAFNSFKNNYLLVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+TYG+GKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYC+TYILSCITKH
Sbjct  61   YYLYSTYGFGKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCLTYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQYK+LM+GRILGGIATSLLFS+FESWLVA
Sbjct  121  SPQYKILMIGRILGGIATSLLFSAFESWLVA  151



>ref|XP_008672796.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACG37381.1| major Facilitator superfamily protein [Zea mays]
 tpg|DAA49286.1| TPA: major Facilitator family protein [Zea mays]
Length=456

 Score =   233 bits (593),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 130/151 (86%), Positives = 147/151 (97%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            MEVFYYLVFGALAA+VAA+EL+K+ KDR++TSP FN+FKNNY++VYSLMM+GDWLQGPYV
Sbjct  1    MEVFYYLVFGALAAIVAALELAKSGKDRVATSPAFNSFKNNYILVYSLMMSGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+ YG+ KG+IG+LFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH
Sbjct  61   YYLYSQYGFDKGDIGRLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQYKVLM+GR+LGGIATSLLFS+FESWLVA
Sbjct  121  SPQYKVLMIGRVLGGIATSLLFSAFESWLVA  151



>gb|KHG25593.1| Major facilitator superfamily domain-containing protein 5 [Gossypium 
arboreum]
Length=457

 Score =   233 bits (593),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 131/151 (87%), Positives = 149/151 (99%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME+FY++VFGAL+AVVAA+ELSK SKDRI+TSP FN+FKNNYL+VYSLMMAGDWLQGPYV
Sbjct  1    MELFYFMVFGALSAVVAALELSKNSKDRINTSPAFNSFKNNYLVVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+TYG+GKG+IGQLFIAGFGSSMLFGTIVGSLADKQGRKRAC+TYCITYILSCITKH
Sbjct  61   YYLYSTYGFGKGDIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACITYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SP+Y++LM+GR+LGGIATSLLFS+FESWLVA
Sbjct  121  SPEYRILMIGRVLGGIATSLLFSAFESWLVA  151



>ref|XP_008381287.1| PREDICTED: molybdate-anion transporter-like [Malus domestica]
Length=460

 Score =   233 bits (593),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 138/151 (91%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            MEVFYY+VFG LAAVVAA ELSK++KDRI+T  TFN FKNNYL VYSLMMAGDWLQGPYV
Sbjct  1    MEVFYYMVFGILAAVVAAAELSKSNKDRINTPSTFNVFKNNYLFVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLYTTYGYGKG+IGQLFIAGFGSSMLFGTIVGSLADKQGRKRAC+TYCITYILSCITKH
Sbjct  61   YYLYTTYGYGKGDIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACITYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQYKVLMLGRILGGIATSLLFS+FESWLVA
Sbjct  121  SPQYKVLMLGRILGGIATSLLFSAFESWLVA  151



>gb|KJB37395.1| hypothetical protein B456_006G202900 [Gossypium raimondii]
Length=457

 Score =   233 bits (593),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 131/151 (87%), Positives = 149/151 (99%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME+FY++VFGAL+AVVAA+ELSK SKDRI+TSP FN+FKNNYL+VYSLMMAGDWLQGPYV
Sbjct  1    MELFYFMVFGALSAVVAALELSKNSKDRINTSPAFNSFKNNYLVVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+TYG+GKG+IGQLFIAGFGSSMLFGTIVGSLADKQGRKRAC+TYCITYILSCITKH
Sbjct  61   YYLYSTYGFGKGDIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACITYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SP+Y++LM+GR+LGGIATSLLFS+FESWLVA
Sbjct  121  SPEYRILMIGRVLGGIATSLLFSAFESWLVA  151



>gb|KJB37396.1| hypothetical protein B456_006G202900 [Gossypium raimondii]
Length=458

 Score =   233 bits (593),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 131/151 (87%), Positives = 149/151 (99%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME+FY++VFGAL+AVVAA+ELSK SKDRI+TSP FN+FKNNYL+VYSLMMAGDWLQGPYV
Sbjct  1    MELFYFMVFGALSAVVAALELSKNSKDRINTSPAFNSFKNNYLVVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+TYG+GKG+IGQLFIAGFGSSMLFGTIVGSLADKQGRKRAC+TYCITYILSCITKH
Sbjct  61   YYLYSTYGFGKGDIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACITYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SP+Y++LM+GR+LGGIATSLLFS+FESWLVA
Sbjct  121  SPEYRILMIGRVLGGIATSLLFSAFESWLVA  151



>gb|EYU19669.1| hypothetical protein MIMGU_mgv1a006017mg [Erythranthe guttata]
 gb|EYU19670.1| hypothetical protein MIMGU_mgv1a006017mg [Erythranthe guttata]
 gb|EYU19671.1| hypothetical protein MIMGU_mgv1a006017mg [Erythranthe guttata]
Length=461

 Score =   233 bits (593),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 134/151 (89%), Positives = 147/151 (97%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME+FYY+VFG LAAVVAA+ELSK++KDRI+TS  FN+FKNNYL+VYSLMMAGDWLQGPYV
Sbjct  1    MELFYYMVFGGLAAVVAALELSKSNKDRINTSSAFNSFKNNYLLVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            Y+LY +YGYGKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH
Sbjct  61   YFLYKSYGYGKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQY+VLM+GRILGGIATSLLFS+FESWLVA
Sbjct  121  SPQYRVLMVGRILGGIATSLLFSAFESWLVA  151



>ref|NP_190500.2| major facilitator protein [Arabidopsis thaliana]
 gb|AAG52174.1|AC012329_1 putative transporter; 8780-5873 [Arabidopsis thaliana]
 gb|AAR92274.1| At3g49310 [Arabidopsis thaliana]
 gb|AAS99687.1| At3g49310 [Arabidopsis thaliana]
 gb|AEE78527.1| major facilitator protein [Arabidopsis thaliana]
Length=460

 Score =   233 bits (593),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 133/151 (88%), Positives = 148/151 (98%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            MEVFYYLVFG +AAVVAA+ELSKT+KDRI+TS +FN+FKNNYL+V+S+MMAGDWLQGPYV
Sbjct  1    MEVFYYLVFGVMAAVVAALELSKTNKDRINTSSSFNSFKNNYLLVFSIMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+TYG+GKG+IGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCI YILSCITKH
Sbjct  61   YYLYSTYGFGKGDIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCIVYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQYKVLM+GRILGGIATSLLFS+FESWL+A
Sbjct  121  SPQYKVLMVGRILGGIATSLLFSAFESWLIA  151



>gb|KJB39448.1| hypothetical protein B456_007G016500 [Gossypium raimondii]
 gb|KJB39451.1| hypothetical protein B456_007G016500 [Gossypium raimondii]
Length=408

 Score =   231 bits (589),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 133/151 (88%), Positives = 147/151 (97%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME+FY++VFGAL AVVAA+ELSK SKDRI+TS  FN+FKNNYL+VYSLMMAGDWLQGPYV
Sbjct  1    MELFYFVVFGALGAVVAALELSKNSKDRINTSSAFNSFKNNYLVVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+TYG+GKGEIGQLFIAGFGSSMLFGTIVGSLADKQGR+RACVTYCITYILSCITKH
Sbjct  61   YYLYSTYGFGKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRRRACVTYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQYK+LM+GR+LGGIATSLLFS+FESWLVA
Sbjct  121  SPQYKILMVGRVLGGIATSLLFSAFESWLVA  151



>dbj|BAF00743.1| hypothetical protein [Arabidopsis thaliana]
Length=460

 Score =   233 bits (593),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 133/151 (88%), Positives = 148/151 (98%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            MEVFYYLVFG +AAVVAA+ELSKT+KDRI+TS +FN+FKNNYL+V+S+MMAGDWLQGPYV
Sbjct  1    MEVFYYLVFGVMAAVVAALELSKTNKDRINTSSSFNSFKNNYLLVFSIMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+TYG+GKG+IGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCI YILSCITKH
Sbjct  61   YYLYSTYGFGKGDIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCIVYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQYKVLM+GRILGGIATSLLFS+FESWL+A
Sbjct  121  SPQYKVLMVGRILGGIATSLLFSAFESWLIA  151



>gb|KDP25194.1| hypothetical protein JCGZ_20350 [Jatropha curcas]
Length=460

 Score =   232 bits (592),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 132/151 (87%), Positives = 146/151 (97%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME+FY++VFG L+AVVAA+ELSKTS+DRI+TS  FNAFKNNYL+VYSLMMAGDWLQGPYV
Sbjct  1    MEIFYFMVFGGLSAVVAALELSKTSRDRINTSTAFNAFKNNYLVVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+ YG+GKGEIGQLFIAGFGSSMLFGTIVGSLADKQGR+RACVTYCITYILSC+TKH
Sbjct  61   YYLYSEYGFGKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRRRACVTYCITYILSCMTKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SP YKVLMLGR+LGGIATSLLFS+FESWLVA
Sbjct  121  SPDYKVLMLGRVLGGIATSLLFSAFESWLVA  151



>gb|KJB37397.1| hypothetical protein B456_006G202900 [Gossypium raimondii]
Length=455

 Score =   232 bits (592),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 131/151 (87%), Positives = 149/151 (99%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME+FY++VFGAL+AVVAA+ELSK SKDRI+TSP FN+FKNNYL+VYSLMMAGDWLQGPYV
Sbjct  1    MELFYFMVFGALSAVVAALELSKNSKDRINTSPAFNSFKNNYLVVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+TYG+GKG+IGQLFIAGFGSSMLFGTIVGSLADKQGRKRAC+TYCITYILSCITKH
Sbjct  61   YYLYSTYGFGKGDIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACITYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SP+Y++LM+GR+LGGIATSLLFS+FESWLVA
Sbjct  121  SPEYRILMIGRVLGGIATSLLFSAFESWLVA  151



>ref|XP_010412660.1| PREDICTED: molybdate-anion transporter-like [Camelina sativa]
Length=416

 Score =   231 bits (589),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            MEVFYYLVFG +  VVA +ELSKT+KDRI+TS +FN+FKNNYL+V+S+MMAGDWLQGPYV
Sbjct  1    MEVFYYLVFGTMTTVVAVLELSKTNKDRINTSSSFNSFKNNYLLVFSIMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+TYG+GKG+IGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCI YILSC+TKH
Sbjct  61   YYLYSTYGFGKGDIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCIVYILSCVTKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQY+VLM+GRILGGIATSLLFS+FESWL+A
Sbjct  121  SPQYRVLMVGRILGGIATSLLFSAFESWLIA  151



>ref|XP_004145939.1| PREDICTED: major facilitator superfamily domain-containing protein 
5-like [Cucumis sativus]
 ref|XP_004160383.1| PREDICTED: major facilitator superfamily domain-containing protein 
5-like [Cucumis sativus]
 gb|KGN49848.1| hypothetical protein Csa_5G139260 [Cucumis sativus]
Length=459

 Score =   232 bits (592),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 130/151 (86%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME+FY+LVFGAL+ VV A+EL+KT+KDRI+T   FNAFKNNYL+VYSLMMAGDWLQGPYV
Sbjct  1    MEIFYFLVFGALSLVVVALELTKTNKDRINTPSAFNAFKNNYLLVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+ YG+GKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRAC+TYCITYILSC+TKH
Sbjct  61   YYLYSQYGFGKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACITYCITYILSCVTKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SP+YKVLMLGR+LGGIATSLLFS+FESWLVA
Sbjct  121  SPEYKVLMLGRVLGGIATSLLFSAFESWLVA  151



>ref|XP_002274807.1| PREDICTED: molybdate-anion transporter [Vitis vinifera]
 emb|CBI23053.3| unnamed protein product [Vitis vinifera]
Length=460

 Score =   232 bits (592),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 131/151 (87%), Positives = 147/151 (97%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            MEVFY+LVFGAL+AVVA IELSK +KDR++T+  FN+FKNNYL+VYSLMMAGDWLQGPYV
Sbjct  1    MEVFYFLVFGALSAVVAVIELSKNNKDRVNTTTAFNSFKNNYLLVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            Y+LY+TYG+GKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH
Sbjct  61   YFLYSTYGFGKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQY++LM+GR+LGGIATSLLFS+FESWLVA
Sbjct  121  SPQYRILMVGRVLGGIATSLLFSAFESWLVA  151



>ref|XP_006404158.1| hypothetical protein EUTSA_v10010332mg [Eutrema salsugineum]
 gb|ESQ45611.1| hypothetical protein EUTSA_v10010332mg [Eutrema salsugineum]
Length=460

 Score =   232 bits (591),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 133/151 (88%), Positives = 149/151 (99%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            MEVFYYLVFGA+AAVVAA+ELSKT+KDRI+TS +FN+FKNNYL+V+S+MMAGDWLQGPYV
Sbjct  1    MEVFYYLVFGAMAAVVAALELSKTNKDRINTSSSFNSFKNNYLVVFSIMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+TYG+GKG+IGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCI YILSCITKH
Sbjct  61   YYLYSTYGFGKGDIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCIVYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQY+VLM+GRILGGIATSLLFS+FESWL+A
Sbjct  121  SPQYRVLMVGRILGGIATSLLFSAFESWLIA  151



>gb|KJB39447.1| hypothetical protein B456_007G016500 [Gossypium raimondii]
Length=460

 Score =   231 bits (590),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 133/151 (88%), Positives = 147/151 (97%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME+FY++VFGAL AVVAA+ELSK SKDRI+TS  FN+FKNNYL+VYSLMMAGDWLQGPYV
Sbjct  1    MELFYFVVFGALGAVVAALELSKNSKDRINTSSAFNSFKNNYLVVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+TYG+GKGEIGQLFIAGFGSSMLFGTIVGSLADKQGR+RACVTYCITYILSCITKH
Sbjct  61   YYLYSTYGFGKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRRRACVTYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQYK+LM+GR+LGGIATSLLFS+FESWLVA
Sbjct  121  SPQYKILMVGRVLGGIATSLLFSAFESWLVA  151



>ref|XP_010533550.1| PREDICTED: molybdate-anion transporter [Tarenaya hassleriana]
Length=491

 Score =   232 bits (592),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 135/152 (89%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  61   KMEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpy  240
            KMEVFY++VFGALAAVVAA+E SK+SKDRISTSP F++FKN+YL+VYSLMMAGDWLQGPY
Sbjct  29   KMEVFYFMVFGALAAVVAALEFSKSSKDRISTSPAFDSFKNSYLLVYSLMMAGDWLQGPY  88

Query  241  vyylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITK  420
            VYYLY+TYG+GKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRAC+TYCITYILSCITK
Sbjct  89   VYYLYSTYGFGKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACITYCITYILSCITK  148

Query  421  HSPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            HSP+Y+VLM+GR+LGGIATSLLFSSFESWLVA
Sbjct  149  HSPEYRVLMVGRVLGGIATSLLFSSFESWLVA  180



>emb|CAB66410.1| putative protein [Arabidopsis thaliana]
Length=482

 Score =   232 bits (591),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 133/151 (88%), Positives = 148/151 (98%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            MEVFYYLVFG +AAVVAA+ELSKT+KDRI+TS +FN+FKNNYL+V+S+MMAGDWLQGPYV
Sbjct  1    MEVFYYLVFGVMAAVVAALELSKTNKDRINTSSSFNSFKNNYLLVFSIMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+TYG+GKG+IGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCI YILSCITKH
Sbjct  61   YYLYSTYGFGKGDIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCIVYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQYKVLM+GRILGGIATSLLFS+FESWL+A
Sbjct  121  SPQYKVLMVGRILGGIATSLLFSAFESWLIA  151



>ref|XP_008437621.1| PREDICTED: molybdate-anion transporter [Cucumis melo]
Length=460

 Score =   231 bits (590),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 130/151 (86%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME+FY+LVFGAL+ VV A+EL+KT+KDRI+T   FNAFKNNYL+VYSLMMAGDWLQGPYV
Sbjct  1    MEIFYFLVFGALSLVVVALELTKTNKDRINTPSAFNAFKNNYLLVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+ YG+GKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRAC+TYCITYILSCITKH
Sbjct  61   YYLYSQYGFGKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACITYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SP+YKVLM+GR+LGGIATSLLFS+FESWLVA
Sbjct  121  SPEYKVLMVGRVLGGIATSLLFSAFESWLVA  151



>ref|XP_011084541.1| PREDICTED: molybdate-anion transporter-like [Sesamum indicum]
 ref|XP_011084542.1| PREDICTED: molybdate-anion transporter-like [Sesamum indicum]
Length=461

 Score =   231 bits (590),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 136/151 (90%), Positives = 149/151 (99%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME+FYY+VFGALAAVVAA+ELSK++KDRI+TS  FN+FKNNYL+VYSLMMAGDWLQGPYV
Sbjct  1    MELFYYMVFGALAAVVAALELSKSNKDRINTSSAFNSFKNNYLLVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+TYG+GKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH
Sbjct  61   YYLYSTYGFGKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQYKVLM+GR+LGGIATSLLFS+FESWLVA
Sbjct  121  SPQYKVLMIGRVLGGIATSLLFSAFESWLVA  151



>gb|KJB39452.1| hypothetical protein B456_007G016500 [Gossypium raimondii]
Length=452

 Score =   231 bits (589),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 133/151 (88%), Positives = 147/151 (97%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME+FY++VFGAL AVVAA+ELSK SKDRI+TS  FN+FKNNYL+VYSLMMAGDWLQGPYV
Sbjct  1    MELFYFVVFGALGAVVAALELSKNSKDRINTSSAFNSFKNNYLVVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+TYG+GKGEIGQLFIAGFGSSMLFGTIVGSLADKQGR+RACVTYCITYILSCITKH
Sbjct  61   YYLYSTYGFGKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRRRACVTYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQYK+LM+GR+LGGIATSLLFS+FESWLVA
Sbjct  121  SPQYKILMVGRVLGGIATSLLFSAFESWLVA  151



>ref|XP_010555746.1| PREDICTED: molybdate-anion transporter-like [Tarenaya hassleriana]
Length=460

 Score =   231 bits (590),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 132/151 (87%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            MEVFYY+VFGAL   VAA+ELSK +KDRI+TS  FN+FKNNYL+VYSLMMAGDWLQGPYV
Sbjct  1    MEVFYYMVFGALGVFVAAMELSKNNKDRINTSSAFNSFKNNYLLVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+TYG+GKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRAC+TYCITYILSCITKH
Sbjct  61   YYLYSTYGFGKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACITYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SP+YKVLM+GR+LGGIATSLLFS+FESWLVA
Sbjct  121  SPEYKVLMIGRVLGGIATSLLFSAFESWLVA  151



>ref|XP_009143909.1| PREDICTED: molybdate-anion transporter-like [Brassica rapa]
Length=460

 Score =   231 bits (590),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 130/151 (86%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            MEVFYY+VFG L  VVA +ELSK +KDRI+TS  F +FKNNYL+VYSLMMAGDWLQGPYV
Sbjct  1    MEVFYYVVFGVLGIVVATLELSKNNKDRINTSSAFTSFKNNYLVVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
             YLY+TYG+ KG+IGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH
Sbjct  61   CYLYSTYGHSKGDIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQYKVLM+GR+LGGIATSLLFSSFESWLVA
Sbjct  121  SPQYKVLMVGRVLGGIATSLLFSSFESWLVA  151



>ref|XP_009398088.1| PREDICTED: molybdate-anion transporter-like [Musa acuminata subsp. 
malaccensis]
Length=464

 Score =   231 bits (590),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 131/151 (87%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            MEVFYY+VFG LAAV A +ELSKTSKDRI+TS  FNAFKNNY +VYSLMMAGDW+QGPYV
Sbjct  1    MEVFYYVVFGGLAAVAAVMELSKTSKDRIATSSAFNAFKNNYCLVYSLMMAGDWMQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+ YG+ KG+IGQLFIAGFGSSMLFGTIVGSLADK+GRKRAC+TYCITYILSCITKH
Sbjct  61   YYLYSQYGFDKGDIGQLFIAGFGSSMLFGTIVGSLADKRGRKRACITYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQYKVL+LGRILGGIATSLLFS+FESWLVA
Sbjct  121  SPQYKVLLLGRILGGIATSLLFSAFESWLVA  151



>emb|CDY55350.1| BnaAnng13850D [Brassica napus]
Length=460

 Score =   231 bits (589),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 132/151 (87%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            MEVFYY+VFG L  VVA +ELSK +KDRI+TS  F +FKNNYL+VYSLMMAGDWLQGPYV
Sbjct  1    MEVFYYVVFGVLGIVVATLELSKNNKDRINTSSAFTSFKNNYLVVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+TYGY KG+IGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH
Sbjct  61   YYLYSTYGYSKGDIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQYKVLM+GR+LGGIATSLLFSSFESWLVA
Sbjct  121  SPQYKVLMVGRVLGGIATSLLFSSFESWLVA  151



>ref|XP_010496627.1| PREDICTED: molybdate-anion transporter-like [Camelina sativa]
Length=462

 Score =   231 bits (589),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 131/151 (87%), Positives = 147/151 (97%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME+FY++VFG LAA+VA +ELSK++KDRI+TSP FN+FKNNYL+VYSLMMAGDWLQGPYV
Sbjct  1    MEIFYFVVFGGLAAIVAGLELSKSNKDRINTSPAFNSFKNNYLLVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+TYG+GKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRA +TYCITYILSCITKH
Sbjct  61   YYLYSTYGFGKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRASITYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQYKVLM+GR+LGGIATSLLFS+FESWLVA
Sbjct  121  SPQYKVLMVGRVLGGIATSLLFSAFESWLVA  151



>emb|CDY19032.1| BnaC01g20360D [Brassica napus]
Length=460

 Score =   231 bits (589),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 132/151 (87%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            MEVFYY+VFG L  VVAA+ELSK +KDRI+TS  F +FKNNYL+VYSLMMAGDWLQGPYV
Sbjct  1    MEVFYYVVFGVLGIVVAALELSKNNKDRINTSSAFTSFKNNYLVVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+TYG+ KG+IGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH
Sbjct  61   YYLYSTYGFSKGDIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQYKVLM+GR+LGGIATSLLFSSFESWLVA
Sbjct  121  SPQYKVLMVGRVLGGIATSLLFSSFESWLVA  151



>emb|CDY19031.1| BnaC01g20370D [Brassica napus]
Length=460

 Score =   231 bits (589),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 132/151 (87%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            MEVFYY+VFG L  VVA +ELSK +KDRI+TS  F +FKNNYL+VYSLMMAGDWLQGPYV
Sbjct  1    MEVFYYVVFGVLGIVVATLELSKNNKDRINTSSAFTSFKNNYLVVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+TYGY KG+IGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH
Sbjct  61   YYLYSTYGYSKGDIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQYKVLM+GR+LGGIATSLLFSSFESWLVA
Sbjct  121  SPQYKVLMVGRVLGGIATSLLFSSFESWLVA  151



>ref|XP_009143901.1| PREDICTED: molybdate-anion transporter-like [Brassica rapa]
 emb|CDY55348.1| BnaAnng13840D [Brassica napus]
Length=460

 Score =   231 bits (589),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 131/151 (87%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            MEVFYY+VFG L  VVA +ELSK +KDRI+TS  F +FKNNYL+VYSLMMAGDWLQGPYV
Sbjct  1    MEVFYYVVFGVLGIVVATLELSKNNKDRINTSSAFTSFKNNYLVVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+TYG+ KG+IGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH
Sbjct  61   YYLYSTYGFSKGDIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQYKVLMLGR+LGGI+TSLLFSSFESWLVA
Sbjct  121  SPQYKVLMLGRVLGGISTSLLFSSFESWLVA  151



>ref|XP_008376777.1| PREDICTED: molybdate-anion transporter [Malus domestica]
Length=460

 Score =   231 bits (588),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 137/151 (91%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            MEVFYY+VFG LAAVVAA ELSK++KDRI+T  TFN FKNNYL VYSLMMAGDWLQGPYV
Sbjct  1    MEVFYYMVFGILAAVVAAAELSKSNKDRINTPSTFNVFKNNYLFVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+TYGYGKG+IGQLFIAGFGSSMLFGTIVGSLADKQGRKRAC+TYCITYILSCITKH
Sbjct  61   YYLYSTYGYGKGDIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACITYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQYKVLMLGRILGGIATSLLFS+FESWLVA
Sbjct  121  SPQYKVLMLGRILGGIATSLLFSAFESWLVA  151



>ref|XP_010426440.1| PREDICTED: molybdate-anion transporter [Camelina sativa]
Length=460

 Score =   231 bits (588),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 146/151 (97%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            MEVFYYLVFG + AVVA +ELSKT+KDRI+TS +FN+FKNNYL+V+S+MMAGDWLQGPYV
Sbjct  1    MEVFYYLVFGTMTAVVAVLELSKTNKDRINTSSSFNSFKNNYLLVFSIMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+TYG+GKG+IGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCI YILSC+TKH
Sbjct  61   YYLYSTYGFGKGDIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCIVYILSCVTKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQY+VLM+GRILGGIATSLLFS+FESWL+A
Sbjct  121  SPQYRVLMVGRILGGIATSLLFSAFESWLIA  151



>gb|ACU20900.1| unknown [Glycine max]
Length=296

 Score =   226 bits (576),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 134/151 (89%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME+F+Y VFG L AVVA  ELSK++KDRI+TS  FN+FKNNYLIVYSLMMAGDWLQGPYV
Sbjct  1    MELFFYAVFGGLGAVVAVTELSKSNKDRINTSSAFNSFKNNYLIVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+TYGYGKG+IGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH
Sbjct  61   YYLYSTYGYGKGDIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SP YKVLMLGRILGGIATSLLFS+FESWLVA
Sbjct  121  SPHYKVLMLGRILGGIATSLLFSAFESWLVA  151



>ref|XP_009361322.1| PREDICTED: molybdate-anion transporter-like [Pyrus x bretschneideri]
Length=460

 Score =   231 bits (588),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 137/151 (91%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            MEVFYY+VFG LAAVVAA ELSK++KDRI+T  TFN FKNNYL VYSLMMAGDWLQGPYV
Sbjct  1    MEVFYYMVFGILAAVVAAAELSKSNKDRINTPSTFNVFKNNYLFVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+TYGYGKG+IGQLFIAGFGSSMLFGTIVGSLADKQGRKRAC+TYCITYILSCITKH
Sbjct  61   YYLYSTYGYGKGDIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACITYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQYKVLMLGRILGGIATSLLFS+FESWLVA
Sbjct  121  SPQYKVLMLGRILGGIATSLLFSAFESWLVA  151



>gb|KJB39449.1| hypothetical protein B456_007G016500 [Gossypium raimondii]
Length=488

 Score =   231 bits (590),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 133/151 (88%), Positives = 147/151 (97%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME+FY++VFGAL AVVAA+ELSK SKDRI+TS  FN+FKNNYL+VYSLMMAGDWLQGPYV
Sbjct  1    MELFYFVVFGALGAVVAALELSKNSKDRINTSSAFNSFKNNYLVVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+TYG+GKGEIGQLFIAGFGSSMLFGTIVGSLADKQGR+RACVTYCITYILSCITKH
Sbjct  61   YYLYSTYGFGKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRRRACVTYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQYK+LM+GR+LGGIATSLLFS+FESWLVA
Sbjct  121  SPQYKILMVGRVLGGIATSLLFSAFESWLVA  151



>ref|XP_010537061.1| PREDICTED: molybdate-anion transporter [Tarenaya hassleriana]
Length=461

 Score =   231 bits (588),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 131/151 (87%), Positives = 146/151 (97%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            MEVFYY+VFGAL  +VAA+ELSK +KDRI+TS  FN+FKNNYL+VYSLMMAGDWLQGPYV
Sbjct  1    MEVFYYMVFGALGVLVAAMELSKNNKDRINTSSAFNSFKNNYLLVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+TYG+GKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRAC+TYCITYILSCITKH
Sbjct  61   YYLYSTYGFGKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACITYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SP+YK+LM+GR+LGGIATSLLFS+FESWLVA
Sbjct  121  SPEYKILMVGRVLGGIATSLLFSAFESWLVA  151



>gb|KHN19524.1| Major facilitator superfamily domain-containing protein 5 [Glycine 
soja]
Length=459

 Score =   231 bits (588),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 136/151 (90%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME+F+Y VFG LAAVVA +ELSK +KDRI+TS  FN+FKNNYL+VYSLMMAGDWLQGPYV
Sbjct  1    MELFFYTVFGGLAAVVAVMELSKNNKDRINTSSAFNSFKNNYLLVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+TYGYGKG+IGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH
Sbjct  61   YYLYSTYGYGKGDIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQYKVLMLGRILGGIATSLLFSSFESWLVA
Sbjct  121  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  151



>ref|XP_002877664.1| hypothetical protein ARALYDRAFT_906210 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53923.1| hypothetical protein ARALYDRAFT_906210 [Arabidopsis lyrata subsp. 
lyrata]
Length=460

 Score =   230 bits (587),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 132/151 (87%), Positives = 147/151 (97%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            MEVFYYLVFG +AAVVAA+ELSK +KDRI+TS +FN+FKNNYL+V+S+MMAGDWLQGPYV
Sbjct  1    MEVFYYLVFGVMAAVVAALELSKRNKDRINTSSSFNSFKNNYLLVFSIMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+TYG+GKG+IGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCI YILSCITKH
Sbjct  61   YYLYSTYGFGKGDIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCIVYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQYKVLM+GRILGGIATSLLFS+FESWL+A
Sbjct  121  SPQYKVLMVGRILGGIATSLLFSAFESWLIA  151



>ref|XP_010541494.1| PREDICTED: molybdate-anion transporter [Tarenaya hassleriana]
Length=460

 Score =   230 bits (587),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 131/151 (87%), Positives = 148/151 (98%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            MEVFY+LVFGA+AAVVA +ELSKT+KDRI+TS  FN+FKNNYL+V+SLMMAGDWLQGPYV
Sbjct  1    MEVFYFLVFGAMAAVVAVLELSKTNKDRINTSAAFNSFKNNYLLVFSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+TYG+GKG+IGQLFIAGFGSSM+FGTIVGSLADKQGR+RACVTYCITYILSCITKH
Sbjct  61   YYLYSTYGFGKGDIGQLFIAGFGSSMVFGTIVGSLADKQGRRRACVTYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQY++LM+GRILGGIATSLLFSSFESWL+A
Sbjct  121  SPQYRILMVGRILGGIATSLLFSSFESWLIA  151



>gb|KHG26960.1| Major facilitator superfamily domain-containing protein 5 [Gossypium 
arboreum]
Length=460

 Score =   230 bits (587),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 132/151 (87%), Positives = 147/151 (97%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME+FY++VFGAL AVVAA+ELSK SKDRI+TS  FN+FKNNYL+VYSLMMAGDWLQGPYV
Sbjct  1    MELFYFVVFGALGAVVAALELSKNSKDRINTSSAFNSFKNNYLVVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+TYG+GKGEIGQLFIAGFGSSMLFGTIVGSLADKQGR+RACVTYCITY+LSCITKH
Sbjct  61   YYLYSTYGFGKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRRRACVTYCITYMLSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQYK+LM+GR+LGGIATSLLFS+FESWLVA
Sbjct  121  SPQYKILMVGRVLGGIATSLLFSAFESWLVA  151



>ref|XP_004502700.1| PREDICTED: major facilitator superfamily domain-containing protein 
5-like [Cicer arietinum]
Length=459

 Score =   230 bits (587),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 135/151 (89%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME+F+Y VFG LAAVVAA+ELSK +KDRI+TS  FN FKNNYL++YSLMMAGDWLQGPYV
Sbjct  1    MELFFYFVFGGLAAVVAALELSKNNKDRINTSSAFNTFKNNYLLIYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+TYGYGKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH
Sbjct  61   YYLYSTYGYGKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQY+VLMLGRILGGIATSLLFS+FESWLVA
Sbjct  121  SPQYRVLMLGRILGGIATSLLFSAFESWLVA  151



>ref|XP_007136474.1| hypothetical protein PHAVU_009G048300g [Phaseolus vulgaris]
 ref|XP_007136475.1| hypothetical protein PHAVU_009G048300g [Phaseolus vulgaris]
 gb|ESW08468.1| hypothetical protein PHAVU_009G048300g [Phaseolus vulgaris]
 gb|ESW08469.1| hypothetical protein PHAVU_009G048300g [Phaseolus vulgaris]
Length=459

 Score =   230 bits (586),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 136/151 (90%), Positives = 146/151 (97%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME+F+Y VFG LAAVVAA+ELSK++KDRI+TS  FN+FKNNYL+VYSLMMAGDWLQGPYV
Sbjct  1    MELFFYTVFGGLAAVVAALELSKSNKDRINTSSAFNSFKNNYLLVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+TYGYGKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCI YILSCITKH
Sbjct  61   YYLYSTYGYGKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCIAYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQYKVLMLGRILGGIATSLLFS+FESWLVA
Sbjct  121  SPQYKVLMLGRILGGIATSLLFSAFESWLVA  151



>ref|XP_003602307.1| Major facilitator superfamily domain-containing protein [Medicago 
truncatula]
 gb|AES72558.1| MFS transporter [Medicago truncatula]
Length=436

 Score =   229 bits (584),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 134/151 (89%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME+F+YLVFG LAAVVA +ELSK +KDRI+TS  FN+FKNNYL++YSLMMAGDWLQGPYV
Sbjct  1    MELFFYLVFGGLAAVVAVLELSKNNKDRINTSSLFNSFKNNYLLIYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+TYGYGKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYI SCITKH
Sbjct  61   YYLYSTYGYGKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYIASCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQY+VLMLGRILGGIATSLLFS+FESWLVA
Sbjct  121  SPQYRVLMLGRILGGIATSLLFSAFESWLVA  151



>ref|XP_003523346.1| PREDICTED: molybdate-anion transporter-like [Glycine max]
Length=459

 Score =   229 bits (585),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 135/151 (89%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME+F+Y VFG LAAVVA +ELSK +KDRI+TS  FN+FKNNYL+VYSLMMAGDWLQGPYV
Sbjct  1    MELFFYTVFGGLAAVVAVMELSKNNKDRINTSSAFNSFKNNYLLVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+TYGYGKG+IGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH
Sbjct  61   YYLYSTYGYGKGDIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQYKVLMLGRILGGIATSLLFS+FESWLVA
Sbjct  121  SPQYKVLMLGRILGGIATSLLFSAFESWLVA  151



>ref|XP_006661963.1| PREDICTED: molybdate-anion transporter-like [Oryza brachyantha]
Length=456

 Score =   229 bits (585),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 146/151 (97%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            MEVFYYLVFG LAAVVAA+EL K+SKDR++T+P FNAFKNNY++VYSLMM+GDWLQGPYV
Sbjct  1    MEVFYYLVFGGLAAVVAALELGKSSKDRVATTPAFNAFKNNYILVYSLMMSGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+ YG+ KG+IG+LFIAGFGSSMLFGTIVGSLADKQGRKRAC+TYCI+YILSCITKH
Sbjct  61   YYLYSQYGFDKGDIGRLFIAGFGSSMLFGTIVGSLADKQGRKRACITYCISYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SP+YK+LM+GR+LGGIATSLLFS+FESWLVA
Sbjct  121  SPEYKILMIGRVLGGIATSLLFSAFESWLVA  151



>gb|KFK27713.1| hypothetical protein AALP_AA8G420100 [Arabis alpina]
Length=460

 Score =   229 bits (585),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 146/151 (97%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            MEVFYYLVFG +A VVA +ELSKT+KDRI+TS  FN+FKNNYL+++S+MMAGDWLQGPYV
Sbjct  1    MEVFYYLVFGVMAIVVAILELSKTNKDRINTSSAFNSFKNNYLLIFSIMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+TYG+GKG+IGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSC+TKH
Sbjct  61   YYLYSTYGFGKGDIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCVTKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQY+VLM+GRILGGI+TSLLFS+FESWL+A
Sbjct  121  SPQYRVLMVGRILGGISTSLLFSAFESWLIA  151



>ref|XP_003602305.1| Major facilitator superfamily domain-containing protein [Medicago 
truncatula]
 gb|AES72556.1| MFS transporter [Medicago truncatula]
Length=459

 Score =   229 bits (585),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 134/151 (89%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME+F+YLVFG LAAVVA +ELSK +KDRI+TS  FN+FKNNYL++YSLMMAGDWLQGPYV
Sbjct  1    MELFFYLVFGGLAAVVAVLELSKNNKDRINTSSLFNSFKNNYLLIYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+TYGYGKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYI SCITKH
Sbjct  61   YYLYSTYGYGKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYIASCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQY+VLMLGRILGGIATSLLFS+FESWLVA
Sbjct  121  SPQYRVLMLGRILGGIATSLLFSAFESWLVA  151



>ref|XP_010676884.1| PREDICTED: molybdate-anion transporter [Beta vulgaris subsp. 
vulgaris]
Length=461

 Score =   229 bits (584),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 135/151 (89%), Positives = 147/151 (97%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            MEVFY LVFGALAAVVAA+EL+KTSKDRI+TS  FN+FKNNY++VYSLMMAGDWLQGPYV
Sbjct  1    MEVFYILVFGALAAVVAALELTKTSKDRINTSSAFNSFKNNYVLVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLYTTYG+ KGEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYC+TYI+SCITKH
Sbjct  61   YYLYTTYGFSKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCLTYIMSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQYK+LM+GRILGGIATSLLFS+FESWLVA
Sbjct  121  SPQYKILMVGRILGGIATSLLFSAFESWLVA  151



>gb|ABR16784.1| unknown [Picea sitchensis]
Length=449

 Score =   228 bits (582),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME+FYY+VFG L+A+VA  ELSK +KDRISTS  F++FKNNYL+VYSLMMAGDWLQGPYV
Sbjct  1    MELFYYVVFGILSAIVAVFELSKNNKDRISTSSAFSSFKNNYLVVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            Y+LY+ YG+ KG+IG+LFIAGFGSSMLFGTIVGSLADKQGRKRAC+TYCITYILSCITKH
Sbjct  61   YFLYSQYGFDKGDIGRLFIAGFGSSMLFGTIVGSLADKQGRKRACITYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQYKVLM+GRILGGIATSLLFS+FESWLVA
Sbjct  121  SPQYKVLMIGRILGGIATSLLFSAFESWLVA  151



>gb|ACN26835.1| unknown [Zea mays]
Length=248

 Score =   222 bits (565),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 123/151 (81%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            MEVFYY+VFGALAA+VA +EL K+ KDR++T+  FN+FKNNY++VYSLMM+GDWLQGPYV
Sbjct  1    MEVFYYVVFGALAAIVAGLELGKSGKDRVATTSAFNSFKNNYVLVYSLMMSGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+ YG+ KG+IG+LFIAGFGSSMLFGTIVGSLADKQGRKRAC+TYCI+YILSCITKH
Sbjct  61   YYLYSQYGFDKGDIGRLFIAGFGSSMLFGTIVGSLADKQGRKRACITYCISYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SP+Y+VLM+GRILGGIATSLLFS+FESWLVA
Sbjct  121  SPEYRVLMIGRILGGIATSLLFSAFESWLVA  151



>gb|ABR17540.1| unknown [Picea sitchensis]
 gb|ACN40211.1| unknown [Picea sitchensis]
Length=463

 Score =   228 bits (581),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME+FYY+VFG L+A+VA  ELSK +KDRISTS  F++FKNNYL+VYSLMMAGDWLQGPYV
Sbjct  1    MELFYYVVFGILSAIVAVFELSKNNKDRISTSSAFSSFKNNYLVVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            Y+LY+ YG+ KG+IG+LFIAGFGSSMLFGTIVGSLADKQGRKRAC+TYCITYILSCITKH
Sbjct  61   YFLYSQYGFDKGDIGRLFIAGFGSSMLFGTIVGSLADKQGRKRACITYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQYKVLM+GRILGGIATSLLFS+FESWLVA
Sbjct  121  SPQYKVLMIGRILGGIATSLLFSAFESWLVA  151



>ref|XP_007039420.1| Major facilitator superfamily protein [Theobroma cacao]
 gb|EOY23921.1| Major facilitator superfamily protein [Theobroma cacao]
Length=535

 Score =   230 bits (586),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 133/151 (88%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME FY LVFGALA++VAA+ELSKTSKDRI+TS  FN+FKNNYL+VYSLMMAGDWLQGPYV
Sbjct  74   MEAFYLLVFGALASLVAALELSKTSKDRINTSSAFNSFKNNYLVVYSLMMAGDWLQGPYV  133

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+ YG+GKGEIG LFIAGFGSSM FGTIVGSLADK+GRKRACVTYCITYILSCITKH
Sbjct  134  YYLYSQYGFGKGEIGHLFIAGFGSSMFFGTIVGSLADKKGRKRACVTYCITYILSCITKH  193

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQYKVLMLGR+LGGIATSLLFS+FESWLVA
Sbjct  194  SPQYKVLMLGRVLGGIATSLLFSAFESWLVA  224



>ref|XP_003526731.1| PREDICTED: molybdate-anion transporter isoform 1 [Glycine max]
Length=459

 Score =   228 bits (581),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 134/151 (89%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME+F+Y VFG L AVVA  ELSK++KDRI+TS  FN+FKNNYLIVYSLMMAGDWLQGPYV
Sbjct  1    MELFFYAVFGGLGAVVAVTELSKSNKDRINTSSAFNSFKNNYLIVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+TYGYGKG+IGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH
Sbjct  61   YYLYSTYGYGKGDIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SP YKVLMLGRILGGIATSLLFS+FESWLVA
Sbjct  121  SPHYKVLMLGRILGGIATSLLFSAFESWLVA  151



>ref|XP_010252496.1| PREDICTED: molybdate-anion transporter-like [Nelumbo nucifera]
Length=464

 Score =   228 bits (581),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME+FYYL+FG L+ VVAA+E SKT+KDRI+TS  FN+FKNNYL+VYSLMMAGDWLQGPYV
Sbjct  1    MEIFYYLIFGCLSLVVAALEFSKTTKDRINTSSAFNSFKNNYLVVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            Y+LY+ YG+ KG+IG+LFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSC TKH
Sbjct  61   YFLYSQYGFDKGDIGRLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCFTKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SP YKVLMLGRILGGIATSLLFS+FESWLVA
Sbjct  121  SPLYKVLMLGRILGGIATSLLFSAFESWLVA  151



>gb|AFP55541.1| major facilitator superfamily domain [Rosa rugosa]
Length=492

 Score =   229 bits (583),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 133/151 (88%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME FYYLVFG LA VVA  ELSK++KDRI+TS  FN+FKNNYL++YSLMMAGDWLQGPYV
Sbjct  1    MEAFYYLVFGVLAVVVAGAELSKSNKDRINTSSAFNSFKNNYLVIYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLYTTYG+GKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRAC+TYCITYILSCITKH
Sbjct  61   YYLYTTYGFGKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACITYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SP Y VLMLGRILGGIATSLLFS+FESWLVA
Sbjct  121  SPHYNVLMLGRILGGIATSLLFSAFESWLVA  151



>ref|XP_009387043.1| PREDICTED: molybdate-anion transporter-like [Musa acuminata subsp. 
malaccensis]
Length=462

 Score =   228 bits (580),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 130/151 (86%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            M+ FYYLVFG LAAVVAA+ELSKTS+DR++TS  FNAFKNNYL+VYSLMMAGDWLQGPYV
Sbjct  1    MDAFYYLVFGGLAAVVAAMELSKTSRDRVATSSPFNAFKNNYLLVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+ YG+ KG+IG+LFIAGFGSSMLFGTIVGSLADK+GRKRACVTYCITYILSCITKH
Sbjct  61   YYLYSQYGFDKGDIGRLFIAGFGSSMLFGTIVGSLADKRGRKRACVTYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SP+YKVLM+GRILGGI+TSLLFS+FESWLVA
Sbjct  121  SPEYKVLMVGRILGGISTSLLFSAFESWLVA  151



>gb|KJB24150.1| hypothetical protein B456_004G130100 [Gossypium raimondii]
 gb|KJB24151.1| hypothetical protein B456_004G130100 [Gossypium raimondii]
Length=462

 Score =   228 bits (580),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 130/151 (86%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME FY +VFG+LA++VA +ELSKTSKDR STS  FN+FKNNYL+VYSLMMAGDWLQGPYV
Sbjct  1    MEPFYLVVFGSLASLVAVLELSKTSKDRFSTSSAFNSFKNNYLVVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+ YG+GKGEIG LFIAGFGSSMLFGT+VGSLADK+GRKRACVTYCITYILSCITKH
Sbjct  61   YYLYSHYGFGKGEIGHLFIAGFGSSMLFGTVVGSLADKRGRKRACVTYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQYKVLMLGR+LGGIATSLLFS+FESWLVA
Sbjct  121  SPQYKVLMLGRVLGGIATSLLFSAFESWLVA  151



>ref|XP_010934492.1| PREDICTED: molybdate-anion transporter [Elaeis guineensis]
Length=460

 Score =   228 bits (580),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 131/151 (87%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME  YYLVFG L+ VVA +E SKTSKDRISTS  FN+FKNNY++VYSLMMAGDWLQGPYV
Sbjct  1    MEALYYLVFGGLSVVVALLEFSKTSKDRISTSVAFNSFKNNYIVVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY TYG+GKGEIG+LFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCI+YILSCITKH
Sbjct  61   YYLYHTYGFGKGEIGRLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCISYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SP++KVLMLGRILGGIATSLLFS+FESWLVA
Sbjct  121  SPEFKVLMLGRILGGIATSLLFSAFESWLVA  151



>gb|AFK42358.1| unknown [Medicago truncatula]
Length=459

 Score =   227 bits (579),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 133/151 (88%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME+F+YLVFG LAAVVA +ELSK +KDRI+TS  FN+FKNNYL++YSLMMAGDWLQGPYV
Sbjct  1    MELFFYLVFGGLAAVVAVLELSKNNKDRINTSSLFNSFKNNYLLIYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+TYGYGKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYI SCITKH
Sbjct  61   YYLYSTYGYGKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYIASCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQY+VLMLGR LGGIATSLLFS+FESWLVA
Sbjct  121  SPQYRVLMLGRTLGGIATSLLFSAFESWLVA  151



>gb|ABB47893.2| Major Facilitator Superfamily protein, expressed [Oryza sativa 
Japonica Group]
Length=455

 Score =   227 bits (579),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 125/151 (83%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            MEVFYYLVFG LAAVVA +EL K+ KDR++T+P FNAFKNNY++VYSLMM+GDWLQGPYV
Sbjct  1    MEVFYYLVFGGLAAVVAGLELGKSGKDRVATTPAFNAFKNNYILVYSLMMSGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+ YG+ KG+IG+LFIAGFGSSMLFGTIVGSLADKQGRKRAC+TYCI+YILSCITKH
Sbjct  61   YYLYSQYGFDKGDIGRLFIAGFGSSMLFGTIVGSLADKQGRKRACITYCISYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SP+YK+LM+GR+LGGIATSLLFS+FESWLVA
Sbjct  121  SPEYKILMIGRVLGGIATSLLFSAFESWLVA  151



>ref|NP_001065080.1| Os10g0519600 [Oryza sativa Japonica Group]
 gb|AAG13421.1|AC051634_2 putative transporter [Oryza sativa Japonica Group]
 gb|AAP54651.1| Major Facilitator Superfamily protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF26994.1| Os10g0519600 [Oryza sativa Japonica Group]
 dbj|BAG96109.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC67318.1| hypothetical protein OsI_34339 [Oryza sativa Indica Group]
 gb|EEE51277.1| hypothetical protein OsJ_32177 [Oryza sativa Japonica Group]
 dbj|BAN20028.1| DUF791 domain protein [Oryza sativa Japonica Group]
Length=456

 Score =   227 bits (579),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 125/151 (83%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            MEVFYYLVFG LAAVVA +EL K+ KDR++T+P FNAFKNNY++VYSLMM+GDWLQGPYV
Sbjct  1    MEVFYYLVFGGLAAVVAGLELGKSGKDRVATTPAFNAFKNNYILVYSLMMSGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+ YG+ KG+IG+LFIAGFGSSMLFGTIVGSLADKQGRKRAC+TYCI+YILSCITKH
Sbjct  61   YYLYSQYGFDKGDIGRLFIAGFGSSMLFGTIVGSLADKQGRKRACITYCISYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SP+YK+LM+GR+LGGIATSLLFS+FESWLVA
Sbjct  121  SPEYKILMIGRVLGGIATSLLFSAFESWLVA  151



>ref|XP_006302235.1| hypothetical protein CARUB_v10020258mg [Capsella rubella]
 gb|EOA35133.1| hypothetical protein CARUB_v10020258mg [Capsella rubella]
Length=462

 Score =   227 bits (579),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 130/151 (86%), Positives = 146/151 (97%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME+FY++VFG LAA+VA +ELSK++KDRI+TS  FN+FKNNYL+VYSLMMAGDWLQGPYV
Sbjct  1    MEIFYFVVFGGLAAIVAGLELSKSNKDRINTSSAFNSFKNNYLLVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+TYG+GKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRA +TYCITYILSCITKH
Sbjct  61   YYLYSTYGFGKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRASITYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQYKVLM+GR+LGGIATSLLFS+FESWLVA
Sbjct  121  SPQYKVLMVGRVLGGIATSLLFSAFESWLVA  151



>dbj|BAF00766.1| hypothetical protein [Arabidopsis thaliana]
Length=462

 Score =   227 bits (579),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 130/151 (86%), Positives = 146/151 (97%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME+FY++VFG LAA+VA +ELSK++KDRI+TS  FN+FKNNYL+VYSLMMAGDWLQGPYV
Sbjct  1    MEIFYFVVFGGLAAIVAGLELSKSNKDRINTSSAFNSFKNNYLLVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+TYG+GKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRA +TYCITYILSCITKH
Sbjct  61   YYLYSTYGFGKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRASITYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQYKVLM+GR+LGGIATSLLFS+FESWLVA
Sbjct  121  SPQYKVLMVGRVLGGIATSLLFSAFESWLVA  151



>ref|XP_010430611.1| PREDICTED: molybdate-anion transporter [Camelina sativa]
Length=462

 Score =   227 bits (579),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 130/151 (86%), Positives = 146/151 (97%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME+FY++VFG LAA+VA +ELSK++KDRI+TS  FN+FKNNYL+VYSLMMAGDWLQGPYV
Sbjct  1    MEIFYFVVFGGLAAIVAGLELSKSNKDRINTSSAFNSFKNNYLLVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+TYG+GKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRA +TYCITYILSCITKH
Sbjct  61   YYLYSTYGFGKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRASITYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQYKVLM+GR+LGGIATSLLFS+FESWLVA
Sbjct  121  SPQYKVLMVGRVLGGIATSLLFSAFESWLVA  151



>ref|NP_176646.1| general substrate transporter-like protein [Arabidopsis thaliana]
 gb|AAS47630.1| At1g64650 [Arabidopsis thaliana]
 gb|AAS76755.1| At1g64650 [Arabidopsis thaliana]
 gb|AEE34269.1| general substrate transporter-like protein [Arabidopsis thaliana]
Length=462

 Score =   227 bits (579),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 130/151 (86%), Positives = 146/151 (97%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME+FY++VFG LAA+VA +ELSK++KDRI+TS  FN+FKNNYL+VYSLMMAGDWLQGPYV
Sbjct  1    MEIFYFVVFGGLAAIVAGLELSKSNKDRINTSSAFNSFKNNYLLVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+TYG+GKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRA +TYCITYILSCITKH
Sbjct  61   YYLYSTYGFGKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRASITYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQYKVLM+GR+LGGIATSLLFS+FESWLVA
Sbjct  121  SPQYKVLMVGRVLGGIATSLLFSAFESWLVA  151



>ref|XP_002886332.1| hypothetical protein ARALYDRAFT_474876 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62591.1| hypothetical protein ARALYDRAFT_474876 [Arabidopsis lyrata subsp. 
lyrata]
Length=462

 Score =   227 bits (579),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 130/151 (86%), Positives = 146/151 (97%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME+FY++VFG LAA+VA +ELSK++KDRI+TS  FN+FKNNYL+VYSLMMAGDWLQGPYV
Sbjct  1    MEIFYFVVFGGLAAIVAGLELSKSNKDRINTSSAFNSFKNNYLLVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+TYG+GKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRA +TYCITYILSCITKH
Sbjct  61   YYLYSTYGFGKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRASITYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQYKVLM+GR+LGGIATSLLFS+FESWLVA
Sbjct  121  SPQYKVLMVGRVLGGIATSLLFSAFESWLVA  151



>gb|AAF19685.1|AC009519_19 F1N19.22 [Arabidopsis thaliana]
Length=474

 Score =   227 bits (579),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 130/151 (86%), Positives = 146/151 (97%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME+FY++VFG LAA+VA +ELSK++KDRI+TS  FN+FKNNYL+VYSLMMAGDWLQGPYV
Sbjct  1    MEIFYFVVFGGLAAIVAGLELSKSNKDRINTSSAFNSFKNNYLLVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+TYG+GKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRA +TYCITYILSCITKH
Sbjct  61   YYLYSTYGFGKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRASITYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQYKVLM+GR+LGGIATSLLFS+FESWLVA
Sbjct  121  SPQYKVLMVGRVLGGIATSLLFSAFESWLVA  151



>ref|XP_008806366.1| PREDICTED: molybdate-anion transporter [Phoenix dactylifera]
Length=462

 Score =   226 bits (577),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 130/151 (86%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME  YYL+FG L+ VVA +E SKTSKDRISTS  FN+FKNNY++VYSLMMAGDWLQGPYV
Sbjct  1    MEALYYLLFGGLSVVVALLEFSKTSKDRISTSVAFNSFKNNYIVVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY TYG+GKGEIG+LFIAGFGSSMLFGTIVGS+ADKQGRKRACVTYCI+YILSCITKH
Sbjct  61   YYLYHTYGFGKGEIGRLFIAGFGSSMLFGTIVGSMADKQGRKRACVTYCISYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQ+KVLMLGRILGGIATSLLFS+FESWLVA
Sbjct  121  SPQFKVLMLGRILGGIATSLLFSAFESWLVA  151



>gb|KHN23335.1| Major facilitator superfamily domain-containing protein 5 [Glycine 
soja]
Length=521

 Score =   228 bits (581),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 134/151 (89%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME+F+Y VFG L AVVA  ELSK++KDRI+TS  FN+FKNNYLIVYSLMMAGDWLQGPYV
Sbjct  1    MELFFYAVFGGLGAVVAVTELSKSNKDRINTSSAFNSFKNNYLIVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+TYGYGKG+IGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH
Sbjct  61   YYLYSTYGYGKGDIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SP YKVLMLGRILGGIATSLLFS+FESWLVA
Sbjct  121  SPHYKVLMLGRILGGIATSLLFSAFESWLVA  151



>gb|KHG17688.1| Major facilitator superfamily domain-containing protein 5 [Gossypium 
arboreum]
Length=462

 Score =   226 bits (577),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME FY +VFG+LA++VA +ELSKTSKDR STS  FN+FKNNYL+VYSLMMAGDWLQGPYV
Sbjct  1    MEPFYLVVFGSLASLVAVLELSKTSKDRFSTSTAFNSFKNNYLVVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+ YG+GKGEIG LFIAGFGSSMLFGT+VGSLADK+GRKRACVTYCITYILSCITKH
Sbjct  61   YYLYSHYGFGKGEIGHLFIAGFGSSMLFGTVVGSLADKRGRKRACVTYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQY+VLMLGR+LGGIATSLLFS+FESWLVA
Sbjct  121  SPQYRVLMLGRVLGGIATSLLFSAFESWLVA  151



>ref|XP_004307944.1| PREDICTED: molybdate-anion transporter [Fragaria vesca subsp. 
vesca]
Length=460

 Score =   226 bits (577),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 132/151 (87%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME FYYLVFGALA VVA  ELSK++KDR++TS  FN+FKNNYL+VYSLMMAGDWLQGPYV
Sbjct  1    MEAFYYLVFGALAVVVAGAELSKSNKDRVNTSAAFNSFKNNYLVVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLYTTYG+GKG+IG LFIAGFGSSMLFGTIVGSLADKQGRKRAC+TYCITYILSCITKH
Sbjct  61   YYLYTTYGFGKGDIGHLFIAGFGSSMLFGTIVGSLADKQGRKRACITYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SP Y VLMLGRILGGIATSLLFS+FESWLVA
Sbjct  121  SPHYNVLMLGRILGGIATSLLFSAFESWLVA  151



>ref|XP_010252339.1| PREDICTED: molybdate-anion transporter-like [Nelumbo nucifera]
Length=462

 Score =   226 bits (577),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME+FYYL+FG LA VVA +E SKT+KDRI+ S  F++FKNNYL+VYSLMMAGDWLQGPYV
Sbjct  1    MEMFYYLLFGGLALVVAILEFSKTTKDRINASAAFHSFKNNYLVVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+ YG+ KG+IG+LFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH
Sbjct  61   YYLYSQYGFDKGDIGRLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQYKVLMLGR+LGGIATSLLFS+FESWLVA
Sbjct  121  SPQYKVLMLGRVLGGIATSLLFSAFESWLVA  151



>ref|XP_002466934.1| hypothetical protein SORBIDRAFT_01g016960 [Sorghum bicolor]
 gb|EER93932.1| hypothetical protein SORBIDRAFT_01g016960 [Sorghum bicolor]
Length=456

 Score =   226 bits (576),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 126/151 (83%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME+FYYLVFGALAA+VAA+EL K+ KDR++TSP FN+FKNNY++VYSLMM+GDWLQGPYV
Sbjct  1    MEMFYYLVFGALAAIVAALELGKSGKDRVATSPAFNSFKNNYILVYSLMMSGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+ YG+ KG+IG+LFIAGFGSSMLFGTIVGSLADK+GRKRACVTYCITYILSC TKH
Sbjct  61   YYLYSQYGFDKGDIGRLFIAGFGSSMLFGTIVGSLADKKGRKRACVTYCITYILSCFTKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQYK+LM+GR+LGGIATSLLFS+FESWLVA
Sbjct  121  SPQYKILMVGRVLGGIATSLLFSAFESWLVA  151



>ref|XP_008803061.1| PREDICTED: molybdate-anion transporter-like [Phoenix dactylifera]
Length=462

 Score =   226 bits (576),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME  YYL+FG L+ VVA +E SKTSKDRISTS  FN+FKNNY++VYSLMMAGDWLQGPYV
Sbjct  1    MEALYYLLFGGLSVVVALLEFSKTSKDRISTSAAFNSFKNNYIVVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY TYG+GKGEIG+LFIAGFGSSM+FGTIVGSLADKQGRKRACVTYCI+YILSCITKH
Sbjct  61   YYLYHTYGFGKGEIGRLFIAGFGSSMIFGTIVGSLADKQGRKRACVTYCISYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SP++KVLMLGRILGGIATSLLFS+FESWLVA
Sbjct  121  SPEFKVLMLGRILGGIATSLLFSAFESWLVA  151



>ref|XP_008439575.1| PREDICTED: molybdate-anion transporter-like [Cucumis melo]
Length=460

 Score =   226 bits (576),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 131/151 (87%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            MEVFYY VFGAL ++VAAIELSK ++DRI+T+  FN+FKNNYL+VYSLMMAGDWLQGPYV
Sbjct  1    MEVFYYFVFGALGSIVAAIELSKNNRDRINTTTAFNSFKNNYLLVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+ YGYGKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSC TKH
Sbjct  61   YYLYSQYGYGKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCTTKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            S +YK+LMLGRILGGIATSLLFS+FESWLVA
Sbjct  121  SSEYKILMLGRILGGIATSLLFSAFESWLVA  151



>ref|XP_004982589.1| PREDICTED: major facilitator superfamily domain-containing protein 
5-like isoform X4 [Setaria italica]
Length=456

 Score =   226 bits (575),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            MEVFYYLVFGALAAVVAA+EL K+ KDR++TSP FN+FKNNY++VYSLMM+GDWLQGPYV
Sbjct  1    MEVFYYLVFGALAAVVAALELGKSGKDRVATSPAFNSFKNNYILVYSLMMSGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+ YG+ KG+IG+LFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSC TKH
Sbjct  61   YYLYSQYGFDKGDIGRLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCFTKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SP+YK+LM+GR+LGGIATSLLFS+FESWLVA
Sbjct  121  SPEYKILMIGRVLGGIATSLLFSAFESWLVA  151



>ref|XP_006350499.1| PREDICTED: major facilitator superfamily domain-containing protein 
5-like isoform X1 [Solanum tuberosum]
 ref|XP_006350500.1| PREDICTED: major facilitator superfamily domain-containing protein 
5-like isoform X2 [Solanum tuberosum]
Length=462

 Score =   226 bits (575),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 131/152 (86%), Positives = 146/152 (96%), Gaps = 1/152 (1%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELS-KTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpy  240
            ME+FYY++FGA+AAVVA +EL  K++KDRI+TS  FN+FKNNY++VYSLMMAGDWLQGPY
Sbjct  1    MELFYYVLFGAMAAVVAVLELGGKSNKDRITTSQAFNSFKNNYILVYSLMMAGDWLQGPY  60

Query  241  vyylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITK  420
            VYYLY+TYG+ KG+IGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITK
Sbjct  61   VYYLYSTYGFSKGDIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITK  120

Query  421  HSPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            HSPQYKVLM+GRILGGIATSLLFSSFESWLVA
Sbjct  121  HSPQYKVLMVGRILGGIATSLLFSSFESWLVA  152



>ref|XP_010109217.1| hypothetical protein L484_011839 [Morus notabilis]
 gb|EXC21397.1| hypothetical protein L484_011839 [Morus notabilis]
Length=459

 Score =   225 bits (574),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 130/151 (86%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME+FYYLVFG L AVVAA+ELSK +KDRI+T+P FN+FKNNYL+VYSLMMAGDWLQGPYV
Sbjct  1    MEIFYYLVFGGLGAVVAAMELSKNNKDRINTTPAFNSFKNNYLVVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+TYG+GKGEIG LFIAGFGSSMLFGTIVGSLADKQGR+RA VTYCITYILSCITKH
Sbjct  61   YYLYSTYGFGKGEIGHLFIAGFGSSMLFGTIVGSLADKQGRRRASVTYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            S QY++LM+GRILGGIATSLLFS+FESWLVA
Sbjct  121  SSQYRILMVGRILGGIATSLLFSAFESWLVA  151



>ref|XP_010318046.1| PREDICTED: molybdate-anion transporter [Solanum lycopersicum]
Length=462

 Score =   226 bits (575),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 131/152 (86%), Positives = 147/152 (97%), Gaps = 1/152 (1%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELS-KTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpy  240
            ME+FYY++FGA+AAVVA +EL  KT+KDRI+TS  FN+FKNNY++VYSLMMAGDWLQGPY
Sbjct  1    MELFYYVLFGAMAAVVAVLELGGKTNKDRITTSQAFNSFKNNYILVYSLMMAGDWLQGPY  60

Query  241  vyylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITK  420
            VYYLY+TYG+GKG+IGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSC+TK
Sbjct  61   VYYLYSTYGFGKGDIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCVTK  120

Query  421  HSPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            HSPQYK+LM+GRILGGIATSLLFSSFESWLVA
Sbjct  121  HSPQYKILMVGRILGGIATSLLFSSFESWLVA  152



>emb|CDP05020.1| unnamed protein product [Coffea canephora]
Length=461

 Score =   225 bits (574),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 133/151 (88%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME+FYY+VFGAL AVVAA+ELSK +KDRI+TS  F +FKNNYL+VYSLMMAGDWLQGPYV
Sbjct  1    MELFYYMVFGALGAVVAALELSKANKDRITTSQAFTSFKNNYLLVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+TYG+GKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRAC TYCITYILSCITKH
Sbjct  61   YYLYSTYGFGKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACATYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQYKVLMLGR+LGGIATSLL S FESWLVA
Sbjct  121  SPQYKVLMLGRVLGGIATSLLCSGFESWLVA  151



>ref|XP_004982588.1| PREDICTED: major facilitator superfamily domain-containing protein 
5-like isoform X3 [Setaria italica]
Length=481

 Score =   226 bits (576),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            MEVFYYLVFGALAAVVAA+EL K+ KDR++TSP FN+FKNNY++VYSLMM+GDWLQGPYV
Sbjct  1    MEVFYYLVFGALAAVVAALELGKSGKDRVATSPAFNSFKNNYILVYSLMMSGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+ YG+ KG+IG+LFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSC TKH
Sbjct  61   YYLYSQYGFDKGDIGRLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCFTKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SP+YK+LM+GR+LGGIATSLLFS+FESWLVA
Sbjct  121  SPEYKILMIGRVLGGIATSLLFSAFESWLVA  151



>gb|KCW89110.1| hypothetical protein EUGRSUZ_A01432 [Eucalyptus grandis]
Length=427

 Score =   224 bits (572),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 135/151 (89%), Positives = 147/151 (97%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            MEVFY++VFGALAAVVAA+ELSK++KDRI+T+  FN+FKNNYL+VYSLMMAGDWLQGPYV
Sbjct  1    MEVFYFMVFGALAAVVAAVELSKSNKDRINTTSAFNSFKNNYLLVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+TYGYGKG+IGQLFIAGFGSSMLFGTIVGSLADKQGRKRA VTYCITYILSCITKH
Sbjct  61   YYLYSTYGYGKGDIGQLFIAGFGSSMLFGTIVGSLADKQGRKRASVTYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SP YKVLMLGRILGGIATSLLFS+FESWLVA
Sbjct  121  SPHYKVLMLGRILGGIATSLLFSAFESWLVA  151



>gb|KFK32961.1| hypothetical protein AALP_AA6G312100 [Arabis alpina]
Length=462

 Score =   225 bits (574),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 146/151 (97%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME+FY++VFG LAA+VA +ELSK++KDRI+TS  FN+FKNNYL+VYSLMMAGDWLQGPYV
Sbjct  1    MEIFYFVVFGGLAAIVAGLELSKSNKDRINTSSAFNSFKNNYLLVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+TYG+GKG+IGQLFIAGFGSSMLFGTIVGSLADKQGRKRA +TYCITYILSCITKH
Sbjct  61   YYLYSTYGFGKGDIGQLFIAGFGSSMLFGTIVGSLADKQGRKRASITYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQY+VLM+GR+LGGIATSLLFS+FESWLVA
Sbjct  121  SPQYRVLMVGRVLGGIATSLLFSAFESWLVA  151



>gb|EMS67574.1| hypothetical protein TRIUR3_28243 [Triticum urartu]
Length=428

 Score =   224 bits (571),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 125/151 (83%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            MEVFYYLVFG LAAVVAA+EL K+ KDR++T   FN+FKNNY++VYSLMM+GDWLQGPYV
Sbjct  1    MEVFYYLVFGGLAAVVAALELGKSGKDRVATPTAFNSFKNNYVLVYSLMMSGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+ YG  KG+IG+LFIAGFGSSMLFGTIVGSLADKQGRKRAC+TYCITYILSCITKH
Sbjct  61   YYLYSQYGVDKGDIGRLFIAGFGSSMLFGTIVGSLADKQGRKRACITYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQY++LM+GR+LGGIATSLLFS+FESWLVA
Sbjct  121  SPQYRILMIGRVLGGIATSLLFSAFESWLVA  151



>gb|KFK29292.1| hypothetical protein AALP_AA7G114400 [Arabis alpina]
Length=460

 Score =   225 bits (574),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 135/151 (89%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            MEVFYY+VFG L  VVAA+ELSK +KDRI+T   FN+FKNNYL+VYSLMMAGDWLQGPYV
Sbjct  1    MEVFYYVVFGVLGLVVAALELSKKNKDRINTCSAFNSFKNNYLLVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLYTTYG+ KGEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH
Sbjct  61   YYLYTTYGFSKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQYKVLMLGR+LGGIATSLLFSSFESWLVA
Sbjct  121  SPQYKVLMLGRVLGGIATSLLFSSFESWLVA  151



>ref|XP_004982587.1| PREDICTED: major facilitator superfamily domain-containing protein 
5-like isoform X2 [Setaria italica]
Length=484

 Score =   226 bits (575),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            MEVFYYLVFGALAAVVAA+EL K+ KDR++TSP FN+FKNNY++VYSLMM+GDWLQGPYV
Sbjct  1    MEVFYYLVFGALAAVVAALELGKSGKDRVATSPAFNSFKNNYILVYSLMMSGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+ YG+ KG+IG+LFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSC TKH
Sbjct  61   YYLYSQYGFDKGDIGRLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCFTKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SP+YK+LM+GR+LGGIATSLLFS+FESWLVA
Sbjct  121  SPEYKILMIGRVLGGIATSLLFSAFESWLVA  151



>ref|XP_006391594.1| hypothetical protein EUTSA_v10023452mg [Eutrema salsugineum]
 gb|ESQ28880.1| hypothetical protein EUTSA_v10023452mg [Eutrema salsugineum]
Length=462

 Score =   225 bits (573),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME+FY +VFG LAA+VA +ELSK++KDRI+TS  FN+FKNNYL+VYSLMMAGDWLQGPYV
Sbjct  1    MEIFYIVVFGGLAAIVAGLELSKSNKDRINTSSAFNSFKNNYLLVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+TYG+GKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRA +TYCITYILSCITKH
Sbjct  61   YYLYSTYGFGKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRASITYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQYK+LM+GR+LGGIATSLLFS+FESWLVA
Sbjct  121  SPQYKILMVGRVLGGIATSLLFSAFESWLVA  151



>ref|XP_004982586.1| PREDICTED: major facilitator superfamily domain-containing protein 
5-like isoform X1 [Setaria italica]
Length=509

 Score =   226 bits (576),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            MEVFYYLVFGALAAVVAA+EL K+ KDR++TSP FN+FKNNY++VYSLMM+GDWLQGPYV
Sbjct  1    MEVFYYLVFGALAAVVAALELGKSGKDRVATSPAFNSFKNNYILVYSLMMSGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+ YG+ KG+IG+LFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSC TKH
Sbjct  61   YYLYSQYGFDKGDIGRLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCFTKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SP+YK+LM+GR+LGGIATSLLFS+FESWLVA
Sbjct  121  SPEYKILMIGRVLGGIATSLLFSAFESWLVA  151



>ref|XP_010941032.1| PREDICTED: molybdate-anion transporter-like [Elaeis guineensis]
Length=462

 Score =   225 bits (573),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME  YYL+FG L+ VVA +E SKTSKDRISTS  FN+FKNNY++VYSLMMAGDWLQGPYV
Sbjct  1    MEALYYLLFGGLSVVVALLEFSKTSKDRISTSAAFNSFKNNYIVVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY TYG+GKGEIG+LFIAGFGSSM+FGTIVGSLADKQGRKRACVTYCI+YILSCITKH
Sbjct  61   YYLYHTYGFGKGEIGRLFIAGFGSSMVFGTIVGSLADKQGRKRACVTYCISYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SP++KVLM+GRILGGIATSLLFS+FESWLVA
Sbjct  121  SPEFKVLMVGRILGGIATSLLFSAFESWLVA  151



>ref|XP_010048797.1| PREDICTED: molybdate-anion transporter-like [Eucalyptus grandis]
 gb|KCW89109.1| hypothetical protein EUGRSUZ_A01432 [Eucalyptus grandis]
Length=460

 Score =   224 bits (572),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 135/151 (89%), Positives = 147/151 (97%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            MEVFY++VFGALAAVVAA+ELSK++KDRI+T+  FN+FKNNYL+VYSLMMAGDWLQGPYV
Sbjct  1    MEVFYFMVFGALAAVVAAVELSKSNKDRINTTSAFNSFKNNYLLVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+TYGYGKG+IGQLFIAGFGSSMLFGTIVGSLADKQGRKRA VTYCITYILSCITKH
Sbjct  61   YYLYSTYGYGKGDIGQLFIAGFGSSMLFGTIVGSLADKQGRKRASVTYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SP YKVLMLGRILGGIATSLLFS+FESWLVA
Sbjct  121  SPHYKVLMLGRILGGIATSLLFSAFESWLVA  151



>gb|ABF93637.1| expressed protein [Oryza sativa Japonica Group]
Length=434

 Score =   223 bits (569),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 124/151 (82%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            MEVFYYLVFG LAAVVA +EL K++KDR++TS  FN+FKNNY++VYSLMM+GDWLQGPYV
Sbjct  1    MEVFYYLVFGGLAAVVAGLELGKSAKDRVTTSQAFNSFKNNYVLVYSLMMSGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+ YG+ KG+IG+LFIAGFGSSMLFGTIVGSLADKQGRKRAC+TYCI+YILSCITKH
Sbjct  61   YYLYSQYGFDKGDIGRLFIAGFGSSMLFGTIVGSLADKQGRKRACITYCISYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SP+YK+LM+GR+LGGIATSLLFS+FESWLVA
Sbjct  121  SPEYKILMIGRVLGGIATSLLFSAFESWLVA  151



>ref|NP_001048746.1| Os03g0114800 [Oryza sativa Japonica Group]
 gb|AAO17028.1| Putative transporter [Oryza sativa Japonica Group]
 gb|ABF93636.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF10660.1| Os03g0114800 [Oryza sativa Japonica Group]
 gb|EAZ25346.1| hypothetical protein OsJ_09160 [Oryza sativa Japonica Group]
 dbj|BAG89502.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAN20029.1| DUF791 domain protein [Oryza sativa Japonica Group]
Length=457

 Score =   224 bits (570),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 124/151 (82%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            MEVFYYLVFG LAAVVA +EL K++KDR++TS  FN+FKNNY++VYSLMM+GDWLQGPYV
Sbjct  1    MEVFYYLVFGGLAAVVAGLELGKSAKDRVTTSQAFNSFKNNYVLVYSLMMSGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+ YG+ KG+IG+LFIAGFGSSMLFGTIVGSLADKQGRKRAC+TYCI+YILSCITKH
Sbjct  61   YYLYSQYGFDKGDIGRLFIAGFGSSMLFGTIVGSLADKQGRKRACITYCISYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SP+YK+LM+GR+LGGIATSLLFS+FESWLVA
Sbjct  121  SPEYKILMIGRVLGGIATSLLFSAFESWLVA  151



>dbj|BAJ89044.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=454

 Score =   224 bits (570),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 125/151 (83%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            MEVFYYLVFG LAAVVAA+EL K+ KDR++T   FN+FKNNY++VYSLMM+GDWLQGPYV
Sbjct  1    MEVFYYLVFGGLAAVVAALELGKSGKDRVATPTAFNSFKNNYVLVYSLMMSGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+ YG+ KG+IG+LFIAGFGSSMLFGTIVGSLADKQGRKRAC+TYCITYILSCITKH
Sbjct  61   YYLYSQYGFDKGDIGRLFIAGFGSSMLFGTIVGSLADKQGRKRACITYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQY++LM+GR+LGGIATSLLFS+FESWLVA
Sbjct  121  SPQYRILMIGRVLGGIATSLLFSAFESWLVA  151



>gb|EAY88269.1| hypothetical protein OsI_09722 [Oryza sativa Indica Group]
Length=457

 Score =   224 bits (570),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 124/151 (82%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            MEVFYYLVFG LAAVVA +EL K++KDR++TS  FN+FKNNY++VYSLMM+GDWLQGPYV
Sbjct  1    MEVFYYLVFGGLAAVVAGLELGKSAKDRVTTSQAFNSFKNNYVLVYSLMMSGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+ YG+ KG+IG+LFIAGFGSSMLFGTIVGSLADKQGRKRAC+TYCI+YILSCITKH
Sbjct  61   YYLYSQYGFDKGDIGRLFIAGFGSSMLFGTIVGSLADKQGRKRACITYCISYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SP+YK+LM+GR+LGGIATSLLFS+FESWLVA
Sbjct  121  SPEYKILMIGRVLGGIATSLLFSAFESWLVA  151



>ref|XP_003558980.1| PREDICTED: molybdate-anion transporter-like [Brachypodium distachyon]
Length=457

 Score =   224 bits (570),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 125/151 (83%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            MEVFYY+VFGALAAVVA +EL K+ KDR++T+  FNAFKNNY++VYSLMM+GDWLQGPYV
Sbjct  1    MEVFYYVVFGALAAVVAGLELGKSGKDRVATTTAFNAFKNNYVLVYSLMMSGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+ YG+ KG+IG+LFIAGFGSSMLFGTIVGSLADKQGRKRAC+TYCITYILSCITKH
Sbjct  61   YYLYSQYGFDKGDIGRLFIAGFGSSMLFGTIVGSLADKQGRKRACITYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SP+Y+VLM+GR+LGGIATSLLFS+FESWLVA
Sbjct  121  SPEYRVLMVGRVLGGIATSLLFSAFESWLVA  151



>dbj|BAJ88961.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=455

 Score =   224 bits (570),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 125/151 (83%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            MEVFYYLVFG LAAVVAA+EL K+ KDR++T   FN+FKNNY++VYSLMM+GDWLQGPYV
Sbjct  1    MEVFYYLVFGGLAAVVAALELGKSGKDRVATPTAFNSFKNNYVLVYSLMMSGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+ YG+ KG+IG+LFIAGFGSSMLFGTIVGSLADKQGRKRAC+TYCITYILSCITKH
Sbjct  61   YYLYSQYGFDKGDIGRLFIAGFGSSMLFGTIVGSLADKQGRKRACITYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQY++LM+GR+LGGIATSLLFS+FESWLVA
Sbjct  121  SPQYRILMIGRVLGGIATSLLFSAFESWLVA  151



>gb|EMS52358.1| hypothetical protein TRIUR3_20211 [Triticum urartu]
Length=449

 Score =   223 bits (568),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 123/151 (81%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME+FYYLVFG L+AVVA +EL K+ KDR++T   FNAFKNNY++VYSLMM+GDWLQGPYV
Sbjct  1    MEIFYYLVFGGLSAVVAGLELGKSGKDRVATPTAFNAFKNNYVLVYSLMMSGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+ YG+ KG+IG+LFIAGFGSSMLFGTIVGSLAD+QGRKRAC+TYCITYILSCITKH
Sbjct  61   YYLYSQYGFDKGDIGRLFIAGFGSSMLFGTIVGSLADRQGRKRACITYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQY+VL+LGRILGG+ATSLLFS+FESWLVA
Sbjct  121  SPQYRVLLLGRILGGVATSLLFSAFESWLVA  151



>gb|ACN31979.1| unknown [Zea mays]
 gb|AFW89812.1| hypothetical protein ZEAMMB73_054877 [Zea mays]
Length=418

 Score =   222 bits (566),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 125/151 (83%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            MEVFYY+VFGALAAVVA +EL K+ KDR++T+  FN+FKNNY++VYSLMM+GDWLQGPYV
Sbjct  1    MEVFYYVVFGALAAVVAGLELGKSGKDRVATTSAFNSFKNNYVLVYSLMMSGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+ YG+ KG+IG+LFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCI+YILSCITKH
Sbjct  61   YYLYSQYGFDKGDIGRLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCISYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SP+Y+VLM+GRILGGIATSLLFS+FESWLVA
Sbjct  121  SPEYRVLMIGRILGGIATSLLFSAFESWLVA  151



>ref|XP_009415826.1| PREDICTED: molybdate-anion transporter-like [Musa acuminata subsp. 
malaccensis]
Length=462

 Score =   223 bits (569),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 131/151 (87%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME FY+L+FG LAAVVAA+E+SKT++DR +TS  FN+FKNNYL+VYSLMMAGDWLQGPYV
Sbjct  1    MEAFYWLLFGGLAAVVAALEMSKTNRDRAATSSAFNSFKNNYLLVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+ YGYGKG+IG+LFIAGFGSSMLFGTIVGSLADKQGRKRA VTYCITYILSCITKH
Sbjct  61   YYLYSQYGYGKGDIGRLFIAGFGSSMLFGTIVGSLADKQGRKRASVTYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQYKVLMLGRILGGIATSLLFS+FESWLVA
Sbjct  121  SPQYKVLMLGRILGGIATSLLFSAFESWLVA  151



>ref|XP_006649263.1| PREDICTED: molybdate-anion transporter-like [Oryza brachyantha]
Length=457

 Score =   223 bits (568),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 122/151 (81%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            MEVFYYLVFG LAAVVA +EL K +KDR++TS  FN+FKNNY++VYSLMM+GDWLQG  V
Sbjct  1    MEVFYYLVFGGLAAVVAGLELGKGAKDRVTTSQAFNSFKNNYVLVYSLMMSGDWLQGADV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+ YG+ KG+IG+LFIAGFGSSMLFGTIVGSLADKQGRKRAC+TYCI+YILSCITKH
Sbjct  61   YYLYSQYGFDKGDIGRLFIAGFGSSMLFGTIVGSLADKQGRKRACITYCISYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SP+YK+LM+GR+LGGIATSLLFS+FESWLVA
Sbjct  121  SPEYKILMIGRVLGGIATSLLFSAFESWLVA  151



>ref|XP_003574207.1| PREDICTED: molybdate-anion transporter-like [Brachypodium distachyon]
Length=455

 Score =   223 bits (567),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 124/151 (82%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME+FYYLVFG L+AVVAA+EL K+ KDR++T   FN+FKNNY++VYSLMM+GDWLQGPYV
Sbjct  1    MELFYYLVFGGLSAVVAALELGKSGKDRVATPTAFNSFKNNYVLVYSLMMSGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+ YG+ KG+IG+LFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH
Sbjct  61   YYLYSQYGFDKGDIGRLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQY++LM+GR+LGGIATSLLFS+FESWLVA
Sbjct  121  SPQYRILMVGRVLGGIATSLLFSAFESWLVA  151



>gb|ACG34533.1| major Facilitator superfamily protein [Zea mays]
 gb|AFW89814.1| major Facilitator family protein [Zea mays]
Length=458

 Score =   223 bits (567),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 125/151 (83%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            MEVFYY+VFGALAAVVA +EL K+ KDR++T+  FN+FKNNY++VYSLMM+GDWLQGPYV
Sbjct  1    MEVFYYVVFGALAAVVAGLELGKSGKDRVATTSAFNSFKNNYVLVYSLMMSGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+ YG+ KG+IG+LFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCI+YILSCITKH
Sbjct  61   YYLYSQYGFDKGDIGRLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCISYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SP+Y+VLM+GRILGGIATSLLFS+FESWLVA
Sbjct  121  SPEYRVLMIGRILGGIATSLLFSAFESWLVA  151



>gb|AFW89813.1| hypothetical protein ZEAMMB73_054877 [Zea mays]
Length=457

 Score =   223 bits (567),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 125/151 (83%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            MEVFYY+VFGALAAVVA +EL K+ KDR++T+  FN+FKNNY++VYSLMM+GDWLQGPYV
Sbjct  1    MEVFYYVVFGALAAVVAGLELGKSGKDRVATTSAFNSFKNNYVLVYSLMMSGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+ YG+ KG+IG+LFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCI+YILSCITKH
Sbjct  61   YYLYSQYGFDKGDIGRLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCISYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SP+Y+VLM+GRILGGIATSLLFS+FESWLVA
Sbjct  121  SPEYRVLMIGRILGGIATSLLFSAFESWLVA  151



>ref|NP_001149961.1| LOC100283588 precursor [Zea mays]
 gb|ACG37353.1| major Facilitator superfamily protein [Zea mays]
Length=458

 Score =   223 bits (567),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 125/151 (83%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            MEVFYY+VFGALAAVVA +EL K+ KDR++T+  FN+FKNNY++VYSLMM+GDWLQGPYV
Sbjct  1    MEVFYYVVFGALAAVVAGLELGKSGKDRVATTSAFNSFKNNYVLVYSLMMSGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+ YG+ KG+IG+LFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCI+YILSCITKH
Sbjct  61   YYLYSQYGFDKGDIGRLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCISYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SP+Y+VLM+GRILGGIATSLLFS+FESWLVA
Sbjct  121  SPEYRVLMIGRILGGIATSLLFSAFESWLVA  151



>ref|XP_008650038.1| PREDICTED: molybdate-anion transporter [Zea mays]
 tpg|DAA42909.1| TPA: hypothetical protein ZEAMMB73_907505 [Zea mays]
Length=457

 Score =   222 bits (565),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 123/151 (81%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            MEVFYY+VFGALAA+VA +EL K+ KDR++T+  FN+FKNNY++VYSLMM+GDWLQGPYV
Sbjct  1    MEVFYYVVFGALAAIVAGLELGKSGKDRVATTSAFNSFKNNYVLVYSLMMSGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+ YG+ KG+IG+LFIAGFGSSMLFGTIVGSLADKQGRKRAC+TYCI+YILSCITKH
Sbjct  61   YYLYSQYGFDKGDIGRLFIAGFGSSMLFGTIVGSLADKQGRKRACITYCISYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SP+Y+VLM+GRILGGIATSLLFS+FESWLVA
Sbjct  121  SPEYRVLMIGRILGGIATSLLFSAFESWLVA  151



>ref|XP_004986003.1| PREDICTED: major facilitator superfamily domain-containing protein 
5-like isoform X2 [Setaria italica]
Length=457

 Score =   222 bits (565),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 124/151 (82%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            MEVFYY+VFGALAAVVA +EL K+ KDR++T+  FN+FKNNY++VYSLMM+GDWLQGPYV
Sbjct  1    MEVFYYVVFGALAAVVAGLELGKSGKDRVATTSAFNSFKNNYVLVYSLMMSGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY  YG+ KG+IG+LFIAGFGSSMLFGTIVGSLADKQGRKRAC+TYCI+YILSCITKH
Sbjct  61   YYLYRQYGFDKGDIGRLFIAGFGSSMLFGTIVGSLADKQGRKRACITYCISYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SP+YK+LM+GRILGGIATSLLFS+FESWLVA
Sbjct  121  SPEYKILMIGRILGGIATSLLFSAFESWLVA  151



>ref|XP_009796128.1| PREDICTED: molybdate-anion transporter-like [Nicotiana sylvestris]
Length=462

 Score =   221 bits (564),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 132/152 (87%), Positives = 148/152 (97%), Gaps = 1/152 (1%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELS-KTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpy  240
            ME+FYY+VFGALAAVVAA+EL  K++KDRI+TS  FN+FKNNY++VYSLMMAGDWLQGPY
Sbjct  1    MELFYYVVFGALAAVVAALELGGKSNKDRITTSQAFNSFKNNYILVYSLMMAGDWLQGPY  60

Query  241  vyylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITK  420
            VYYLY+TYG+GKG+IGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITK
Sbjct  61   VYYLYSTYGFGKGDIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITK  120

Query  421  HSPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            HSPQYK+LM+GR+LGGIATSLLFS+FESWLVA
Sbjct  121  HSPQYKILMIGRVLGGIATSLLFSAFESWLVA  152



>ref|XP_004986002.1| PREDICTED: major facilitator superfamily domain-containing protein 
5-like isoform X1 [Setaria italica]
Length=467

 Score =   221 bits (564),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 124/151 (82%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            MEVFYY+VFGALAAVVA +EL K+ KDR++T+  FN+FKNNY++VYSLMM+GDWLQGPYV
Sbjct  1    MEVFYYVVFGALAAVVAGLELGKSGKDRVATTSAFNSFKNNYVLVYSLMMSGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY  YG+ KG+IG+LFIAGFGSSMLFGTIVGSLADKQGRKRAC+TYCI+YILSCITKH
Sbjct  61   YYLYRQYGFDKGDIGRLFIAGFGSSMLFGTIVGSLADKQGRKRACITYCISYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SP+YK+LM+GRILGGIATSLLFS+FESWLVA
Sbjct  121  SPEYKILMIGRILGGIATSLLFSAFESWLVA  151



>ref|XP_006404159.1| hypothetical protein EUTSA_v10010332mg [Eutrema salsugineum]
 gb|ESQ45612.1| hypothetical protein EUTSA_v10010332mg [Eutrema salsugineum]
Length=476

 Score =   222 bits (565),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 133/167 (80%), Positives = 149/167 (89%), Gaps = 16/167 (10%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMM----------  213
            MEVFYYLVFGA+AAVVAA+ELSKT+KDRI+TS +FN+FKNNYL+V+S+MM          
Sbjct  1    MEVFYYLVFGAMAAVVAALELSKTNKDRINTSSSFNSFKNNYLVVFSIMMGKEDNTVITN  60

Query  214  ------AGDWLQgpyvyylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRA  375
                  AGDWLQGPYVYYLY+TYG+GKG+IGQLFIAGFGSSMLFGTIVGSLADKQGRKRA
Sbjct  61   NEAIIDAGDWLQGPYVYYLYSTYGFGKGDIGQLFIAGFGSSMLFGTIVGSLADKQGRKRA  120

Query  376  CVTYCITYILSCITKHSPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            CVTYCI YILSCITKHSPQY+VLM+GRILGGIATSLLFS+FESWL+A
Sbjct  121  CVTYCIVYILSCITKHSPQYRVLMVGRILGGIATSLLFSAFESWLIA  167



>ref|XP_011022428.1| PREDICTED: molybdate-anion transporter-like [Populus euphratica]
Length=462

 Score =   221 bits (563),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME+FY++VFG LAAVVAA+ELSKTS+DRISTS  F++FKNNYL+VYSLMMAGDWLQGPYV
Sbjct  1    MEIFYWMVFGGLAAVVAALELSKTSRDRISTSSAFSSFKNNYLVVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+ YG+GKG+IG LFIAGFGSSMLFGTIVGSLADKQGRKRA +TYCITYILSC TKH
Sbjct  61   YYLYSQYGFGKGDIGHLFIAGFGSSMLFGTIVGSLADKQGRKRASITYCITYILSCATKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SP+YK+LM+GR+LGGIATSLLFS+FESWLVA
Sbjct  121  SPEYKILMVGRVLGGIATSLLFSAFESWLVA  151



>ref|XP_009629563.1| PREDICTED: molybdate-anion transporter-like [Nicotiana tomentosiformis]
Length=462

 Score =   221 bits (562),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 132/152 (87%), Positives = 147/152 (97%), Gaps = 1/152 (1%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELS-KTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpy  240
            ME FYY+VFGALAAVVAA+EL  K++KDRI+TS  FN+FKNNY++VYSLMMAGDWLQGPY
Sbjct  1    MEFFYYVVFGALAAVVAALELGGKSNKDRITTSQAFNSFKNNYILVYSLMMAGDWLQGPY  60

Query  241  vyylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITK  420
            VYYLY+TYG+GKG+IGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITK
Sbjct  61   VYYLYSTYGFGKGDIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITK  120

Query  421  HSPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            HSPQYK+LM+GR+LGGIATSLLFS+FESWLVA
Sbjct  121  HSPQYKILMIGRVLGGIATSLLFSAFESWLVA  152



>ref|XP_004309548.1| PREDICTED: molybdate-anion transporter-like [Fragaria vesca subsp. 
vesca]
 ref|XP_011470905.1| PREDICTED: molybdate-anion transporter-like [Fragaria vesca subsp. 
vesca]
Length=464

 Score =   221 bits (562),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 130/151 (86%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME+FY+L+FGAL+AVVAA+ELSK +KDRI TS TF  FKNNYL+VYSLMMAGDWLQGPYV
Sbjct  1    MELFYFLLFGALSAVVAALELSKRNKDRIITSSTFTLFKNNYLLVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+TYG+ KG+IGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSC TKH
Sbjct  61   YYLYSTYGFTKGDIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCFTKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
             P YKVLMLGR+LGGIATSLLFS+FESWLVA
Sbjct  121  FPDYKVLMLGRVLGGIATSLLFSAFESWLVA  151



>ref|XP_008806966.1| PREDICTED: molybdate-anion transporter-like isoform X2 [Phoenix 
dactylifera]
Length=462

 Score =   221 bits (562),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 123/151 (81%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME+FYYL FG L+ VVA +ELSKT+KDR++ S  FN+FKNNYL+VYSL MAGDWLQGPYV
Sbjct  1    MELFYYLAFGGLSVVVATVELSKTNKDRVAISSAFNSFKNNYLVVYSLAMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+ YG+ KG+IG+LFIAGFGSSMLFGTIVGSLADKQGRKRAC+TYC  YILSCITKH
Sbjct  61   YYLYSQYGFDKGDIGRLFIAGFGSSMLFGTIVGSLADKQGRKRACMTYCRAYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SP+YKVLMLGR+LGGIATSLLFS+FESWLVA
Sbjct  121  SPEYKVLMLGRVLGGIATSLLFSAFESWLVA  151



>ref|XP_002304575.2| hypothetical protein POPTR_0003s14550g [Populus trichocarpa]
 gb|EEE79554.2| hypothetical protein POPTR_0003s14550g [Populus trichocarpa]
Length=462

 Score =   220 bits (561),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 126/151 (83%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME+FY++VFG LAAVVA +ELSKTS+DRI+TS  F++FKNNYLIVYSLMMAGDWLQGPYV
Sbjct  1    MEIFYWMVFGGLAAVVATLELSKTSRDRINTSSAFSSFKNNYLIVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+ YG+GKG+IG LFIAGFGSSMLFGTIVGSLADKQGRKRA +TYCITYILSC TKH
Sbjct  61   YYLYSQYGFGKGDIGHLFIAGFGSSMLFGTIVGSLADKQGRKRASITYCITYILSCATKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SP+YK+LM+GR+LGGIATSLLFS+FESWLVA
Sbjct  121  SPEYKILMVGRVLGGIATSLLFSAFESWLVA  151



>ref|XP_010919323.1| PREDICTED: molybdate-anion transporter-like [Elaeis guineensis]
Length=462

 Score =   220 bits (561),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 125/151 (83%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME+FY L FG L+ VVAA+ELSKT+KDR++ S  FN+FKNNYL+VYSL MAGDWLQGPYV
Sbjct  1    MELFYCLAFGGLSMVVAALELSKTNKDRVAISSAFNSFKNNYLVVYSLAMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+ YG+ KG+IG+LFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCI YILSCITKH
Sbjct  61   YYLYSQYGFDKGDIGRLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCIAYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SP+YKVLMLGR+LGGIATSLLFS+FESWLVA
Sbjct  121  SPEYKVLMLGRVLGGIATSLLFSAFESWLVA  151



>ref|XP_008239240.1| PREDICTED: molybdate-anion transporter-like [Prunus mume]
Length=461

 Score =   220 bits (561),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 126/151 (83%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME FY+L+FGAL+AVVAA+ELSK +KDRI TS  FN FKNNYL++YSLMMAGDWLQGPYV
Sbjct  1    MEFFYFLLFGALSAVVAALELSKNNKDRIHTSSVFNDFKNNYLLIYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+ YG+ KG+IGQLFIAGFGSSMLFGT+VGSLADKQGRKRAC+TYCITYILSC TKH
Sbjct  61   YYLYSQYGFSKGDIGQLFIAGFGSSMLFGTVVGSLADKQGRKRACITYCITYILSCFTKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
             P YKVL+LGRILGGIATSLLFS+FESWLVA
Sbjct  121  FPDYKVLLLGRILGGIATSLLFSAFESWLVA  151



>ref|XP_008374105.1| PREDICTED: molybdate-anion transporter-like [Malus domestica]
Length=461

 Score =   220 bits (561),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 126/151 (83%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME+FY L+FG +AAVVAA+ELSK +KDRI T+  FNAFKNNYL++YSLMMAGDWLQGPYV
Sbjct  1    MELFYILLFGGMAAVVAALELSKNNKDRIHTTSAFNAFKNNYLLIYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+ YG+ KG+IGQLFIAGFGSSMLFGTIVGSLADKQGRKRAC+TYCITYILSC TKH
Sbjct  61   YYLYSQYGFSKGDIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACITYCITYILSCFTKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
             P YKVL+LGRILGGIATSLLFS+FESWLVA
Sbjct  121  FPDYKVLLLGRILGGIATSLLFSAFESWLVA  151



>ref|XP_007211182.1| hypothetical protein PRUPE_ppa005436mg [Prunus persica]
 gb|EMJ12381.1| hypothetical protein PRUPE_ppa005436mg [Prunus persica]
Length=461

 Score =   220 bits (561),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 126/151 (83%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME FY+L+FGAL+AVVAA+ELSK +KDRI TS  FN FKNNYL++YSLMMAGDWLQGPYV
Sbjct  1    MEFFYFLLFGALSAVVAALELSKNNKDRIHTSSVFNDFKNNYLLIYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+ YG+ KG+IGQLFIAGFGSSMLFGT+VGSLADKQGRKRAC+TYCITYILSC TKH
Sbjct  61   YYLYSQYGFSKGDIGQLFIAGFGSSMLFGTVVGSLADKQGRKRACITYCITYILSCFTKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
             P YKVL+LGRILGGIATSLLFS+FESWLVA
Sbjct  121  FPDYKVLLLGRILGGIATSLLFSAFESWLVA  151



>ref|XP_009358691.1| PREDICTED: molybdate-anion transporter-like [Pyrus x bretschneideri]
Length=461

 Score =   220 bits (560),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 125/151 (83%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME+FY L+FG +AAVVAA+ELSK +KDRI T+  FNAFKNNYL++YSLMMAGDWLQGPYV
Sbjct  1    MELFYILLFGGMAAVVAALELSKNNKDRIHTTSAFNAFKNNYLLIYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+ YG+ KG+IGQLFIAGFGSSMLFGT+VGSLADKQGRKRAC+TYCITYILSC TKH
Sbjct  61   YYLYSQYGFSKGDIGQLFIAGFGSSMLFGTVVGSLADKQGRKRACITYCITYILSCFTKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
             P YKVL+LGRILGGIATSLLFS+FESWLVA
Sbjct  121  FPDYKVLLLGRILGGIATSLLFSAFESWLVA  151



>ref|XP_008806965.1| PREDICTED: molybdate-anion transporter-like isoform X1 [Phoenix 
dactylifera]
Length=489

 Score =   220 bits (561),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 123/151 (81%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME+FYYL FG L+ VVA +ELSKT+KDR++ S  FN+FKNNYL+VYSL MAGDWLQGPYV
Sbjct  1    MELFYYLAFGGLSVVVATVELSKTNKDRVAISSAFNSFKNNYLVVYSLAMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+ YG+ KG+IG+LFIAGFGSSMLFGTIVGSLADKQGRKRAC+TYC  YILSCITKH
Sbjct  61   YYLYSQYGFDKGDIGRLFIAGFGSSMLFGTIVGSLADKQGRKRACMTYCRAYILSCITKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SP+YKVLMLGR+LGGIATSLLFS+FESWLVA
Sbjct  121  SPEYKVLMLGRVLGGIATSLLFSAFESWLVA  151



>ref|XP_006439246.1| hypothetical protein CICLE_v10020066mg [Citrus clementina]
 gb|ESR52486.1| hypothetical protein CICLE_v10020066mg [Citrus clementina]
Length=461

 Score =   219 bits (559),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME FY++VF  LAA+V A+ELSK+SKDRI TS +FN+F NNY+IVYSLMMAGDWLQGPYV
Sbjct  1    MESFYFVVFACLAALVVAMELSKSSKDRIGTSSSFNSFMNNYIIVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+TYG+GKGEIGQLFIAGFGSSMLFGT+VGSLADKQGRKRACVTYCITY+LSC+TKH
Sbjct  61   YYLYSTYGFGKGEIGQLFIAGFGSSMLFGTLVGSLADKQGRKRACVTYCITYMLSCVTKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            S +YK+LMLGRILGGIATSLLFS+FESWLVA
Sbjct  121  SSEYKILMLGRILGGIATSLLFSAFESWLVA  151



>ref|XP_004134591.1| PREDICTED: major facilitator superfamily domain-containing protein 
5-like [Cucumis sativus]
 ref|XP_004158651.1| PREDICTED: major facilitator superfamily domain-containing protein 
5-like [Cucumis sativus]
 gb|KGN49448.1| hypothetical protein Csa_6G525350 [Cucumis sativus]
Length=460

 Score =   218 bits (555),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 123/151 (81%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME+F+Y +FGA+ ++V AIELSK ++DRI+ +  FN+FKNNYL+VYSLMMAGDWLQGPYV
Sbjct  1    MELFFYFIFGAMGSIVVAIELSKNNRDRINATTAFNSFKNNYLLVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+ YGYGKGEIGQLFIAGFGSSMLFGTIVGSLADKQGR+RACV YCITYILSC TKH
Sbjct  61   YYLYSQYGYGKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRRRACVIYCITYILSCFTKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            S +YK+LMLGRILGGIATSLLFS+FESWLVA
Sbjct  121  SSEYKILMLGRILGGIATSLLFSAFESWLVA  151



>emb|CDX86981.1| BnaC03g52510D [Brassica napus]
Length=475

 Score =   218 bits (554),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 124/145 (86%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = +1

Query  82   LVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyvyylytt  261
            +VFG +AAVVA +ELSKT+KDRI+TS +FN+FKNNYL+V+S+MMAGDWLQGPYVYYLY+T
Sbjct  1    MVFGVMAAVVAGLELSKTNKDRINTSSSFNSFKNNYLVVFSIMMAGDWLQGPYVYYLYST  60

Query  262  ygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKHSPQYKV  441
            YG+GKG+IGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCI YILSCITKHSPQY+V
Sbjct  61   YGFGKGDIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCIVYILSCITKHSPQYRV  120

Query  442  LMLGRILGGIATSLLFSSFESWLVA  516
            LM+GRILGGIATSLLFS+FESWL+A
Sbjct  121  LMVGRILGGIATSLLFSAFESWLIA  145



>ref|XP_009393576.1| PREDICTED: molybdate-anion transporter [Musa acuminata subsp. 
malaccensis]
Length=463

 Score =   216 bits (550),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME FY+L+F  LA VVAA+ELSKT++DR STS  FN+FKNNY++VYSLMMAGDWLQGPYV
Sbjct  1    MEAFYWLLFCWLAVVVAAMELSKTNRDRASTSSAFNSFKNNYILVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+ YGYGKG+IG+LFIAGFGSSMLFGTIVGSLADKQGRKRA VTYCITYILSC+TKH
Sbjct  61   YYLYSQYGYGKGDIGRLFIAGFGSSMLFGTIVGSLADKQGRKRASVTYCITYILSCMTKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQ+KVLMLGR+LGGIATSLLFS+FESWLVA
Sbjct  121  SPQFKVLMLGRVLGGIATSLLFSAFESWLVA  151



>emb|CDY08126.1| BnaA06g16000D [Brassica napus]
Length=468

 Score =   216 bits (550),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 125/151 (83%), Positives = 143/151 (95%), Gaps = 1/151 (1%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            MEVFYYLVFG +AAVVAA+E+SK SKD+ +TS +FN+FKNNY++V+S+MMAGDWLQGPYV
Sbjct  1    MEVFYYLVFGVMAAVVAALEMSKRSKDQ-NTSSSFNSFKNNYILVFSIMMAGDWLQGPYV  59

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+TYG+GK +IGQLFIAGFGSSMLFGTIVGSLADK GRKRACVTYCI YILSCITKH
Sbjct  60   YYLYSTYGFGKRDIGQLFIAGFGSSMLFGTIVGSLADKHGRKRACVTYCIVYILSCITKH  119

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQY+VLM+GRILGGIATSLL S+FESWL+A
Sbjct  120  SPQYRVLMVGRILGGIATSLLNSAFESWLIA  150



>ref|XP_009389334.1| PREDICTED: molybdate-anion transporter-like [Musa acuminata subsp. 
malaccensis]
Length=461

 Score =   214 bits (546),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 123/151 (81%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            MEVFYYLVFG LAA VAA+EL KT KDR++ S  F+ FKNNYL VYSLMMAGDWLQGPYV
Sbjct  1    MEVFYYLVFGGLAAAVAAMELRKTRKDRVAISSAFDTFKNNYLFVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+ YG  KGEIG+LFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYI+SC+TKH
Sbjct  61   YYLYSQYGLNKGEIGRLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYIVSCLTKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
             P+Y  L++GRILGGI+TSLLFS+FESWLVA
Sbjct  121  CPEYTSLLIGRILGGISTSLLFSAFESWLVA  151



>ref|XP_009149745.1| PREDICTED: molybdate-anion transporter [Brassica rapa]
Length=459

 Score =   214 bits (546),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 123/151 (81%), Positives = 142/151 (94%), Gaps = 1/151 (1%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            MEVFYYLVFG +AAVV A+E+SK +KD+ +TS +FN+FKNNY++V+S+MMAGDWLQGPYV
Sbjct  1    MEVFYYLVFGVMAAVVVALEMSKRNKDQ-NTSSSFNSFKNNYILVFSIMMAGDWLQGPYV  59

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+TYG+GK +IGQLFIAGFGSSMLFGTIVGSLADK GRKRACVTYCI YILSCITKH
Sbjct  60   YYLYSTYGFGKRDIGQLFIAGFGSSMLFGTIVGSLADKHGRKRACVTYCIVYILSCITKH  119

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQY+VLM+GRILGGIATSLL S+FESWL+A
Sbjct  120  SPQYRVLMVGRILGGIATSLLNSAFESWLIA  150



>ref|XP_001753342.1| predicted protein [Physcomitrella patens]
 gb|EDQ81971.1| predicted protein [Physcomitrella patens]
Length=459

 Score =   213 bits (541),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 131/151 (87%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME ++Y VFG    ++ A+E  K+SKDRI+TSP FNAFKNNYL+VYSLMMAGDWLQGPYV
Sbjct  1    MEFYFYAVFGIQVILLVALEFGKSSKDRITTSPAFNAFKNNYLVVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            Y LY  YGY KG+IG+LFIAGFGSSM+FGT+VGSLAD+ GRKR  V YCITYILSC TKH
Sbjct  61   YALYVFYGYNKGDIGKLFIAGFGSSMIFGTVVGSLADRYGRKRMSVIYCITYILSCFTKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SP Y+VLMLGR+LGGIATSLLFSSFESWLVA
Sbjct  121  SPAYRVLMLGRVLGGIATSLLFSSFESWLVA  151



>ref|XP_010507346.1| PREDICTED: molybdate-anion transporter-like [Camelina sativa]
Length=526

 Score =   211 bits (538),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 129/192 (67%), Positives = 146/192 (76%), Gaps = 41/192 (21%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDW------  225
            MEVFYYLVFG + AVVA +ELSKT+KDRI+TS +FN+FKNNYL+V+S+MMAGDW      
Sbjct  1    MEVFYYLVFGTMTAVVAVLELSKTNKDRINTSSSFNSFKNNYLLVFSIMMAGDWLQGPYV  60

Query  226  -----------------------------------LQgpyvyylyttygygkgEIGQLFI  300
                                               LQGPYVYYLY+TYG+GKG+IGQLFI
Sbjct  61   YYLYSTYGFGKGDIGQLFIAVCGYIYDYVVVAGDWLQGPYVYYLYSTYGFGKGDIGQLFI  120

Query  301  AGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKHSPQYKVLMLGRILGGIATS  480
            AGFGSSMLFGTIVGSLADKQGRKRACVTYCI YILSC+TKHSPQY+VLM+GRILGGIATS
Sbjct  121  AGFGSSMLFGTIVGSLADKQGRKRACVTYCIVYILSCVTKHSPQYRVLMVGRILGGIATS  180

Query  481  LLFSSFESWLVA  516
            LLFS+FESWL+A
Sbjct  181  LLFSAFESWLIA  192



>ref|XP_001760679.1| predicted protein [Physcomitrella patens]
 gb|EDQ74418.1| predicted protein [Physcomitrella patens]
Length=461

 Score =   209 bits (533),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 131/151 (87%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME ++Y VF   A V+ A+E  K+ KD+I+TSP FNAFKNNYL+VYSLMMAGDWLQGPYV
Sbjct  1    MEFYFYAVFAVQAMVLVALEFGKSGKDQITTSPAFNAFKNNYLVVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            Y LY  YGY KG+IG+LFIAGFGSSMLFGTIVGSLAD+ GRKR  V YCITY+LSC TKH
Sbjct  61   YALYVFYGYDKGDIGKLFIAGFGSSMLFGTIVGSLADRYGRKRMSVIYCITYMLSCFTKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQY+VLMLGR+LGGIATSLLFSSFESWLVA
Sbjct  121  SPQYRVLMLGRVLGGIATSLLFSSFESWLVA  151



>ref|XP_010090586.1| Translocase of chloroplast 132 [Morus notabilis]
 gb|EXB39945.1| Translocase of chloroplast 132 [Morus notabilis]
Length=750

 Score =   214 bits (544),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 132/178 (74%), Positives = 145/178 (81%), Gaps = 27/178 (15%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMA---------  216
            ME+FY+L+FGALA VVAA+ELSKT KDRISTSP FNAFKNNY++VYS+MMA         
Sbjct  1    MEIFYFLLFGALALVVAALELSKTGKDRISTSPAFNAFKNNYILVYSIMMAMEDEFCFVC  60

Query  217  ------------------GDWLQgpyvyylyttygygkgEIGQLFIAGFGSSMLFGTIVG  342
                              GDWLQGPYVYYLY+ YG+GKGEIGQLFIAGFGSSM+FGTIVG
Sbjct  61   FGSILDFGNIAVLIAAIAGDWLQGPYVYYLYSQYGFGKGEIGQLFIAGFGSSMVFGTIVG  120

Query  343  SLADKQGRKRACVTYCITYILSCITKHSPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SLADKQGRKRACVTYCITYILSCITKHS +YKVLMLGR+LGGIATSLL S+FESWLVA
Sbjct  121  SLADKQGRKRACVTYCITYILSCITKHSSEYKVLMLGRVLGGIATSLLCSAFESWLVA  178



>ref|XP_001755472.1| predicted protein [Physcomitrella patens]
 gb|EDQ79532.1| predicted protein [Physcomitrella patens]
Length=459

 Score =   208 bits (530),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 129/151 (85%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME ++Y VFG     + A+E  K+ KDRI+TS  FNAFKNNYL+VYSLMMAGDWLQGPYV
Sbjct  1    MEFYFYAVFGIQVIALVALEFGKSGKDRITTSSAFNAFKNNYLVVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            Y LY  YGY KG+IG+LFIAGFGSSMLFGTIVGSLAD+ GRKR  V YCITY+LSC TKH
Sbjct  61   YALYVFYGYNKGDIGKLFIAGFGSSMLFGTIVGSLADRYGRKRMSVIYCITYMLSCFTKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SP+Y+VLMLGR+LGGIATSLLFSSFESWLVA
Sbjct  121  SPEYRVLMLGRVLGGIATSLLFSSFESWLVA  151



>ref|XP_002977775.1| hypothetical protein SELMODRAFT_176583 [Selaginella moellendorffii]
 ref|XP_002986895.1| hypothetical protein SELMODRAFT_182749 [Selaginella moellendorffii]
 gb|EFJ11977.1| hypothetical protein SELMODRAFT_182749 [Selaginella moellendorffii]
 gb|EFJ21113.1| hypothetical protein SELMODRAFT_176583 [Selaginella moellendorffii]
Length=462

 Score =   207 bits (527),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 131/151 (87%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME FY +VF      VAA+E  + SKDRI  +  FNAFKNNYL+VYSLMMAGDWLQGPYV
Sbjct  1    METFYLVVFAVQLLAVAALEFRRGSKDRIVATSAFNAFKNNYLVVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            Y+LY+ YG+ KG+IG+LFIAGFGSSMLFGTIVGSLADK GRKRA +TYCITYILSC TKH
Sbjct  61   YFLYSHYGFQKGDIGRLFIAGFGSSMLFGTIVGSLADKYGRKRASITYCITYILSCFTKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQ++VLM+GRILGGIATSLLFS+FESWLVA
Sbjct  121  SPQFQVLMVGRILGGIATSLLFSAFESWLVA  151



>gb|EMT22205.1| hypothetical protein F775_28807 [Aegilops tauschii]
Length=454

 Score =   206 bits (523),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 137/151 (91%), Gaps = 3/151 (2%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME+FYY+VFG LAAVVA +EL K+ KDR++T   FNAFKNNY++  +   AGDWLQGPYV
Sbjct  1    MEIFYYVVFGGLAAVVAGLELGKSGKDRVATPTAFNAFKNNYVLGVA---AGDWLQGPYV  57

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+ YG+ KG+IG+LFIAGFGSSMLFGTIVGSLAD+QGRKRAC+TYCITYILSCITKH
Sbjct  58   YYLYSQYGFDKGDIGRLFIAGFGSSMLFGTIVGSLADRQGRKRACITYCITYILSCITKH  117

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SPQY+VL+LGRILGG+ATSLLFS+FESWLVA
Sbjct  118  SPQYRVLLLGRILGGVATSLLFSAFESWLVA  148



>ref|XP_006368797.1| hypothetical protein POPTR_0001s11250g [Populus trichocarpa]
 gb|ERP65366.1| hypothetical protein POPTR_0001s11250g [Populus trichocarpa]
Length=377

 Score =   201 bits (510),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 135/151 (89%), Gaps = 5/151 (3%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME+FY++VFG LAA+VAA+E SKTS+DRI+TS TF++FKNNYL+VYSLMMAGDWLQGPYV
Sbjct  1    MEIFYFMVFGGLAAMVAALEFSKTSRDRINTSSTFSSFKNNYLVVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YY Y+ YG+ KGEIGQLFIAGFG SMLFGTIVGS     GRKRAC+TYCITYILSC TKH
Sbjct  61   YYPYSQYGFRKGEIGQLFIAGFGFSMLFGTIVGS-----GRKRACITYCITYILSCATKH  115

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SP YK+L++GR+LGGI TSLLFS+FESWL A
Sbjct  116  SPDYKILVVGRVLGGIVTSLLFSAFESWLGA  146



>gb|KDO37229.1| hypothetical protein CISIN_1g014905mg [Citrus sinensis]
Length=416

 Score =   199 bits (506),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 125/151 (83%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME FY++VF  LAA+V A+ELSK SKDRI TS +FN+F N+Y+IVYSLMMAGDWLQGPYV
Sbjct  1    MESFYFVVFACLAALVVAMELSKNSKDRIGTSSSFNSFMNSYIIVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+TYG+GKGEIGQLFIAGFGSSMLFGT+VGSLADKQGRKRACVTYCITY+LSC+TKH
Sbjct  61   YYLYSTYGFGKGEIGQLFIAGFGSSMLFGTLVGSLADKQGRKRACVTYCITYMLSCVTKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            S +YK+LMLGRI GGIATSLLFS+FESWLVA
Sbjct  121  SSEYKILMLGRIFGGIATSLLFSAFESWLVA  151



>ref|XP_006476306.1| PREDICTED: molybdate-anion transporter-like [Citrus sinensis]
Length=461

 Score =   199 bits (507),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 125/151 (83%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME FY++VF  LAA+V A+ELSK SKDRI TS +FN+F N+Y+IVYSLMMAGDWLQGPYV
Sbjct  1    MESFYFVVFACLAALVVAMELSKNSKDRIGTSSSFNSFMNSYIIVYSLMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            YYLY+TYG+GKGEIGQLFIAGFGSSMLFGT+VGSLADKQGRKRACVTYCITY+LSC+TKH
Sbjct  61   YYLYSTYGFGKGEIGQLFIAGFGSSMLFGTLVGSLADKQGRKRACVTYCITYMLSCVTKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            S +YK+LMLGRI GGIATSLLFS+FESWLVA
Sbjct  121  SSEYKILMLGRIFGGIATSLLFSAFESWLVA  151



>ref|XP_003062454.1| major facilitator superfamily [Micromonas pusilla CCMP1545]
 gb|EEH53273.1| major facilitator superfamily [Micromonas pusilla CCMP1545]
Length=453

 Score =   175 bits (444),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 102/152 (67%), Positives = 121/152 (80%), Gaps = 1/152 (1%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKT-SKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpy  240
            ME +Y+L FG LA   A +E+ K  +K+R++   TF +F+N YL VYSLMMAGDWLQGPY
Sbjct  1    MEGYYWLQFGILAIACAGLEMQKAGNKERVAMPDTFISFRNLYLFVYSLMMAGDWLQGPY  60

Query  241  vyylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITK  420
            VY LY  YGY  G+IG+LFIAGFGSSM+FGT+VGS+ADK GRK A +TYC+TYI SC+TK
Sbjct  61   VYALYQHYGYSTGDIGKLFIAGFGSSMIFGTVVGSMADKYGRKNAALTYCVTYIASCVTK  120

Query  421  HSPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            H   Y VLMLGR  GGIATSLLF+SFESWLVA
Sbjct  121  HWSDYNVLMLGRFFGGIATSLLFTSFESWLVA  152



>emb|CDY05924.1| BnaC08g21010D [Brassica napus]
Length=474

 Score =   173 bits (438),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 113/166 (68%), Positives = 135/166 (81%), Gaps = 12/166 (7%)
 Frame = +1

Query  52   AETKMEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQ  231
            A+  MEVFYYLVFG +AAVVAA+E+SK +KD+ ++SP FN+FKN+Y++V+S+MMAGDWLQ
Sbjct  28   AKVTMEVFYYLVFGVMAAVVAALEMSKRNKDQNTSSP-FNSFKNSYVLVFSVMMAGDWLQ  86

Query  232  gpyvyylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRK--RACV--------  381
            GPYVYYLY+TYG+GK +IGQLFIAGFGSSMLFGTIVGSLA KQG      CV        
Sbjct  87   GPYVYYLYSTYGFGKRDIGQLFIAGFGSSMLFGTIVGSLAHKQGELILSVCVLDSGVERG  146

Query  382  -TYCITYILSCITKHSPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
              Y +  + SCITKHSPQ  VLM+GRILGGIATSLL S+FESWL+A
Sbjct  147  HVYILYSLHSCITKHSPQNTVLMVGRILGGIATSLLNSAFESWLIA  192



>ref|XP_002506106.1| major facilitator superfamily [Micromonas sp. RCC299]
 gb|ACO67364.1| major facilitator superfamily [Micromonas sp. RCC299]
Length=454

 Score =   169 bits (428),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 98/152 (64%), Positives = 121/152 (80%), Gaps = 1/152 (1%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKT-SKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpy  240
            ME +Y++ FG +A V A +E+ K  ++++++    F AF+N+YL VYSLMMAGDWLQGPY
Sbjct  1    MEGYYWIQFGLIAIVCAMLEMQKMGTREKVTMPQNFMAFRNSYLFVYSLMMAGDWLQGPY  60

Query  241  vyylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITK  420
            VY LY  YGY  G+IG+LFIAGFGSSM+FGT+VGS+ADK GRK A +TY +TYI SCITK
Sbjct  61   VYALYQHYGYTTGDIGKLFIAGFGSSMIFGTVVGSMADKYGRKNAALTYVVTYIASCITK  120

Query  421  HSPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            H   Y VLMLGR  GGIATSLLF++FESWLVA
Sbjct  121  HWSDYGVLMLGRFFGGIATSLLFTAFESWLVA  152



>gb|EPS57272.1| hypothetical protein M569_17548, partial [Genlisea aurea]
Length=195

 Score =   160 bits (404),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 92/101 (91%), Positives = 99/101 (98%), Gaps = 0/101 (0%)
 Frame = +1

Query  214  AGDWLQgpyvyylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCI  393
            AGDWLQGPYVYYLY TYG+GKGEIGQLFIAGFGSSMLFGTIVGSLADKQGR+RA VTYCI
Sbjct  1    AGDWLQGPYVYYLYQTYGFGKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRRRASVTYCI  60

Query  394  TYILSCITKHSPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            TYILSCITKHSPQY++LM+GR+LGGIATSLLFS+FESWLVA
Sbjct  61   TYILSCITKHSPQYRILMVGRVLGGIATSLLFSAFESWLVA  101



>emb|CDX73755.1| BnaC08g22480D [Brassica napus]
Length=124

 Score =   155 bits (393),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 90/101 (89%), Positives = 97/101 (96%), Gaps = 0/101 (0%)
 Frame = +1

Query  214  AGDWLQgpyvyylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCI  393
            AGDWLQGPYVYYLY+TYG+GK +IGQLFIAGFGSSMLFGTIVGSLADKQ RKRACVTYCI
Sbjct  8    AGDWLQGPYVYYLYSTYGFGKRDIGQLFIAGFGSSMLFGTIVGSLADKQDRKRACVTYCI  67

Query  394  TYILSCITKHSPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
             YILSCITKHSPQY+VLM+GRILGGIATSLL S+FESWL+A
Sbjct  68   VYILSCITKHSPQYRVLMVGRILGGIATSLLNSAFESWLIA  108



>ref|XP_001699326.1| hypothetical protein CHLREDRAFT_82040 [Chlamydomonas reinhardtii]
 gb|EDO98756.1| predicted protein, partial [Chlamydomonas reinhardtii]
Length=440

 Score =   164 bits (415),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 97/151 (64%), Positives = 117/151 (77%), Gaps = 0/151 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME  Y+++FGALA +VA + L++      S    F A +NNY+ VY+LMMAGDWLQGPYV
Sbjct  1    MEQVYWVIFGALAFIVAGLVLTQVLSGAGSQLQAFFALRNNYVFVYALMMAGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
            Y LY  YGY   +IG+LFIAGFGSSM+FGT+VGSLADK GRK+A + Y + Y  SC TKH
Sbjct  61   YALYQHYGYDVKDIGRLFIAGFGSSMIFGTVVGSLADKHGRKKAALLYVVLYAASCATKH  120

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SP Y VLM+GR+LGGIATSLLFS+FESWLVA
Sbjct  121  SPDYGVLMIGRLLGGIATSLLFSAFESWLVA  151



>ref|NP_001077772.1| general substrate transporter-like protein [Arabidopsis thaliana]
 gb|AEE34270.1| general substrate transporter-like protein [Arabidopsis thaliana]
Length=421

 Score =   163 bits (412),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 94/102 (92%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = +1

Query  211  MAGDWLQgpyvyylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYC  390
            +AGDWLQGPYVYYLY+TYG+GKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRA +TYC
Sbjct  9    LAGDWLQGPYVYYLYSTYGFGKGEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRASITYC  68

Query  391  ITYILSCITKHSPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            ITYILSCITKHSPQYKVLM+GR+LGGIATSLLFS+FESWLVA
Sbjct  69   ITYILSCITKHSPQYKVLMVGRVLGGIATSLLFSAFESWLVA  110



>ref|XP_001416912.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO95205.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=452

 Score =   163 bits (413),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 106/153 (69%), Positives = 120/153 (78%), Gaps = 2/153 (1%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSK--TSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgp  237
            ME FY L FGALA+V AA+E+ K  TS    S    F AF+ NYL+VY+LMMAGDWLQGP
Sbjct  1    MESFYVLTFGALASVCAALEVRKRPTSGKGASLPANFLAFRTNYLVVYALMMAGDWLQGP  60

Query  238  yvyylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCIT  417
            YVY LY  YGYG G+IG+LFIAGFGSSM+FGTIVGSLAD+ GRK A +TY  TYI SCIT
Sbjct  61   YVYALYKHYGYGTGDIGKLFIAGFGSSMIFGTIVGSLADRYGRKLAGLTYVATYIASCIT  120

Query  418  KHSPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            KH   Y VLMLGR  GGIATSLLF++FESWLV+
Sbjct  121  KHWSDYGVLMLGRFFGGIATSLLFTAFESWLVS  153



>emb|CEF97079.1| Major facilitator superfamily domain, general substrate transporter 
[Ostreococcus tauri]
Length=451

 Score =   162 bits (411),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 106/154 (69%), Positives = 119/154 (77%), Gaps = 3/154 (2%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSK--TSKDRISTSP-TFNAFKNNYLIVYSLMMAGDWLQg  234
            ME FY L F ALA   A IELSK  + K      P  F AF+NNYL+VY+LMMAGDWLQG
Sbjct  1    MEGFYVLTFIALAIGCAGIELSKRPSGKGAAGNLPANFLAFRNNYLVVYALMMAGDWLQG  60

Query  235  pyvyylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCI  414
            PYVY LY  YGYG G+IG+LFIAGFGSSM+FGTIVGSLAD+ GRK A +TY +TYI SCI
Sbjct  61   PYVYALYKHYGYGTGDIGKLFIAGFGSSMIFGTIVGSLADRYGRKLAGLTYVVTYIASCI  120

Query  415  TKHSPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            TKH   Y VLMLGR  GGIATSLLF++FESWLV+
Sbjct  121  TKHWSDYGVLMLGRFFGGIATSLLFTAFESWLVS  154



>ref|XP_003078107.1| putative transporter (ISS) [Ostreococcus tauri]
Length=493

 Score =   162 bits (411),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 106/154 (69%), Positives = 119/154 (77%), Gaps = 3/154 (2%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSK--TSKDRISTSP-TFNAFKNNYLIVYSLMMAGDWLQg  234
            ME FY L F ALA   A IELSK  + K      P  F AF+NNYL+VY+LMMAGDWLQG
Sbjct  43   MEGFYVLTFIALAIGCAGIELSKRPSGKGAAGNLPANFLAFRNNYLVVYALMMAGDWLQG  102

Query  235  pyvyylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCI  414
            PYVY LY  YGYG G+IG+LFIAGFGSSM+FGTIVGSLAD+ GRK A +TY +TYI SCI
Sbjct  103  PYVYALYKHYGYGTGDIGKLFIAGFGSSMIFGTIVGSLADRYGRKLAGLTYVVTYIASCI  162

Query  415  TKHSPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            TKH   Y VLMLGR  GGIATSLLF++FESWLV+
Sbjct  163  TKHWSDYGVLMLGRFFGGIATSLLFTAFESWLVS  196



>ref|XP_005843441.1| hypothetical protein CHLNCDRAFT_33124, partial [Chlorella variabilis]
 gb|EFN51339.1| hypothetical protein CHLNCDRAFT_33124, partial [Chlorella variabilis]
Length=438

 Score =   161 bits (407),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 96/153 (63%), Positives = 115/153 (75%), Gaps = 2/153 (1%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRI--STSPTFNAFKNNYLIVYSLMMAGDWLQgp  237
            ME FY  +FG  A + A +E    +      +T+  F  F+NNYL+VYSLMMAGDWLQGP
Sbjct  1    MEPFYAALFGVAAVLAAVLEYGNRAGRNAPGNTTREFTMFRNNYLLVYSLMMAGDWLQGP  60

Query  238  yvyylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCIT  417
            YVY LY  YG+ +G+IG+LFIAGFGSSM+FGTIVGSLADK GRKRA +TYC+TY L C T
Sbjct  61   YVYALYQYYGFERGDIGKLFIAGFGSSMVFGTIVGSLADKHGRKRAALTYCVTYTLGCFT  120

Query  418  KHSPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            KH   + +L  GR+L GIATSLLFS+FESWLVA
Sbjct  121  KHFNNFWILAGGRVLCGIATSLLFSAFESWLVA  153



>ref|XP_007510912.1| predicted protein [Bathycoccus prasinos]
 emb|CCO66472.1| predicted protein [Bathycoccus prasinos]
Length=445

 Score =   161 bits (407),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 97/152 (64%), Positives = 112/152 (74%), Gaps = 1/152 (1%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSK-TSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpy  240
            ME +Y+  F  LA   A +E  K T K++     +F  F+NNYL VYSLMMAGDWLQGPY
Sbjct  1    MEAYYWTQFSVLAVFCALMEFQKFTQKEKTQMPSSFLNFRNNYLFVYSLMMAGDWLQGPY  60

Query  241  vyylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITK  420
            VY LY  YGY  G+IG+LFIAGFGSSM+FGT+VGS+ADK GRK A + Y  TYI SC+TK
Sbjct  61   VYALYQHYGYTTGDIGKLFIAGFGSSMIFGTVVGSMADKHGRKAAALVYVATYIASCVTK  120

Query  421  HSPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            H   Y VLMLGR  GGIATSLLF+ FESWLVA
Sbjct  121  HWSDYYVLMLGRFFGGIATSLLFTVFESWLVA  152



>ref|XP_005647097.1| DUF791-domain-containing protein [Coccomyxa subellipsoidea C-169]
 gb|EIE22553.1| DUF791-domain-containing protein [Coccomyxa subellipsoidea C-169]
Length=484

 Score =   161 bits (408),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 96/152 (63%), Positives = 123/152 (81%), Gaps = 1/152 (1%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKT-SKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpy  240
            ME FY  VFGALAA+ A +EL+K+ S    +TS  F+ F++NY++VYSLMMAGDWLQGPY
Sbjct  1    MEPFYIAVFGALAAIAAVLELTKSKSTSTDNTSKEFSRFRSNYVLVYSLMMAGDWLQGPY  60

Query  241  vyylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITK  420
            VY LY  YG+ + +IG+LFIAGFGSSM+FGTIVGSLADK GRK+A +TY +TY++ C TK
Sbjct  61   VYALYQHYGFDRSDIGRLFIAGFGSSMIFGTIVGSLADKTGRKKAALTYVVTYVIGCATK  120

Query  421  HSPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            H   + VL++GR+  G+ATSLL+S+FESWLVA
Sbjct  121  HWDVFGVLLVGRLFCGVATSLLYSAFESWLVA  152



>ref|XP_002949049.1| hypothetical protein VOLCADRAFT_58801 [Volvox carteri f. nagariensis]
 gb|EFJ49984.1| hypothetical protein VOLCADRAFT_58801 [Volvox carteri f. nagariensis]
Length=438

 Score =   160 bits (404),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 97/153 (63%), Positives = 116/153 (76%), Gaps = 2/153 (1%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTS--KDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgp  237
            ME  Y+ +FG LA +VA + L++        S    F + +NNY+ VY+LMMAGDWLQGP
Sbjct  1    MESVYWFIFGLLAVIVAGMLLTQGGIVSGNASQLQAFFSLRNNYVFVYALMMAGDWLQGP  60

Query  238  yvyylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCIT  417
            YVY LY  YGYG  +IG+LFIAGFGSSMLFGT+VGSLADK GRK+A + Y +TY  SC T
Sbjct  61   YVYALYQHYGYGVKDIGRLFIAGFGSSMLFGTVVGSLADKHGRKKAALLYVLTYAASCAT  120

Query  418  KHSPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            KHSP Y +LM GR+LGGIATSLLFS+FESWLVA
Sbjct  121  KHSPDYGILMFGRLLGGIATSLLFSAFESWLVA  153



>gb|KDD74397.1| DUF791 hypothetical protein, partial [Helicosporidium sp. ATCC 
50920]
Length=228

 Score =   153 bits (386),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 91/151 (60%), Positives = 114/151 (75%), Gaps = 1/151 (1%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIE-LSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpy  240
            ME F   +FG ++ V AA+E  ++  +   S    FN+FKNNY++VYSLMMAGDWLQGPY
Sbjct  1    MEPFLLSLFGLMSGVAAALEWANRHGRANKSIDQAFNSFKNNYVVVYSLMMAGDWLQGPY  60

Query  241  vyylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITK  420
            VY LY  YG+  G+IG+LFIAGFGSSM+FGT+VGSLADK GRKRA +TY   Y   C+TK
Sbjct  61   VYALYQHYGFSHGDIGRLFIAGFGSSMVFGTLVGSLADKHGRKRAALTYVAVYSAGCLTK  120

Query  421  HSPQYKVLMLGRILGGIATSLLFSSFESWLV  513
            H  ++ VL  GR+L G+ATSLL+S+FESWLV
Sbjct  121  HFNRFGVLFFGRLLCGVATSLLYSAFESWLV  151



>gb|EMT11170.1| hypothetical protein F775_20203 [Aegilops tauschii]
Length=451

 Score =   150 bits (378),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 88/151 (58%), Positives = 102/151 (68%), Gaps = 22/151 (15%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            ME+FYYLVFG LAAVVA    ++ ++      P     +      Y              
Sbjct  1    MEIFYYLVFGGLAAVVAGWSWARAARTASQPPPHSTPSRTTTSCQYGF------------  48

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKH  423
                      KG+IG+LF+AGFGSSMLFGTIVGSLAD+QGRKRAC+TYCITYILSCITKH
Sbjct  49   ---------DKGDIGRLFVAGFGSSMLFGTIVGSLADRQGRKRACITYCITYILSCITKH  99

Query  424  SPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            SP Y+VL LGRILGG+ATSLLFS+FESWLVA
Sbjct  100  SPHYRVL-LGRILGGVATSLLFSAFESWLVA  129



>ref|XP_011398587.1| Major facilitator superfamily domain-containing protein 5 [Auxenochlorella 
protothecoides]
 gb|KFM25691.1| Major facilitator superfamily domain-containing protein 5 [Auxenochlorella 
protothecoides]
Length=470

 Score =   149 bits (377),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 90/151 (60%), Positives = 108/151 (72%), Gaps = 1/151 (1%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIEL-SKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpy  240
            ME FY  +F   A   A  E  ++  K   +    F  FK NYL+VYS MMAGDWLQGPY
Sbjct  1    MEAFYVYLFMVGAVAAAVFEYGNRLVKVTAAPDLAFRGFKTNYLVVYSFMMAGDWLQGPY  60

Query  241  vyylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITK  420
            VY LY  YG+ +GEIG+LFIAGFGSSM+FGT++GSLADK GRKRA + Y + Y L C TK
Sbjct  61   VYALYEHYGFTRGEIGRLFIAGFGSSMIFGTVMGSLADKYGRKRAALLYVVCYTLGCFTK  120

Query  421  HSPQYKVLMLGRILGGIATSLLFSSFESWLV  513
            H+P + VL  GRIL GIATSLL+S+FESW+V
Sbjct  121  HAPNFWVLFFGRILCGIATSLLYSAFESWVV  151



>ref|XP_005711678.1| unnamed protein product [Chondrus crispus]
 emb|CDF41384.1| unnamed protein product [Chondrus crispus]
Length=460

 Score =   148 bits (374),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 83/132 (63%), Positives = 102/132 (77%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  ELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyvyylyttygygkgEIGQLFI  300
            + +K S    + +P F AF+NNYL+VY L +A DWLQGPYVY LY  YGYGK EI QLFI
Sbjct  31   DAAKPSDGPAANTPDFRAFQNNYLLVYLLAIAADWLQGPYVYALYAEYGYGKKEIAQLFI  90

Query  301  AGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKHSPQYKVLMLGRILGGIATS  480
            AGFGSS +FGT +GS+ADK GRK   + + ITY LSC+TKHSP +  LM+GR+L GIATS
Sbjct  91   AGFGSSAVFGTFIGSIADKYGRKFNVLVFVITYALSCMTKHSPNFATLMVGRLLAGIATS  150

Query  481  LLFSSFESWLVA  516
            +LFS+FESWLV+
Sbjct  151  ILFSAFESWLVS  162



>ref|XP_002948878.1| hypothetical protein VOLCADRAFT_58628 [Volvox carteri f. nagariensis]
 gb|EFJ50258.1| hypothetical protein VOLCADRAFT_58628 [Volvox carteri f. nagariensis]
Length=492

 Score =   144 bits (364),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 101/133 (76%), Gaps = 1/133 (1%)
 Frame = +1

Query  121  ELSKTSK-DRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyvyylyttygygkgEIGQLF  297
            ELS T+    +     F  F++NYL+V+ LMMAGDWLQGPY+Y LY  YGY  G+IG  F
Sbjct  27   ELSPTATLQNVDEQKRFRVFRSNYLLVFCLMMAGDWLQGPYIYALYEHYGYTVGDIGHFF  86

Query  298  IAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKHSPQYKVLMLGRILGGIAT  477
            I GFGSS++FGT+VG+LAD  GR+ A + Y +TY LSC TKHSP+Y VLM GR+LGGI+T
Sbjct  87   IMGFGSSLVFGTVVGALADIIGRRSASLVYVVTYCLSCATKHSPRYWVLMSGRMLGGIST  146

Query  478  SLLFSSFESWLVA  516
            SLLFS FESWLVA
Sbjct  147  SLLFSVFESWLVA  159



>gb|AEY68285.1| MOT2 [Chlamydomonas reinhardtii]
Length=535

 Score =   143 bits (361),  Expect = 6e-37, Method: Composition-based stats.
 Identities = 81/122 (66%), Positives = 95/122 (78%), Gaps = 0/122 (0%)
 Frame = +1

Query  151  STSPTFNAFKNNYLIVYSLMMAGDWLQgpyvyylyttygygkgEIGQLFIAGFGSSMLFG  330
            + S  F  F+NNYLIV+ +MMAGDWLQGPY+Y LY  YGY  G+IG  FI GFGSSM+FG
Sbjct  77   AESKRFRLFRNNYLIVFCMMMAGDWLQGPYIYALYEHYGYSVGDIGHFFIMGFGSSMVFG  136

Query  331  TIVGSLADKQGRKRACVTYCITYILSCITKHSPQYKVLMLGRILGGIATSLLFSSFESWL  510
            T+VG+LAD  GR+ A + Y  TY LSC TKHSP+Y VLM GR LGG++TSLLFS FESWL
Sbjct  137  TVVGALADITGRRAASLAYVATYCLSCATKHSPRYGVLMAGRALGGVSTSLLFSVFESWL  196

Query  511  VA  516
            VA
Sbjct  197  VA  198



>ref|XP_001629395.1| predicted protein [Nematostella vectensis]
 gb|EDO37332.1| predicted protein, partial [Nematostella vectensis]
Length=411

 Score =   142 bits (357),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 95/127 (75%), Gaps = 0/127 (0%)
 Frame = +1

Query  133  TSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyvyylyttygygkgEIGQLFIAGFG  312
            + K + S+ P F AF+ +YLIVY L  A DWLQGP+VY L+++YG    +I QLF+AGFG
Sbjct  23   SDKQQASSDPGFQAFQRSYLIVYLLAQAADWLQGPHVYALFSSYGLTPLQINQLFVAGFG  82

Query  313  SSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKHSPQYKVLMLGRILGGIATSLLFS  492
            SSM+FGTIVGS ADK GRK  C+ Y I Y L CI KH P + +LM GR +GGIATS+LFS
Sbjct  83   SSMIFGTIVGSFADKLGRKFNCILYGILYGLDCICKHFPNFYILMCGRFMGGIATSILFS  142

Query  493  SFESWLV  513
            +FESWLV
Sbjct  143  AFESWLV  149



>gb|KIZ05289.1| Major facilitator superfamily domain-containing protein 5 [Monoraphidium 
neglectum]
Length=187

 Score =   133 bits (335),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 75/131 (57%), Positives = 91/131 (69%), Gaps = 20/131 (15%)
 Frame = +1

Query  169  NAFKNNYLIVYSLMM---------------AGDWLQgpyvyylyttygygkgEIGQLFIA  303
             AF+NNYL VYSL M               AG ++     Y LY  YGY   +IGQLFI 
Sbjct  16   RAFRNNYLFVYSLQMRELSSTPCSSPAIATAGPYV-----YALYEHYGYSPAQIGQLFIT  70

Query  304  GFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKHSPQYKVLMLGRILGGIATSL  483
            GFGSSM+FGT +G+LADK GRK+A + Y + Y LSC+TKH P ++VLMLGR+LGG+ATSL
Sbjct  71   GFGSSMVFGTFIGALADKAGRKKATLGYVVAYSLSCLTKHYPNFRVLMLGRVLGGVATSL  130

Query  484  LFSSFESWLVA  516
            LFS+FESWLVA
Sbjct  131  LFSAFESWLVA  141



>gb|KIZ07268.1| Major facilitator superfamily domain-containing protein 5 [Monoraphidium 
neglectum]
Length=459

 Score =   138 bits (348),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 88/150 (59%), Positives = 104/150 (69%), Gaps = 7/150 (5%)
 Frame = +1

Query  67   EVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyvy  246
            + FYY+V+  +   + A+   +        S  F AF+NNYL VYSL       QGPYVY
Sbjct  3    DAFYYIVWSIIVLPLTALCWKEGIAAISDNSQAFKAFRNNYLAVYSL-------QGPYVY  55

Query  247  ylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKHS  426
             LY  YGY   +IGQLFIAGFGSSM+FGT VG+LADK GRK A + Y +TY LSC TKHS
Sbjct  56   ALYEHYGYSPAQIGQLFIAGFGSSMVFGTFVGALADKLGRKNAALGYVVTYSLSCCTKHS  115

Query  427  PQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            P Y VLM GR+LGGIATSLL+S+FESWLVA
Sbjct  116  PDYWVLMGGRVLGGIATSLLYSAFESWLVA  145



>ref|XP_009066968.1| hypothetical protein LOTGIDRAFT_134790 [Lottia gigantea]
 gb|ESO82303.1| hypothetical protein LOTGIDRAFT_134790 [Lottia gigantea]
Length=437

 Score =   136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 78/127 (61%), Positives = 96/127 (76%), Gaps = 4/127 (3%)
 Frame = +1

Query  145  RISTSPTFNA----FKNNYLIVYSLMMAGDWLQgpyvyylyttygygkgEIGQLFIAGFG  312
            R + SP  NA    F+ +YL+VY L MAGDWLQGP+VY LY  YG    +I +LF+AGFG
Sbjct  23   RSTLSPVNNASFSNFQRSYLVVYLLAMAGDWLQGPHVYALYENYGMTPHQIDRLFVAGFG  82

Query  313  SSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKHSPQYKVLMLGRILGGIATSLLFS  492
            SSM+FGTIVGS ADK GRK  C+ Y + Y L+CITKH   + +LMLGR+LGGIATS+L+S
Sbjct  83   SSMMFGTIVGSFADKYGRKTNCILYGVLYGLACITKHFNNFWILMLGRLLGGIATSILYS  142

Query  493  SFESWLV  513
            +FESWLV
Sbjct  143  AFESWLV  149



>ref|XP_005760520.1| hypothetical protein EMIHUDRAFT_55298, partial [Emiliania huxleyi 
CCMP1516]
 gb|EOD08091.1| hypothetical protein EMIHUDRAFT_55298, partial [Emiliania huxleyi 
CCMP1516]
Length=166

 Score =   130 bits (328),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 71/120 (59%), Positives = 91/120 (76%), Gaps = 0/120 (0%)
 Frame = +1

Query  154  TSPTFNAFKNNYLIVYSLMMAGDWLQgpyvyylyttygygkgEIGQLFIAGFGSSMLFGT  333
            +S  F+ F+  ++ VY + M  DWLQGPYVY LY++YG+ K  I  LFI GFG+SM+FGT
Sbjct  1    SSAEFSRFQRGFMSVYYIAMTADWLQGPYVYALYSSYGFSKHNIAVLFIGGFGASMVFGT  60

Query  334  IVGSLADKQGRKRACVTYCITYILSCITKHSPQYKVLMLGRILGGIATSLLFSSFESWLV  513
              G L+D+ GRKR+C+ YC  YI+SC+TKH+  Y  LMLGR+ GGIATSLLFS+FESWLV
Sbjct  61   FAGVLSDRLGRKRSCMAYCFLYIVSCVTKHARDYNTLMLGRVTGGIATSLLFSAFESWLV  120



>gb|EYB98848.1| hypothetical protein Y032_0127g1379 [Ancylostoma ceylanicum]
Length=273

 Score =   133 bits (335),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/129 (57%), Positives = 98/129 (76%), Gaps = 1/129 (1%)
 Frame = +1

Query  127  SKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyvyylyttygygkgEIGQLFIAG  306
            ++T+ + +   P F +F+  Y+IVY L +AGDWLQGP+VY LY +YG  K +I  LFIAG
Sbjct  20   TRTAVESVD-DPNFKSFQRTYIIVYLLAVAGDWLQGPHVYVLYQSYGMSKHQIEILFIAG  78

Query  307  FGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKHSPQYKVLMLGRILGGIATSLL  486
            FGSS+LFGT++GS ADK GR+  C+ Y + Y L+C+TKH    K+LM+GR LGGIATS+L
Sbjct  79   FGSSLLFGTVIGSFADKFGRRNNCLIYGVLYGLACVTKHFANMKILMIGRFLGGIATSIL  138

Query  487  FSSFESWLV  513
            +S+FESWLV
Sbjct  139  YSAFESWLV  147



>ref|XP_005645928.1| DUF791-domain-containing protein [Coccomyxa subellipsoidea C-169]
 gb|EIE21384.1| DUF791-domain-containing protein [Coccomyxa subellipsoidea C-169]
Length=470

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 85/152 (56%), Positives = 111/152 (73%), Gaps = 1/152 (1%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRI-STSPTFNAFKNNYLIVYSLMMAGDWLQgpy  240
            M+ F  L F +LAA+ A +EL K    ++ +T+  F  F+ NY++VY+LMMAGDWLQGPY
Sbjct  1    MDGFLLLTFASLAALTAVLELFKRRSSKLDTTNREFLRFRANYVLVYALMMAGDWLQGPY  60

Query  241  vyylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITK  420
            VY LY  YG+ +G+IG+LFI GF SSM+FGTI GSLADK GRK+A + Y + Y   C+TK
Sbjct  61   VYALYQYYGFDRGQIGRLFIGGFASSMVFGTIAGSLADKYGRKKAALAYVVMYTSGCVTK  120

Query  421  HSPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            H   + VL+ GR+  G+ATSLL S+FESWLVA
Sbjct  121  HFNDFNVLLAGRLFSGVATSLLNSAFESWLVA  152



>ref|XP_009028431.1| hypothetical protein HELRODRAFT_88702 [Helobdella robusta]
 gb|ESN93425.1| hypothetical protein HELRODRAFT_88702 [Helobdella robusta]
Length=418

 Score =   134 bits (338),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 75/122 (61%), Positives = 94/122 (77%), Gaps = 0/122 (0%)
 Frame = +1

Query  148  ISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyvyylyttygygkgEIGQLFIAGFGSSMLF  327
            + T  +F  FK +YLIVY L  AGDWLQGPYVY LY +YG    +I  LF+AGFGSSMLF
Sbjct  28   VVTDISFRNFKRSYLIVYLLAAAGDWLQGPYVYALYQSYGMATHDIELLFVAGFGSSMLF  87

Query  328  GTIVGSLADKQGRKRACVTYCITYILSCITKHSPQYKVLMLGRILGGIATSLLFSSFESW  507
            GT+VGS+ADK GRK  C+ Y I Y LSC+TKH   + +LM+GR+LGGIATS+L+S+FESW
Sbjct  88   GTVVGSVADKYGRKTNCILYGILYSLSCVTKHFNNFSILMVGRLLGGIATSILYSAFESW  147

Query  508  LV  513
            ++
Sbjct  148  VI  149



>ref|XP_002129829.1| PREDICTED: molybdate-anion transporter [Ciona intestinalis]
Length=435

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 72/117 (62%), Positives = 89/117 (76%), Gaps = 0/117 (0%)
 Frame = +1

Query  163  TFNAFKNNYLIVYSLMMAGDWLQgpyvyylyttygygkgEIGQLFIAGFGSSMLFGTIVG  342
             F +F+  Y++VY L M GDW QGPYVY LY  YG    +I  LF+AGFGSSM+FGT VG
Sbjct  33   NFLSFQKTYMVVYLLAMGGDWFQGPYVYALYQHYGMSSHQIDILFVAGFGSSMIFGTFVG  92

Query  343  SLADKQGRKRACVTYCITYILSCITKHSPQYKVLMLGRILGGIATSLLFSSFESWLV  513
            S+ADK GR+  CV Y I YILSCITKH P + +L++GR LGGIATS+L+S+FESWL+
Sbjct  93   SVADKFGRRFNCVLYGILYILSCITKHFPHFTILLVGRFLGGIATSILYSAFESWLI  149



>gb|ELT90330.1| hypothetical protein CAPTEDRAFT_161785 [Capitella teleta]
Length=467

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 96/128 (75%), Gaps = 2/128 (2%)
 Frame = +1

Query  136  SKDRISTS--PTFNAFKNNYLIVYSLMMAGDWLQgpyvyylyttygygkgEIGQLFIAGF  309
            ++ ++STS    F AF+  YL VY L MAGDWLQGPYVY LY  YG    +I  LF+AGF
Sbjct  22   TRTKVSTSSDAAFKAFQRTYLAVYLLAMAGDWLQGPYVYALYAHYGMNTHDIQVLFVAGF  81

Query  310  GSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKHSPQYKVLMLGRILGGIATSLLF  489
            GSS++FGT+VGS ADK GR+  C+ Y + Y L+C+TKH   + +LM+GR+LGGIATS+L+
Sbjct  82   GSSLVFGTVVGSFADKYGRRNNCIMYGVLYGLACVTKHFNNFYILMVGRLLGGIATSILY  141

Query  490  SSFESWLV  513
            S+FESWL+
Sbjct  142  SAFESWLI  149



>ref|XP_002613663.1| hypothetical protein BRAFLDRAFT_251617 [Branchiostoma floridae]
 gb|EEN69672.1| hypothetical protein BRAFLDRAFT_251617 [Branchiostoma floridae]
Length=407

 Score =   130 bits (328),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 72/128 (56%), Positives = 95/128 (74%), Gaps = 5/128 (4%)
 Frame = +1

Query  130  KTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyvyylyttygygkgEIGQLFIAGF  309
             T +DR      F +F+  YL+VY L  AGDW+QGP+VY LY +YG    +I QLF+AGF
Sbjct  26   PTVEDR-----NFQSFQRTYLVVYLLGAAGDWMQGPHVYALYQSYGMTTHQIEQLFVAGF  80

Query  310  GSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKHSPQYKVLMLGRILGGIATSLLF  489
            GSSM+FGT+VGS ADK GR+  C+ Y I Y L+C+TKH   + +LM+GR+LGG+ATS+LF
Sbjct  81   GSSMVFGTVVGSFADKIGRRTNCILYGILYSLACVTKHFANFWILMVGRLLGGVATSILF  140

Query  490  SSFESWLV  513
            S+F+SWLV
Sbjct  141  SAFDSWLV  148



>gb|EAY88268.1| hypothetical protein OsI_09721 [Oryza sativa Indica Group]
Length=117

 Score =   123 bits (309),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 79/99 (80%), Positives = 92/99 (93%), Gaps = 0/99 (0%)
 Frame = +1

Query  64   MEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyv  243
            MEVFYYLVFG LAAVVA +EL K++KDR++TS  FN+FKNNY++VYSLMM+GDWLQGPYV
Sbjct  1    MEVFYYLVFGGLAAVVAGLELGKSAKDRVTTSQAFNSFKNNYVLVYSLMMSGDWLQGPYV  60

Query  244  yylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQ  360
            YYLY+ YG+ KG+IG+LFIAGFGSSMLFGTIVGSLADKQ
Sbjct  61   YYLYSQYGFDKGDIGRLFIAGFGSSMLFGTIVGSLADKQ  99



>ref|XP_005095963.1| PREDICTED: major facilitator superfamily domain-containing protein 
5-like [Aplysia californica]
Length=481

 Score =   130 bits (328),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 72/121 (60%), Positives = 90/121 (74%), Gaps = 0/121 (0%)
 Frame = +1

Query  151  STSPTFNAFKNNYLIVYSLMMAGDWLQgpyvyylyttygygkgEIGQLFIAGFGSSMLFG  330
            ST P F  F+  YL+VY L M GDWLQGP+VY LY +YG    +I  LF+AGFGSSML G
Sbjct  29   STDPAFAVFQRTYLVVYLLAMTGDWLQGPHVYALYESYGMTTEQIDILFVAGFGSSMLVG  88

Query  331  TIVGSLADKQGRKRACVTYCITYILSCITKHSPQYKVLMLGRILGGIATSLLFSSFESWL  510
            TIVGS+AD+ GR+  C+ Y I Y  +C+TKH   + +LM+GRILGG ATS+L+S+FESWL
Sbjct  89   TIVGSVADRYGRRTNCILYGILYGSACVTKHFGNFWILMVGRILGGTATSILYSAFESWL  148

Query  511  V  513
            V
Sbjct  149  V  149



>ref|XP_005712300.1| unnamed protein product [Chondrus crispus]
 emb|CDF77426.1| unnamed protein product [Chondrus crispus]
Length=437

 Score =   129 bits (324),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 93/124 (75%), Gaps = 4/124 (3%)
 Frame = +1

Query  154  TSPT----FNAFKNNYLIVYSLMMAGDWLQgpyvyylyttygygkgEIGQLFIAGFGSSM  321
            +SPT    F  F+ NYL+VY L +A DWLQGPY+Y LY  YG+ K +IG+L+IAGF SS 
Sbjct  28   SSPTDARPFAHFQANYLLVYLLAVAADWLQGPYIYALYAQYGFSKSDIGRLYIAGFASSA  87

Query  322  LFGTIVGSLADKQGRKRACVTYCITYILSCITKHSPQYKVLMLGRILGGIATSLLFSSFE  501
            +FGT+V +LAD+ GR+   + YC+ Y  SC+TKHSP Y VL+ GRILGG+A S+L S+FE
Sbjct  88   VFGTVVAALADRYGRRNNALLYCVLYAASCLTKHSPNYYVLLFGRILGGVAYSILSSAFE  147

Query  502  SWLV  513
            SW+V
Sbjct  148  SWMV  151



>ref|NP_500274.2| Protein Y54G2A.4 [Caenorhabditis elegans]
 emb|CCD83490.1| SAMT-1 [Caenorhabditis elegans]
Length=432

 Score =   129 bits (323),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 92/126 (73%), Gaps = 0/126 (0%)
 Frame = +1

Query  136  SKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyvyylyttygygkgEIGQLFIAGFGS  315
            S    +  P F +F+  YLIVY + +AGDWLQGP+VY LY +YG  K +I  LFIAGFGS
Sbjct  22   SATESNDDPKFKSFQRTYLIVYMMAVAGDWLQGPHVYALYESYGMSKHQIEILFIAGFGS  81

Query  316  SMLFGTIVGSLADKQGRKRACVTYCITYILSCITKHSPQYKVLMLGRILGGIATSLLFSS  495
            S+LFGT +GS+ADK GR+  C+ Y I Y  +CITKH     VLM+GR LGGIATS+L+S+
Sbjct  82   SLLFGTFIGSIADKFGRRNNCLMYAILYGGACITKHFGNMPVLMIGRFLGGIATSILYSA  141

Query  496  FESWLV  513
            FESWL+
Sbjct  142  FESWLI  147



>ref|XP_009310066.1| hypothetical protein DQ04_02361000 [Trypanosoma grayi]
 gb|KEG11688.1| hypothetical protein DQ04_02361000 [Trypanosoma grayi]
Length=430

 Score =   128 bits (322),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 73/122 (60%), Positives = 92/122 (75%), Gaps = 0/122 (0%)
 Frame = +1

Query  151  STSPTFNAFKNNYLIVYSLMMAGDWLQgpyvyylyttygygkgEIGQLFIAGFGSSMLFG  330
            +T+P+F +F+  +L+VY L MA DW+QGPY+Y LYT YGY + E G LFI GFGSS++FG
Sbjct  40   TTTPSFKSFQRQFLLVYLLAMAADWMQGPYIYRLYTHYGYDRHENGILFITGFGSSLVFG  99

Query  331  TIVGSLADKQGRKRACVTYCITYILSCITKHSPQYKVLMLGRILGGIATSLLFSSFESWL  510
            T VG LAD  GR+RAC  Y + Y LSC TKH   + VL+ GR LGGIATSLL+S FESW+
Sbjct  100  TWVGPLADTWGRRRACALYSVVYALSCATKHFNHFGVLVAGRFLGGIATSLLWSVFESWM  159

Query  511  VA  516
            V+
Sbjct  160  VS  161



>ref|XP_003091996.1| hypothetical protein CRE_02678 [Caenorhabditis remanei]
 gb|EFO98440.1| hypothetical protein CRE_02678 [Caenorhabditis remanei]
Length=427

 Score =   128 bits (322),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 92/126 (73%), Gaps = 0/126 (0%)
 Frame = +1

Query  136  SKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyvyylyttygygkgEIGQLFIAGFGS  315
            S    +  P F +F+  YLIVY + +AGDWLQGP+VY LY +YG  K +I  LFIAGFGS
Sbjct  22   SATETNDDPQFKSFQRTYLIVYMMAVAGDWLQGPHVYALYESYGMSKHQIEILFIAGFGS  81

Query  316  SMLFGTIVGSLADKQGRKRACVTYCITYILSCITKHSPQYKVLMLGRILGGIATSLLFSS  495
            S++FGT +GS+ADK GR+  C+ Y I Y  +CITKH     VLM+GR LGG+ATS+L+S+
Sbjct  82   SLIFGTFIGSIADKFGRRNNCLMYAILYGGACITKHFGNMPVLMIGRFLGGVATSILYSA  141

Query  496  FESWLV  513
            FESWL+
Sbjct  142  FESWLI  147



>ref|XP_005839624.1| hypothetical protein GUITHDRAFT_161244 [Guillardia theta CCMP2712]
 gb|EKX52644.1| hypothetical protein GUITHDRAFT_161244 [Guillardia theta CCMP2712]
Length=487

 Score =   128 bits (321),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 78/152 (51%), Positives = 100/152 (66%), Gaps = 20/152 (13%)
 Frame = +1

Query  118  IELSKTSKDRISTSPT---FNAFKNNYLIVYSLMMAGDWLQgpyvyylyttygygkgE--  282
            I+L++ ++ + + SPT   F  F+  YL+VY   +  DWLQGPYVY LY  Y + K E  
Sbjct  17   IQLAQ-NRSKTAGSPTTSDFKKFQRLYLVVYFCSVMADWLQGPYVYALYDYYKFTKKEVE  75

Query  283  --------------IGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITK  420
                          IG LFI GFGSS +FG   GS ADK GRK +C+ YC+TYI+SC+TK
Sbjct  76   SDEMSVLACKSEEQIGVLFIVGFGSSAVFGVFAGSFADKYGRKLSCLVYCVTYIVSCLTK  135

Query  421  HSPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            HSP + VL+ GR+ GGIATS+LFSSFESW+VA
Sbjct  136  HSPNFNVLLFGRLTGGIATSILFSSFESWMVA  167



>gb|EGT53812.1| hypothetical protein CAEBREN_10853 [Caenorhabditis brenneri]
Length=432

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 92/126 (73%), Gaps = 0/126 (0%)
 Frame = +1

Query  136  SKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyvyylyttygygkgEIGQLFIAGFGS  315
            S    +  P F +F+  YL+VY + +AGDWLQGP+VY LY +YG  K +I  LFIAGFGS
Sbjct  22   SATESNDDPQFKSFQRTYLVVYMMAVAGDWLQGPHVYALYESYGMSKHQIEILFIAGFGS  81

Query  316  SMLFGTIVGSLADKQGRKRACVTYCITYILSCITKHSPQYKVLMLGRILGGIATSLLFSS  495
            S+LFGT +GS+ADK GR+  C+ Y I Y  +CITKH     VLM+GR LGG+ATS+L+S+
Sbjct  82   SLLFGTFIGSIADKFGRRNNCLMYAILYGGACITKHFGNMPVLMIGRFLGGVATSILYSA  141

Query  496  FESWLV  513
            FESWL+
Sbjct  142  FESWLI  147



>emb|CDJ86726.1| Protein of unknown function DUF791 domain containing protein 
[Haemonchus contortus]
Length=428

 Score =   126 bits (316),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 72/117 (62%), Positives = 89/117 (76%), Gaps = 0/117 (0%)
 Frame = +1

Query  163  TFNAFKNNYLIVYSLMMAGDWLQgpyvyylyttygygkgEIGQLFIAGFGSSMLFGTIVG  342
             F  F+  YL VY + +AGDWLQGP+VY LY +YG  K +I  LFIAGFGSS+LFGT++G
Sbjct  31   NFMKFQVIYLTVYLMAVAGDWLQGPHVYALYQSYGMSKHQIELLFIAGFGSSLLFGTVIG  90

Query  343  SLADKQGRKRACVTYCITYILSCITKHSPQYKVLMLGRILGGIATSLLFSSFESWLV  513
            S ADK GR+  C+ Y I Y  SCITKH P  +VLM+GR LGGIATS+L+S+FESW+V
Sbjct  91   SFADKFGRRNNCIIYGILYGCSCITKHFPSMEVLMVGRFLGGIATSILYSAFESWMV  147



>gb|ERG81318.1| major facilitator superfamily domain-containing protein 5 [Ascaris 
suum]
Length=406

 Score =   125 bits (314),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 70/116 (60%), Positives = 84/116 (72%), Gaps = 0/116 (0%)
 Frame = +1

Query  166  FNAFKNNYLIVYSLMMAGDWLQgpyvyylyttygygkgEIGQLFIAGFGSSMLFGTIVGS  345
            F +F+ NYL VY L +AGDWLQGP+VY LY + G  K EI  LF+ GF SS+ FGT + S
Sbjct  33   FISFQRNYLTVYLLAVAGDWLQGPHVYALYESSGMSKHEIELLFVGGFASSLFFGTFIAS  92

Query  346  LADKQGRKRACVTYCITYILSCITKHSPQYKVLMLGRILGGIATSLLFSSFESWLV  513
            LADK GRK  C  Y I Y LSCITKH   + V M+GR+ GGIATS+L+S+FESWLV
Sbjct  93   LADKYGRKSNCFVYGILYALSCITKHFANFWVFMIGRLFGGIATSVLYSAFESWLV  148



>gb|KHN75465.1| Major facilitator superfamily domain-containing protein 5 [Toxocara 
canis]
Length=508

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 94/126 (75%), Gaps = 0/126 (0%)
 Frame = +1

Query  136  SKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyvyylyttygygkgEIGQLFIAGFGS  315
            SK   S    F +F+ +YL+VY L +AGDWLQGP+VY LY +YG  K +I  LF+AGFGS
Sbjct  22   SKATSSEDAQFLSFQRSYLVVYLLAVAGDWLQGPHVYALYESYGMTKHDIELLFVAGFGS  81

Query  316  SMLFGTIVGSLADKQGRKRACVTYCITYILSCITKHSPQYKVLMLGRILGGIATSLLFSS  495
            S+LFGT + S+ADK GRK +C  Y + Y  +CITKH   + +LMLGR+LGGIATS+L+S+
Sbjct  82   SLLFGTFIASVADKYGRKSSCFLYGMLYAGACITKHFANFWILMLGRLLGGIATSILYSA  141

Query  496  FESWLV  513
            FESWLV
Sbjct  142  FESWLV  147



>ref|XP_005537599.1| hypothetical protein, conserved [Cyanidioschyzon merolae strain 
10D]
 dbj|BAM81563.1| hypothetical protein, conserved [Cyanidioschyzon merolae strain 
10D]
Length=471

 Score =   125 bits (314),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 90/127 (71%), Gaps = 1/127 (1%)
 Frame = +1

Query  136  SKDRISTSPT-FNAFKNNYLIVYSLMMAGDWLQgpyvyylyttygygkgEIGQLFIAGFG  312
            + D+I T    F +F+  YL VY L +A DWLQGP VY LY  YG+ K EI  LFIAGFG
Sbjct  48   ADDQIKTQRLGFCSFQRTYLSVYFLAVAADWLQGPMVYALYDAYGFSKHEIAALFIAGFG  107

Query  313  SSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKHSPQYKVLMLGRILGGIATSLLFS  492
            SSM+ GT  G+LAD  GRKR  + YC  Y +SC+TKH P + VL++GR+LGG+ATSLLFS
Sbjct  108  SSMVLGTYAGALADNFGRKRLALVYCAFYTVSCLTKHFPHFGVLLVGRLLGGMATSLLFS  167

Query  493  SFESWLV  513
             FE+W V
Sbjct  168  VFEAWYV  174



>ref|XP_011417659.1| PREDICTED: molybdate-anion transporter-like isoform X1 [Crassostrea 
gigas]
 gb|EKC36378.1| Major facilitator superfamily domain-containing protein 5 [Crassostrea 
gigas]
Length=447

 Score =   124 bits (312),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 95/129 (74%), Gaps = 1/129 (1%)
 Frame = +1

Query  127  SKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyvyylyttygygkgEIGQLFIAG  306
            ++T+   IS +  F  F+  YL+VY L MAGDWLQGP+VY LY +YG    +I  LF+AG
Sbjct  22   TRTALTTISDA-AFKNFQRVYLVVYLLAMAGDWLQGPHVYALYDSYGMSSHQIEVLFVAG  80

Query  307  FGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKHSPQYKVLMLGRILGGIATSLL  486
            FGSSM+FGT+VGS AD+ GR+   + Y I Y  +CITKH   + +LMLGR+LGGIATS+L
Sbjct  81   FGSSMIFGTVVGSFADRYGRRANTIVYGILYGGACITKHFNNFYILMLGRLLGGIATSIL  140

Query  487  FSSFESWLV  513
            +S+FESW++
Sbjct  141  YSAFESWMI  149



>ref|XP_011417660.1| PREDICTED: molybdate-anion transporter-like isoform X2 [Crassostrea 
gigas]
 ref|XP_011417661.1| PREDICTED: molybdate-anion transporter-like isoform X2 [Crassostrea 
gigas]
Length=432

 Score =   124 bits (312),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 95/129 (74%), Gaps = 1/129 (1%)
 Frame = +1

Query  127  SKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyvyylyttygygkgEIGQLFIAG  306
            ++T+   IS +  F  F+  YL+VY L MAGDWLQGP+VY LY +YG    +I  LF+AG
Sbjct  22   TRTALTTISDA-AFKNFQRVYLVVYLLAMAGDWLQGPHVYALYDSYGMSSHQIEVLFVAG  80

Query  307  FGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKHSPQYKVLMLGRILGGIATSLL  486
            FGSSM+FGT+VGS AD+ GR+   + Y I Y  +CITKH   + +LMLGR+LGGIATS+L
Sbjct  81   FGSSMIFGTVVGSFADRYGRRANTIVYGILYGGACITKHFNNFYILMLGRLLGGIATSIL  140

Query  487  FSSFESWLV  513
            +S+FESW++
Sbjct  141  YSAFESWMI  149



>ref|XP_011417662.1| PREDICTED: molybdate-anion transporter-like isoform X3 [Crassostrea 
gigas]
 ref|XP_011417663.1| PREDICTED: molybdate-anion transporter-like isoform X3 [Crassostrea 
gigas]
Length=426

 Score =   124 bits (312),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 95/129 (74%), Gaps = 1/129 (1%)
 Frame = +1

Query  127  SKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyvyylyttygygkgEIGQLFIAG  306
            ++T+   IS +  F  F+  YL+VY L MAGDWLQGP+VY LY +YG    +I  LF+AG
Sbjct  22   TRTALTTISDA-AFKNFQRVYLVVYLLAMAGDWLQGPHVYALYDSYGMSSHQIEVLFVAG  80

Query  307  FGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKHSPQYKVLMLGRILGGIATSLL  486
            FGSSM+FGT+VGS AD+ GR+   + Y I Y  +CITKH   + +LMLGR+LGGIATS+L
Sbjct  81   FGSSMIFGTVVGSFADRYGRRANTIVYGILYGGACITKHFNNFYILMLGRLLGGIATSIL  140

Query  487  FSSFESWLV  513
            +S+FESW++
Sbjct  141  YSAFESWMI  149



>gb|KHJ97825.1| hypothetical protein OESDEN_02190 [Oesophagostomum dentatum]
Length=281

 Score =   122 bits (305),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 75/124 (60%), Positives = 89/124 (72%), Gaps = 3/124 (2%)
 Frame = +1

Query  151  STSPTFNAFKNNYLIVYSLMMA---GDWLQgpyvyylyttygygkgEIGQLFIAGFGSSM  321
            S    F  F+  YL VY L +A   GDWLQGP+VY LY +YG  K +I  LFIAGFGSS+
Sbjct  27   SDDVNFKKFQRTYLTVYLLAVAISAGDWLQGPHVYVLYESYGMSKHQIELLFIAGFGSSL  86

Query  322  LFGTIVGSLADKQGRKRACVTYCITYILSCITKHSPQYKVLMLGRILGGIATSLLFSSFE  501
            LFGTI+GS ADK GR+  C+ Y I Y L C+TKH    +VLM+GR LGGIATS+LFS+FE
Sbjct  87   LFGTIIGSFADKFGRRNNCLLYGILYGLGCVTKHFGIMEVLMIGRFLGGIATSILFSAFE  146

Query  502  SWLV  513
            SWLV
Sbjct  147  SWLV  150



>ref|XP_006674896.1| hypothetical protein BATDEDRAFT_3104, partial [Batrachochytrium 
dendrobatidis JAM81]
 gb|EGF83719.1| hypothetical protein BATDEDRAFT_3104, partial [Batrachochytrium 
dendrobatidis JAM81]
Length=362

 Score =   123 bits (308),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 90/117 (77%), Gaps = 0/117 (0%)
 Frame = +1

Query  166  FNAFKNNYLIVYSLMMAGDWLQgpyvyylyttygygkgEIGQLFIAGFGSSMLFGTIVGS  345
            F AF++NYL+VY L++  DWLQGPY+Y LY +Y Y    I  LF+ GF SS + GT VGS
Sbjct  1    FRAFQSNYLLVYGLVLISDWLQGPYIYSLYKSYNYELDIIALLFVTGFLSSAIVGTFVGS  60

Query  346  LADKQGRKRACVTYCITYILSCITKHSPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            +AD+ GR+  CV +C+ Y LSC+TK SP++ +LMLGR+LGGI+TSLLF+ FESW+++
Sbjct  61   IADRFGRRLGCVLFCVFYALSCLTKLSPEFGMLMLGRVLGGISTSLLFTVFESWMIS  117



>ref|XP_002680886.1| DUF791 domain-containing protein [Naegleria gruberi]
 gb|EFC48142.1| DUF791 domain-containing protein [Naegleria gruberi]
Length=456

 Score =   124 bits (310),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 71/121 (59%), Positives = 88/121 (73%), Gaps = 0/121 (0%)
 Frame = +1

Query  151  STSPTFNAFKNNYLIVYSLMMAGDWLQgpyvyylyttygygkgEIGQLFIAGFGSSMLFG  330
            ST  TF  F+NNYL+VY  M   DWLQG YVY LY +YGY    I +LFI GF SSM+FG
Sbjct  41   STLNTFAKFQNNYLVVYLCMTFSDWLQGAYVYVLYESYGYEIETISRLFIFGFFSSMIFG  100

Query  331  TIVGSLADKQGRKRACVTYCITYILSCITKHSPQYKVLMLGRILGGIATSLLFSSFESWL  510
            TI+GSL+DK GRK+ C+T+ + Y L+C+TKHS    VLM+GR   GIATS+L S FESW+
Sbjct  101  TIIGSLSDKLGRKKICLTFVVLYALACLTKHSSNLVVLMIGRFFSGIATSILSSVFESWM  160

Query  511  V  513
            +
Sbjct  161  I  161



>ref|XP_001693567.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP08821.1| predicted protein [Chlamydomonas reinhardtii]
Length=439

 Score =   123 bits (308),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 71/102 (70%), Positives = 81/102 (79%), Gaps = 0/102 (0%)
 Frame = +1

Query  211  MAGDWLQgpyvyylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYC  390
            MAGDWLQGPY+Y LY  YGY  G+IG  FI GFGSSM+FGT+VG+LAD  GR+ A + Y 
Sbjct  1    MAGDWLQGPYIYALYEHYGYSVGDIGHFFIMGFGSSMVFGTVVGALADITGRRAASLAYV  60

Query  391  ITYILSCITKHSPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
             TY LSC TKHSP+Y VLM GR LGG++TSLLFS FESWLVA
Sbjct  61   ATYCLSCATKHSPRYGVLMAGRALGGVSTSLLFSVFESWLVA  102



>ref|XP_009011883.1| hypothetical protein HELRODRAFT_73100 [Helobdella robusta]
 gb|ESO10069.1| hypothetical protein HELRODRAFT_73100 [Helobdella robusta]
Length=413

 Score =   122 bits (306),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 87/117 (74%), Gaps = 0/117 (0%)
 Frame = +1

Query  163  TFNAFKNNYLIVYSLMMAGDWLQgpyvyylyttygygkgEIGQLFIAGFGSSMLFGTIVG  342
             F+ F++ YL+VY      DW+QGPY+Y LY  YG+   EI +LF+AG+GSSM+FGT VG
Sbjct  33   NFSRFQHIYLLVYLFATGNDWIQGPYIYALYRHYGFSSQEIDRLFVAGYGSSMVFGTFVG  92

Query  343  SLADKQGRKRACVTYCITYILSCITKHSPQYKVLMLGRILGGIATSLLFSSFESWLV  513
            SLAD+ GRK+ C+ Y   Y LSCITKH P + VL +GRI+ GIATS+L S+FESWL+
Sbjct  93   SLADRFGRKKNCLLYAFLYSLSCITKHIPSFSVLFIGRIISGIATSILCSAFESWLI  149



>dbj|GAM17291.1| hypothetical protein SAMD00019534_004660, partial [Acytostelium 
subglobosum LB1]
Length=448

 Score =   122 bits (305),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 68/131 (52%), Positives = 93/131 (71%), Gaps = 0/131 (0%)
 Frame = +1

Query  124  LSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyvyylyttygygkgEIGQLFIA  303
            LS T+   +++  +F AF+N YL +Y L M  DW+QGPYVY LY +YG+   +I  LF++
Sbjct  36   LSSTNTFSVTSQMSFKAFQNQYLFIYLLAMGADWMQGPYVYALYKSYGFAMSDIAILFVS  95

Query  304  GFGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKHSPQYKVLMLGRILGGIATSL  483
            GF SSM+FG IVG +ADK GRK   + + I Y  SC+TK  P Y +LM+GRIL G++TSL
Sbjct  96   GFLSSMVFGVIVGPIADKYGRKLMTIIFGILYSASCVTKLMPDYNILMVGRILSGVSTSL  155

Query  484  LFSSFESWLVA  516
            LFS FESW+++
Sbjct  156  LFSVFESWMIS  166



>ref|XP_002634990.1| Hypothetical protein CBG13530 [Caenorhabditis briggsae]
Length=452

 Score =   121 bits (304),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 91/126 (72%), Gaps = 1/126 (1%)
 Frame = +1

Query  136  SKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyvyylyttygygkgEIGQLFIAGFGS  315
            S    +  P F +F+  YLIVY + +AGDWLQGP+VY LY +YG  K +I  LFIAG GS
Sbjct  22   SATESNDDPQFKSFQRTYLIVYMMAVAGDWLQGPHVYALYESYGMSKHQIEILFIAG-GS  80

Query  316  SMLFGTIVGSLADKQGRKRACVTYCITYILSCITKHSPQYKVLMLGRILGGIATSLLFSS  495
            S+LFGT +GS+ADK GR+  C+ Y I Y  +CITKH     VLM+GR LGG+ATS+L+S+
Sbjct  81   SLLFGTFIGSIADKFGRRNNCLMYAILYGGACITKHFGNMPVLMIGRFLGGVATSILYSA  140

Query  496  FESWLV  513
            FESWL+
Sbjct  141  FESWLI  146



>ref|XP_004996271.1| hypothetical protein PTSG_02768 [Salpingoeca rosetta]
 gb|EGD82088.1| hypothetical protein PTSG_02768 [Salpingoeca rosetta]
Length=453

 Score =   121 bits (303),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 70/130 (54%), Positives = 91/130 (70%), Gaps = 0/130 (0%)
 Frame = +1

Query  127  SKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyvyylyttygygkgEIGQLFIAG  306
            +  +    + S +F  F+  +L VY +M A DW QGPYVY LY  YG+   + GQLFIAG
Sbjct  37   AAANSTHTAASNSFRQFQWRFLTVYLVMTAADWAQGPYVYNLYEHYGFSIAQNGQLFIAG  96

Query  307  FGSSMLFGTIVGSLADKQGRKRACVTYCITYILSCITKHSPQYKVLMLGRILGGIATSLL  486
            FG+S+  GTI GSLADK+GRK   V Y + Y+ SC+TKH   + VL++GR+LGGIATSLL
Sbjct  97   FGASLTLGTIAGSLADKRGRKFGAVLYGLLYMASCVTKHFNSFPVLIVGRVLGGIATSLL  156

Query  487  FSSFESWLVA  516
            FS FE+W+VA
Sbjct  157  FSVFEAWMVA  166



>ref|XP_001743669.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ91247.1| predicted protein, partial [Monosiga brevicollis MX1]
Length=419

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 87/110 (79%), Gaps = 0/110 (0%)
 Frame = +1

Query  187  YLIVYSLMMAGDWLQgpyvyylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGR  366
            YL++YS+++A DW+QGPY+Y LY  YG+   + GQLFIAGF SSM+FGT+ G+LAD+ GR
Sbjct  1    YLLIYSMLVAADWVQGPYMYRLYQAYGFTLAQNGQLFIAGFASSMVFGTVAGTLADRFGR  60

Query  367  KRACVTYCITYILSCITKHSPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            KR  + Y + Y LSC+TKH+  +  LM+GRILGG+ATSLLF+  ESW+VA
Sbjct  61   KRGTILYTLVYGLSCLTKHARDFPTLMVGRILGGLATSLLFTVPESWVVA  110



>ref|XP_004994920.1| hypothetical protein PTSG_04024 [Salpingoeca rosetta]
 gb|EGD83416.1| hypothetical protein PTSG_04024 [Salpingoeca rosetta]
Length=438

 Score =   118 bits (296),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 72/155 (46%), Positives = 105/155 (68%), Gaps = 0/155 (0%)
 Frame = +1

Query  49   LAETKMEVFYYLVFGalaavvaaIELSKTSKDRISTSPTFNAFKNNYLIVYSLMMAGDWL  228
            +A    E   Y+VFG +A    A  +  ++  ++S +  F  F+  YL +Y + M  DWL
Sbjct  1    MAAAGFEEAVYVVFGCVAVGTIAAFVYTSTFHKLSKNADFVTFQYKYLGIYLVAMMADWL  60

Query  229  QgpyvyylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKRACVTYCITYILS  408
            QGPY+Y LY  YG+ + +I  L+I+GF SSMLFG ++G+LAD+ GR+R C+T+C  Y LS
Sbjct  61   QGPYLYRLYEHYGFLEEQIAALYISGFVSSMLFGPLLGNLADRYGRRRLCITFCYLYSLS  120

Query  409  CITKHSPQYKVLMLGRILGGIATSLLFSSFESWLV  513
            C+ K S  + +LMLGRILGG++TSLL S+FESW++
Sbjct  121  CLMKLSSSFFLLMLGRILGGLSTSLLTSAFESWMI  155



>ref|XP_006822017.1| PREDICTED: molybdate-anion transporter-like [Saccoglossus kowalevskii]
Length=448

 Score =   118 bits (295),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 63/122 (52%), Positives = 92/122 (75%), Gaps = 0/122 (0%)
 Frame = +1

Query  148  ISTSPTFNAFKNNYLIVYSLMMAGDWLQgpyvyylyttygygkgEIGQLFIAGFGSSMLF  327
            I+++PTF  F+  Y +VY L +A DWLQGPY+Y LY+ YG+ + +I  L++ GF SS++F
Sbjct  31   ITSNPTFTQFQRGYFLVYFLALAADWLQGPYLYKLYSYYGFIESQIAVLYVCGFASSVVF  90

Query  328  GTIVGSLADKQGRKRACVTYCITYILSCITKHSPQYKVLMLGRILGGIATSLLFSSFESW  507
            GT  G LADK GRK+ C+T+ + Y +SC+TK S  Y +L++GR+L GI+TSLLF++FE+W
Sbjct  91   GTYAGILADKLGRKKLCMTFAVVYSVSCLTKLSRDYAILIVGRVLSGISTSLLFTAFEAW  150

Query  508  LV  513
             V
Sbjct  151  YV  152



>gb|KIZ07414.1| Putative 2-oxoglutarate/malatecarrier protein [Monoraphidium 
neglectum]
Length=766

 Score =   120 bits (301),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 89/180 (49%), Positives = 118/180 (66%), Gaps = 9/180 (5%)
 Frame = +1

Query  4    FLDTLHQPQIVD*VELAETKMEVFYYLVFGalaavvaaIELSKTSK---DRISTSPTFNA  174
            FLD L + Q     +L    +  FY+L F A      A+EL   S     + +T  +  A
Sbjct  282  FLDALPKIQKQYVRKLGFAHLCSFYWLTFAAFFVPAVALELGHGSGLFGGKGATGGSARA  341

Query  175  ------FKNNYLIVYSLMMAGDWLQgpyvyylyttygygkgEIGQLFIAGFGSSMLFGTI  336
                  F++NYL+V++LMMAGDW+QGPY+Y+LY  YG+   +IG+LFI GF SS +FGT+
Sbjct  342  GRDYARFRDNYLVVFALMMAGDWMQGPYIYHLYEHYGFSVRDIGRLFIMGFASSAVFGTV  401

Query  337  VGSLADKQGRKRACVTYCITYILSCITKHSPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
             G+LADK GRKRA + Y +TY  SC TKHS  Y VL+LGR+LGG++TSLLFS FE+W VA
Sbjct  402  AGALADKYGRKRASLLYVLTYSASCATKHSSSYDVLLLGRLLGGVSTSLLFSVFEAWAVA  461



>ref|XP_004345242.1| hypothetical protein CAOG_06493 [Capsaspora owczarzaki ATCC 30864]
 gb|KJE96125.1| hypothetical protein CAOG_006493 [Capsaspora owczarzaki ATCC 
30864]
Length=470

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 86/119 (72%), Gaps = 0/119 (0%)
 Frame = +1

Query  157  SPTFNAFKNNYLIVYSLMMAGDWLQgpyvyylyttygygkgEIGQLFIAGFGSSMLFGTI  336
            SP F +F+ NY+ VY L    DWLQGPYVY LY + G+   EI  LFIAGF SS++FGT+
Sbjct  46   SPAFRSFQRNYIAVYLLAQGCDWLQGPYVYSLYKSGGFAPSEISMLFIAGFASSLVFGTL  105

Query  337  VGSLADKQGRKRACVTYCITYILSCITKHSPQYKVLMLGRILGGIATSLLFSSFESWLV  513
            +G + D+ GR+R  + Y    + +C+T HS Q+ +L+LGR+LGGI++SLL ++FE+W+V
Sbjct  106  IGGIGDRLGRRRNAIVYGCVVVATCVTMHSRQFPILLLGRVLGGISSSLLHTTFEAWMV  164



>ref|XP_006593767.1| PREDICTED: molybdate-anion transporter-like isoform X1 [Glycine 
max]
 ref|XP_006593768.1| PREDICTED: molybdate-anion transporter-like isoform X2 [Glycine 
max]
Length=142

 Score =   111 bits (277),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/53 (98%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +1

Query  358  QGRKRACVTYCITYILSCITKHSPQYKVLMLGRILGGIATSLLFSSFESWLVA  516
            +GRKRACVTYCITYILSCITKHSPQYKVLMLGRILGGIATSLLFSSFESWLVA
Sbjct  8    RGRKRACVTYCITYILSCITKHSPQYKVLMLGRILGGIATSLLFSSFESWLVA  60



>ref|XP_002598588.1| hypothetical protein BRAFLDRAFT_118340 [Branchiostoma floridae]
 gb|EEN54600.1| hypothetical protein BRAFLDRAFT_118340 [Branchiostoma floridae]
Length=475

 Score =   116 bits (291),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 77/167 (46%), Positives = 108/167 (65%), Gaps = 10/167 (6%)
 Frame = +1

Query  22   QPQIVD*VELAETKMEVFYYLVFGalaavvaaIEL--SKTSKDRISTS-PTFNAFKNNYL  192
            +PQ+ +        ME F  +VF  L+A+   +E+   K     IS S P F  F+ +Y 
Sbjct  6    KPQLAN-------NMEGFVCIVFFFLSALCVGMEIMARKARPPEISASNPIFRKFQTDYF  58

Query  193  IVYSLMMAGDWLQgpyvyylyttygygkgEIGQLFIAGFGSSMLFGTIVGSLADKQGRKR  372
             VY L +  DWLQGPY+Y LY+ YG+ + +I  L++ GF SS++FGT  G LAD+ GRK+
Sbjct  59   KVYFLALLADWLQGPYLYKLYSHYGFEESQIAVLYVCGFASSVIFGTGTGVLADRYGRKK  118

Query  373  ACVTYCITYILSCITKHSPQYKVLMLGRILGGIATSLLFSSFESWLV  513
             CV + + Y +SC+TK S  Y VL+LGR+LGGI+TSLLF++FESW V
Sbjct  119  LCVCFAVVYSISCLTKLSRHYGVLILGRVLGGISTSLLFTAFESWYV  165



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 552470516325