BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001P20

Length=550
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KDO49150.1|  hypothetical protein CISIN_1g046325mg                 67.4    5e-10   Citrus sinensis [apfelsine]
ref|XP_010647782.1|  PREDICTED: la-related protein 6C isoform X2      66.6    9e-10   Vitis vinifera
ref|XP_002281817.1|  PREDICTED: la-related protein 6C isoform X1      66.6    1e-09   Vitis vinifera
ref|XP_006423072.1|  hypothetical protein CICLE_v10028506mg           65.9    1e-09   Citrus clementina [clementine]
ref|XP_006480245.1|  PREDICTED: la-related protein 7-like             65.9    2e-09   Citrus sinensis [apfelsine]
ref|XP_010255219.1|  PREDICTED: la-related protein 6C-like            65.5    2e-09   Nelumbo nucifera [Indian lotus]
emb|CAN81423.1|  hypothetical protein VITISV_035943                   65.9    3e-09   Vitis vinifera
ref|XP_006346524.1|  PREDICTED: uncharacterized protein LOC102603710  64.3    5e-09   Solanum tuberosum [potatoes]
ref|XP_009625721.1|  PREDICTED: la-related protein 6C-like            63.9    7e-09   Nicotiana tomentosiformis
ref|XP_003520171.1|  PREDICTED: la-related protein 6-like             63.5    9e-09   Glycine max [soybeans]
ref|XP_009761551.1|  PREDICTED: la-related protein 6C-like isofor...  63.5    1e-08   Nicotiana sylvestris
gb|KHN31051.1|  La-related protein 7                                  62.4    2e-08   Glycine soja [wild soybean]
ref|XP_003528499.1|  PREDICTED: la-related protein 6-like             62.4    2e-08   
gb|AES90236.2|  LA-related protein 6 LA RNA-binding domain protein    62.0    3e-08   Medicago truncatula
ref|XP_003608039.1|  La-related protein                               62.0    3e-08   
ref|XP_010248222.1|  PREDICTED: la-related protein 6C-like            61.6    4e-08   Nelumbo nucifera [Indian lotus]
ref|XP_008236635.1|  PREDICTED: la-related protein 6C isoform X2      61.2    5e-08   Prunus mume [ume]
ref|XP_008236634.1|  PREDICTED: la-related protein 6C isoform X1      61.2    5e-08   Prunus mume [ume]
ref|XP_007200048.1|  hypothetical protein PRUPE_ppa024894mg           61.2    6e-08   
ref|XP_008236636.1|  PREDICTED: la-related protein 6C isoform X3      60.8    6e-08   Prunus mume [ume]
gb|KJB47430.1|  hypothetical protein B456_008G026200                  60.8    8e-08   Gossypium raimondii
gb|KJB32421.1|  hypothetical protein B456_005G240000                  60.1    1e-07   Gossypium raimondii
ref|XP_007042355.1|  RNA-binding protein, putative isoform 2          59.7    2e-07   
ref|XP_007042354.1|  RNA-binding protein, putative isoform 1          59.7    2e-07   
ref|XP_007156532.1|  hypothetical protein PHAVU_003G293900g           59.3    2e-07   Phaseolus vulgaris [French bean]
gb|KJB79267.1|  hypothetical protein B456_013G040700                  59.3    3e-07   Gossypium raimondii
ref|XP_004292453.1|  PREDICTED: la-related protein 6C                 58.9    3e-07   Fragaria vesca subsp. vesca
ref|XP_009609348.1|  PREDICTED: la-related protein 6C-like            58.5    4e-07   Nicotiana tomentosiformis
ref|XP_004145408.1|  PREDICTED: uncharacterized protein LOC101207999  58.5    5e-07   
ref|XP_004153773.1|  PREDICTED: uncharacterized protein LOC101217948  58.2    5e-07   
ref|XP_004171643.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  58.2    6e-07   
gb|KGN61738.1|  hypothetical protein Csa_2G235610                     58.2    6e-07   Cucumis sativus [cucumbers]
ref|XP_010999935.1|  PREDICTED: la-related protein 6C-like            57.4    1e-06   Populus euphratica
ref|XP_010315496.1|  PREDICTED: la-related protein 6C                 55.8    3e-06   
ref|XP_008459218.1|  PREDICTED: la-related protein 6C                 55.5    4e-06   Cucumis melo [Oriental melon]
ref|XP_006384451.1|  hypothetical protein POPTR_0004s15210g           55.5    4e-06   
ref|XP_010930389.1|  PREDICTED: la-related protein 6C                 55.5    5e-06   Elaeis guineensis
ref|XP_008392294.1|  PREDICTED: la-related protein 6C                 55.1    6e-06   
ref|XP_011092740.1|  PREDICTED: la-related protein 6C-like isofor...  55.1    7e-06   Sesamum indicum [beniseed]
ref|XP_011092741.1|  PREDICTED: la-related protein 6C-like isofor...  55.1    7e-06   Sesamum indicum [beniseed]
ref|XP_010107985.1|  La-related protein 7                             55.1    7e-06   Morus notabilis
ref|XP_002521842.1|  lupus la ribonucleoprotein, putative             55.1    7e-06   Ricinus communis
ref|XP_008360671.1|  PREDICTED: la-related protein 6C-like            54.3    8e-06   
ref|XP_008803782.1|  PREDICTED: la-related protein 6C                 54.3    1e-05   
ref|XP_011001196.1|  PREDICTED: la-related protein 6C                 53.5    2e-05   Populus euphratica
ref|XP_011088295.1|  PREDICTED: la-related protein 6C                 53.1    2e-05   Sesamum indicum [beniseed]
ref|XP_002313090.2|  hypothetical protein POPTR_0009s10970g           53.1    2e-05   
ref|XP_009772752.1|  PREDICTED: la-related protein 6C-like            52.8    3e-05   Nicotiana sylvestris
gb|KDP38238.1|  hypothetical protein JCGZ_04881                       50.4    2e-04   Jatropha curcas
ref|XP_010540322.1|  PREDICTED: la-related protein 6C                 49.7    4e-04   Tarenaya hassleriana [spider flower]



>gb|KDO49150.1| hypothetical protein CISIN_1g046325mg, partial [Citrus sinensis]
Length=442

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 39/61 (64%), Gaps = 8/61 (13%)
 Frame = +1

Query  388  FKLNVHAPEFVPRTFTQIPVSGYYYPYSQY--------QDWIYVGDQDSFPFFDNKNVVL  543
            FK NV APEFVPR+ TQ+P+SGYYYP  QY         DWI+VGDQ+      + +V +
Sbjct  68   FKFNVQAPEFVPRSHTQMPISGYYYPCFQYIGGTATGSADWIFVGDQEPVYVISSPSVAM  127

Query  544  P  546
            P
Sbjct  128  P  128



>ref|XP_010647782.1| PREDICTED: la-related protein 6C isoform X2 [Vitis vinifera]
Length=406

 Score = 66.6 bits (161),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 36/60 (60%), Gaps = 7/60 (12%)
 Frame = +1

Query  388  FKLNVHAPEFVPRTFTQIPVSGYYYPY-------SQYQDWIYVGDQDSFPFFDNKNVVLP  546
            FK N  APEFVPR+ TQ+P+SGY+YP        +   DW+YV DQD   F  N N  LP
Sbjct  34   FKFNAQAPEFVPRSHTQVPISGYFYPCFHLLGGGAGSADWLYVADQDPVHFISNSNGSLP  93



>ref|XP_002281817.1| PREDICTED: la-related protein 6C isoform X1 [Vitis vinifera]
 emb|CBI32464.3| unnamed protein product [Vitis vinifera]
Length=412

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 36/60 (60%), Gaps = 7/60 (12%)
 Frame = +1

Query  388  FKLNVHAPEFVPRTFTQIPVSGYYYPY-------SQYQDWIYVGDQDSFPFFDNKNVVLP  546
            FK N  APEFVPR+ TQ+P+SGY+YP        +   DW+YV DQD   F  N N  LP
Sbjct  34   FKFNAQAPEFVPRSHTQVPISGYFYPCFHLLGGGAGSADWLYVADQDPVHFISNSNGSLP  93



>ref|XP_006423072.1| hypothetical protein CICLE_v10028506mg [Citrus clementina]
 gb|ESR36312.1| hypothetical protein CICLE_v10028506mg [Citrus clementina]
Length=424

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 39/61 (64%), Gaps = 8/61 (13%)
 Frame = +1

Query  388  FKLNVHAPEFVPRTFTQIPVSGYYYPYSQY--------QDWIYVGDQDSFPFFDNKNVVL  543
            FK NV APEFVPR+ TQ+P+SGYYYP  QY         DWI+VGDQ+      + +V +
Sbjct  48   FKFNVQAPEFVPRSHTQMPISGYYYPCFQYIGGTATGSADWIFVGDQEPVYVISSPSVAM  107

Query  544  P  546
            P
Sbjct  108  P  108



>ref|XP_006480245.1| PREDICTED: la-related protein 7-like [Citrus sinensis]
Length=424

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 39/61 (64%), Gaps = 8/61 (13%)
 Frame = +1

Query  388  FKLNVHAPEFVPRTFTQIPVSGYYYPYSQY--------QDWIYVGDQDSFPFFDNKNVVL  543
            FK NV APEFVPR+ TQ+P+SGYYYP  QY         DWI+VGDQ+      + +V +
Sbjct  48   FKFNVQAPEFVPRSHTQMPISGYYYPCFQYIGGTATGSADWIFVGDQEPVYVISSPSVAM  107

Query  544  P  546
            P
Sbjct  108  P  108



>ref|XP_010255219.1| PREDICTED: la-related protein 6C-like [Nelumbo nucifera]
Length=407

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 37/60 (62%), Gaps = 6/60 (10%)
 Frame = +1

Query  385  CFKLNVHAPEFVPRTFTQIPVSGYYYPY------SQYQDWIYVGDQDSFPFFDNKNVVLP  546
             FK NVHAPEFVPR+ TQ+P+SGY+YP+      S   DW Y  +Q+      N NV LP
Sbjct  24   SFKFNVHAPEFVPRSQTQMPISGYFYPFFHFLGGSSGSDWYYFTEQEPIQIVSNSNVTLP  83



>emb|CAN81423.1| hypothetical protein VITISV_035943 [Vitis vinifera]
Length=941

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 36/60 (60%), Gaps = 7/60 (12%)
 Frame = +1

Query  388  FKLNVHAPEFVPRTFTQIPVSGYYYPY-------SQYQDWIYVGDQDSFPFFDNKNVVLP  546
            FK N  APEFVPR+ TQ+P+SGY+YP        +   DW+YV DQD   F  N N  LP
Sbjct  34   FKFNAQAPEFVPRSHTQVPISGYFYPCFHLLGGGAGSADWLYVADQDPVHFISNSNGSLP  93



>ref|XP_006346524.1| PREDICTED: uncharacterized protein LOC102603710 [Solanum tuberosum]
Length=396

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 37/58 (64%), Gaps = 8/58 (14%)
 Frame = +1

Query  385  CFKLNVHAPEFVPRTF-TQIPVSGYYYPYSQY-------QDWIYVGDQDSFPFFDNKN  534
            CFK NV APEFVPR+  T  P+S Y+YPY QY        DW+YV DQD+  +  N+N
Sbjct  28   CFKFNVQAPEFVPRSHNTTTPISSYFYPYFQYVSGGNTTSDWLYVADQDTLSYVPNQN  85



>ref|XP_009625721.1| PREDICTED: la-related protein 6C-like [Nicotiana tomentosiformis]
Length=410

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 54/116 (47%), Gaps = 28/116 (24%)
 Frame = +1

Query  211  MAQMKRPEKEVVSCTKNAQEMESVRGNDQGKKKMggssvsigstsssaggvgggggggCF  390
            MAQ++RPEK V  C +   + E+   +    K                           F
Sbjct  1    MAQLQRPEK-VDECIRETTQFETKDVSKTSNKN-------------------NKEDTASF  40

Query  391  KLNVHAPEFVPRTF-TQIPVSGYYYPYSQY-------QDWIYVGDQDSFPFFDNKN  534
            K NV APEFVPR+  T  P+S Y+YPY QY        DW+YVGDQD+  +  N++
Sbjct  41   KFNVQAPEFVPRSHTTTTPISSYFYPYFQYLSGGTAASDWLYVGDQDTISYVSNQS  96



>ref|XP_003520171.1| PREDICTED: la-related protein 6-like [Glycine max]
 gb|KHN37485.1| La-related protein 7 [Glycine soja]
Length=404

 Score = 63.5 bits (153),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 35/60 (58%), Gaps = 7/60 (12%)
 Frame = +1

Query  388  FKLNVHAPEFVPRTFTQIPVSGYYYP-------YSQYQDWIYVGDQDSFPFFDNKNVVLP  546
            FK N  APEFVPR+ TQ+PVSGYYYP        S+  DW +VGDQD        NV  P
Sbjct  27   FKFNAQAPEFVPRSHTQMPVSGYYYPCFQIFGGSSESADWFFVGDQDPSCLIPTPNVAQP  86



>ref|XP_009761551.1| PREDICTED: la-related protein 6C-like isoform X1 [Nicotiana sylvestris]
Length=411

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 55/116 (47%), Gaps = 27/116 (23%)
 Frame = +1

Query  211  MAQMKRPEKEVVSCTKNAQEMESVRGNDQGKKKMggssvsigstsssaggvgggggggCF  390
            MAQ++RPEK    CT+   + E+   +    K       +                   F
Sbjct  1    MAQLQRPEK-ADECTQETTQFETKDVSKTSNKNTNKEDTA------------------SF  41

Query  391  KLNVHAPEFVPRTF-TQIPVSGYYYPYSQY-------QDWIYVGDQDSFPFFDNKN  534
            K NV APEFVPR+  T  P+S Y+YPY QY        DW+YVGDQD+  +  N++
Sbjct  42   KFNVQAPEFVPRSHTTTTPISSYFYPYFQYLSGGTATSDWLYVGDQDTISYVPNQS  97



>gb|KHN31051.1| La-related protein 7 [Glycine soja]
Length=399

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 34/60 (57%), Gaps = 6/60 (10%)
 Frame = +1

Query  385  CFKLNVHAPEFVPRTFTQIPVSGYYYPY------SQYQDWIYVGDQDSFPFFDNKNVVLP  546
             FK N  APEFVPR+  Q+PVSGY+YPY      S   DW +VGDQD        N  LP
Sbjct  25   SFKFNAQAPEFVPRSQIQMPVSGYFYPYFQILGGSGESDWFFVGDQDPSCLIPTANAALP  84



>ref|XP_003528499.1| PREDICTED: la-related protein 6-like [Glycine max]
Length=399

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 34/59 (58%), Gaps = 6/59 (10%)
 Frame = +1

Query  388  FKLNVHAPEFVPRTFTQIPVSGYYYPY------SQYQDWIYVGDQDSFPFFDNKNVVLP  546
            FK N  APEFVPR+  Q+PVSGY+YPY      S   DW +VGDQD        N  LP
Sbjct  26   FKFNAQAPEFVPRSQIQMPVSGYFYPYFQILGGSGESDWFFVGDQDPSCLIPTANAALP  84



>gb|AES90236.2| LA-related protein 6 LA RNA-binding domain protein [Medicago 
truncatula]
Length=404

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 37/60 (62%), Gaps = 7/60 (12%)
 Frame = +1

Query  388  FKLNVHAPEFVPRTFTQIPVSGYYYPY------SQYQDWIYVGDQD-SFPFFDNKNVVLP  546
            FK NV APEFVPR+ +Q+P+SGY+YP       S   DW YVGDQD S     N NV  P
Sbjct  29   FKFNVQAPEFVPRSHSQMPISGYFYPCFQILGGSGESDWFYVGDQDPSACLIPNANVSQP  88



>ref|XP_003608039.1| La-related protein [Medicago truncatula]
Length=442

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 37/60 (62%), Gaps = 7/60 (12%)
 Frame = +1

Query  388  FKLNVHAPEFVPRTFTQIPVSGYYYPY------SQYQDWIYVGDQD-SFPFFDNKNVVLP  546
            FK NV APEFVPR+ +Q+P+SGY+YP       S   DW YVGDQD S     N NV  P
Sbjct  29   FKFNVQAPEFVPRSHSQMPISGYFYPCFQILGGSGESDWFYVGDQDPSACLIPNANVSQP  88



>ref|XP_010248222.1| PREDICTED: la-related protein 6C-like [Nelumbo nucifera]
Length=410

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 37/60 (62%), Gaps = 6/60 (10%)
 Frame = +1

Query  385  CFKLNVHAPEFVPRTFTQIPVSGYYYPY------SQYQDWIYVGDQDSFPFFDNKNVVLP  546
             FK N  APEFVPR+ TQ+P++GY+YP+      S   DW Y+ +Q+   +  N NV +P
Sbjct  24   SFKFNAQAPEFVPRSQTQMPITGYFYPFFPFLGGSSGSDWFYIAEQEPVQYVANSNVTVP  83



>ref|XP_008236635.1| PREDICTED: la-related protein 6C isoform X2 [Prunus mume]
Length=395

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 37/60 (62%), Gaps = 6/60 (10%)
 Frame = +1

Query  385  CFKLNVHAPEFVPRTFTQIPVSGYYYP------YSQYQDWIYVGDQDSFPFFDNKNVVLP  546
             FK N  APEFVPR+ TQ+P+SGY+YP       S   DW Y+GDQ+  P+  + N  +P
Sbjct  27   SFKFNAQAPEFVPRSHTQMPISGYFYPCFHFLGESASPDWFYIGDQELPPYLISNNPNIP  86



>ref|XP_008236634.1| PREDICTED: la-related protein 6C isoform X1 [Prunus mume]
Length=401

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 37/60 (62%), Gaps = 6/60 (10%)
 Frame = +1

Query  385  CFKLNVHAPEFVPRTFTQIPVSGYYYP------YSQYQDWIYVGDQDSFPFFDNKNVVLP  546
             FK N  APEFVPR+ TQ+P+SGY+YP       S   DW Y+GDQ+  P+  + N  +P
Sbjct  27   SFKFNAQAPEFVPRSHTQMPISGYFYPCFHFLGESASPDWFYIGDQELPPYLISNNPNIP  86



>ref|XP_007200048.1| hypothetical protein PRUPE_ppa024894mg [Prunus persica]
 gb|EMJ01247.1| hypothetical protein PRUPE_ppa024894mg [Prunus persica]
Length=401

 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 37/60 (62%), Gaps = 6/60 (10%)
 Frame = +1

Query  385  CFKLNVHAPEFVPRTFTQIPVSGYYYP------YSQYQDWIYVGDQDSFPFFDNKNVVLP  546
             FK N  APEFVPR+ TQ+P+SGY+YP       S   DW Y+GDQ+  P+  + N  +P
Sbjct  27   SFKFNAQAPEFVPRSHTQMPISGYFYPCFHFLGESASPDWFYIGDQELPPYLISNNPNIP  86



>ref|XP_008236636.1| PREDICTED: la-related protein 6C isoform X3 [Prunus mume]
Length=352

 Score = 60.8 bits (146),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 37/60 (62%), Gaps = 6/60 (10%)
 Frame = +1

Query  385  CFKLNVHAPEFVPRTFTQIPVSGYYYP------YSQYQDWIYVGDQDSFPFFDNKNVVLP  546
             FK N  APEFVPR+ TQ+P+SGY+YP       S   DW Y+GDQ+  P+  + N  +P
Sbjct  27   SFKFNAQAPEFVPRSHTQMPISGYFYPCFHFLGESASPDWFYIGDQELPPYLISNNPNIP  86



>gb|KJB47430.1| hypothetical protein B456_008G026200 [Gossypium raimondii]
Length=423

 Score = 60.8 bits (146),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 35/65 (54%), Gaps = 11/65 (17%)
 Frame = +1

Query  388  FKLNVHAPEFVPRTFTQIPVSGYYYPYSQY----------QDWIYVGDQDSFP-FFDNKN  534
            FK N HA EFVPR+ TQIP+SGYYYP   Y           DW  VGDQ+       N N
Sbjct  50   FKFNAHAQEFVPRSHTQIPISGYYYPCFHYLGGAAAAAGSSDWFLVGDQERAACLISNPN  109

Query  535  VVLPQ  549
            + +P 
Sbjct  110  ISIPH  114



>gb|KJB32421.1| hypothetical protein B456_005G240000 [Gossypium raimondii]
Length=435

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 38/62 (61%), Gaps = 9/62 (15%)
 Frame = +1

Query  388  FKLNVHAPEFVPRTFTQIPVSGYYYPYSQY--------QDWIYVGDQDSFPFF-DNKNVV  540
            FK N HAPEFVP++ TQ+P+SGYYYP   Y         DW ++G+Q+   +   N N+ 
Sbjct  61   FKFNAHAPEFVPKSHTQMPISGYYYPCFHYLGGAAAAASDWFFLGEQEPSAYLSSNPNIS  120

Query  541  LP  546
            +P
Sbjct  121  IP  122



>ref|XP_007042355.1| RNA-binding protein, putative isoform 2 [Theobroma cacao]
 gb|EOX98186.1| RNA-binding protein, putative isoform 2 [Theobroma cacao]
Length=422

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 37/60 (62%), Gaps = 7/60 (12%)
 Frame = +1

Query  388  FKLNVHAPEFVPRTFTQIPVSGYYYPYSQY------QDWIYVGDQDSFPFF-DNKNVVLP  546
            FK N  APEFVPR+ TQ+P+SGYYYP   Y       DW +VGDQ+   +   N N+ +P
Sbjct  48   FKFNAQAPEFVPRSHTQVPLSGYYYPCFHYLGGAGGSDWFFVGDQEPADYLISNPNLPIP  107



>ref|XP_007042354.1| RNA-binding protein, putative isoform 1 [Theobroma cacao]
 gb|EOX98185.1| RNA-binding protein, putative isoform 1 [Theobroma cacao]
Length=440

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 37/60 (62%), Gaps = 7/60 (12%)
 Frame = +1

Query  388  FKLNVHAPEFVPRTFTQIPVSGYYYPYSQY------QDWIYVGDQDSFPFF-DNKNVVLP  546
            FK N  APEFVPR+ TQ+P+SGYYYP   Y       DW +VGDQ+   +   N N+ +P
Sbjct  48   FKFNAQAPEFVPRSHTQVPLSGYYYPCFHYLGGAGGSDWFFVGDQEPADYLISNPNLPIP  107



>ref|XP_007156532.1| hypothetical protein PHAVU_003G293900g [Phaseolus vulgaris]
 gb|ESW28526.1| hypothetical protein PHAVU_003G293900g [Phaseolus vulgaris]
Length=399

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 35/59 (59%), Gaps = 6/59 (10%)
 Frame = +1

Query  388  FKLNVHAPEFVPRTFTQIPVSGYYYPYSQY------QDWIYVGDQDSFPFFDNKNVVLP  546
            FK N  APEFVPR+ +Q+P+SGY+YP  Q        DW +VGDQD        +V LP
Sbjct  26   FKFNAQAPEFVPRSQSQMPISGYFYPCFQILGGCGDSDWFFVGDQDPSCLIPTASVALP  84



>gb|KJB79267.1| hypothetical protein B456_013G040700 [Gossypium raimondii]
Length=415

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 39/78 (50%), Gaps = 26/78 (33%)
 Frame = +1

Query  385  CFKLNVHAPEFVPRTFTQIPVSGYYYPYSQY---------------QDWIYVGDQD----  507
             FK N HAPEFVP + TQIP+SGYYYP   Y                DW +VG+Q+    
Sbjct  34   TFKFNAHAPEFVPSSHTQIPISGYYYPCFHYLGGGGGGGGIGAGVGSDWFFVGEQEPAAY  93

Query  508  -------SFPFFDNKNVV  540
                   SFP F  KNV+
Sbjct  94   MFSNHNLSFPNFSYKNVL  111



>ref|XP_004292453.1| PREDICTED: la-related protein 6C [Fragaria vesca subsp. vesca]
Length=401

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 33/51 (65%), Gaps = 6/51 (12%)
 Frame = +1

Query  388  FKLNVHAPEFVPRTFTQIPVSGYYYPY------SQYQDWIYVGDQDSFPFF  522
            FK N  APEFVPR+ TQ+P+SGY+YP       +   DW Y+GDQ+  P+ 
Sbjct  27   FKFNAQAPEFVPRSHTQVPISGYFYPCFHFLGDTASPDWFYIGDQELPPYL  77



>ref|XP_009609348.1| PREDICTED: la-related protein 6C-like [Nicotiana tomentosiformis]
Length=428

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 32/52 (62%), Gaps = 7/52 (13%)
 Frame = +1

Query  385  CFKLNVHAPEFVPRTFTQIPVSGYYYPYSQY-------QDWIYVGDQDSFPF  519
             FK NV APEFVP++   IP+S Y YPY QY        DWIY GDQ++  F
Sbjct  51   SFKFNVQAPEFVPKSHATIPISRYIYPYFQYVNTTTTTNDWIYGGDQETISF  102



>ref|XP_004145408.1| PREDICTED: uncharacterized protein LOC101207999 [Cucumis sativus]
Length=423

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 36/61 (59%), Gaps = 7/61 (11%)
 Frame = +1

Query  385  CFKLNVHAPEFVPRTFTQIPVSGYYYPYSQY-------QDWIYVGDQDSFPFFDNKNVVL  543
             F+ N  APEF PRT TQ+PV+GY++PY  +        DW ++GDQ+      N N+ L
Sbjct  41   AFRFNAQAPEFFPRTQTQMPVTGYFHPYFHFLGGGPASSDWFFIGDQEPAYLIPNPNIQL  100

Query  544  P  546
            P
Sbjct  101  P  101



>ref|XP_004153773.1| PREDICTED: uncharacterized protein LOC101217948, partial [Cucumis 
sativus]
Length=393

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 36/61 (59%), Gaps = 7/61 (11%)
 Frame = +1

Query  385  CFKLNVHAPEFVPRTFTQIPVSGYYYPYSQY-------QDWIYVGDQDSFPFFDNKNVVL  543
             F+ N  APEF PRT TQ+PV+GY++PY  +        DW ++GDQ+      N N+ L
Sbjct  11   AFRFNAQAPEFFPRTQTQMPVTGYFHPYFHFLGGGPASSDWFFIGDQEPAYLIPNPNIQL  70

Query  544  P  546
            P
Sbjct  71   P  71



>ref|XP_004171643.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101217948 
[Cucumis sativus]
Length=429

 Score = 58.2 bits (139),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 36/61 (59%), Gaps = 7/61 (11%)
 Frame = +1

Query  385  CFKLNVHAPEFVPRTFTQIPVSGYYYPYSQY-------QDWIYVGDQDSFPFFDNKNVVL  543
             F+ N  APEF PRT TQ+PV+GY++PY  +        DW ++GDQ+      N N+ L
Sbjct  41   AFRFNAQAPEFFPRTQTQMPVTGYFHPYFHFLGGGPASSDWFFIGDQEPAYLIPNPNIQL  100

Query  544  P  546
            P
Sbjct  101  P  101



>gb|KGN61738.1| hypothetical protein Csa_2G235610 [Cucumis sativus]
Length=446

 Score = 58.2 bits (139),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 36/61 (59%), Gaps = 7/61 (11%)
 Frame = +1

Query  385  CFKLNVHAPEFVPRTFTQIPVSGYYYPYSQY-------QDWIYVGDQDSFPFFDNKNVVL  543
             F+ N  APEF PRT TQ+PV+GY++PY  +        DW ++GDQ+      N N+ L
Sbjct  41   AFRFNAQAPEFFPRTQTQMPVTGYFHPYFHFLGGGPASSDWFFIGDQEPAYLIPNPNIQL  100

Query  544  P  546
            P
Sbjct  101  P  101



>ref|XP_010999935.1| PREDICTED: la-related protein 6C-like [Populus euphratica]
Length=414

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 39/66 (59%), Gaps = 13/66 (20%)
 Frame = +1

Query  388  FKLNVHAPEFVPR---TFTQIPVSGYYYPYSQY--------QDWIYVGDQDSFPFF--DN  528
            FK N  APEF+PR   T TQ+P+SGY+YPY  Y         DW +VG+QD   +   +N
Sbjct  31   FKFNAQAPEFLPRSHTTATQMPISGYFYPYFNYLGATAAGGSDWFFVGNQDHAAYLISNN  90

Query  529  KNVVLP  546
             N+ +P
Sbjct  91   PNLAMP  96



>ref|XP_010315496.1| PREDICTED: la-related protein 6C [Solanum lycopersicum]
Length=415

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 36/65 (55%), Gaps = 15/65 (23%)
 Frame = +1

Query  385  CFKLNVHAPEFVPRTF--------TQIPVSGYYYPYSQY-------QDWIYVGDQDSFPF  519
             FK NV APEFVPR+         T  P+S Y+YPY QY        DW+YV DQD+  +
Sbjct  27   SFKFNVQAPEFVPRSHTTTTNTTTTTTPISSYFYPYFQYLSGGNTTSDWLYVADQDTLSY  86

Query  520  FDNKN  534
              N+N
Sbjct  87   LPNQN  91



>ref|XP_008459218.1| PREDICTED: la-related protein 6C [Cucumis melo]
Length=424

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 35/61 (57%), Gaps = 7/61 (11%)
 Frame = +1

Query  385  CFKLNVHAPEFVPRTFTQIPVSGYYYPYSQY-------QDWIYVGDQDSFPFFDNKNVVL  543
             F+ N  APEF PRT  Q+PV+GY++PY  +        DW ++GDQ+      N N+ L
Sbjct  41   AFRFNAQAPEFFPRTQPQMPVTGYFHPYFHFLGGGPASSDWFFIGDQEPAYLIPNPNIQL  100

Query  544  P  546
            P
Sbjct  101  P  101



>ref|XP_006384451.1| hypothetical protein POPTR_0004s15210g [Populus trichocarpa]
 gb|ERP62248.1| hypothetical protein POPTR_0004s15210g [Populus trichocarpa]
Length=429

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 32/53 (60%), Gaps = 13/53 (25%)
 Frame = +1

Query  388  FKLNVHAPEFVPRTF---TQIPVSGYYYPYSQY----------QDWIYVGDQD  507
            FK N  APEFVPR+    TQ+P+SGY+YP   Y           DWI+VGDQD
Sbjct  39   FKFNAQAPEFVPRSHTNTTQLPISGYFYPCFHYFGATASAAGGSDWIFVGDQD  91



>ref|XP_010930389.1| PREDICTED: la-related protein 6C [Elaeis guineensis]
Length=412

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 35/55 (64%), Gaps = 10/55 (18%)
 Frame = +1

Query  388  FKLNVHAPEFVPRTFTQI-PVSGYYYPYSQY---------QDWIYVGDQDSFPFF  522
            FK NVHAPEFVPR+++Q  P+SGY+YPY Q+          DWIY  +Q+   F 
Sbjct  25   FKFNVHAPEFVPRSYSQASPISGYFYPYLQFFGNGGGGLGPDWIYFAEQEPSHFV  79



>ref|XP_008392294.1| PREDICTED: la-related protein 6C [Malus domestica]
Length=404

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 33/56 (59%), Gaps = 7/56 (13%)
 Frame = +1

Query  388  FKLNVHAPEFVPRTFTQIPVSGYYYP-------YSQYQDWIYVGDQDSFPFFDNKN  534
            F  N  APEFVPR+  Q+P+SGY+YP        +   DW Y+GDQ+  P+  + N
Sbjct  28   FTFNAQAPEFVPRSHAQMPISGYFYPCFHFLGDSTASPDWFYIGDQELPPYLISNN  83



>ref|XP_011092740.1| PREDICTED: la-related protein 6C-like isoform X1 [Sesamum indicum]
Length=410

 Score = 55.1 bits (131),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 36/59 (61%), Gaps = 10/59 (17%)
 Frame = +1

Query  385  CFKLNVHAPEFVPR----TFTQIPVSGYYYPYSQYQD-----WIYVGDQD-SFPFFDNK  531
             FK NV APEFVP     T TQ+P++GY+YP  QY D     WIYV +QD + P   +K
Sbjct  25   SFKFNVAAPEFVPTLAHTTATQVPITGYFYPCFQYIDGTSGNWIYVAEQDITLPLVHSK  83



>ref|XP_011092741.1| PREDICTED: la-related protein 6C-like isoform X2 [Sesamum indicum]
Length=406

 Score = 55.1 bits (131),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 36/59 (61%), Gaps = 10/59 (17%)
 Frame = +1

Query  385  CFKLNVHAPEFVPR----TFTQIPVSGYYYPYSQYQD-----WIYVGDQD-SFPFFDNK  531
             FK NV APEFVP     T TQ+P++GY+YP  QY D     WIYV +QD + P   +K
Sbjct  25   SFKFNVAAPEFVPTLAHTTATQVPITGYFYPCFQYIDGTSGNWIYVAEQDITLPLVHSK  83



>ref|XP_010107985.1| La-related protein 7 [Morus notabilis]
 gb|EXC17385.1| La-related protein 7 [Morus notabilis]
Length=397

 Score = 55.1 bits (131),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 37/61 (61%), Gaps = 8/61 (13%)
 Frame = +1

Query  388  FKLNVHAPEFVPRTFTQIPVSGYYYP-------YSQYQDWIYVGDQDSFPFF-DNKNVVL  543
            F+ N  APEFVPRT TQ+PVSGY++P        +   DW++V D D   ++  N N+ L
Sbjct  26   FRFNAQAPEFVPRTKTQMPVSGYFHPCFHILGGSADSPDWLFVEDHDPPSYWISNLNISL  85

Query  544  P  546
            P
Sbjct  86   P  86



>ref|XP_002521842.1| lupus la ribonucleoprotein, putative [Ricinus communis]
 gb|EEF40478.1| lupus la ribonucleoprotein, putative [Ricinus communis]
Length=440

 Score = 55.1 bits (131),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 38/80 (48%), Gaps = 27/80 (34%)
 Frame = +1

Query  385  CFKLNVHAPEFVPRTF------TQIPVSGYYYPYSQY------QDWIYVGDQD-------  507
             FK N  APEFVPR+       TQIP+SGY+YP   Y       DW +VGDQD       
Sbjct  49   SFKFNAQAPEFVPRSHSFNQNQTQIPISGYFYPCFHYLGAASGSDWFFVGDQDPHNAAAT  108

Query  508  --------SFPFFDNKNVVL  543
                    +FP   NK  +L
Sbjct  109  YLISNPNLAFPNSSNKTTLL  128



>ref|XP_008360671.1| PREDICTED: la-related protein 6C-like [Malus domestica]
Length=278

 Score = 54.3 bits (129),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 33/56 (59%), Gaps = 7/56 (13%)
 Frame = +1

Query  388  FKLNVHAPEFVPRTFTQIPVSGYYYPYSQYQ-------DWIYVGDQDSFPFFDNKN  534
            F  N  APEFVPR+  Q+P+SGY+YP   +        DW Y+GDQ+  P+  + N
Sbjct  28   FTFNAQAPEFVPRSHAQMPISGYFYPCFHFLGDSTASPDWFYIGDQELPPYLISNN  83



>ref|XP_008803782.1| PREDICTED: la-related protein 6C [Phoenix dactylifera]
Length=412

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 34/54 (63%), Gaps = 10/54 (19%)
 Frame = +1

Query  388  FKLNVHAPEFVPRTFTQI-PVSGYYYPYSQY---------QDWIYVGDQDSFPF  519
            FK NVHAPEFVPR+ +Q  P+SGY+YPY Q+          DWIY  +Q+   F
Sbjct  25   FKFNVHAPEFVPRSHSQAPPISGYFYPYLQFFGNGGGGLGPDWIYFAEQEPAHF  78



>ref|XP_011001196.1| PREDICTED: la-related protein 6C [Populus euphratica]
Length=428

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 31/53 (58%), Gaps = 13/53 (25%)
 Frame = +1

Query  388  FKLNVHAPEFVPRTFTQ---IPVSGYYYPYSQY----------QDWIYVGDQD  507
            FK N  APEFVPR+ T    +P+SGY+YP   Y           DWI+VGDQD
Sbjct  38   FKFNAQAPEFVPRSHTNTSPLPISGYFYPCFHYFGATDSAAGGSDWIFVGDQD  90



>ref|XP_011088295.1| PREDICTED: la-related protein 6C [Sesamum indicum]
Length=365

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 34/55 (62%), Gaps = 9/55 (16%)
 Frame = +1

Query  388  FKLNVHAPEFVPRTF--TQIPVSGYYYPYSQYQD------WIYVGDQD-SFPFFD  525
            FK N  APEFVPR+   TQ+PV+ Y YPY  Y D      WIYV DQ+ +FP  D
Sbjct  11   FKFNAGAPEFVPRSQAQTQLPVTSYLYPYVPYVDGISCGSWIYVADQETTFPVVD  65



>ref|XP_002313090.2| hypothetical protein POPTR_0009s10970g [Populus trichocarpa]
 gb|EEE87045.2| hypothetical protein POPTR_0009s10970g [Populus trichocarpa]
Length=419

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 33/57 (58%), Gaps = 11/57 (19%)
 Frame = +1

Query  385  CFKLNVHAPEFVPRTFT---QIPVSGYYYPYSQY--------QDWIYVGDQDSFPFF  522
             FK N  APEF+PR+ T   Q+P+SGY+YPY  Y         DW +VG+QD   + 
Sbjct  30   SFKFNAQAPEFLPRSHTAATQMPISGYFYPYFNYLGATAAGGSDWFFVGNQDHAAYL  86



>ref|XP_009772752.1| PREDICTED: la-related protein 6C-like [Nicotiana sylvestris]
Length=431

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 28/48 (58%), Gaps = 9/48 (19%)
 Frame = +1

Query  385  CFKLNVHAPEFVPRTFTQIPVSGYYYPYSQY---------QDWIYVGD  501
             FK NV APEFVP++   IP+SGY YPY QY          DWI  GD
Sbjct  53   SFKFNVQAPEFVPKSHATIPISGYIYPYFQYVNTTITTTTNDWISGGD  100



>gb|KDP38238.1| hypothetical protein JCGZ_04881 [Jatropha curcas]
Length=457

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 37/76 (49%), Gaps = 23/76 (30%)
 Frame = +1

Query  388  FKLNVHAPEFVPRTF----------------TQIPVSGYYYPYSQY------QDWIYVGD  501
            FK N  APEFVPR+                 TQ+P+SGY+YP   Y       DW ++G+
Sbjct  61   FKFNAQAPEFVPRSHSPSPAASPAAAAAAAQTQMPISGYFYPCFHYLGATTGSDWFFLGE  120

Query  502  QDSFPFF-DNKNVVLP  546
            QD   +   N N+ LP
Sbjct  121  QDPHAYLISNPNLALP  136



>ref|XP_010540322.1| PREDICTED: la-related protein 6C [Tarenaya hassleriana]
Length=425

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 30/51 (59%), Gaps = 12/51 (24%)
 Frame = +1

Query  385  CFKLNVHAPEFVPRTF----TQIPVSGYYYPYSQY--------QDWIYVGD  501
             FK N  APEFVPR+      Q+PVSGY+ P+ QY         DW++VGD
Sbjct  34   AFKFNAQAPEFVPRSHMPAAAQVPVSGYFCPFFQYLGGGGAPDSDWVFVGD  84



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 590079713720