BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001P19

Length=581
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004246525.1|  PREDICTED: probable uridine nucleosidase 1         182   2e-52   Solanum lycopersicum
ref|XP_009366647.1|  PREDICTED: uridine nucleosidase 1-like isofo...    181   7e-52   Pyrus x bretschneideri [bai li]
ref|XP_009621486.1|  PREDICTED: probable uridine nucleosidase 1         180   1e-51   Nicotiana tomentosiformis
gb|KCW89213.1|  hypothetical protein EUGRSUZ_A015182                    175   2e-51   Eucalyptus grandis [rose gum]
ref|XP_007204697.1|  hypothetical protein PRUPE_ppa008281mg             179   2e-51   Prunus persica
ref|XP_011019892.1|  PREDICTED: uridine nucleosidase 1                  180   2e-51   Populus euphratica
ref|XP_008241263.1|  PREDICTED: uridine nucleosidase 1                  179   4e-51   Prunus mume [ume]
ref|XP_002283153.2|  PREDICTED: uridine nucleosidase 1                  179   4e-51   Vitis vinifera
ref|XP_006341119.1|  PREDICTED: uridine nucleosidase 1-like isofo...    177   1e-50   Solanum tuberosum [potatoes]
ref|XP_009366646.1|  PREDICTED: uridine nucleosidase 1-like isofo...    178   1e-50   Pyrus x bretschneideri [bai li]
emb|CDP15395.1|  unnamed protein product                                177   2e-50   Coffea canephora [robusta coffee]
ref|XP_010049632.1|  PREDICTED: uridine nucleosidase 1                  176   5e-50   Eucalyptus grandis [rose gum]
ref|XP_009796567.1|  PREDICTED: probable uridine nucleosidase 1         176   6e-50   Nicotiana sylvestris
ref|XP_004249446.1|  PREDICTED: uridine nucleosidase 1-like             175   9e-50   Solanum lycopersicum
ref|XP_007027686.1|  Uridine-ribohydrolase 1 isoform 1                  175   1e-49   Theobroma cacao [chocolate]
ref|XP_010244373.1|  PREDICTED: uridine nucleosidase 1-like             175   1e-49   Nelumbo nucifera [Indian lotus]
ref|XP_004303003.1|  PREDICTED: uridine nucleosidase 1                  175   1e-49   Fragaria vesca subsp. vesca
gb|KDO61100.1|  hypothetical protein CISIN_1g019503mg                   172   2e-49   Citrus sinensis [apfelsine]
ref|XP_006341118.1|  PREDICTED: uridine nucleosidase 1-like isofo...    174   4e-49   Solanum tuberosum [potatoes]
ref|XP_002309047.2|  hypothetical protein POPTR_0006s08350g             172   6e-49   
gb|KDO61096.1|  hypothetical protein CISIN_1g019503mg                   172   2e-48   Citrus sinensis [apfelsine]
ref|XP_006430245.1|  hypothetical protein CICLE_v10012143mg             172   2e-48   Citrus clementina [clementine]
ref|XP_006481808.1|  PREDICTED: uridine nucleosidase 1-like             172   2e-48   Citrus sinensis [apfelsine]
gb|KDO61097.1|  hypothetical protein CISIN_1g019503mg                   172   2e-48   Citrus sinensis [apfelsine]
ref|XP_009374743.1|  PREDICTED: uridine nucleosidase 1-like             172   2e-48   Pyrus x bretschneideri [bai li]
gb|KDP42725.1|  hypothetical protein JCGZ_23665                         171   3e-48   Jatropha curcas
ref|XP_008808554.1|  PREDICTED: uridine nucleosidase 1-like isofo...    169   6e-48   Phoenix dactylifera
ref|XP_004974197.1|  PREDICTED: probable uridine nucleosidase 1-like    170   8e-48   Setaria italica
ref|XP_010683768.1|  PREDICTED: probable uridine nucleosidase 1         171   8e-48   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010271715.1|  PREDICTED: uridine nucleosidase 1-like isofo...    170   1e-47   Nelumbo nucifera [Indian lotus]
ref|XP_008808553.1|  PREDICTED: probable uridine nucleosidase 1 i...    169   1e-47   Phoenix dactylifera
ref|XP_010271713.1|  PREDICTED: uridine nucleosidase 1-like isofo...    169   2e-47   Nelumbo nucifera [Indian lotus]
ref|XP_010271714.1|  PREDICTED: uridine nucleosidase 1-like isofo...    169   2e-47   Nelumbo nucifera [Indian lotus]
ref|XP_006659689.1|  PREDICTED: probable uridine nucleosidase 1-like    168   3e-47   Oryza brachyantha
ref|XP_009133074.1|  PREDICTED: uridine nucleosidase 1                  167   8e-47   Brassica rapa
gb|KJB62174.1|  hypothetical protein B456_009G404900                    165   9e-47   Gossypium raimondii
ref|NP_001242310.1|  uncharacterized protein LOC100787563               167   1e-46   
ref|XP_003574927.1|  PREDICTED: probable uridine nucleosidase 1         167   1e-46   Brachypodium distachyon [annual false brome]
dbj|BAJ99745.1|  predicted protein                                      167   1e-46   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006603710.1|  PREDICTED: uncharacterized protein LOC100787...    167   1e-46   Glycine max [soybeans]
ref|XP_009411962.1|  PREDICTED: probable uridine nucleosidase 1         167   2e-46   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX84137.1|  BnaC04g08990D                                          167   2e-46   
gb|KJB62176.1|  hypothetical protein B456_009G404900                    166   2e-46   Gossypium raimondii
gb|EMS49519.1|  hypothetical protein TRIUR3_15036                       165   2e-46   Triticum urartu
ref|XP_010909808.1|  PREDICTED: probable uridine nucleosidase 1         166   2e-46   Elaeis guineensis
emb|CDX75052.1|  BnaA05g07980D                                          166   3e-46   
ref|XP_002881439.1|  inosine-uridine preferring nucleoside hydrol...    166   4e-46   
ref|XP_006577068.1|  PREDICTED: uridine nucleosidase 1-like             165   4e-46   
gb|KJB62175.1|  hypothetical protein B456_009G404900                    166   5e-46   Gossypium raimondii
ref|XP_009393379.1|  PREDICTED: uridine nucleosidase 1-like isofo...    164   5e-46   
ref|XP_008801224.1|  PREDICTED: probable uridine nucleosidase 1 i...    164   5e-46   Phoenix dactylifera
emb|CDX84566.1|  BnaA03g16640D                                          165   8e-46   
ref|XP_006410804.1|  hypothetical protein EUTSA_v10016893mg             165   8e-46   Eutrema salsugineum [saltwater cress]
ref|XP_008801223.1|  PREDICTED: probable uridine nucleosidase 1 i...    165   9e-46   
gb|KHN02239.1|  Uridine nucleosidase 1                                  164   1e-45   Glycine soja [wild soybean]
ref|XP_004956207.1|  PREDICTED: probable uridine nucleosidase 2-like    165   1e-45   Setaria italica
tpg|DAA48674.1|  TPA: hypothetical protein ZEAMMB73_378734              162   1e-45   
gb|ABK24733.1|  unknown                                                 165   1e-45   Picea sitchensis
gb|ACJ84669.1|  unknown                                                 159   1e-45   Medicago truncatula
ref|XP_010552831.1|  PREDICTED: uridine nucleosidase 1                  164   1e-45   Tarenaya hassleriana [spider flower]
ref|XP_008801222.1|  PREDICTED: probable uridine nucleosidase 1 i...    164   1e-45   Phoenix dactylifera
emb|CDX79669.1|  BnaC03g20050D                                          164   2e-45   
ref|XP_008801221.1|  PREDICTED: probable uridine nucleosidase 1 i...    165   2e-45   
ref|XP_010516843.1|  PREDICTED: uridine nucleosidase 1-like             164   2e-45   Camelina sativa [gold-of-pleasure]
ref|XP_009393378.1|  PREDICTED: probable uridine nucleosidase 1 i...    164   2e-45   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG09677.1|  Uridine nucleosidase 1 -like protein                    164   2e-45   Gossypium arboreum [tree cotton]
ref|XP_002461988.1|  hypothetical protein SORBIDRAFT_02g011950          166   2e-45   Sorghum bicolor [broomcorn]
ref|XP_010509488.1|  PREDICTED: uridine nucleosidase 1                  163   4e-45   Camelina sativa [gold-of-pleasure]
tpg|DAA39615.1|  TPA: hypothetical protein ZEAMMB73_210413              159   5e-45   
ref|XP_004143313.1|  PREDICTED: uridine nucleosidase 1-like             162   7e-45   Cucumis sativus [cucumbers]
ref|NP_565843.1|  Uridine nucleosidase 1                                162   7e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010943708.1|  PREDICTED: probable uridine nucleosidase 1         162   8e-45   Elaeis guineensis
ref|NP_001266933.1|  pyrimidine-specific ribonucleoside hydrolase...    162   8e-45   
gb|AFW61723.1|  hypothetical protein ZEAMMB73_926916                    161   9e-45   
ref|XP_011094375.1|  PREDICTED: uridine nucleosidase 1-like             162   1e-44   Sesamum indicum [beniseed]
ref|XP_008462559.1|  PREDICTED: uridine nucleosidase 1                  161   2e-44   Cucumis melo [Oriental melon]
gb|KJB36383.1|  hypothetical protein B456_006G156300                    160   2e-44   Gossypium raimondii
ref|XP_009143597.1|  PREDICTED: uridine nucleosidase 1-like             161   2e-44   Brassica rapa
gb|KEH24134.1|  inosine-uridine preferring nucleoside hydrolase         160   2e-44   Medicago truncatula
ref|NP_001141948.1|  uncharacterized protein LOC100274097               161   2e-44   Zea mays [maize]
gb|KHN18754.1|  Uridine nucleosidase 1                                  160   3e-44   Glycine soja [wild soybean]
ref|XP_003625788.1|  Inosine-uridine preferring ribonucleoside hy...    160   3e-44   Medicago truncatula
gb|ACF80359.1|  unknown                                                 160   4e-44   Zea mays [maize]
gb|KJB36384.1|  hypothetical protein B456_006G156300                    160   4e-44   Gossypium raimondii
ref|NP_001148615.1|  LOC100282231                                       160   5e-44   Zea mays [maize]
ref|XP_010505163.1|  PREDICTED: uridine nucleosidase 1-like             160   5e-44   Camelina sativa [gold-of-pleasure]
gb|ACL53372.1|  unknown                                                 160   5e-44   Zea mays [maize]
ref|NP_001062489.1|  Os08g0557900                                       160   6e-44   
gb|EYU35466.1|  hypothetical protein MIMGU_mgv1a009694mg                160   7e-44   Erythranthe guttata [common monkey flower]
pdb|4KPO|A  Chain A, Plant Nucleoside Hydrolase - Zmnrh3 Enzyme         159   8e-44   Zea mays [maize]
ref|XP_004494158.1|  PREDICTED: uridine nucleosidase 1-like             159   9e-44   Cicer arietinum [garbanzo]
ref|XP_006294539.1|  hypothetical protein CARUB_v10023574mg             159   1e-43   
ref|XP_006851502.1|  hypothetical protein AMTR_s00040p00153690          159   2e-43   Amborella trichopoda
ref|NP_001105259.1|  uncharacterized protein LOC542168                  159   2e-43   
ref|XP_007162884.1|  hypothetical protein PHAVU_001G188700g             157   7e-43   Phaseolus vulgaris [French bean]
ref|XP_002528714.1|  inosine-uridine preferring nucleoside hydrol...    157   1e-42   Ricinus communis
gb|KFK36524.1|  hypothetical protein AALP_AA4G135500                    156   2e-42   Arabis alpina [alpine rockcress]
ref|XP_006660994.1|  PREDICTED: probable uridine nucleosidase 2-like    155   3e-42   
ref|XP_010101596.1|  hypothetical protein L484_015425                   154   2e-41   Morus notabilis
ref|NP_001063966.1|  Os09g0567900                                       154   2e-41   
ref|XP_011077879.1|  PREDICTED: uridine nucleosidase 1-like             152   6e-41   Sesamum indicum [beniseed]
gb|EMT19270.1|  hypothetical protein F775_29162                         151   1e-40   
gb|EEC85085.1|  hypothetical protein OsI_32443                          150   2e-40   Oryza sativa Indica Group [Indian rice]
ref|XP_003578679.1|  PREDICTED: probable uridine nucleosidase 2         150   2e-40   Brachypodium distachyon [annual false brome]
ref|XP_009383672.1|  PREDICTED: probable uridine nucleosidase 1         149   7e-40   Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU36642.1|  hypothetical protein MIMGU_mgv1a010172mg                144   4e-38   Erythranthe guttata [common monkey flower]
ref|XP_011074012.1|  PREDICTED: probable uridine nucleosidase 2 i...    142   2e-37   Sesamum indicum [beniseed]
gb|KCW88014.1|  hypothetical protein EUGRSUZ_A00423                     141   4e-37   Eucalyptus grandis [rose gum]
ref|XP_011074011.1|  PREDICTED: probable uridine nucleosidase 2 i...    142   5e-37   Sesamum indicum [beniseed]
ref|XP_010068713.1|  PREDICTED: probable uridine nucleosidase 2         141   7e-37   Eucalyptus grandis [rose gum]
gb|KCW88013.1|  hypothetical protein EUGRSUZ_A00423                     141   8e-37   Eucalyptus grandis [rose gum]
ref|XP_010683131.1|  PREDICTED: probable uridine nucleosidase 2         140   1e-36   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008383887.1|  PREDICTED: probable uridine nucleosidase 2 i...    140   1e-36   
ref|XP_008383895.1|  PREDICTED: probable uridine nucleosidase 2 i...    139   1e-36   
ref|XP_007204702.1|  hypothetical protein PRUPE_ppa009563mg             139   1e-36   
ref|XP_008383874.1|  PREDICTED: probable uridine nucleosidase 2 i...    140   2e-36   
ref|XP_008383880.1|  PREDICTED: probable uridine nucleosidase 2 i...    140   2e-36   
ref|XP_008383867.1|  PREDICTED: probable uridine nucleosidase 2 i...    140   2e-36   
ref|XP_008367729.1|  PREDICTED: probable uridine nucleosidase 2         137   2e-36   
ref|XP_008243078.1|  PREDICTED: probable uridine nucleosidase 2         140   2e-36   Prunus mume [ume]
emb|CDP19150.1|  unnamed protein product                                139   4e-36   Coffea canephora [robusta coffee]
ref|XP_009379911.1|  PREDICTED: probable uridine nucleosidase 2         139   5e-36   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010912743.1|  PREDICTED: probable uridine nucleosidase 2         139   6e-36   Elaeis guineensis
ref|XP_006858723.1|  hypothetical protein AMTR_s00066p00114470          138   8e-36   Amborella trichopoda
ref|XP_010251428.1|  PREDICTED: probable uridine nucleosidase 2 i...    137   1e-35   Nelumbo nucifera [Indian lotus]
ref|XP_006493127.1|  PREDICTED: probable uridine nucleosidase 2-like    138   1e-35   Citrus sinensis [apfelsine]
ref|XP_009343682.1|  PREDICTED: probable uridine nucleosidase 2         138   1e-35   Pyrus x bretschneideri [bai li]
ref|XP_010251427.1|  PREDICTED: probable uridine nucleosidase 2 i...    137   2e-35   Nelumbo nucifera [Indian lotus]
gb|EEC84027.1|  hypothetical protein OsI_30252                          137   3e-35   Oryza sativa Indica Group [Indian rice]
ref|XP_003555679.1|  PREDICTED: probable uridine nucleosidase 2-like    136   6e-35   Glycine max [soybeans]
ref|XP_001771662.1|  predicted protein                                  136   6e-35   
gb|KDP29547.1|  hypothetical protein JCGZ_19260                         136   7e-35   Jatropha curcas
ref|XP_002529114.1|  inosine-uridine preferring nucleoside hydrol...    135   7e-35   
gb|AFZ84928.1|  nucleoside N-ribohydrolase 2                            136   8e-35   Physcomitrella patens
gb|EPS73547.1|  hypothetical protein M569_01207                         135   1e-34   Genlisea aurea
ref|XP_007026485.1|  Uridine-ribohydrolase 2                            135   1e-34   
gb|KJB77093.1|  hypothetical protein B456_012G120100                    133   2e-34   Gossypium raimondii
emb|CDY06176.1|  BnaA09g50270D                                          134   2e-34   
gb|KJB77094.1|  hypothetical protein B456_012G120100                    134   3e-34   Gossypium raimondii
ref|XP_007153015.1|  hypothetical protein PHAVU_003G000600g             134   3e-34   Phaseolus vulgaris [French bean]
ref|XP_009118579.1|  PREDICTED: probable uridine nucleosidase 2         133   6e-34   Brassica rapa
emb|CDY10016.1|  BnaC08g44350D                                          133   6e-34   Brassica napus [oilseed rape]
gb|KJB77097.1|  hypothetical protein B456_012G120100                    133   6e-34   Gossypium raimondii
ref|XP_004138951.1|  PREDICTED: probable uridine nucleosidase 2-like    133   7e-34   Cucumis sativus [cucumbers]
gb|KEH40954.1|  inosine-uridine preferring nucleoside hydrolase         132   7e-34   Medicago truncatula
ref|XP_008457260.1|  PREDICTED: probable uridine nucleosidase 2         133   1e-33   Cucumis melo [Oriental melon]
emb|CDM81367.1|  unnamed protein product                                133   1e-33   Triticum aestivum [Canadian hard winter wheat]
gb|AFZ84927.1|  nucleoside N-ribohydrolase 3_v4                         134   1e-33   Physcomitrella patens
gb|ACU23843.1|  unknown                                                 130   1e-33   Glycine max [soybeans]
gb|AFZ84925.1|  nucleoside N-ribohydrolase 3_v2                         133   1e-33   Physcomitrella patens
gb|AFZ84924.1|  nucleoside N-ribohydrolase 3                            133   1e-33   Physcomitrella patens
gb|ACJ85074.1|  unknown                                                 132   1e-33   Medicago truncatula
ref|XP_001752621.1|  predicted protein                                  133   1e-33   
gb|AFZ84926.1|  nucleoside N-ribohydrolase 3_v3                         133   2e-33   Physcomitrella patens
ref|XP_011005265.1|  PREDICTED: probable uridine nucleosidase 2         132   2e-33   Populus euphratica
ref|XP_002310384.1|  inosine-uridine preferring nucleoside hydrol...    132   2e-33   Populus trichocarpa [western balsam poplar]
ref|XP_006353123.1|  PREDICTED: probable uridine nucleosidase 2-like    132   2e-33   Solanum tuberosum [potatoes]
gb|EMS60980.1|  hypothetical protein TRIUR3_20777                       132   2e-33   Triticum urartu
ref|XP_002280271.1|  PREDICTED: probable uridine nucleosidase 2         132   2e-33   Vitis vinifera
ref|XP_004251983.1|  PREDICTED: probable uridine nucleosidase 2         132   2e-33   Solanum lycopersicum
ref|XP_004498093.1|  PREDICTED: probable uridine nucleosidase 2-like    132   2e-33   Cicer arietinum [garbanzo]
ref|XP_009610288.1|  PREDICTED: probable uridine nucleosidase 2         132   3e-33   Nicotiana tomentosiformis
ref|XP_004287181.1|  PREDICTED: probable uridine nucleosidase 2         132   3e-33   Fragaria vesca subsp. vesca
ref|XP_006606983.1|  PREDICTED: probable uridine nucleosidase 2-l...    130   3e-33   
ref|XP_006418002.1|  hypothetical protein EUTSA_v10008223mg             131   4e-33   Eutrema salsugineum [saltwater cress]
ref|XP_010228384.1|  PREDICTED: probable uridine nucleosidase 2         131   4e-33   Brachypodium distachyon [annual false brome]
ref|XP_010457655.1|  PREDICTED: probable uridine nucleosidase 2 i...    131   4e-33   Camelina sativa [gold-of-pleasure]
gb|KHN08006.1|  Putative uridine nucleosidase 2                         131   4e-33   Glycine soja [wild soybean]
ref|XP_002963726.1|  hypothetical protein SELMODRAFT_80581              131   5e-33   Selaginella moellendorffii
ref|XP_003556968.1|  PREDICTED: probable uridine nucleosidase 2-l...    131   5e-33   Glycine max [soybeans]
ref|XP_010457653.1|  PREDICTED: probable uridine nucleosidase 2 i...    131   5e-33   
gb|ABR16229.1|  unknown                                                 131   5e-33   Picea sitchensis
dbj|BAJ94046.1|  predicted protein                                      131   6e-33   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010485120.1|  PREDICTED: probable uridine nucleosidase 2         130   6e-33   Camelina sativa [gold-of-pleasure]
gb|AFK46096.1|  unknown                                                 130   6e-33   Medicago truncatula
ref|XP_010457654.1|  PREDICTED: probable uridine nucleosidase 2 i...    130   6e-33   Camelina sativa [gold-of-pleasure]
ref|XP_010457651.1|  PREDICTED: probable uridine nucleosidase 2 i...    130   6e-33   Camelina sativa [gold-of-pleasure]
gb|EMS58664.1|  hypothetical protein TRIUR3_01534                       130   7e-33   Triticum urartu
ref|XP_009761342.1|  PREDICTED: probable uridine nucleosidase 2         130   1e-32   Nicotiana sylvestris
ref|XP_007027687.1|  Uridine-ribohydrolase 1 isoform 2                  129   1e-32   
ref|XP_010314790.1|  PREDICTED: probable uridine nucleosidase 2 i...    130   1e-32   Solanum lycopersicum
ref|XP_009111046.1|  PREDICTED: probable uridine nucleosidase 2         130   1e-32   Brassica rapa
ref|XP_006305378.1|  hypothetical protein CARUB_v10009769mg             129   1e-32   Capsella rubella
ref|XP_004253041.1|  PREDICTED: probable uridine nucleosidase 2 i...    129   2e-32   Solanum lycopersicum
emb|CDY15547.1|  BnaA08g28310D                                          129   2e-32   Brassica napus [oilseed rape]
gb|KJB77096.1|  hypothetical protein B456_012G120100                    129   2e-32   Gossypium raimondii
gb|AAS07209.1|  putative inosine-uridine preferring nucleoside hy...    128   2e-32   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002889557.1|  inosine-uridine preferring nucleoside hydrol...    129   2e-32   
gb|KJB77095.1|  hypothetical protein B456_012G120100                    129   2e-32   Gossypium raimondii
emb|CAN75814.1|  hypothetical protein VITISV_004635                     129   3e-32   Vitis vinifera
gb|AFW79716.1|  hypothetical protein ZEAMMB73_657631                    128   3e-32   
tpg|DAA53927.1|  TPA: hypothetical protein ZEAMMB73_327365              128   3e-32   
gb|EMT01801.1|  hypothetical protein F775_09054                         128   3e-32   
ref|XP_002974810.1|  hypothetical protein SELMODRAFT_101709             129   4e-32   
emb|CDX86570.1|  BnaC08g01330D                                          125   4e-32   
ref|NP_001150443.1|  nucleoside N-ribohydrolase 1a                      128   4e-32   Zea mays [maize]
gb|AAS07208.1|  putative inosine-uridine preferring nucleoside hy...    128   4e-32   Oryza sativa Japonica Group [Japonica rice]
gb|ADX07370.1|  nucleoside N-ribohydrolase 1b                           128   5e-32   Zea mays [maize]
ref|NP_001050402.1|  Os03g0425200                                       128   5e-32   
ref|NP_001132212.1|  uncharacterized protein LOC100193643               128   5e-32   
tpg|DAA53926.1|  TPA: pyrimidine-specific ribonucleoside hydrolas...    128   5e-32   
ref|NP_001117234.1|  inosine nucleoside hydrolase                       127   6e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009619043.1|  PREDICTED: uridine nucleosidase 1-like             127   7e-32   Nicotiana tomentosiformis
gb|ADX07369.1|  nucleoside N-ribohydrolase 1a                           128   8e-32   Zea mays [maize]
ref|NP_563745.1|  inosine nucleoside hydrolase                          127   1e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010475268.1|  PREDICTED: probable uridine nucleosidase 2         127   1e-31   Camelina sativa [gold-of-pleasure]
ref|XP_002455360.1|  hypothetical protein SORBIDRAFT_03g009290          127   1e-31   Sorghum bicolor [broomcorn]
gb|AAD30614.1|AC007153_6  Hypothetical protein                          127   2e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010522248.1|  PREDICTED: probable uridine nucleosidase 2         127   2e-31   Tarenaya hassleriana [spider flower]
ref|XP_006342441.1|  PREDICTED: probable uridine nucleosidase 2-like    126   3e-31   Solanum tuberosum [potatoes]
ref|NP_001148640.1|  pyrimidine-specific ribonucleoside hydrolase...    126   3e-31   
ref|XP_008676026.1|  PREDICTED: probable uridine nucleosidase 2         121   8e-31   
ref|XP_010557049.1|  PREDICTED: probable uridine nucleosidase 2         124   1e-30   Tarenaya hassleriana [spider flower]
ref|XP_004967883.1|  PREDICTED: probable uridine nucleosidase 2-like    123   4e-30   Setaria italica
ref|XP_006651516.1|  PREDICTED: probable uridine nucleosidase 2-like    122   9e-30   
gb|ABR26176.1|  pyrimidine-specific ribonucleoside hydrolase riha       119   7e-29   Oryza sativa Indica Group [Indian rice]
ref|XP_002972452.1|  hypothetical protein SELMODRAFT_97048              117   5e-28   Selaginella moellendorffii
ref|XP_002984283.1|  hypothetical protein SELMODRAFT_180819             117   6e-28   Selaginella moellendorffii
ref|WP_012069248.1|  nucleoside hydrolase                               115   3e-27   Marinomonas sp. MWYL1
ref|WP_024022427.1|  nucleoside hydrolase                               114   8e-27   Marinomonas profundimaris
ref|WP_036160357.1|  nucleoside hydrolase                               113   1e-26   Marinomonas ushuaiensis
gb|AES60050.2|  inosine-uridine preferring nucleoside hydrolase         113   1e-26   Medicago truncatula
ref|XP_002502123.1|  inosine-uridine preferring nucleoside hydrolase    113   2e-26   Micromonas commoda
ref|XP_005652379.1|  hypothetical protein COCSUDRAFT_83455              112   3e-26   Coccomyxa subellipsoidea C-169
ref|XP_001783230.1|  predicted protein                                  113   3e-26   
pdb|4KPN|A  Chain A, Plant Nucleoside Hydrolase - Ppnrh1 Enzyme         112   4e-26   Physcomitrella patens
ref|WP_013796756.1|  nucleoside hydrolase                               110   1e-25   Marinomonas posidonica
ref|XP_006430246.1|  hypothetical protein CICLE_v10012143mg             110   2e-25   
gb|KDO61098.1|  hypothetical protein CISIN_1g019503mg                   109   2e-25   Citrus sinensis [apfelsine]
gb|KJB23785.1|  hypothetical protein B456_004G115000                    102   2e-24   Gossypium raimondii
gb|KCW88020.1|  hypothetical protein EUGRSUZ_A00427                     106   4e-24   Eucalyptus grandis [rose gum]
ref|XP_002945850.1|  hypothetical protein VOLCADRAFT_55637              106   5e-24   Volvox carteri f. nagariensis
ref|WP_013662054.1|  nucleoside hydrolase                               106   7e-24   Marinomonas mediterranea
ref|WP_028671561.1|  nucleoside hydrolase                               105   2e-23   Saccharospirillum impatiens
ref|XP_005845976.1|  hypothetical protein CHLNCDRAFT_59718              105   2e-23   Chlorella variabilis
ref|WP_043525939.1|  nucleoside hydrolase                               104   2e-23   Halomonas xinjiangensis
ref|WP_010628627.1|  nucleoside hydrolase                               104   3e-23   Halomonas sp. KM-1
gb|EWH01315.1|  nucleoside hydrolase                                    104   3e-23   Halomonas sp. BC04
ref|XP_001696220.1|  hypothetical protein CHLREDRAFT_23981              103   3e-23   Chlamydomonas reinhardtii
ref|WP_022953052.1|  nucleoside hydrolase                               103   6e-23   Leucothrix mucor
ref|XP_003589799.1|  Pyrimidine-specific ribonucleoside hydrolase...    103   9e-23   
ref|WP_019366390.1|  hypothetical protein                               101   3e-22   Pseudomonas luteola
ref|WP_010795783.1|  hypothetical protein                               101   3e-22   Pseudomonas
ref|WP_043893339.1|  nucleoside hydrolase                             98.6    3e-22   
ref|XP_003057409.1|  predicted protein                                  101   4e-22   Micromonas pusilla CCMP1545
ref|WP_025733755.1|  nucleoside hydrolase                               100   9e-22   Carnimonas nigrificans
ref|WP_024952902.1|  nucleoside hydrolase                               100   9e-22   Cobetia
ref|WP_019950298.1|  hypothetical protein                               100   1e-21   Kushneria aurantia
gb|KDD76385.1|  inosine-uridine preferring nucleoside hydrolase         100   1e-21   Helicosporidium sp. ATCC 50920
ref|WP_019810135.1|  inosine/uridine-preferring nucleoside hydrolase  99.4    2e-21   
ref|WP_020558985.1|  hypothetical protein                             99.0    3e-21   Thiofilum flexile
ref|WP_011396206.1|  inosine-uridine nucleoside N-ribohydrolase       98.6    3e-21   Hahella chejuensis
ref|WP_019950296.1|  hypothetical protein                             98.6    3e-21   Kushneria aurantia
ref|WP_009832244.1|  nucleoside hydrolase                             98.6    4e-21   Marinomonas sp. MED121
ref|WP_018708767.1|  hypothetical protein                             98.6    4e-21   Bacillus fordii
ref|WP_027705806.1|  nucleoside hydrolase                             98.2    4e-21   Zymobacter palmae
ref|WP_043333594.1|  nucleoside hydrolase                             98.2    5e-21   Cobetia amphilecti
ref|WP_027350397.1|  nucleoside hydrolase                             97.8    8e-21   Halotalea alkalilenta
ref|WP_023006876.1|  nucleoside hydrolase                             97.4    8e-21   Halomonas sp. PBN3
ref|WP_016415106.1|  nucleoside hydrolase                             97.1    1e-20   Halomonas anticariensis
ref|XP_006442032.1|  hypothetical protein CICLE_v10023374mg           97.1    1e-20   
ref|WP_007624434.1|  probable uridine nucleosidase 2                  96.7    1e-20   Paraglaciecola arctica
ref|WP_044831679.1|  nucleoside hydrolase                             96.3    3e-20   Thalassomonas actiniarum
ref|WP_014109631.1|  nucleoside hydrolase                             95.9    3e-20   Glaciecola nitratireducens
ref|WP_007104018.1|  probable uridine nucleosidase 2                  95.9    3e-20   Paraglaciecola polaris
ref|WP_040186693.1|  nucleoside hydrolase                             95.5    5e-20   Halomonas salina
ref|WP_044838479.1|  nucleoside hydrolase                             95.1    6e-20   Thalassomonas viridans
ref|WP_032097507.1|  MULTISPECIES: nucleoside hydrolase               94.0    1e-19   Alteromonas
ref|WP_020395492.1|  hypothetical protein                             94.0    2e-19   Thiolinea disciformis
gb|ADE39847.1|  Inosine/uridine-preferring nucleoside hydrolase       93.2    3e-19   Candidatus Puniceispirillum marinum IMCC1322
ref|WP_018671390.1|  nucleosidase                                     92.8    3e-19   Brevibacillus laterosporus
ref|WP_041861325.1|  nucleoside hydrolase                             92.8    3e-19   
ref|WP_026678347.1|  nucleoside hydrolase                             92.8    4e-19   Fictibacillus gelatini
ref|WP_016741040.1|  nucleosidase                                     92.8    4e-19   Bacillales
ref|WP_006012718.1|  probable uridine nucleosidase 2                  92.8    4e-19   Glaciecola pallidula
ref|WP_026294602.1|  nucleoside hydrolase                             92.8    4e-19   Salinimonas chungwhensis
ref|WP_027961122.1|  nucleoside hydrolase                             92.4    5e-19   Halomonas halodenitrificans
ref|WP_020409745.1|  hypothetical protein                             92.4    5e-19   Hahella ganghwensis
ref|WP_008302313.1|  MULTISPECIES: nucleoside hydrolase               92.4    5e-19   Alteromonadaceae
ref|WP_010181233.1|  nucleoside hydrolase                             92.4    5e-19   
ref|WP_019017645.1|  nucleoside hydrolase                             92.4    6e-19   
ref|WP_012685239.1|  nucleosidase                                     92.0    6e-19   
ref|WP_028560101.1|  nucleoside hydrolase                             92.0    7e-19   
ref|WP_007640814.1|  probable uridine nucleosidase 2                  92.0    8e-19   
ref|WP_018181834.1|  hypothetical protein                             91.7    1e-18   
ref|WP_003335135.1|  pyrimidine-specific ribonucleoside hydrolase...  91.3    1e-18   
ref|WP_014977204.1|  nucleoside hydrolase                             91.3    1e-18   
ref|WP_026377374.1|  nucleoside hydrolase                             91.3    1e-18   
ref|WP_003339043.1|  inosine-uridine preferring nucleoside hydrol...  91.3    1e-18   
ref|WP_031411005.1|  nucleoside hydrolase                             91.3    1e-18   
ref|WP_022584508.1|  nucleosidase                                     91.3    1e-18   
ref|WP_014999236.1|  nucleoside hydrolase                             90.9    2e-18   
ref|WP_012519405.1|  nucleoside hydrolase                             90.9    2e-18   
ref|WP_015067793.1|  inosine-uridine nucleoside N-ribohydrolase       90.9    2e-18   
ref|WP_014980008.1|  MULTISPECIES: nucleoside hydrolase               90.9    2e-18   
ref|WP_014950381.1|  nucleoside hydrolase                             90.9    2e-18   
ref|WP_021817473.1|  nucleoside hydrolase                             90.9    2e-18   
ref|WP_007989586.1|  probable uridine nucleosidase 2                  90.5    2e-18   
ref|WP_039071113.1|  nucleoside hydrolase                             90.5    2e-18   
ref|WP_003387863.1|  nucleosidase                                     90.5    2e-18   
ref|WP_026499774.1|  nucleoside hydrolase                             90.5    2e-18   
ref|XP_008656012.1|  PREDICTED: probable uridine nucleosidase 2       87.4    2e-18   
ref|WP_033185791.1|  nucleoside hydrolase                             90.5    2e-18   
ref|WP_006994280.1|  probable uridine nucleosidase 2                  90.5    3e-18   
ref|WP_035832200.1|  hypothetical protein                             90.1    3e-18   
ref|WP_011576236.1|  nucleoside hydrolase                             90.1    3e-18   
ref|WP_031932291.1|  nucleoside hydrolase                             90.1    4e-18   
ref|WP_008843014.1|  probable uridine nucleosidase 2                  89.7    4e-18   
ref|WP_025256107.1|  nucleoside hydrolase                             89.7    4e-18   
ref|WP_005834466.1|  nucleosidase                                     89.7    4e-18   
ref|WP_035470878.1|  nucleoside hydrolase                             89.7    4e-18   
ref|WP_027834547.1|  nucleoside hydrolase                             89.4    5e-18   
ref|WP_013782977.1|  nucleoside hydrolase                             89.4    5e-18   
ref|WP_025843992.1|  nucleoside hydrolase                             89.4    5e-18   
ref|WP_007786210.1|  MULTISPECIES: Inosine-uridine nucleoside N-r...  89.4    5e-18   
ref|WP_016854881.1|  nucleoside hydrolase                             89.4    6e-18   
ref|WP_042135371.1|  nucleoside hydrolase                             89.4    6e-18   
ref|WP_027603072.1|  MULTISPECIES: nucleoside hydrolase               89.4    7e-18   
ref|WP_006006549.1|  nucleoside hydrolase                             89.0    7e-18   
ref|WP_044341084.1|  nucleoside hydrolase                             89.0    7e-18   
ref|WP_007161284.1|  nucleoside hydrolase                             89.0    7e-18   
ref|WP_027598236.1|  nucleoside hydrolase                             89.0    7e-18   
ref|WP_020827165.1|  nucleoside hydrolase                             89.0    8e-18   
ref|WP_029420925.1|  hypothetical protein                             89.0    8e-18   
ref|WP_024016759.1|  inosine-uridine nucleoside N-ribohydrolase       89.0    8e-18   
ref|WP_044057789.1|  nucleoside hydrolase                             89.0    9e-18   
ref|WP_036635153.1|  hypothetical protein                             88.6    1e-17   
ref|WP_042621633.1|  nucleoside hydrolase                             88.6    1e-17   
ref|WP_035598501.1|  nucleoside hydrolase                             88.6    1e-17   
ref|WP_020593377.1|  hypothetical protein                             88.2    1e-17   
ref|WP_026127024.1|  nucleoside hydrolase                             88.2    2e-17   
ref|WP_017639476.1|  nucleoside hydrolase                             88.2    2e-17   
ref|WP_027882180.1|  ribonucleoside hydrolase                         88.2    2e-17   
gb|EPS59486.1|  inosine-uridine preferring nucleoside hydrolase f...  83.6    2e-17   
ref|WP_044551685.1|  nucleoside hydrolase                             87.8    2e-17   
ref|WP_017250902.1|  nucleosidase                                     87.8    2e-17   
ref|WP_040725536.1|  nucleoside hydrolase                             87.8    2e-17   
ref|WP_034306579.1|  nucleoside hydrolase                             87.4    2e-17   
ref|WP_029719768.1|  nucleoside hydrolase                             87.4    2e-17   
ref|WP_040589766.1|  hypothetical protein                             87.4    3e-17   
ref|WP_036829325.1|  hydrolase                                        87.4    3e-17   
ref|WP_007727482.1|  Inosine-uridine nucleoside N-ribohydrolase       87.4    3e-17   
ref|WP_029097698.1|  nucleoside hydrolase                             87.0    3e-17   
gb|EPS62849.1|  uridine nucleosidase 1                                86.7    4e-17   
ref|WP_041730048.1|  hypothetical protein                             87.0    4e-17   
ref|WP_036659510.1|  nucleoside hydrolase                             87.0    4e-17   
ref|WP_015738055.1|  Inosine/uridine-preferring nucleoside hydrolase  86.7    4e-17   
ref|WP_005525756.1|  inosine-uridine nucleoside N-ribohydrolase       86.7    4e-17   
gb|ADB49063.1|  Inosine/uridine-preferring nucleoside hydrolase       86.7    4e-17   
ref|WP_005520808.1|  inosine-uridine nucleoside N-ribohydrolase       86.7    5e-17   
ref|WP_035300578.1|  nucleoside hydrolase                             86.7    5e-17   
ref|WP_015401139.1|  putative nucleoside hydrolase                    86.3    6e-17   
ref|WP_017893036.1|  nucleoside hydrolase                             86.3    7e-17   
ref|WP_012145407.1|  nucleoside hydrolase                             86.3    7e-17   
ref|WP_025745765.1|  nucleoside hydrolase                             86.3    8e-17   
ref|WP_036590725.1|  hypothetical protein                             84.7    8e-17   
emb|CEG24476.1|  purine nucleosidase                                  85.9    9e-17   
ref|WP_007198615.1|  inosine-uridine preferring nucleoside hydrolase  85.9    1e-16   
ref|WP_036698091.1|  nucleoside hydrolase                             85.5    1e-16   
ref|NP_595062.1|  uridine ribohydrolase (predicted)                   85.5    1e-16   
ref|WP_040646577.1|  hypothetical protein                             83.2    1e-16   
ref|WP_013332310.1|  nucleoside hydrolase                             85.5    1e-16   
ref|WP_026128421.1|  nucleoside hydrolase                             85.5    1e-16   
ref|WP_026124420.1|  nucleoside hydrolase                             85.5    1e-16   
ref|WP_025438060.1|  hypothetical protein                             85.1    2e-16   
emb|CEG28893.1|  purine nucleosidase                                  84.7    3e-16   
ref|WP_017598672.1|  nucleoside hydrolase                             84.3    3e-16   
ref|WP_017546888.1|  nucleoside hydrolase                             84.3    3e-16   
ref|WP_019086721.1|  hypothetical protein                             84.3    3e-16   
gb|EDN00703.1|  Inosine-uridine preferring nucleoside hydrolase       83.2    3e-16   
ref|WP_010509644.1|  hypothetical protein                             84.0    4e-16   
ref|WP_019091566.1|  hypothetical protein                             84.0    4e-16   
ref|WP_025484209.1|  hypothetical protein                             84.3    4e-16   
ref|WP_043569364.1|  nucleoside hydrolase                             84.0    4e-16   
ref|XP_004515537.1|  PREDICTED: probable uridine nucleosidase 1-like  81.3    4e-16   
ref|WP_007426571.1|  inosine-uridine preferring nucleoside hydrolase  84.0    5e-16   
ref|WP_026125306.1|  nucleoside hydrolase                             83.6    5e-16   
ref|WP_042282596.1|  nucleoside hydrolase                             83.6    5e-16   
ref|WP_017567904.1|  nucleoside hydrolase                             83.6    6e-16   
ref|WP_019007604.1|  hypothetical protein                             83.6    6e-16   
ref|WP_027214601.1|  nucleoside hydrolase                             83.6    6e-16   
ref|WP_027434330.1|  hypothetical protein                             83.6    6e-16   
ref|WP_017621610.1|  hypothetical protein                             83.6    6e-16   
emb|CEG28892.1|  inosine-uridine preferring nucleoside hydrolase      83.6    6e-16   
ref|WP_030455894.1|  nucleoside hydrolase                             83.6    6e-16   
ref|WP_019855893.1|  hypothetical protein                             83.6    7e-16   
emb|CDR35150.1|  Putative inosine/uridine-preferring nucleoside h...  83.6    7e-16   
ref|WP_041018711.1|  hypothetical protein                             83.2    8e-16   
ref|WP_018131327.1|  hypothetical protein                             83.2    9e-16   
ref|WP_017576040.1|  nucleoside hydrolase                             82.8    9e-16   
ref|WP_037485654.1|  hypothetical protein                             83.2    9e-16   
ref|WP_010677097.1|  hypothetical protein                             82.8    1e-15   
ref|WP_004072790.1|  hypothetical protein                             83.2    1e-15   
ref|WP_027091351.1|  nucleoside hydrolase                             82.8    1e-15   
ref|WP_006295702.1|  inosine-uridine nucleoside N-ribohydrolase       82.8    1e-15   
gb|AGH47494.1|  inosine/uridine-preferring nucleoside hydrolase       82.4    1e-15   
ref|WP_017593427.1|  hypothetical protein                             82.4    1e-15   
ref|WP_007637007.1|  probable uridine nucleosidase 2                  82.4    1e-15   
ref|WP_044049744.1|  nucleoside hydrolase                             82.4    1e-15   
ref|WP_031383487.1|  nucleoside hydrolase                             82.4    1e-15   
ref|WP_034787069.1|  nucleoside hydrolase                             82.4    2e-15   
ref|WP_030904507.1|  nucleoside hydrolase                             82.4    2e-15   
ref|WP_017616150.1|  nucleoside hydrolase                             82.4    2e-15   
ref|WP_025703070.1|  hypothetical protein                             82.4    2e-15   
ref|WP_013911738.1|  inosine-uridine nucleoside N-ribohydrolase       82.0    2e-15   
ref|WP_027845448.1|  nucleoside hydrolase                             82.0    2e-15   
ref|WP_023513619.1|  pyrimidine-specific ribonucleoside hydrolase...  82.0    2e-15   
ref|WP_029417329.1|  nucleoside hydrolase                             82.0    2e-15   
ref|WP_040241074.1|  nucleoside hydrolase                             82.0    2e-15   
ref|WP_009827560.1|  inosine-uridine preferring nucleoside hydrolase  82.0    2e-15   
ref|WP_034412605.1|  hypothetical protein                             80.9    2e-15   
ref|WP_017590355.1|  nucleoside hydrolase                             82.0    2e-15   
ref|WP_011507138.1|  MULTISPECIES: nucleoside hydrolase               82.0    2e-15   
ref|WP_042126214.1|  nucleoside hydrolase                             82.0    2e-15   
ref|WP_026116927.1|  nucleoside hydrolase                             81.6    2e-15   
ref|WP_031360948.1|  nucleoside hydrolase                             82.0    2e-15   
ref|WP_026117498.1|  nucleoside hydrolase                             81.6    2e-15   
gb|AFR07911.1|  inosine-uridine preferring nucleoside hydrolase       81.6    3e-15   
ref|WP_027236320.1|  nucleoside hydrolase                             81.6    3e-15   
ref|WP_041562187.1|  nucleoside hydrolase                             81.6    3e-15   
ref|WP_027777519.1|  nucleoside hydrolase                             81.6    3e-15   
ref|WP_019610171.1|  nucleoside hydrolase                             81.3    3e-15   
ref|WP_040275282.1|  nucleoside hydrolase                             81.3    4e-15   
ref|WP_013342644.1|  nucleoside hydrolase                             81.3    4e-15   
ref|WP_035376755.1|  hypothetical protein                             81.3    4e-15   
ref|WP_035559248.1|  nucleoside hydrolase                             81.3    4e-15   
ref|WP_035086343.1|  hypothetical protein                             81.3    4e-15   
ref|WP_007177989.1|  nucleoside hydrolase                             81.3    4e-15   
ref|WP_020068152.1|  nucleoside hydrolase                             81.3    4e-15   
gb|ETX03208.1|  hypothetical protein ETSY1_00890                      81.3    4e-15   
ref|WP_006781161.1|  hydrolase [                                      80.9    5e-15   
ref|WP_018581146.1|  inosine-uridine nucleoside N-ribohydrolase       80.9    5e-15   
ref|WP_006840100.1|  inosine-uridine nucleoside N-ribohydrolase       80.9    5e-15   
ref|WP_043618497.1|  nucleoside hydrolase                             80.9    6e-15   
ref|WP_025253045.1|  nucleoside hydrolase                             80.5    6e-15   
ref|WP_044521676.1|  nucleoside hydrolase                             80.5    6e-15   
ref|WP_035351077.1|  hypothetical protein                             80.9    6e-15   
ref|WP_034648315.1|  nucleoside hydrolase                             80.5    6e-15   
ref|WP_023515340.1|  pyrimidine-specific ribonucleoside hydrolase...  80.5    6e-15   
ref|WP_023635880.1|  inosine-uridine nucleoside N-ribohydrolase       80.9    6e-15   
ref|WP_014525923.1|  inosine-uridine nucleoside N-ribohydrolase       80.5    7e-15   
ref|WP_039685632.1|  nucleoside hydrolase                             80.5    7e-15   
ref|WP_029975250.1|  nucleoside hydrolase                             80.5    7e-15   
ref|WP_014873596.1|  MULTISPECIES: inosine-uridine preferring nuc...  80.5    7e-15   
ref|WP_014836515.1|  inosine-uridine nucleoside N-ribohydrolase       80.5    7e-15   
ref|WP_040978466.1|  hypothetical protein                             80.5    7e-15   
ref|WP_013156221.1|  nucleoside hydrolase                             80.5    7e-15   
ref|WP_006008936.1|  probable uridine nucleosidase 2                  80.5    7e-15   
ref|WP_024098354.1|  Inosine-uridine nucleoside N-ribohydrolase       80.5    7e-15   
ref|WP_039191446.1|  nucleoside hydrolase                             80.1    8e-15   
ref|WP_008558876.1|  inosine-uridine preferring nucleoside hydrolase  80.1    8e-15   
ref|WP_010396726.1|  hypothetical protein                             80.5    8e-15   
ref|WP_039173587.1|  nucleoside hydrolase                             80.1    8e-15   
ref|WP_039151186.1|  nucleoside hydrolase                             80.1    8e-15   
ref|WP_007911555.1|  Inosine/uridine-preferring nucleoside hydrolase  80.1    9e-15   
ref|WP_025694762.1|  hypothetical protein                             80.1    9e-15   
ref|WP_009946513.1|  nucleoside hydrolase                             80.1    1e-14   
ref|WP_027886636.1|  MULTISPECIES: ribonucleoside hydrolase           80.1    1e-14   
ref|WP_027876360.1|  ribonucleoside hydrolase                         80.1    1e-14   
ref|XP_011397565.1|  putative uridine nucleosidase 2                  79.7    1e-14   
ref|WP_026878181.1|  nucleoside hydrolase                             80.1    1e-14   
ref|WP_015868607.1|  uridine nucleosidase                             79.7    1e-14   
ref|WP_025654547.1|  hypothetical protein                             80.1    1e-14   
ref|WP_042206560.1|  hypothetical protein                             79.7    1e-14   
ref|WP_037892377.1|  nucleoside hydrolase                             80.1    1e-14   
ref|WP_009158179.1|  inosine-uridine preferring nucleoside hydrolase  79.7    1e-14   
ref|WP_010669135.1|  hypothetical protein                             79.7    1e-14   
ref|WP_036679333.1|  MULTISPECIES: nucleoside hydrolase               79.7    1e-14   
ref|WP_018565773.1|  nucleoside hydrolase                             80.1    1e-14   
emb|CDQ36116.1|  Non-specific ribonucleoside hydrolase RihC           79.7    1e-14   
ref|WP_025688215.1|  hypothetical protein                             79.7    1e-14   
ref|WP_027257807.1|  nucleoside hydrolase                             79.7    1e-14   
ref|WP_035120394.1|  nucleoside hydrolase                             79.7    2e-14   
ref|WP_034221696.1|  hypothetical protein                             79.3    2e-14   
ref|WP_019297386.1|  MULTISPECIES: inosine-uridine preferring nuc...  79.3    2e-14   
ref|WP_040170980.1|  nucleoside hydrolase                             79.0    2e-14   
gb|EDT10145.1|  Inosine/uridine-preferring nucleoside hydrolase       78.6    2e-14   
ref|WP_015844877.1|  inosine/uridine-preferring nucleoside hydrolase  79.3    2e-14   
ref|WP_040180438.1|  nucleoside hydrolase                             79.0    2e-14   
ref|WP_034626025.1|  nucleoside hydrolase                             79.3    2e-14   
ref|WP_037107240.1|  nucleoside hydrolase                             79.3    2e-14   
ref|WP_007819493.1|  inosine-uridine preferring nucleoside hydrolase  79.3    2e-14   
ref|WP_020487326.1|  nucleoside hydrolase                             79.0    2e-14   
ref|WP_024091404.1|  inosine-uridine preferring nucleoside hydrolase  79.0    2e-14   
ref|WP_042160752.1|  nucleoside hydrolase                             79.0    2e-14   
ref|WP_015236073.1|  inosine-uridine nucleoside N-ribohydrolase       79.0    2e-14   
ref|WP_008720638.1|  MULTISPECIES: nucleoside hydrolase               79.0    2e-14   
ref|WP_024324371.1|  nucleoside hydrolase                             79.0    3e-14   
gb|EYR65051.1|  nucleoside hydrolase                                  79.3    3e-14   
ref|WP_012067017.1|  MULTISPECIES: nucleoside hydrolase               79.0    3e-14   
ref|WP_029966702.1|  nucleoside hydrolase                             79.0    3e-14   
ref|WP_041309793.1|  hypothetical protein                             79.0    3e-14   
ref|WP_018021018.1|  inosine-uridine nucleoside N-ribohydrolase       79.0    3e-14   
ref|WP_024311014.1|  nucleoside hydrolase                             79.0    3e-14   
gb|ACZ07625.1|  Inosine/uridine-preferring nucleoside hydrolase       78.6    3e-14   
ref|WP_017997851.1|  hypothetical protein                             78.6    3e-14   
ref|WP_036612871.1|  nucleoside hydrolase                             78.6    3e-14   
ref|WP_042186741.1|  nucleoside hydrolase                             78.6    3e-14   
ref|WP_003472013.1|  nucleosidase                                     78.6    3e-14   
gb|EBA16004.1|  Inosine-uridine nucleoside N-ribohydrolase            78.6    3e-14   



>ref|XP_004246525.1| PREDICTED: probable uridine nucleosidase 1 [Solanum lycopersicum]
Length=334

 Score =   182 bits (462),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 125/147 (85%), Gaps = 4/147 (3%)
 Frame = +3

Query  141  MPISDGNSSAGVVEVYSSAGENREKiiidtdpgiddtVAILMAFQTPHLEILGLTTIFGN  320
            M I DG+    +V+  +S  + REKIIIDTDPGIDD++ ILMAFQTP +EI+GLTTIFGN
Sbjct  1    MSICDGD----LVDSNNSFAKQREKIIIDTDPGIDDSMTILMAFQTPEVEIIGLTTIFGN  56

Query  321  VTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKPRIADFVHGADGLGNLNVPPPKSK  500
            VTT++ATRNALLL E AG PDVPVAEGSPE LK G+PR+ADFVHG+DGLGNL +P P SK
Sbjct  57   VTTKDATRNALLLCEAAGYPDVPVAEGSPEPLKGGEPRVADFVHGSDGLGNLFLPSPNSK  116

Query  501  KIEQSASDFLVDKVSEFPSEVSILALG  581
            KI++SAS+FLV+KVSE+P EVSILALG
Sbjct  117  KIDKSASEFLVEKVSEYPGEVSILALG  143



>ref|XP_009366647.1| PREDICTED: uridine nucleosidase 1-like isoform X2 [Pyrus x bretschneideri]
Length=342

 Score =   181 bits (459),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 101/150 (67%), Positives = 125/150 (83%), Gaps = 0/150 (0%)
 Frame = +3

Query  132  ETVMPISDGNSSAGVVEVYSSAGENREKiiidtdpgiddtVAILMAFQTPHLEILGLTTI  311
            E+ M  S+G +  G  +   +    REK+IIDTDPGIDDT+AILMAFQ+P LEILG TTI
Sbjct  2    ESAMTNSNGVAVDGERDCVRANHLKREKLIIDTDPGIDDTMAILMAFQSPELEILGFTTI  61

Query  312  FGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKPRIADFVHGADGLGNLNVPPP  491
            FGNVTTE+ATRNALLL E+AG P +PVAEGSPE LK G PR+ADF+HG+DG+GNL++PPP
Sbjct  62   FGNVTTEDATRNALLLCEIAGHPGLPVAEGSPEPLKGGSPRVADFIHGSDGMGNLHLPPP  121

Query  492  KSKKIEQSASDFLVDKVSEFPSEVSILALG  581
            K+KKIE++A++FLVD +SE+P EVSILALG
Sbjct  122  KTKKIEKNAAEFLVDMISEYPGEVSILALG  151



>ref|XP_009621486.1| PREDICTED: probable uridine nucleosidase 1 [Nicotiana tomentosiformis]
Length=339

 Score =   180 bits (457),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 124/149 (83%), Gaps = 3/149 (2%)
 Frame = +3

Query  141  MPISDGNSSAGVVEV--YSSAGENREKiiidtdpgiddtVAILMAFQTPHLEILGLTTIF  314
            M   DG+   G V    YS A + REKIIIDTDPGIDD++AILMAFQTP +EI+GLTTIF
Sbjct  1    MSNCDGDLVDGFVTTNNYSFA-KQREKIIIDTDPGIDDSMAILMAFQTPEVEIIGLTTIF  59

Query  315  GNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKPRIADFVHGADGLGNLNVPPPK  494
            GNVTT++ATRNALLL E AG PDVPVAEGSPE LKRG+PR+ADFVHG+DGLGNL +P P 
Sbjct  60   GNVTTKDATRNALLLCETAGYPDVPVAEGSPEPLKRGEPRVADFVHGSDGLGNLFLPCPN  119

Query  495  SKKIEQSASDFLVDKVSEFPSEVSILALG  581
            SKK + SAS+FLV+KVSE+P EVSILALG
Sbjct  120  SKKNDNSASEFLVEKVSEYPGEVSILALG  148



>gb|KCW89213.1| hypothetical protein EUGRSUZ_A015182, partial [Eucalyptus grandis]
Length=180

 Score =   175 bits (443),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 83/110 (75%), Positives = 97/110 (88%), Gaps = 0/110 (0%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKP  431
            +AI MAFQ P +EILG TTIFGN TTE ATRNALLL E+AGRPDVPVAEGS E LK GKP
Sbjct  29   MAIFMAFQAPEVEILGFTTIFGNATTEAATRNALLLCEIAGRPDVPVAEGSHEPLKGGKP  88

Query  432  RIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             +ADFVHG+DG+GN+ +PPPK+KK+E+SAS+FLVDKVSEFP +VS+LALG
Sbjct  89   CVADFVHGSDGIGNICLPPPKAKKVEKSASEFLVDKVSEFPGQVSVLALG  138



>ref|XP_007204697.1| hypothetical protein PRUPE_ppa008281mg [Prunus persica]
 gb|EMJ05896.1| hypothetical protein PRUPE_ppa008281mg [Prunus persica]
Length=338

 Score =   179 bits (455),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 98/125 (78%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = +3

Query  207  REKiiidtdpgiddtVAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDV  386
            REK+IIDTDPGIDDT+AILMAFQTP LE+LGLTTIFGNVTTE+ATRNALLL E+AG P +
Sbjct  23   REKLIIDTDPGIDDTIAILMAFQTPELEVLGLTTIFGNVTTEDATRNALLLCEIAGHPSL  82

Query  387  PVAEGSPEALKRGKPRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVS  566
            PVAEGSPE LK G+PR+ADF+HG+DGLGN+ +PPP+ K+IE+SAS+FLVD VSE+P EVS
Sbjct  83   PVAEGSPEPLKGGRPRVADFIHGSDGLGNIFLPPPERKQIEKSASEFLVDMVSEYPGEVS  142

Query  567  ILALG  581
            ILALG
Sbjct  143  ILALG  147



>ref|XP_011019892.1| PREDICTED: uridine nucleosidase 1 [Populus euphratica]
 ref|XP_011019893.1| PREDICTED: uridine nucleosidase 1 [Populus euphratica]
 ref|XP_011019894.1| PREDICTED: uridine nucleosidase 1 [Populus euphratica]
Length=351

 Score =   180 bits (456),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/110 (78%), Positives = 101/110 (92%), Gaps = 0/110 (0%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKP  431
            +AILMAFQ+P LE+LGLTTIFGNV+TE+ATRNAL+L E+AGRPDVPVAEGSPE LK G P
Sbjct  52   MAILMAFQSPELEVLGLTTIFGNVSTEDATRNALILCEIAGRPDVPVAEGSPEPLKGGIP  111

Query  432  RIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
            R+ADFVHG+DGLGN  + PPK+KKI++SAS+FLVDKVSE+P EVSILALG
Sbjct  112  RVADFVHGSDGLGNTFLSPPKAKKIDKSASEFLVDKVSEYPGEVSILALG  161



>ref|XP_008241263.1| PREDICTED: uridine nucleosidase 1 [Prunus mume]
Length=338

 Score =   179 bits (454),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 98/125 (78%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = +3

Query  207  REKiiidtdpgiddtVAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDV  386
            REK+IIDTDPGIDDT+AILMAFQTP LE+LGLTTIFGNVTTE+ATRNALLL E+AG P +
Sbjct  23   REKLIIDTDPGIDDTMAILMAFQTPELEVLGLTTIFGNVTTEDATRNALLLCEIAGHPSL  82

Query  387  PVAEGSPEALKRGKPRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVS  566
            PVAEGSPE LK G+PR+ADF+HG+DGLGN+ +PPP+ KKIE++AS+FLVD VSE+P EVS
Sbjct  83   PVAEGSPEPLKGGRPRVADFIHGSDGLGNIFLPPPERKKIEKNASEFLVDMVSEYPGEVS  142

Query  567  ILALG  581
            ILALG
Sbjct  143  ILALG  147



>ref|XP_002283153.2| PREDICTED: uridine nucleosidase 1 [Vitis vinifera]
 emb|CBI30265.3| unnamed protein product [Vitis vinifera]
Length=342

 Score =   179 bits (454),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 102/151 (68%), Positives = 125/151 (83%), Gaps = 0/151 (0%)
 Frame = +3

Query  129  QETVMPISDGNSSAGVVEVYSSAGENREKiiidtdpgiddtVAILMAFQTPHLEILGLTT  308
             E VM  S G       +V S++    +K+IIDTDPGIDD++AILMAFQTP LEILGLTT
Sbjct  1    MECVMLSSHGGLCDASYDVVSNSPVQPDKVIIDTDPGIDDSMAILMAFQTPELEILGLTT  60

Query  309  IFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKPRIADFVHGADGLGNLNVPP  488
            +FGNVTT++ATRNALLL E+AGRPDVPVAEGS   LK G+PR+ADF+HG+DGLGN+ +P 
Sbjct  61   VFGNVTTKDATRNALLLCEIAGRPDVPVAEGSSGPLKGGEPRVADFIHGSDGLGNIFLPQ  120

Query  489  PKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
            PK+KKIE++A++FLVDKVSE+P EVSILALG
Sbjct  121  PKAKKIEKNAAEFLVDKVSEYPGEVSILALG  151



>ref|XP_006341119.1| PREDICTED: uridine nucleosidase 1-like isoform X2 [Solanum tuberosum]
Length=334

 Score =   177 bits (450),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 122/147 (83%), Gaps = 4/147 (3%)
 Frame = +3

Query  141  MPISDGNSSAGVVEVYSSAGENREKiiidtdpgiddtVAILMAFQTPHLEILGLTTIFGN  320
            M I DG+    +V   +S  + REKIIIDTDPGIDD++ ILMAFQTP +EI+GLTTIFGN
Sbjct  1    MSIYDGD----LVASNNSFAKQREKIIIDTDPGIDDSMTILMAFQTPEVEIIGLTTIFGN  56

Query  321  VTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKPRIADFVHGADGLGNLNVPPPKSK  500
            VTT+NATRNALLL E AG PDVPVAEGS E LK G+PR+ADFVHG+DGLGNL +P P SK
Sbjct  57   VTTKNATRNALLLCEAAGYPDVPVAEGSSEPLKGGEPRVADFVHGSDGLGNLFLPSPNSK  116

Query  501  KIEQSASDFLVDKVSEFPSEVSILALG  581
            KI++SAS+FLV+KV E+P EVSILALG
Sbjct  117  KIDKSASEFLVEKVCEYPGEVSILALG  143



>ref|XP_009366646.1| PREDICTED: uridine nucleosidase 1-like isoform X1 [Pyrus x bretschneideri]
Length=343

 Score =   178 bits (451),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 82/110 (75%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKP  431
            +AILMAFQ+P LEILG TTIFGNVTTE+ATRNALLL E+AG P +PVAEGSPE LK G P
Sbjct  43   MAILMAFQSPELEILGFTTIFGNVTTEDATRNALLLCEIAGHPGLPVAEGSPEPLKGGSP  102

Query  432  RIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
            R+ADF+HG+DG+GNL++PPPK+KKIE++A++FLVD +SE+P EVSILALG
Sbjct  103  RVADFIHGSDGMGNLHLPPPKTKKIEKNAAEFLVDMISEYPGEVSILALG  152



>emb|CDP15395.1| unnamed protein product [Coffea canephora]
Length=348

 Score =   177 bits (449),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 87/110 (79%), Positives = 99/110 (90%), Gaps = 0/110 (0%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKP  431
            +AILMAFQ+P L+ILGLTTI+GNVTTE ATRNALLL E+AG P VPVAEGSP  LK G+P
Sbjct  48   MAILMAFQSPDLDILGLTTIYGNVTTEGATRNALLLCEIAGYPGVPVAEGSPGPLKGGEP  107

Query  432  RIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             IADFVHG+DGLGN+ +PPPKSKKIE+SAS+FLVDKVSE+P EVSILALG
Sbjct  108  CIADFVHGSDGLGNIFLPPPKSKKIEKSASEFLVDKVSEYPGEVSILALG  157



>ref|XP_010049632.1| PREDICTED: uridine nucleosidase 1 [Eucalyptus grandis]
Length=328

 Score =   176 bits (445),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 83/110 (75%), Positives = 97/110 (88%), Gaps = 0/110 (0%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKP  431
            +AI MAFQ P +EILG TTIFGN TTE ATRNALLL E+AGRPDVPVAEGS E LK GKP
Sbjct  29   MAIFMAFQAPEVEILGFTTIFGNATTEAATRNALLLCEIAGRPDVPVAEGSHEPLKGGKP  88

Query  432  RIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             +ADFVHG+DG+GN+ +PPPK+KK+E+SAS+FLVDKVSEFP +VS+LALG
Sbjct  89   CVADFVHGSDGIGNICLPPPKAKKVEKSASEFLVDKVSEFPGQVSVLALG  138



>ref|XP_009796567.1| PREDICTED: probable uridine nucleosidase 1 [Nicotiana sylvestris]
Length=339

 Score =   176 bits (445),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 100/131 (76%), Positives = 117/131 (89%), Gaps = 0/131 (0%)
 Frame = +3

Query  189  SSAGENREKiiidtdpgiddtVAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREV  368
            +S  + REKIIIDTDPGIDD++AILMAFQTP +EI+GLTTIFGNVTT++ATRNALLL E 
Sbjct  18   NSFAKQREKIIIDTDPGIDDSMAILMAFQTPEVEIIGLTTIFGNVTTKDATRNALLLCEA  77

Query  369  AGRPDVPVAEGSPEALKRGKPRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSE  548
            AG PDVPVAEGSPE LK G+PR+ADFVHG+DGLGNL +P P SKK ++SAS+FLV+KVSE
Sbjct  78   AGYPDVPVAEGSPEPLKGGEPRVADFVHGSDGLGNLFLPSPNSKKNDKSASEFLVEKVSE  137

Query  549  FPSEVSILALG  581
            +P EVSILALG
Sbjct  138  YPGEVSILALG  148



>ref|XP_004249446.1| PREDICTED: uridine nucleosidase 1-like [Solanum lycopersicum]
Length=331

 Score =   175 bits (444),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 98/127 (77%), Positives = 113/127 (89%), Gaps = 0/127 (0%)
 Frame = +3

Query  201  ENREKiiidtdpgiddtVAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRP  380
            +NREKIIIDTDPGIDD++AILMAFQ+P +EILGLTTIFGN TT+ ATRNAL+L E AG P
Sbjct  14   KNREKIIIDTDPGIDDSMAILMAFQSPEVEILGLTTIFGNATTKAATRNALILCETAGYP  73

Query  381  DVPVAEGSPEALKRGKPRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSE  560
            D+PVAEGS E LKRG+P +ADFVHG+DGLGNL +P P S KIE+SAS+FLVDKVSE+P E
Sbjct  74   DIPVAEGSLETLKRGEPHVADFVHGSDGLGNLFLPSPNSNKIEKSASEFLVDKVSEYPGE  133

Query  561  VSILALG  581
            VSILALG
Sbjct  134  VSILALG  140



>ref|XP_007027686.1| Uridine-ribohydrolase 1 isoform 1 [Theobroma cacao]
 gb|EOY08188.1| Uridine-ribohydrolase 1 isoform 1 [Theobroma cacao]
Length=344

 Score =   175 bits (444),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 86/110 (78%), Positives = 99/110 (90%), Gaps = 0/110 (0%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKP  431
            +AILMAFQ+P LEILGLTTIFGNV TE+AT NALLL E+AG PDVPVAEGSPE LK G+P
Sbjct  44   MAILMAFQSPELEILGLTTIFGNVATEDATCNALLLCEIAGCPDVPVAEGSPEPLKGGRP  103

Query  432  RIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
            RIADFVHG+DGLGN+ +PP K+KK E+SAS+FLV+KVSE+P EVSILALG
Sbjct  104  RIADFVHGSDGLGNIFLPPQKTKKSEKSASEFLVEKVSEYPGEVSILALG  153



>ref|XP_010244373.1| PREDICTED: uridine nucleosidase 1-like [Nelumbo nucifera]
Length=337

 Score =   175 bits (443),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/110 (75%), Positives = 96/110 (87%), Gaps = 0/110 (0%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKP  431
            +AI MAFQ+P LE++GLT IFGNVTTE+ATRNALLL E+AGR DVPVAEGSPE LK GKP
Sbjct  37   MAIFMAFQSPELEVIGLTAIFGNVTTEDATRNALLLCEIAGRTDVPVAEGSPEPLKGGKP  96

Query  432  RIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
            R+ DF HG+DG+GN+ +PPPK  KI +SAS+FLVDKVSE+P EVSILALG
Sbjct  97   RVCDFAHGSDGMGNIYLPPPKENKIGKSASEFLVDKVSEYPGEVSILALG  146



>ref|XP_004303003.1| PREDICTED: uridine nucleosidase 1 [Fragaria vesca subsp. vesca]
Length=343

 Score =   175 bits (443),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/110 (75%), Positives = 101/110 (92%), Gaps = 0/110 (0%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKP  431
            +AILMAFQTP LEILGLTTIFGNVTTE+ATRNALLL E+AG+P +PVAEGS E LK G+P
Sbjct  43   MAILMAFQTPELEILGLTTIFGNVTTEDATRNALLLCEIAGQPGLPVAEGSHEPLKGGRP  102

Query  432  RIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
            R+ADF+HG+DGLGN+ +PPP++KKIE++A++FLVD VS++P EVSILALG
Sbjct  103  RVADFIHGSDGLGNVFIPPPETKKIEKNAAEFLVDTVSQYPGEVSILALG  152



>gb|KDO61100.1| hypothetical protein CISIN_1g019503mg [Citrus sinensis]
Length=260

 Score =   172 bits (436),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/110 (75%), Positives = 98/110 (89%), Gaps = 0/110 (0%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKP  431
            + ILMAFQTP LEILGLTTIFGNVTTE+ATRNAL L E+AG P VPVAEGSPE LK GKP
Sbjct  34   MTILMAFQTPELEILGLTTIFGNVTTEDATRNALTLCEMAGCPGVPVAEGSPEPLKGGKP  93

Query  432  RIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
            R+A+F HG+DG+GN+++ PPK+KK +++AS+FLVDKVSE+P EVSILALG
Sbjct  94   RVAEFAHGSDGMGNISLTPPKAKKCDKNASEFLVDKVSEYPGEVSILALG  143



>ref|XP_006341118.1| PREDICTED: uridine nucleosidase 1-like isoform X1 [Solanum tuberosum]
Length=337

 Score =   174 bits (440),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 84/110 (76%), Positives = 97/110 (88%), Gaps = 0/110 (0%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKP  431
            + ILMAFQTP +EI+GLTTIFGNVTT+NATRNALLL E AG PDVPVAEGS E LK G+P
Sbjct  37   MTILMAFQTPEVEIIGLTTIFGNVTTKNATRNALLLCEAAGYPDVPVAEGSSEPLKGGEP  96

Query  432  RIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
            R+ADFVHG+DGLGNL +P P SKKI++SAS+FLV+KV E+P EVSILALG
Sbjct  97   RVADFVHGSDGLGNLFLPSPNSKKIDKSASEFLVEKVCEYPGEVSILALG  146



>ref|XP_002309047.2| hypothetical protein POPTR_0006s08350g [Populus trichocarpa]
 gb|EEE92570.2| hypothetical protein POPTR_0006s08350g [Populus trichocarpa]
Length=300

 Score =   172 bits (436),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 83/110 (75%), Positives = 98/110 (89%), Gaps = 0/110 (0%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKP  431
            +AILMAFQ+P LE+LGLTTIFGNV+TE+ATRNALLL E+AGRPDVPVAEGSPE LK G P
Sbjct  1    MAILMAFQSPELEVLGLTTIFGNVSTEDATRNALLLCEIAGRPDVPVAEGSPEPLKGGIP  60

Query  432  RIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             + DF+HG+DGLGN  + PPK+KKI +SAS+FL+DKVSE+P EVSILALG
Sbjct  61   TVPDFIHGSDGLGNTFLSPPKAKKIGKSASEFLLDKVSEYPGEVSILALG  110



>gb|KDO61096.1| hypothetical protein CISIN_1g019503mg [Citrus sinensis]
Length=334

 Score =   172 bits (436),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/110 (75%), Positives = 98/110 (89%), Gaps = 0/110 (0%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKP  431
            + ILMAFQTP LEILGLTTIFGNVTTE+ATRNAL L E+AG P VPVAEGSPE LK GKP
Sbjct  34   MTILMAFQTPELEILGLTTIFGNVTTEDATRNALTLCEMAGCPGVPVAEGSPEPLKGGKP  93

Query  432  RIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
            R+A+F HG+DG+GN+++ PPK+KK +++AS+FLVDKVSE+P EVSILALG
Sbjct  94   RVAEFAHGSDGMGNISLTPPKAKKCDKNASEFLVDKVSEYPGEVSILALG  143



>ref|XP_006430245.1| hypothetical protein CICLE_v10012143mg [Citrus clementina]
 gb|ESR43485.1| hypothetical protein CICLE_v10012143mg [Citrus clementina]
Length=338

 Score =   172 bits (436),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/110 (75%), Positives = 98/110 (89%), Gaps = 0/110 (0%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKP  431
            + ILMAFQTP LEILGLTTIFGNVTTE+ATRNAL L E+AG P VPVAEGSPE LK GKP
Sbjct  38   MTILMAFQTPELEILGLTTIFGNVTTEDATRNALTLCEMAGCPGVPVAEGSPEPLKGGKP  97

Query  432  RIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
            R+A+F HG+DG+GN+++ PPK+KK +++AS+FLVDKVSE+P EVSILALG
Sbjct  98   RVAEFAHGSDGMGNISLTPPKAKKCDKNASEFLVDKVSEYPGEVSILALG  147



>ref|XP_006481808.1| PREDICTED: uridine nucleosidase 1-like [Citrus sinensis]
 gb|KDO61095.1| hypothetical protein CISIN_1g019503mg [Citrus sinensis]
Length=338

 Score =   172 bits (436),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/110 (75%), Positives = 98/110 (89%), Gaps = 0/110 (0%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKP  431
            + ILMAFQTP LEILGLTTIFGNVTTE+ATRNAL L E+AG P VPVAEGSPE LK GKP
Sbjct  38   MTILMAFQTPELEILGLTTIFGNVTTEDATRNALTLCEMAGCPGVPVAEGSPEPLKGGKP  97

Query  432  RIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
            R+A+F HG+DG+GN+++ PPK+KK +++AS+FLVDKVSE+P EVSILALG
Sbjct  98   RVAEFAHGSDGMGNISLTPPKAKKCDKNASEFLVDKVSEYPGEVSILALG  147



>gb|KDO61097.1| hypothetical protein CISIN_1g019503mg [Citrus sinensis]
Length=340

 Score =   172 bits (435),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/110 (75%), Positives = 98/110 (89%), Gaps = 0/110 (0%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKP  431
            + ILMAFQTP LEILGLTTIFGNVTTE+ATRNAL L E+AG P VPVAEGSPE LK GKP
Sbjct  34   MTILMAFQTPELEILGLTTIFGNVTTEDATRNALTLCEMAGCPGVPVAEGSPEPLKGGKP  93

Query  432  RIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
            R+A+F HG+DG+GN+++ PPK+KK +++AS+FLVDKVSE+P EVSILALG
Sbjct  94   RVAEFAHGSDGMGNISLTPPKAKKCDKNASEFLVDKVSEYPGEVSILALG  143



>ref|XP_009374743.1| PREDICTED: uridine nucleosidase 1-like [Pyrus x bretschneideri]
Length=338

 Score =   172 bits (435),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = +3

Query  207  REKiiidtdpgiddtVAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDV  386
            REK+IIDTDPGIDDT+AILMAFQ+P LEILG TT+FGNV TE+ATRNALLL E+AG P +
Sbjct  23   REKLIIDTDPGIDDTMAILMAFQSPELEILGFTTVFGNVATEDATRNALLLCEIAGHPGL  82

Query  387  PVAEGSPEALKRGKPRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVS  566
            PVAEGS E LK G+P +ADF+HG+DGLGNL++PPPK+KKIE++A++FLVD VSE+P EVS
Sbjct  83   PVAEGSHEPLKGGRPCVADFIHGSDGLGNLHLPPPKTKKIEKNAAEFLVDMVSEYPGEVS  142

Query  567  ILALG  581
            ILALG
Sbjct  143  ILALG  147



>gb|KDP42725.1| hypothetical protein JCGZ_23665 [Jatropha curcas]
Length=338

 Score =   171 bits (434),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 97/133 (73%), Positives = 114/133 (86%), Gaps = 0/133 (0%)
 Frame = +3

Query  183  VYSSAGENREKiiidtdpgiddtVAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLR  362
            V+S +    EK+IIDTDPGIDD++AILMAFQ+P LEILGLTTIFGNVTT +ATRNALLL 
Sbjct  15   VFSGSASLPEKLIIDTDPGIDDSMAILMAFQSPKLEILGLTTIFGNVTTTDATRNALLLC  74

Query  363  EVAGRPDVPVAEGSPEALKRGKPRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKV  542
            E+AG P VPVAEGSPE LK G PR+ADFVHG+DGLG + +P PK+ KIE++AS+FLVDKV
Sbjct  75   EIAGCPGVPVAEGSPEPLKGGTPRVADFVHGSDGLGEIFLPSPKATKIEKTASEFLVDKV  134

Query  543  SEFPSEVSILALG  581
            SE+P EV ILALG
Sbjct  135  SEYPGEVCILALG  147



>ref|XP_008808554.1| PREDICTED: uridine nucleosidase 1-like isoform X2 [Phoenix dactylifera]
Length=302

 Score =   169 bits (429),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 98/110 (89%), Gaps = 0/110 (0%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKP  431
            +AI+MAFQTP + +LGLTTIFGNV+TE+ATRNAL+L E+AGRPDVPVAEGS E LK GKP
Sbjct  37   MAIMMAFQTPEIAVLGLTTIFGNVSTEDATRNALILCEIAGRPDVPVAEGSHEPLKGGKP  96

Query  432  RIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
            R+ADF+HG+DGLGN+ +PPP  KK E++AS+FLVD VS++P +VSILALG
Sbjct  97   RVADFIHGSDGLGNIFLPPPVGKKSEKNASEFLVDTVSQYPGDVSILALG  146



>ref|XP_004974197.1| PREDICTED: probable uridine nucleosidase 1-like [Setaria italica]
Length=325

 Score =   170 bits (430),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 82/110 (75%), Positives = 98/110 (89%), Gaps = 0/110 (0%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKP  431
            + ILMAF+TP +EI+GLTTIFGNV+TE ATRNALLL E AG P+VPVAEGSPE LK GKP
Sbjct  25   MTILMAFRTPSVEIIGLTTIFGNVSTEGATRNALLLCERAGHPEVPVAEGSPEPLKGGKP  84

Query  432  RIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
            RIADFVHG+DG+GN+ +P P SKK+E+SA++FLV+KVSEFP EVS+LALG
Sbjct  85   RIADFVHGSDGIGNMFLPEPTSKKVEESAAEFLVNKVSEFPGEVSVLALG  134



>ref|XP_010683768.1| PREDICTED: probable uridine nucleosidase 1 [Beta vulgaris subsp. 
vulgaris]
Length=345

 Score =   171 bits (432),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 101/152 (66%), Positives = 124/152 (82%), Gaps = 1/152 (1%)
 Frame = +3

Query  126  LQETVMPISDGNSSAGVVEVYSSAGENREKiiidtdpgiddtVAILMAFQTPHLEILGLT  305
            ++E+VM  S    S     VY S+ + REK+IIDTDPGIDD++ ILMAFQT  ++I+GLT
Sbjct  4    IEESVMSDSHFGESISNGIVYDSSFK-REKLIIDTDPGIDDSMTILMAFQTQEVDIIGLT  62

Query  306  TIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKPRIADFVHGADGLGNLNVP  485
            T+FGNVTTE+AT+NALLL E+AGRP+VPVAEGS   LK G PR+ADFVHG+DGLGN+ +P
Sbjct  63   TVFGNVTTEDATKNALLLCEIAGRPEVPVAEGSLGPLKGGIPRVADFVHGSDGLGNIYLP  122

Query  486  PPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             P +KKIE+SA+ FLVDKVSEFP EVSILALG
Sbjct  123  APNAKKIEKSAAQFLVDKVSEFPGEVSILALG  154



>ref|XP_010271715.1| PREDICTED: uridine nucleosidase 1-like isoform X3 [Nelumbo nucifera]
Length=336

 Score =   170 bits (430),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/110 (76%), Positives = 95/110 (86%), Gaps = 0/110 (0%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKP  431
            +AI MAFQ   LE+LGLTTIFGNVTTE+ATRNALLL E+AGRPDVPVAEGS E LK GKP
Sbjct  37   MAIFMAFQLSDLEVLGLTTIFGNVTTEDATRNALLLCEIAGRPDVPVAEGSLEPLKGGKP  96

Query  432  RIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
            RIADFVHG+DG+GN+ + PPK KKI  +AS+FLVDKVSE P E+SILALG
Sbjct  97   RIADFVHGSDGMGNIFLAPPKEKKIGINASEFLVDKVSEHPGEISILALG  146



>ref|XP_008808553.1| PREDICTED: probable uridine nucleosidase 1 isoform X1 [Phoenix 
dactylifera]
Length=337

 Score =   169 bits (429),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 98/110 (89%), Gaps = 0/110 (0%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKP  431
            +AI+MAFQTP + +LGLTTIFGNV+TE+ATRNAL+L E+AGRPDVPVAEGS E LK GKP
Sbjct  37   MAIMMAFQTPEIAVLGLTTIFGNVSTEDATRNALILCEIAGRPDVPVAEGSHEPLKGGKP  96

Query  432  RIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
            R+ADF+HG+DGLGN+ +PPP  KK E++AS+FLVD VS++P +VSILALG
Sbjct  97   RVADFIHGSDGLGNIFLPPPVGKKSEKNASEFLVDTVSQYPGDVSILALG  146



>ref|XP_010271713.1| PREDICTED: uridine nucleosidase 1-like isoform X1 [Nelumbo nucifera]
Length=343

 Score =   169 bits (429),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 84/110 (76%), Positives = 95/110 (86%), Gaps = 0/110 (0%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKP  431
            +AI MAFQ   LE+LGLTTIFGNVTTE+ATRNALLL E+AGRPDVPVAEGS E LK GKP
Sbjct  37   MAIFMAFQLSDLEVLGLTTIFGNVTTEDATRNALLLCEIAGRPDVPVAEGSLEPLKGGKP  96

Query  432  RIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
            RIADFVHG+DG+GN+ + PPK KKI  +AS+FLVDKVSE P E+SILALG
Sbjct  97   RIADFVHGSDGMGNIFLAPPKEKKIGINASEFLVDKVSEHPGEISILALG  146



>ref|XP_010271714.1| PREDICTED: uridine nucleosidase 1-like isoform X2 [Nelumbo nucifera]
Length=337

 Score =   169 bits (429),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 84/110 (76%), Positives = 95/110 (86%), Gaps = 0/110 (0%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKP  431
            +AI MAFQ   LE+LGLTTIFGNVTTE+ATRNALLL E+AGRPDVPVAEGS E LK GKP
Sbjct  37   MAIFMAFQLSDLEVLGLTTIFGNVTTEDATRNALLLCEIAGRPDVPVAEGSLEPLKGGKP  96

Query  432  RIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
            RIADFVHG+DG+GN+ + PPK KKI  +AS+FLVDKVSE P E+SILALG
Sbjct  97   RIADFVHGSDGMGNIFLAPPKEKKIGINASEFLVDKVSEHPGEISILALG  146



>ref|XP_006659689.1| PREDICTED: probable uridine nucleosidase 1-like [Oryza brachyantha]
Length=324

 Score =   168 bits (426),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 98/110 (89%), Gaps = 0/110 (0%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKP  431
            + ILMAF+ P +EI+GLTTIFGNV+T+NATRNALLL E AG PDVPVAEGSPE LK G+P
Sbjct  24   MTILMAFRAPSVEIIGLTTIFGNVSTQNATRNALLLCERAGHPDVPVAEGSPEPLKGGEP  83

Query  432  RIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
            R+ADFVHG+DGLGNL +P P +KK+E+SA++F+V+KVS+FP EVS+LALG
Sbjct  84   RVADFVHGSDGLGNLFLPAPTTKKVEESAAEFMVNKVSQFPGEVSVLALG  133



>ref|XP_009133074.1| PREDICTED: uridine nucleosidase 1 [Brassica rapa]
Length=331

 Score =   167 bits (424),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 119/147 (81%), Gaps = 7/147 (5%)
 Frame = +3

Query  141  MPISDGNSSAGVVEVYSSAGENREKiiidtdpgiddtVAILMAFQTPHLEILGLTTIFGN  320
            M I +G  S G V V       REK+IIDTDPGIDD++AI+MAFQTP LEILGLTT+FGN
Sbjct  1    MEICNGGISNGDVLV-------REKLIIDTDPGIDDSMAIMMAFQTPELEILGLTTVFGN  53

Query  321  VTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKPRIADFVHGADGLGNLNVPPPKSK  500
            V+T++ATRNALLL EVAG PDVPVAEGS E LK G PR+ADFVHG +GLG ++VP P  K
Sbjct  54   VSTQDATRNALLLCEVAGFPDVPVAEGSSEPLKGGIPRVADFVHGKNGLGEVSVPLPSRK  113

Query  501  KIEQSASDFLVDKVSEFPSEVSILALG  581
            K E+SA++FLV+KVSE+P EV+ILALG
Sbjct  114  KCEKSAAEFLVEKVSEYPGEVTILALG  140



>gb|KJB62174.1| hypothetical protein B456_009G404900 [Gossypium raimondii]
Length=260

 Score =   165 bits (418),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 95/110 (86%), Gaps = 0/110 (0%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKP  431
            +AI MAFQ P  EILGLTTIFGNV TE+ATRNALLL E+AGRPDVPVA+GSPE L  G+P
Sbjct  44   MAIFMAFQNPEYEILGLTTIFGNVQTEDATRNALLLCEIAGRPDVPVAQGSPEPLTGGRP  103

Query  432  RIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             +ADFVHG+DGLGN+ + PPK+ K +++AS+FLV+KVSE+P EVSILALG
Sbjct  104  IVADFVHGSDGLGNILLSPPKTSKSDKAASEFLVEKVSEYPGEVSILALG  153



>ref|NP_001242310.1| uncharacterized protein LOC100787563 [Glycine max]
 gb|ACU21342.1| unknown [Glycine max]
Length=330

 Score =   167 bits (422),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 96/110 (87%), Gaps = 0/110 (0%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKP  431
            +AI MAFQ+P +E+LGLTTIFGN TTE +TRNALLL E+AGR ++PVA+GSPE LK G P
Sbjct  30   MAIFMAFQSPDVEVLGLTTIFGNTTTEVSTRNALLLCEIAGRENIPVAQGSPEPLKGGTP  89

Query  432  RIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
            R+ADFVHG DGLGN  +PPPK +KIE+SAS+FLV+KVSE+P EVS+LALG
Sbjct  90   RVADFVHGKDGLGNTFLPPPKGEKIEKSASEFLVEKVSEYPGEVSVLALG  139



>ref|XP_003574927.1| PREDICTED: probable uridine nucleosidase 1 [Brachypodium distachyon]
Length=327

 Score =   167 bits (422),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 98/110 (89%), Gaps = 0/110 (0%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKP  431
            + ILMAF+ P +EI+GLTTIFGNVTTENATRNALLL E AG P+VPVAEGSPE LK G P
Sbjct  27   MTILMAFEEPSVEIIGLTTIFGNVTTENATRNALLLCERAGHPEVPVAEGSPEPLKGGIP  86

Query  432  RIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
            R+ADFVHG+DGLGNL++P P +KK+E++A++F+V+KVSEFP E+++LALG
Sbjct  87   RVADFVHGSDGLGNLSLPAPTTKKVEENAAEFMVNKVSEFPGEITVLALG  136



>dbj|BAJ99745.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93219.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=324

 Score =   167 bits (422),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 97/110 (88%), Gaps = 0/110 (0%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKP  431
            + ILMAF  P +EI+GLTTIFGNVTTE ATRNALLL E AG P+VPVAEGSPE LK G+P
Sbjct  24   MTILMAFGEPSVEIIGLTTIFGNVTTEYATRNALLLCERAGHPEVPVAEGSPEPLKGGEP  83

Query  432  RIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
            R+ADFVHG+DGLGNL++P P SKK+E+SA++F+V+KVS+FP E+S+LALG
Sbjct  84   RVADFVHGSDGLGNLSLPAPTSKKVEESAAEFMVNKVSQFPGEISVLALG  133



>ref|XP_006603710.1| PREDICTED: uncharacterized protein LOC100787563 isoform X1 [Glycine 
max]
Length=330

 Score =   167 bits (422),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 96/110 (87%), Gaps = 0/110 (0%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKP  431
            +AI MAFQ+P +E+LGLTTIFGN TTE +TRNALLL E+AGR ++PVA+GSPE LK G P
Sbjct  30   MAIFMAFQSPDVEVLGLTTIFGNTTTEVSTRNALLLCEIAGRENIPVAQGSPEPLKGGTP  89

Query  432  RIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
            R+ADFVHG DGLGN  +PPPK +KIE+SAS+FLV+KVSE+P EVS+LALG
Sbjct  90   RVADFVHGKDGLGNTFLPPPKGEKIEKSASEFLVEKVSEYPGEVSVLALG  139



>ref|XP_009411962.1| PREDICTED: probable uridine nucleosidase 1 [Musa acuminata subsp. 
malaccensis]
Length=337

 Score =   167 bits (422),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 95/110 (86%), Gaps = 0/110 (0%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKP  431
            +AILMAFQ P +E+LGLTTIFGNV TE+AT NALLL E+AG P+VPVAEGS E LK GKP
Sbjct  37   MAILMAFQKPEIEVLGLTTIFGNVFTEDATSNALLLCEIAGHPEVPVAEGSHEPLKGGKP  96

Query  432  RIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
            R+ADF HG+DG GN+ +PPP  KKIE+SAS+FLVDKVS++P +VSILALG
Sbjct  97   RVADFAHGSDGFGNIFLPPPVGKKIEKSASEFLVDKVSQYPGDVSILALG  146



>emb|CDX84137.1| BnaC04g08990D [Brassica napus]
Length=339

 Score =   167 bits (422),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 97/151 (64%), Positives = 121/151 (80%), Gaps = 3/151 (2%)
 Frame = +3

Query  129  QETVMPISDGNSSAGVVEVYSSAGENREKiiidtdpgiddtVAILMAFQTPHLEILGLTT  308
             ++ M   +G  S G V   SS    REK+IIDTDPGIDD++AI+MAFQTP LEILGLTT
Sbjct  1    MDSTMENCNGGISNGDVSGLSS---KREKLIIDTDPGIDDSMAIMMAFQTPELEILGLTT  57

Query  309  IFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKPRIADFVHGADGLGNLNVPP  488
            +FGNV T++ATRNALLL E+AG PD+PVAEGS E LK G PR+ADFVHG +GLG+++VP 
Sbjct  58   VFGNVQTQDATRNALLLCEIAGFPDLPVAEGSSEPLKGGIPRVADFVHGKNGLGDVSVPS  117

Query  489  PKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
            P  KK ++SA++FLVDKVS+FP EV++LALG
Sbjct  118  PCRKKCDKSAAEFLVDKVSQFPGEVTVLALG  148



>gb|KJB62176.1| hypothetical protein B456_009G404900 [Gossypium raimondii]
Length=301

 Score =   166 bits (419),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 95/110 (86%), Gaps = 0/110 (0%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKP  431
            +AI MAFQ P  EILGLTTIFGNV TE+ATRNALLL E+AGRPDVPVA+GSPE L  G+P
Sbjct  1    MAIFMAFQNPEYEILGLTTIFGNVQTEDATRNALLLCEIAGRPDVPVAQGSPEPLTGGRP  60

Query  432  RIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             +ADFVHG+DGLGN+ + PPK+ K +++AS+FLV+KVSE+P EVSILALG
Sbjct  61   IVADFVHGSDGLGNILLSPPKTSKSDKAASEFLVEKVSEYPGEVSILALG  110



>gb|EMS49519.1| hypothetical protein TRIUR3_15036 [Triticum urartu]
Length=289

 Score =   165 bits (418),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 97/110 (88%), Gaps = 0/110 (0%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKP  431
            + ILMAF  P +EI+GLTTIFGNVTTE ATRNALLL E AG P+VPVAEGSPE LK G+P
Sbjct  24   MTILMAFGEPSVEIIGLTTIFGNVTTEYATRNALLLCERAGHPEVPVAEGSPEPLKGGEP  83

Query  432  RIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
            R+ADFVHG+DGLGNL++P P +KK+E+SA++F+V+KVS+FP E+S+LALG
Sbjct  84   RVADFVHGSDGLGNLSLPAPTTKKVEESAAEFMVNKVSQFPGEISVLALG  133



>ref|XP_010909808.1| PREDICTED: probable uridine nucleosidase 1 [Elaeis guineensis]
Length=337

 Score =   166 bits (421),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 95/110 (86%), Gaps = 0/110 (0%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKP  431
            +AI+MAFQTP +E+LGLTTIFGNV TE ATRNALLL E++G PDVPVAEGS E LK GKP
Sbjct  37   MAIMMAFQTPEIELLGLTTIFGNVITEYATRNALLLCEISGHPDVPVAEGSHEPLKGGKP  96

Query  432  RIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
            R+ADF+HG+DGLGN+ +PPP  KK E+SAS+FLVD VS+ P +VSILALG
Sbjct  97   RVADFIHGSDGLGNMFLPPPVGKKSEKSASEFLVDTVSQCPGDVSILALG  146



>emb|CDX75052.1| BnaA05g07980D [Brassica napus]
Length=339

 Score =   166 bits (420),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 95/151 (63%), Positives = 122/151 (81%), Gaps = 3/151 (2%)
 Frame = +3

Query  129  QETVMPISDGNSSAGVVEVYSSAGENREKiiidtdpgiddtVAILMAFQTPHLEILGLTT  308
             ++ M I +G  S G V   SS    REK+IIDTDPGIDD++AI+MAFQTP L+ILGLTT
Sbjct  1    MDSTMEICNGGISNGDVSGLSS---KREKLIIDTDPGIDDSMAIMMAFQTPELDILGLTT  57

Query  309  IFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKPRIADFVHGADGLGNLNVPP  488
            +FGNV T++ATRNALLL E+ G PD+PVAEGS E LK G PR+ADFVHG +GLG+++VP 
Sbjct  58   VFGNVQTQDATRNALLLCEIGGFPDLPVAEGSSEPLKGGIPRVADFVHGKNGLGDVSVPS  117

Query  489  PKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
            P SKK ++SA++FLV+KVS++P EV++LALG
Sbjct  118  PCSKKCDKSAAEFLVEKVSQYPGEVTVLALG  148



>ref|XP_002881439.1| inosine-uridine preferring nucleoside hydrolase family protein 
[Arabidopsis lyrata subsp. lyrata]
 gb|EFH57698.1| inosine-uridine preferring nucleoside hydrolase family protein 
[Arabidopsis lyrata subsp. lyrata]
Length=332

 Score =   166 bits (419),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = +3

Query  207  REKiiidtdpgiddtVAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDV  386
            REK+IIDTDPGIDD++AI+MAFQTP LEILGLTT+FGNV+T++ATRNALLL E+AG PDV
Sbjct  17   REKLIIDTDPGIDDSMAIMMAFQTPELEILGLTTVFGNVSTQDATRNALLLCEIAGFPDV  76

Query  387  PVAEGSPEALKRGKPRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVS  566
            PVAEGS E LK G PR+ADFVHG +GLG++++PPP  KK E+SA++FL +KVSE+P EV+
Sbjct  77   PVAEGSSEPLKGGIPRVADFVHGKNGLGDVSLPPPSRKKCEKSAAEFLDEKVSEYPGEVT  136

Query  567  ILALG  581
            ILALG
Sbjct  137  ILALG  141



>ref|XP_006577068.1| PREDICTED: uridine nucleosidase 1-like [Glycine max]
Length=314

 Score =   165 bits (418),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 96/110 (87%), Gaps = 0/110 (0%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKP  431
            +AILMAFQ+P +E+LGLTTIFGN TTE +T NALLL E+AGR D+PVA+GS E LK GKP
Sbjct  34   MAILMAFQSPDVEVLGLTTIFGNTTTELSTLNALLLCEMAGREDIPVAQGSHEPLKGGKP  93

Query  432  RIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
            R+ADFVHG DGLGN  +PPPK +KIE+SAS+FLV+KVSE+P EVS+LALG
Sbjct  94   RVADFVHGKDGLGNTFLPPPKGEKIEKSASEFLVEKVSEYPGEVSVLALG  143



>gb|KJB62175.1| hypothetical protein B456_009G404900 [Gossypium raimondii]
Length=344

 Score =   166 bits (419),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 95/110 (86%), Gaps = 0/110 (0%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKP  431
            +AI MAFQ P  EILGLTTIFGNV TE+ATRNALLL E+AGRPDVPVA+GSPE L  G+P
Sbjct  44   MAIFMAFQNPEYEILGLTTIFGNVQTEDATRNALLLCEIAGRPDVPVAQGSPEPLTGGRP  103

Query  432  RIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             +ADFVHG+DGLGN+ + PPK+ K +++AS+FLV+KVSE+P EVSILALG
Sbjct  104  IVADFVHGSDGLGNILLSPPKTSKSDKAASEFLVEKVSEYPGEVSILALG  153



>ref|XP_009393379.1| PREDICTED: uridine nucleosidase 1-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=276

 Score =   164 bits (414),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 96/110 (87%), Gaps = 0/110 (0%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKP  431
            +AILMAFQ P +EILGLTTIFGNV+TE+AT NALLL E+AG P+VPVAEGS E LK GKP
Sbjct  37   MAILMAFQKPEIEILGLTTIFGNVSTEDATCNALLLCEIAGHPEVPVAEGSHEPLKGGKP  96

Query  432  RIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             +ADFVHG+DGLGN+ +PPP  K+IE++AS+FLV+KVS++P +V ILALG
Sbjct  97   HVADFVHGSDGLGNIFLPPPLGKQIEKTASEFLVEKVSQYPGDVCILALG  146



>ref|XP_008801224.1| PREDICTED: probable uridine nucleosidase 1 isoform X4 [Phoenix 
dactylifera]
 ref|XP_008801225.1| PREDICTED: probable uridine nucleosidase 1 isoform X4 [Phoenix 
dactylifera]
Length=301

 Score =   164 bits (416),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 96/110 (87%), Gaps = 0/110 (0%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKP  431
            + I+MAFQTP +E+LGLTTIFGNV+TE+ATRNALLL E+AG P+V VAEGS E LK GKP
Sbjct  1    MTIMMAFQTPEIEVLGLTTIFGNVSTEDATRNALLLCEIAGHPNVLVAEGSDEPLKGGKP  60

Query  432  RIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
            R+ADFVHG+DGLGN+  PPP  KK E+SAS+FLV+KVS++P +VSILALG
Sbjct  61   RVADFVHGSDGLGNIFHPPPAGKKSEKSASEFLVEKVSQYPGDVSILALG  110



>emb|CDX84566.1| BnaA03g16640D [Brassica napus]
Length=331

 Score =   165 bits (417),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 118/147 (80%), Gaps = 7/147 (5%)
 Frame = +3

Query  141  MPISDGNSSAGVVEVYSSAGENREKiiidtdpgiddtVAILMAFQTPHLEILGLTTIFGN  320
            M I +G  S G V V       REK+IIDTDPGIDD++AI+MAFQTP LEILGLTT+FGN
Sbjct  1    MEICNGGISNGDVLV-------REKLIIDTDPGIDDSMAIMMAFQTPELEILGLTTVFGN  53

Query  321  VTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKPRIADFVHGADGLGNLNVPPPKSK  500
            V+T++ATRNALLL E+AG PDVPVAEGS E LK G PR+ADFVHG +GLG ++VP P  K
Sbjct  54   VSTQDATRNALLLCEIAGFPDVPVAEGSSEPLKGGIPRVADFVHGKNGLGEVSVPLPSRK  113

Query  501  KIEQSASDFLVDKVSEFPSEVSILALG  581
            K E+SA++FLV+KVSE P EV+ILALG
Sbjct  114  KCEKSAAEFLVEKVSEHPGEVTILALG  140



>ref|XP_006410804.1| hypothetical protein EUTSA_v10016893mg [Eutrema salsugineum]
 gb|ESQ52257.1| hypothetical protein EUTSA_v10016893mg [Eutrema salsugineum]
Length=339

 Score =   165 bits (417),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = +3

Query  207  REKiiidtdpgiddtVAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDV  386
            REK+IIDTDPGIDD++AILMAFQTP LEILGLTT+FGNV+T++ATRNALLL E+AG PDV
Sbjct  24   REKLIIDTDPGIDDSMAILMAFQTPELEILGLTTVFGNVSTQDATRNALLLCEIAGFPDV  83

Query  387  PVAEGSPEALKRGKPRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVS  566
            PVAEG  E +K G PR+ADFVHG +GLG+++VP P S+K E+SA++FLV+KVSE+P EV+
Sbjct  84   PVAEGCSEPVKGGIPRVADFVHGTNGLGDVSVPLPSSEKCEKSAAEFLVEKVSEYPGEVT  143

Query  567  ILALG  581
            ILALG
Sbjct  144  ILALG  148



>ref|XP_008801223.1| PREDICTED: probable uridine nucleosidase 1 isoform X3 [Phoenix 
dactylifera]
Length=330

 Score =   165 bits (417),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 96/110 (87%), Gaps = 0/110 (0%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKP  431
            + I+MAFQTP +E+LGLTTIFGNV+TE+ATRNALLL E+AG P+V VAEGS E LK GKP
Sbjct  65   MTIMMAFQTPEIEVLGLTTIFGNVSTEDATRNALLLCEIAGHPNVLVAEGSDEPLKGGKP  124

Query  432  RIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
            R+ADFVHG+DGLGN+  PPP  KK E+SAS+FLV+KVS++P +VSILALG
Sbjct  125  RVADFVHGSDGLGNIFHPPPAGKKSEKSASEFLVEKVSQYPGDVSILALG  174



>gb|KHN02239.1| Uridine nucleosidase 1 [Glycine soja]
Length=330

 Score =   164 bits (416),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 95/110 (86%), Gaps = 0/110 (0%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKP  431
            +AI MAFQ+P +E+LGLTTIFGN TTE +TRNALLL E+AG  ++PVA+GSPE LK G P
Sbjct  30   MAIFMAFQSPDVEVLGLTTIFGNTTTEVSTRNALLLCEIAGHENIPVAQGSPEPLKGGTP  89

Query  432  RIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
            R+ADFVHG DGLGN  +PPPK +KIE+SAS+FLV+KVSE+P EVS+LALG
Sbjct  90   RVADFVHGKDGLGNTFLPPPKGEKIEKSASEFLVEKVSEYPGEVSVLALG  139



>ref|XP_004956207.1| PREDICTED: probable uridine nucleosidase 2-like [Setaria italica]
Length=333

 Score =   165 bits (417),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 96/110 (87%), Gaps = 0/110 (0%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKP  431
            VAI+MAFQ+P +++LGLTTIFGN TTE+ATRNAL+L E AG P+VPVAEGS E LK GKP
Sbjct  33   VAIMMAFQSPGVQVLGLTTIFGNCTTEHATRNALILCEKAGHPEVPVAEGSHEPLKGGKP  92

Query  432  RIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
            ++A FVHG+DGLGN+ +P P  KK+EQSA++FLVDKVS+FP EVS+LALG
Sbjct  93   KVAAFVHGSDGLGNIELPDPTIKKVEQSAAEFLVDKVSQFPGEVSVLALG  142



>tpg|DAA48674.1| TPA: hypothetical protein ZEAMMB73_378734 [Zea mays]
Length=246

 Score =   162 bits (410),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 95/110 (86%), Gaps = 0/110 (0%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKP  431
            + ILMAF+ P +EI+GLTTIFGNV T+ ATRNALLL E AG P+VPVAEGS E LK GKP
Sbjct  25   MTILMAFRAPSVEIIGLTTIFGNVDTKGATRNALLLCERAGCPEVPVAEGSHEPLKGGKP  84

Query  432  RIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
            R+ADFVHG+DG+GNL +P P +KK+E+SA+DFL++KVSEFP EVS+LALG
Sbjct  85   RVADFVHGSDGIGNLFLPAPSAKKVEESAADFLINKVSEFPGEVSVLALG  134



>gb|ABK24733.1| unknown [Picea sitchensis]
Length=339

 Score =   165 bits (417),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKP  431
            + ILMAFQ P  E++GLTTIFGNV T++ATRNAL L EVAG PD+PVAEG PE LKRG P
Sbjct  39   ITILMAFQLPEFEVIGLTTIFGNVLTKDATRNALHLCEVAGFPDIPVAEGCPEPLKRGPP  98

Query  432  RIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             IADF+HG+DGLGN   PPPK+KKI+++A +FLVDKVSE+P EV+ILALG
Sbjct  99   FIADFIHGSDGLGNTLPPPPKNKKIDKNACEFLVDKVSEYPGEVTILALG  148



>gb|ACJ84669.1| unknown [Medicago truncatula]
Length=163

 Score =   159 bits (403),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 94/110 (85%), Gaps = 0/110 (0%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKP  431
            +AILMAF  P +E++GLTT+FGN  TE+ATRNALLL E+AGR +VPVAEGS E LK G+P
Sbjct  34   MAILMAFHCPEVEVIGLTTVFGNAQTEDATRNALLLCEIAGRQNVPVAEGSTEPLKGGRP  93

Query  432  RIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
            R+ADFVHG DGLGNL +P PK+ KI++SAS+FLV+KVSE P EV++LALG
Sbjct  94   RVADFVHGKDGLGNLFLPDPKTNKIDKSASEFLVEKVSESPGEVTVLALG  143



>ref|XP_010552831.1| PREDICTED: uridine nucleosidase 1 [Tarenaya hassleriana]
Length=335

 Score =   164 bits (416),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 96/147 (65%), Positives = 120/147 (82%), Gaps = 3/147 (2%)
 Frame = +3

Query  141  MPISDGNSSAGVVEVYSSAGENREKiiidtdpgiddtVAILMAFQTPHLEILGLTTIFGN  320
            M I +G    G +   S     REK+IIDTDPGIDD++AILMAFQTP LE+LGLTTIFGN
Sbjct  1    MEICNGGIQNGCLLASSP---KREKLIIDTDPGIDDSMAILMAFQTPVLEVLGLTTIFGN  57

Query  321  VTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKPRIADFVHGADGLGNLNVPPPKSK  500
            V+T++ATRNALLL E+AG P+VPVAEGS   LK G PR+ADFVHG++GLGN+++P P +K
Sbjct  58   VSTQDATRNALLLCEIAGFPEVPVAEGSSGPLKGGIPRVADFVHGSNGLGNISLPLPSAK  117

Query  501  KIEQSASDFLVDKVSEFPSEVSILALG  581
            K E+SAS+FLV+KVSE+P EV++LALG
Sbjct  118  KCEKSASEFLVEKVSEYPGEVTVLALG  144



>ref|XP_008801222.1| PREDICTED: probable uridine nucleosidase 1 isoform X2 [Phoenix 
dactylifera]
Length=338

 Score =   164 bits (416),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 96/110 (87%), Gaps = 0/110 (0%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKP  431
            + I+MAFQTP +E+LGLTTIFGNV+TE+ATRNALLL E+AG P+V VAEGS E LK GKP
Sbjct  38   MTIMMAFQTPEIEVLGLTTIFGNVSTEDATRNALLLCEIAGHPNVLVAEGSDEPLKGGKP  97

Query  432  RIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
            R+ADFVHG+DGLGN+  PPP  KK E+SAS+FLV+KVS++P +VSILALG
Sbjct  98   RVADFVHGSDGLGNIFHPPPAGKKSEKSASEFLVEKVSQYPGDVSILALG  147



>emb|CDX79669.1| BnaC03g20050D [Brassica napus]
Length=335

 Score =   164 bits (415),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = +3

Query  207  REKiiidtdpgiddtVAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDV  386
            REK+IIDTDPGIDD++AI+MAFQTP LEILGLTT+FGNV+T++ATRNALLL EVAG PDV
Sbjct  20   REKLIIDTDPGIDDSMAIMMAFQTPELEILGLTTVFGNVSTQDATRNALLLCEVAGFPDV  79

Query  387  PVAEGSPEALKRGKPRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVS  566
            PVAEGS E LK G PR+ADFVHG +GLG ++VP P  KK ++SA++FLV+KVSE+P EV+
Sbjct  80   PVAEGSSEPLKGGIPRVADFVHGKNGLGEVSVPLPSRKKCDKSAAEFLVEKVSEYPGEVT  139

Query  567  ILALG  581
            ILALG
Sbjct  140  ILALG  144



>ref|XP_008801221.1| PREDICTED: probable uridine nucleosidase 1 isoform X1 [Phoenix 
dactylifera]
Length=365

 Score =   165 bits (417),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 96/110 (87%), Gaps = 0/110 (0%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKP  431
            + I+MAFQTP +E+LGLTTIFGNV+TE+ATRNALLL E+AG P+V VAEGS E LK GKP
Sbjct  65   MTIMMAFQTPEIEVLGLTTIFGNVSTEDATRNALLLCEIAGHPNVLVAEGSDEPLKGGKP  124

Query  432  RIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
            R+ADFVHG+DGLGN+  PPP  KK E+SAS+FLV+KVS++P +VSILALG
Sbjct  125  RVADFVHGSDGLGNIFHPPPAGKKSEKSASEFLVEKVSQYPGDVSILALG  174



>ref|XP_010516843.1| PREDICTED: uridine nucleosidase 1-like [Camelina sativa]
Length=339

 Score =   164 bits (415),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 116/142 (82%), Gaps = 0/142 (0%)
 Frame = +3

Query  156  GNSSAGVVEVYSSAGENREKiiidtdpgiddtVAILMAFQTPHLEILGLTTIFGNVTTEN  335
            G S+  V  +       REK+IIDTDPGIDD++AI+MAFQTP LEILGLTT+FGNVTT++
Sbjct  7    GISNGDVFGISFGISSKREKLIIDTDPGIDDSMAIMMAFQTPELEILGLTTVFGNVTTQD  66

Query  336  ATRNALLLREVAGRPDVPVAEGSPEALKRGKPRIADFVHGADGLGNLNVPPPKSKKIEQS  515
            ATRNALLL E+AG PDVPVAEG+ E LK G PR+ADFVHG +GLG++++PPP   K E+S
Sbjct  67   ATRNALLLCEIAGFPDVPVAEGTSEPLKGGIPRVADFVHGKNGLGDVSLPPPSITKSEKS  126

Query  516  ASDFLVDKVSEFPSEVSILALG  581
            A++FL +KVSEFP EV+ILALG
Sbjct  127  AAEFLDEKVSEFPGEVTILALG  148



>ref|XP_009393378.1| PREDICTED: probable uridine nucleosidase 1 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=337

 Score =   164 bits (414),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 96/110 (87%), Gaps = 0/110 (0%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKP  431
            +AILMAFQ P +EILGLTTIFGNV+TE+AT NALLL E+AG P+VPVAEGS E LK GKP
Sbjct  37   MAILMAFQKPEIEILGLTTIFGNVSTEDATCNALLLCEIAGHPEVPVAEGSHEPLKGGKP  96

Query  432  RIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             +ADFVHG+DGLGN+ +PPP  K+IE++AS+FLV+KVS++P +V ILALG
Sbjct  97   HVADFVHGSDGLGNIFLPPPLGKQIEKTASEFLVEKVSQYPGDVCILALG  146



>gb|KHG09677.1| Uridine nucleosidase 1 -like protein [Gossypium arboreum]
Length=344

 Score =   164 bits (415),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 90/126 (71%), Positives = 108/126 (86%), Gaps = 0/126 (0%)
 Frame = +3

Query  204  NREKiiidtdpgiddtVAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPD  383
            NR K+IIDTDPGIDD++AI MAFQ P  EILGLTTIFGNV TE+ATRNALLL E+AGRPD
Sbjct  28   NRNKLIIDTDPGIDDSMAIFMAFQNPEYEILGLTTIFGNVQTEDATRNALLLCEIAGRPD  87

Query  384  VPVAEGSPEALKRGKPRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEV  563
            VPV +GSPE L  G+P +ADFVHG+DGLGN+ + PPK+ K +++AS+FLV KVSE+P +V
Sbjct  88   VPVVQGSPEPLTGGRPNVADFVHGSDGLGNIFLSPPKTSKSDKTASEFLVGKVSEYPGKV  147

Query  564  SILALG  581
            SILALG
Sbjct  148  SILALG  153



>ref|XP_002461988.1| hypothetical protein SORBIDRAFT_02g011950 [Sorghum bicolor]
 gb|EER98509.1| hypothetical protein SORBIDRAFT_02g011950 [Sorghum bicolor]
Length=417

 Score =   166 bits (419),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 95/110 (86%), Gaps = 0/110 (0%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKP  431
            VAI+MAFQ P +++LGLTTIFGN TTE+ATRNAL+L E AG P+VPVAEGS E LK GKP
Sbjct  117  VAIMMAFQLPGVQVLGLTTIFGNCTTEHATRNALILCEKAGHPEVPVAEGSHEPLKGGKP  176

Query  432  RIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             +ADFVHG+DGLGN+ +P P  KK+E+SA+DFLVDKVS+FP EVS+LALG
Sbjct  177  HVADFVHGSDGLGNIVLPDPTIKKVEESAADFLVDKVSQFPGEVSVLALG  226



>ref|XP_010509488.1| PREDICTED: uridine nucleosidase 1 [Camelina sativa]
Length=339

 Score =   163 bits (413),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = +3

Query  207  REKiiidtdpgiddtVAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDV  386
            REK+IIDTDPGIDD++AI+MAFQTP LEILGLTT+FGNVTT++ATRNALLL E+AG PDV
Sbjct  24   REKLIIDTDPGIDDSMAIMMAFQTPELEILGLTTVFGNVTTQDATRNALLLCEIAGFPDV  83

Query  387  PVAEGSPEALKRGKPRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVS  566
            PVAEG+ E LK G PR+ADFVHG +GLG++++PPP   K E+SA++FL +KVSEFP EV+
Sbjct  84   PVAEGTSEPLKGGIPRVADFVHGKNGLGDVSLPPPSITKSEKSAAEFLDEKVSEFPGEVT  143

Query  567  ILALG  581
            ILALG
Sbjct  144  ILALG  148



>tpg|DAA39615.1| TPA: hypothetical protein ZEAMMB73_210413 [Zea mays]
Length=203

 Score =   159 bits (402),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 92/110 (84%), Gaps = 0/110 (0%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKP  431
            VAILMAFQ P +++LGLTTIFGN TTE+ATRNAL+L E A   +VPVAEGS E LK GKP
Sbjct  15   VAILMAFQMPGVQVLGLTTIFGNCTTEHATRNALILCEKASHLEVPVAEGSHEPLKGGKP  74

Query  432  RIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             +ADFVHG DGLGN+++P P  KK+E+SA+DFLVDKVS FP EVS+LALG
Sbjct  75   HVADFVHGPDGLGNVDLPDPTIKKVEESATDFLVDKVSRFPGEVSVLALG  124



>ref|XP_004143313.1| PREDICTED: uridine nucleosidase 1-like [Cucumis sativus]
 ref|XP_004156258.1| PREDICTED: uridine nucleosidase 1-like [Cucumis sativus]
 gb|KGN48254.1| hypothetical protein Csa_6G452060 [Cucumis sativus]
Length=332

 Score =   162 bits (411),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 81/110 (74%), Positives = 91/110 (83%), Gaps = 0/110 (0%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKP  431
            + I MAFQ+P LEILGLTT+FGNV  E+AT NALLL E+AGR DVPVAEGS E LK G P
Sbjct  32   MTIFMAFQSPGLEILGLTTVFGNVFIEDATNNALLLCEMAGRSDVPVAEGSAEPLKGGTP  91

Query  432  RIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             IADFVHG+DGLGNLN+P P SKKIE+SAS+FLV  VS+ P EVSILALG
Sbjct  92   HIADFVHGSDGLGNLNLPSPSSKKIEKSASEFLVKTVSQHPGEVSILALG  141



>ref|NP_565843.1| Uridine nucleosidase 1 [Arabidopsis thaliana]
 sp|Q9SJM7.2|URH1_ARATH RecName: Full=Uridine nucleosidase 1; AltName: Full=Uridine ribohydrolase 
1 [Arabidopsis thaliana]
 gb|AAL06843.1| At2g36310/F2H17.8 [Arabidopsis thaliana]
 gb|AAL47407.1| At2g36310/F2H17.8 [Arabidopsis thaliana]
 gb|AAD21435.2| expressed protein [Arabidopsis thaliana]
 gb|AAM63615.1| unknown [Arabidopsis thaliana]
 gb|AEC09231.1| Uridine nucleosidase 1 [Arabidopsis thaliana]
Length=336

 Score =   162 bits (411),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 96/110 (87%), Gaps = 0/110 (0%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKP  431
            +AILMAFQTP LEILGLTT+FGNV+T++ATRNALLL E+AG PDVPVAEGS E LK G P
Sbjct  36   MAILMAFQTPELEILGLTTVFGNVSTQDATRNALLLCEIAGFPDVPVAEGSSEPLKGGIP  95

Query  432  RIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
            R+ADFVHG +GLG++++PPP  KK E+SA++FL +KV E+P EV+ILALG
Sbjct  96   RVADFVHGKNGLGDVSLPPPSRKKSEKSAAEFLDEKVEEYPGEVTILALG  145



>ref|XP_010943708.1| PREDICTED: probable uridine nucleosidase 1 [Elaeis guineensis]
Length=337

 Score =   162 bits (411),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 95/110 (86%), Gaps = 0/110 (0%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKP  431
            + I+MAFQTP +E+LGLTTIFGNV+ E+AT NALLL E+AGRPDV VAEGS E LK GKP
Sbjct  37   MTIMMAFQTPEIEVLGLTTIFGNVSAEDATSNALLLCEIAGRPDVLVAEGSHEPLKGGKP  96

Query  432  RIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
            R+ADFVHG+DGLGN+  PPP  KK E+SAS+FLV+K+S++P +VSILALG
Sbjct  97   RVADFVHGSDGLGNIFHPPPVGKKSEKSASEFLVEKISQYPGDVSILALG  146



>ref|NP_001266933.1| pyrimidine-specific ribonucleoside hydrolase rihA [Zea mays]
 gb|ACG36517.1| pyrimidine-specific ribonucleoside hydrolase rihA [Zea mays]
 gb|AFD54993.1| nucleoside N-ribohydrolase 2b [Zea mays subsp. mays]
 tpg|DAA48673.1| TPA: putative inosine-uridine preferring nucleoside hydrolase 
[Zea mays]
Length=325

 Score =   162 bits (410),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 95/110 (86%), Gaps = 0/110 (0%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKP  431
            + ILMAF+ P +EI+GLTTIFGNV T+ ATRNALLL E AG P+VPVAEGS E LK GKP
Sbjct  25   MTILMAFRAPSVEIIGLTTIFGNVDTKGATRNALLLCERAGCPEVPVAEGSHEPLKGGKP  84

Query  432  RIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
            R+ADFVHG+DG+GNL +P P +KK+E+SA+DFL++KVSEFP EVS+LALG
Sbjct  85   RVADFVHGSDGIGNLFLPAPSAKKVEESAADFLINKVSEFPGEVSVLALG  134



>gb|AFW61723.1| hypothetical protein ZEAMMB73_926916 [Zea mays]
Length=296

 Score =   161 bits (407),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 94/110 (85%), Gaps = 0/110 (0%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKP  431
            +AILMAF+   LEI+GLTTIFGNV TE AT NALLL E AG P+VPVAEGS E LK GKP
Sbjct  25   MAILMAFRAHTLEIIGLTTIFGNVDTEGATCNALLLCERAGHPEVPVAEGSHEPLKGGKP  84

Query  432  RIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
            RIADFVHG+DG+GNL +P P +KK+E+SA+DF+V+KVSEFP EVS+LALG
Sbjct  85   RIADFVHGSDGIGNLFLPAPSAKKVEESAADFMVNKVSEFPGEVSVLALG  134



>ref|XP_011094375.1| PREDICTED: uridine nucleosidase 1-like [Sesamum indicum]
Length=338

 Score =   162 bits (410),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 124/147 (84%), Gaps = 0/147 (0%)
 Frame = +3

Query  141  MPISDGNSSAGVVEVYSSAGENREKiiidtdpgiddtVAILMAFQTPHLEILGLTTIFGN  320
            M IS+     G+V   +   + REKI+IDTDPGIDD++AILMAFQ+P LEILGLTTIFGN
Sbjct  1    MSISESGGIDGMVVSDNCFSKKREKIVIDTDPGIDDSMAILMAFQSPELEILGLTTIFGN  60

Query  321  VTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKPRIADFVHGADGLGNLNVPPPKSK  500
            VTTE+ATRNALLL E+AG PDVPVAEGS E LKRG PRIADFVHG++GLGN+ +PPPKSK
Sbjct  61   VTTEDATRNALLLCEIAGCPDVPVAEGSSEPLKRGPPRIADFVHGSNGLGNVILPPPKSK  120

Query  501  KIEQSASDFLVDKVSEFPSEVSILALG  581
            K  +SAS+FLVDKVSEFP EVSILALG
Sbjct  121  KSGKSASEFLVDKVSEFPGEVSILALG  147



>ref|XP_008462559.1| PREDICTED: uridine nucleosidase 1 [Cucumis melo]
Length=332

 Score =   161 bits (408),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 91/110 (83%), Gaps = 0/110 (0%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKP  431
            + I MAFQ+P LEILGLTT+FGNV  E+AT NALLL E+AGR DVPVAEG  E LK G P
Sbjct  32   MTIFMAFQSPGLEILGLTTVFGNVFIEDATLNALLLCEMAGRSDVPVAEGRAEPLKGGTP  91

Query  432  RIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             IADFVHG+DGLGNLN+P P +KKIE+SASDFLV+ VS+ P EVSILALG
Sbjct  92   HIADFVHGSDGLGNLNLPSPSTKKIEKSASDFLVETVSQHPGEVSILALG  141



>gb|KJB36383.1| hypothetical protein B456_006G156300 [Gossypium raimondii]
Length=301

 Score =   160 bits (406),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 96/110 (87%), Gaps = 0/110 (0%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKP  431
            +AILMAFQ P ++ILGLTT+FGNV TE+ATRNALLL E+AG P VPV EGS E LK G+P
Sbjct  1    MAILMAFQNPEVDILGLTTVFGNVRTEDATRNALLLCEIAGCPSVPVVEGSHEPLKGGRP  60

Query  432  RIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
            R+ADFVHG+DG+GN+ + PPK++K ++SAS+FLV+KVS++P EVSILALG
Sbjct  61   RVADFVHGSDGMGNIFLRPPKTEKSDKSASEFLVEKVSQYPGEVSILALG  110



>ref|XP_009143597.1| PREDICTED: uridine nucleosidase 1-like [Brassica rapa]
Length=339

 Score =   161 bits (408),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 94/151 (62%), Positives = 120/151 (79%), Gaps = 3/151 (2%)
 Frame = +3

Query  129  QETVMPISDGNSSAGVVEVYSSAGENREKiiidtdpgiddtVAILMAFQTPHLEILGLTT  308
             ++ M I +G  S G V   SS    REK+IIDTDPGIDD++AI+MAFQT  L+ILGLTT
Sbjct  1    MDSAMEICNGGISNGDVSGLSS---KREKLIIDTDPGIDDSMAIMMAFQTLELDILGLTT  57

Query  309  IFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKPRIADFVHGADGLGNLNVPP  488
            +FGNV T++ATRNALLL E+ G PD+PVAEGS E LK G PR+ADFVHG +GLG+++VP 
Sbjct  58   VFGNVQTQDATRNALLLCEIGGFPDLPVAEGSSEPLKGGIPRVADFVHGKNGLGDVSVPS  117

Query  489  PKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
            P  KK ++SA++FLV+KVSE+P EV++LALG
Sbjct  118  PCRKKCDKSAAEFLVEKVSEYPGEVTVLALG  148



>gb|KEH24134.1| inosine-uridine preferring nucleoside hydrolase [Medicago truncatula]
Length=301

 Score =   160 bits (405),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 94/110 (85%), Gaps = 0/110 (0%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKP  431
            +AILMAF  P +E++GLTT+FGN  TE+ATRNALLL E+AGR +VPVAEGS E LK G+P
Sbjct  1    MAILMAFHCPEVEVIGLTTVFGNAQTEDATRNALLLCEIAGRQNVPVAEGSTEPLKGGRP  60

Query  432  RIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
            R+ADFVHG DGLGNL +P PK+ KI++SAS+FLV+KVSE P EV++LALG
Sbjct  61   RVADFVHGKDGLGNLFLPDPKTNKIDKSASEFLVEKVSESPGEVTVLALG  110



>ref|NP_001141948.1| uncharacterized protein LOC100274097 [Zea mays]
 gb|ACF87362.1| unknown [Zea mays]
 gb|ADX07371.1| nucleoside N-ribohydrolase 2 [Zea mays]
 gb|AFW61722.1| hypothetical protein ZEAMMB73_926916 [Zea mays]
Length=325

 Score =   161 bits (407),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 94/110 (85%), Gaps = 0/110 (0%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKP  431
            +AILMAF+   LEI+GLTTIFGNV TE AT NALLL E AG P+VPVAEGS E LK GKP
Sbjct  25   MAILMAFRAHTLEIIGLTTIFGNVDTEGATCNALLLCERAGHPEVPVAEGSHEPLKGGKP  84

Query  432  RIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
            RIADFVHG+DG+GNL +P P +KK+E+SA+DF+V+KVSEFP EVS+LALG
Sbjct  85   RIADFVHGSDGIGNLFLPAPSAKKVEESAADFMVNKVSEFPGEVSVLALG  134



>gb|KHN18754.1| Uridine nucleosidase 1 [Glycine soja]
Length=334

 Score =   160 bits (406),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 95/110 (86%), Gaps = 0/110 (0%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKP  431
            +AILMAFQ+P +E+LGLTTIFGN TTE +T NALLL E+AG  ++PVA+GS E LK GKP
Sbjct  34   MAILMAFQSPDVEVLGLTTIFGNTTTELSTLNALLLCEMAGHENIPVAQGSHEPLKGGKP  93

Query  432  RIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
            R+ADFVHG DGLGN  +PPPK +KIE+SAS+FLV+KVSE+P EVS+LALG
Sbjct  94   RVADFVHGKDGLGNTFLPPPKGEKIEKSASEFLVEKVSEYPGEVSVLALG  143



>ref|XP_003625788.1| Inosine-uridine preferring ribonucleoside hydrolase [Medicago 
truncatula]
 gb|AES82006.1| inosine-uridine preferring nucleoside hydrolase [Medicago truncatula]
Length=334

 Score =   160 bits (406),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 94/110 (85%), Gaps = 0/110 (0%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKP  431
            +AILMAF  P +E++GLTT+FGN  TE+ATRNALLL E+AGR +VPVAEGS E LK G+P
Sbjct  34   MAILMAFHCPEVEVIGLTTVFGNAQTEDATRNALLLCEIAGRQNVPVAEGSTEPLKGGRP  93

Query  432  RIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
            R+ADFVHG DGLGNL +P PK+ KI++SAS+FLV+KVSE P EV++LALG
Sbjct  94   RVADFVHGKDGLGNLFLPDPKTNKIDKSASEFLVEKVSESPGEVTVLALG  143



>gb|ACF80359.1| unknown [Zea mays]
Length=325

 Score =   160 bits (405),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 94/110 (85%), Gaps = 0/110 (0%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKP  431
            + ILMAF+ P +EI+GLTTIFGNV T+ ATRNALLL E AG P+VPVAEGS E LK GKP
Sbjct  25   MTILMAFRAPSVEIIGLTTIFGNVDTKGATRNALLLCERAGCPEVPVAEGSHEPLKGGKP  84

Query  432  RIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
            R+ADFVHG+DG+GNL +P P  KK+E+SA+DFL++KVSEFP EVS+LALG
Sbjct  85   RVADFVHGSDGIGNLFLPVPSVKKVEESAADFLINKVSEFPGEVSVLALG  134



>gb|KJB36384.1| hypothetical protein B456_006G156300 [Gossypium raimondii]
Length=344

 Score =   160 bits (406),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 96/110 (87%), Gaps = 0/110 (0%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKP  431
            +AILMAFQ P ++ILGLTT+FGNV TE+ATRNALLL E+AG P VPV EGS E LK G+P
Sbjct  44   MAILMAFQNPEVDILGLTTVFGNVRTEDATRNALLLCEIAGCPSVPVVEGSHEPLKGGRP  103

Query  432  RIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
            R+ADFVHG+DG+GN+ + PPK++K ++SAS+FLV+KVS++P EVSILALG
Sbjct  104  RVADFVHGSDGMGNIFLRPPKTEKSDKSASEFLVEKVSQYPGEVSILALG  153



>ref|NP_001148615.1| LOC100282231 [Zea mays]
 ref|XP_008667957.1| PREDICTED: LOC100282231 isoform X1 [Zea mays]
 gb|ACG32246.1| pyrimidine-specific ribonucleoside hydrolase rihB [Zea mays]
 gb|ADX07372.1| nucleoside N-ribohydrolase 3 [Zea mays]
 tpg|DAA39612.1| TPA: pyrimidine-specific ribonucleoside hydrolase rihB isoform 
1 [Zea mays]
 tpg|DAA39613.1| TPA: pyrimidine-specific ribonucleoside hydrolase rihB isoform 
2 [Zea mays]
 tpg|DAA39614.1| TPA: pyrimidine-specific ribonucleoside hydrolase rihB isoform 
3 [Zea mays]
Length=315

 Score =   160 bits (404),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 92/110 (84%), Gaps = 0/110 (0%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKP  431
            VAILMAFQ P +++LGLTTIFGN TTE+ATRNAL+L E A   +VPVAEGS E LK GKP
Sbjct  15   VAILMAFQMPGVQVLGLTTIFGNCTTEHATRNALILCEKASHLEVPVAEGSHEPLKGGKP  74

Query  432  RIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             +ADFVHG DGLGN+++P P  KK+E+SA+DFLVDKVS FP EVS+LALG
Sbjct  75   HVADFVHGPDGLGNVDLPDPTIKKVEESATDFLVDKVSRFPGEVSVLALG  124



>ref|XP_010505163.1| PREDICTED: uridine nucleosidase 1-like [Camelina sativa]
Length=339

 Score =   160 bits (405),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = +3

Query  207  REKiiidtdpgiddtVAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDV  386
            REK+IIDTDPGIDD++AI+MAFQTP LEILGLTT+FGNVTT++ATRNALLL E+AG PDV
Sbjct  24   REKLIIDTDPGIDDSMAIMMAFQTPELEILGLTTVFGNVTTQDATRNALLLCEIAGFPDV  83

Query  387  PVAEGSPEALKRGKPRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVS  566
            PVAEG+ E LK G PR+ADFVHG +GLG++++PPP   K E SA++FL +KVSE+P EV+
Sbjct  84   PVAEGTSEPLKGGIPRVADFVHGKNGLGDVSLPPPCITKSEISAAEFLDEKVSEYPGEVT  143

Query  567  ILALG  581
            ILALG
Sbjct  144  ILALG  148



>gb|ACL53372.1| unknown [Zea mays]
Length=315

 Score =   160 bits (404),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 92/110 (84%), Gaps = 0/110 (0%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKP  431
            VAILMAFQ P +++LGLTTIFGN TTE+ATRNAL+L E A   +VPVAEGS E LK GKP
Sbjct  15   VAILMAFQMPGVQVLGLTTIFGNCTTEHATRNALILCEKASHLEVPVAEGSHEPLKGGKP  74

Query  432  RIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             +ADFVHG DGLGN+++P P  KK+E+SA+DFLVDKVS FP EVS+LALG
Sbjct  75   HVADFVHGPDGLGNVDLPDPTIKKVEESATDFLVDKVSRFPGEVSVLALG  124



>ref|NP_001062489.1| Os08g0557900 [Oryza sativa Japonica Group]
 sp|Q6ZJ05.1|URH1_ORYSJ RecName: Full=Probable uridine nucleosidase 1; AltName: Full=Uridine 
ribohydrolase 1 [Oryza sativa Japonica Group]
 dbj|BAD09089.1| putative inosine-uridine nucleoside N-ribohydrolase [Oryza sativa 
Japonica Group]
 dbj|BAF24403.1| Os08g0557900 [Oryza sativa Japonica Group]
 dbj|BAG89467.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE69140.1| hypothetical protein OsJ_28263 [Oryza sativa Japonica Group]
Length=324

 Score =   160 bits (404),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 96/110 (87%), Gaps = 0/110 (0%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKP  431
            + ILMAF+ P +EI+GLTTIFGN TT+NAT+NALLL E AG P+VPVAEGS E LK G+P
Sbjct  24   MTILMAFRAPTVEIIGLTTIFGNTTTKNATQNALLLCERAGHPEVPVAEGSAEPLKGGEP  83

Query  432  RIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
            R+ADFVHG+DGLGNL +P P SKK++++A++F+V+KVS+FP EVSILALG
Sbjct  84   RVADFVHGSDGLGNLFLPAPTSKKVDENAAEFMVNKVSQFPGEVSILALG  133



>gb|EYU35466.1| hypothetical protein MIMGU_mgv1a009694mg [Erythranthe guttata]
Length=334

 Score =   160 bits (404),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 125/147 (85%), Gaps = 4/147 (3%)
 Frame = +3

Query  141  MPISDGNSSAGVVEVYSSAGENREKiiidtdpgiddtVAILMAFQTPHLEILGLTTIFGN  320
            M I  G    GVV       +N EKIIIDTDPGIDD++AILMAFQ+P L+ILGLTTIFGN
Sbjct  1    MSIVHGGKIDGVV----VGSDNCEKIIIDTDPGIDDSMAILMAFQSPGLDILGLTTIFGN  56

Query  321  VTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKPRIADFVHGADGLGNLNVPPPKSK  500
            VTTE+AT+NAL L E+AGRPD+PVA+GSPE LKRG+PR+ADFVHG++GLGN++ PPPKSK
Sbjct  57   VTTEDATQNALFLCEIAGRPDIPVAQGSPEPLKRGEPRVADFVHGSNGLGNISFPPPKSK  116

Query  501  KIEQSASDFLVDKVSEFPSEVSILALG  581
            K ++SAS+FLVDKVSEFP EVS+LALG
Sbjct  117  KSDKSASEFLVDKVSEFPGEVSVLALG  143



>pdb|4KPO|A Chain A, Plant Nucleoside Hydrolase - Zmnrh3 Enzyme
 pdb|4KPO|B Chain B, Plant Nucleoside Hydrolase - Zmnrh3 Enzyme
Length=330

 Score =   159 bits (403),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 92/110 (84%), Gaps = 0/110 (0%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKP  431
            VAILMAFQ P +++LGLTTIFGN TTE+ATRNAL+L E A   +VPVAEGS E LK GKP
Sbjct  30   VAILMAFQMPGVQVLGLTTIFGNCTTEHATRNALILCEKASHLEVPVAEGSHEPLKGGKP  89

Query  432  RIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             +ADFVHG DGLGN+++P P  KK+E+SA+DFLVDKVS FP EVS+LALG
Sbjct  90   HVADFVHGPDGLGNVDLPDPTIKKVEESATDFLVDKVSRFPGEVSVLALG  139



>ref|XP_004494158.1| PREDICTED: uridine nucleosidase 1-like [Cicer arietinum]
Length=334

 Score =   159 bits (403),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 87/126 (69%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = +3

Query  204  NREKiiidtdpgiddtVAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPD  383
            N EK+IIDTDPGIDD++AILMAF  P +E++GLTTIFGN  TE+ATRNALLL E+AGR +
Sbjct  18   NAEKLIIDTDPGIDDSMAILMAFHCPEVEVVGLTTIFGNAATEDATRNALLLCEIAGRQN  77

Query  384  VPVAEGSPEALKRGKPRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEV  563
            +PVAEGS E LK G+PR+ADFVHG DGLGN+ +P PK+ KI++SAS+FLV+KVSE P E+
Sbjct  78   IPVAEGSTEPLKGGRPRVADFVHGKDGLGNIFLPDPKANKIDKSASEFLVEKVSECPGEI  137

Query  564  SILALG  581
            ++LALG
Sbjct  138  TVLALG  143



>ref|XP_006294539.1| hypothetical protein CARUB_v10023574mg [Capsella rubella]
 gb|EOA27437.1| hypothetical protein CARUB_v10023574mg [Capsella rubella]
Length=338

 Score =   159 bits (402),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = +3

Query  207  REKiiidtdpgiddtVAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDV  386
            REK+IIDTDPGIDD++AI+MAFQTP LEILGLTT+FGNV+T++AT NALLL E+AG PDV
Sbjct  24   REKLIIDTDPGIDDSMAIMMAFQTPELEILGLTTVFGNVSTQDATHNALLLCEIAGFPDV  83

Query  387  PVAEGSPEALKRGKPRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVS  566
            PVAEG+ E LK G PR+ADFVHG +GLG++++P P  KK E+SA++FL +KVSE+P EV+
Sbjct  84   PVAEGTSEPLKGGIPRVADFVHGKNGLGDVSLPSPSIKKCEKSAAEFLDEKVSEYPGEVT  143

Query  567  ILALG  581
            ILALG
Sbjct  144  ILALG  148



>ref|XP_006851502.1| hypothetical protein AMTR_s00040p00153690 [Amborella trichopoda]
 gb|ERN13083.1| hypothetical protein AMTR_s00040p00153690 [Amborella trichopoda]
Length=329

 Score =   159 bits (401),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 92/110 (84%), Gaps = 0/110 (0%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKP  431
            + ILMAFQ+P LE+LGLTT+FGNV T++ATRNAL L E+AG PD+PV+EGSPE LK G+P
Sbjct  29   ITILMAFQSPGLEVLGLTTVFGNVATKDATRNALHLCEIAGYPDLPVSEGSPEPLKGGEP  88

Query  432  RIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
            RI DF HG+DGLGN   P PK KKI +SAS+FLVDK++E P EVSILALG
Sbjct  89   RIDDFFHGSDGLGNTFPPSPKGKKIGKSASEFLVDKITEHPGEVSILALG  138



>ref|NP_001105259.1| uncharacterized protein LOC542168 [Zea mays]
 gb|AAT00629.1| putative inosine-uridine preferring nucleoside hydrolase [Zea 
mays]
Length=325

 Score =   159 bits (401),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 94/110 (85%), Gaps = 0/110 (0%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKP  431
            + ILMAF+ P +EI+GLTTIFGNV T+ ATRNALLL E AG P+VPVAEGS E LK GK 
Sbjct  25   MTILMAFRAPSVEIIGLTTIFGNVDTKGATRNALLLCERAGCPEVPVAEGSHEPLKGGKR  84

Query  432  RIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
            R+ADFVHG+DG+GNL +P P +KK+E+SA+DFL++KVSEFP EVS+LALG
Sbjct  85   RVADFVHGSDGIGNLFLPAPSAKKVEESAADFLINKVSEFPGEVSVLALG  134



>ref|XP_007162884.1| hypothetical protein PHAVU_001G188700g [Phaseolus vulgaris]
 gb|ESW34878.1| hypothetical protein PHAVU_001G188700g [Phaseolus vulgaris]
Length=334

 Score =   157 bits (397),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 107/126 (85%), Gaps = 0/126 (0%)
 Frame = +3

Query  204  NREKiiidtdpgiddtVAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPD  383
            N EK+IIDTDPGIDD++AILMAFQ+P +E+LGLT+IFGN  TE +TRNALLL E+AGR +
Sbjct  18   NAEKLIIDTDPGIDDSMAILMAFQSPDVEVLGLTSIFGNAMTEVSTRNALLLCEIAGREN  77

Query  384  VPVAEGSPEALKRGKPRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEV  563
            VPVA+GS E LK G PRIADFVHG DGLGN  +P PK KKIE+SA +FLV+KVSE P EV
Sbjct  78   VPVAQGSSEPLKGGTPRIADFVHGEDGLGNTFLPLPKGKKIEKSACEFLVEKVSENPGEV  137

Query  564  SILALG  581
            S+LALG
Sbjct  138  SVLALG  143



>ref|XP_002528714.1| inosine-uridine preferring nucleoside hydrolase, putative [Ricinus 
communis]
 gb|EEF33626.1| inosine-uridine preferring nucleoside hydrolase, putative [Ricinus 
communis]
Length=330

 Score =   157 bits (396),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKP  431
            +AILMAFQ+P L+ILGLTT FGN   E+ATRNALLL E+AG   VPVA G+ E LK GKP
Sbjct  30   MAILMAFQSPELDILGLTTTFGNAKLEDATRNALLLCEIAGCSGVPVAAGNSEPLKGGKP  89

Query  432  RIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
            R+ADF HG+DG+GNL +P P+++KIE+SAS+FLVD++SE+P EVSILALG
Sbjct  90   RVADFAHGSDGVGNLFLPSPRAQKIEKSASEFLVDQISEYPGEVSILALG  139



>gb|KFK36524.1| hypothetical protein AALP_AA4G135500 [Arabis alpina]
Length=335

 Score =   156 bits (395),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 91/110 (83%), Gaps = 0/110 (0%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKP  431
            +AI+MAFQTP LEILGLTT+FGNV  E+ATRNAL L E+AG PDVPVAEG  E LK G P
Sbjct  35   MAIMMAFQTPELEILGLTTVFGNVLIEDATRNALALCEIAGFPDVPVAEGIAEPLKGGIP  94

Query  432  RIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
            R+ADFVHG++GLG+++V  P   K E+ A++FLVDKVSEFP EV+ILALG
Sbjct  95   RVADFVHGSNGLGDVSVSSPSRTKCEKGAAEFLVDKVSEFPGEVTILALG  144



>ref|XP_006660994.1| PREDICTED: probable uridine nucleosidase 2-like [Oryza brachyantha]
Length=327

 Score =   155 bits (392),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 91/110 (83%), Gaps = 0/110 (0%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKP  431
            VAI+MAF+ P + ++GLTTIFGN TT  ATRNAL+L E AGR DVPVAEGS E LK GKP
Sbjct  26   VAIMMAFEAPGVHVVGLTTIFGNCTTSYATRNALILCERAGRSDVPVAEGSAEPLKGGKP  85

Query  432  RIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             +ADFVHG+DGLGN ++P P + K+EQSA++FLV+KVSE P EVS+LALG
Sbjct  86   HVADFVHGSDGLGNTSLPDPITNKVEQSAAEFLVNKVSESPGEVSVLALG  135



>ref|XP_010101596.1| hypothetical protein L484_015425 [Morus notabilis]
 gb|EXB88735.1| hypothetical protein L484_015425 [Morus notabilis]
Length=337

 Score =   154 bits (388),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 86/110 (78%), Positives = 99/110 (90%), Gaps = 0/110 (0%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKP  431
            +AI MAFQ P LE+LGLTTIFGNVTTE+ATRNALLL E+A RPDVPVA+GSPE LK G+P
Sbjct  37   MAIFMAFQNPGLEVLGLTTIFGNVTTEDATRNALLLCEIARRPDVPVAKGSPEPLKGGEP  96

Query  432  RIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
            RIADF+HG+DGLGNL +P PKSKK E+SA++FLVDKVSE+P EVSILALG
Sbjct  97   RIADFIHGSDGLGNLFLPSPKSKKSEKSAAEFLVDKVSEYPGEVSILALG  146



>ref|NP_001063966.1| Os09g0567900 [Oryza sativa Japonica Group]
 sp|Q652Q8.1|URH2_ORYSJ RecName: Full=Probable uridine nucleosidase 2; AltName: Full=Uridine 
ribohydrolase 2 [Oryza sativa Japonica Group]
 dbj|BAD46209.1| putative inosine-uridine nucleoside N-ribohydrolase [Oryza sativa 
Japonica Group]
 dbj|BAF25880.1| Os09g0567900 [Oryza sativa Japonica Group]
 dbj|BAG87909.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE70259.1| hypothetical protein OsJ_30393 [Oryza sativa Japonica Group]
Length=337

 Score =   154 bits (388),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 74/111 (67%), Positives = 93/111 (84%), Gaps = 1/111 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKP  431
            VAI+MAF+ P ++++GLTTIFGN TT +ATRNAL+L + AGRP+VPVAEGS E LK GKP
Sbjct  35   VAIMMAFEAPGVKVVGLTTIFGNCTTSHATRNALILCDRAGRPEVPVAEGSAEPLKGGKP  94

Query  432  RIADFVHGADGLGNLNVP-PPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             +ADFVHG+DGLGN + P P  + K+EQSA++FLVDKVSE P E+S+LALG
Sbjct  95   HVADFVHGSDGLGNTSFPDPTTTNKVEQSAAEFLVDKVSESPGEISVLALG  145



>ref|XP_011077879.1| PREDICTED: uridine nucleosidase 1-like [Sesamum indicum]
Length=327

 Score =   152 bits (383),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 85/110 (77%), Positives = 98/110 (89%), Gaps = 0/110 (0%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKP  431
            +AILMAF++P +EILGLTTIFGNV TE+ATRNAL L E+AGRPDVPVAEGS E LK GKP
Sbjct  27   MAILMAFRSPDVEILGLTTIFGNVITEDATRNALFLCEIAGRPDVPVAEGSSEPLKGGKP  86

Query  432  RIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
            R+ DFVHG+DGLGN+ VPPPKSKK  +SAS+FLVD+VSE+P EVSILALG
Sbjct  87   RVCDFVHGSDGLGNIFVPPPKSKKSNKSASEFLVDEVSEYPGEVSILALG  136



>gb|EMT19270.1| hypothetical protein F775_29162 [Aegilops tauschii]
Length=319

 Score =   151 bits (381),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 78/140 (56%), Positives = 98/140 (70%), Gaps = 30/140 (21%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKR---  422
            + ILMAF  P++EI+GLTTIFGNVTTE ATRNALLL E AG P+VPVAEGSPE LK    
Sbjct  24   MTILMAFGEPNVEIIGLTTIFGNVTTEYATRNALLLCERAGHPEVPVAEGSPEPLKLMLE  83

Query  423  ---------------------------GKPRIADFVHGADGLGNLNVPPPKSKKIEQSAS  521
                                       G+PR+ADFVHG+DGLGNL++P P +KK+E+SA+
Sbjct  84   VCILYYQLKMTLSAYWIIIHQKRLAKGGEPRVADFVHGSDGLGNLSLPAPTTKKVEESAA  143

Query  522  DFLVDKVSEFPSEVSILALG  581
            +F+V+KVS+FP E+S+LALG
Sbjct  144  EFMVNKVSQFPGEISVLALG  163



>gb|EEC85085.1| hypothetical protein OsI_32443 [Oryza sativa Indica Group]
Length=337

 Score =   150 bits (380),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/111 (66%), Positives = 92/111 (83%), Gaps = 1/111 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKP  431
            VAI+MAF+ P ++++GLTTIFGN TT +ATRNAL+L + AGRP+VPVAEGS E LK GKP
Sbjct  35   VAIMMAFEAPGVKVVGLTTIFGNCTTSHATRNALILCDRAGRPEVPVAEGSAEPLKGGKP  94

Query  432  RIADFVHGADGLGNLNVP-PPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             +ADFVHG+DGLGN + P    + K+EQSA++FLVDKVSE P E+S+LALG
Sbjct  95   HVADFVHGSDGLGNTSFPDSTTTNKVEQSAAEFLVDKVSESPGEISVLALG  145



>ref|XP_003578679.1| PREDICTED: probable uridine nucleosidase 2 [Brachypodium distachyon]
Length=329

 Score =   150 bits (380),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKP  431
            VAI+MAF  P +E+LGLTTIFGN TT  +TRNAL+L E AGR +VPVAEGS E LK GKP
Sbjct  30   VAIMMAFNLPSVEVLGLTTIFGNCTTAYSTRNALILCEKAGRTEVPVAEGSAEPLKGGKP  89

Query  432  RIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             +ADFVHG+DG+GN+ V  P +KK EQ+A+ FLVDKVS+ P EVS+LALG
Sbjct  90   NVADFVHGSDGIGNVPVTDPTTKKAEQTAAQFLVDKVSQSPGEVSVLALG  139



>ref|XP_009383672.1| PREDICTED: probable uridine nucleosidase 1 [Musa acuminata subsp. 
malaccensis]
Length=338

 Score =   149 bits (377),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 92/110 (84%), Gaps = 0/110 (0%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKP  431
            + ILMAFQ P +EILGLTTIFGNV TE+ATRNALLL E+AG   VPVAEGS E LK  +P
Sbjct  38   MTILMAFQLPEIEILGLTTIFGNVRTEDATRNALLLCEIAGHRQVPVAEGSHEPLKGEEP  97

Query  432  RIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             IADF+HG+DGLGN+ +PPP  +K++++AS+FLV+ VS++P +V+ILALG
Sbjct  98   SIADFIHGSDGLGNIFLPPPVGEKMDKNASEFLVEMVSQYPGDVTILALG  147



>gb|EYU36642.1| hypothetical protein MIMGU_mgv1a010172mg [Erythranthe guttata]
Length=320

 Score =   144 bits (364),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 88/111 (79%), Gaps = 1/111 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRG-K  428
            +AI +A Q+P +E++GLTTIFGNV T  ATRNAL L E+AGR D+PVAEGS   + +G K
Sbjct  19   MAIFLALQSPEVEVIGLTTIFGNVYTTLATRNALHLLEIAGRTDIPVAEGSHVTITKGTK  78

Query  429  PRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             RIADFVHG DGLGN N PPPK K+I+QSA+DFL+ + + +P EV+++ALG
Sbjct  79   LRIADFVHGTDGLGNQNFPPPKGKQIDQSAADFLIQQAALYPGEVTVVALG  129



>ref|XP_011074012.1| PREDICTED: probable uridine nucleosidase 2 isoform X2 [Sesamum 
indicum]
Length=297

 Score =   142 bits (357),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 86/111 (77%), Gaps = 1/111 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRG-K  428
            +AI +A Q+P +E++GLTTI+GNV T  ATRNAL L E+AGR D+PVAEGS   + +G K
Sbjct  19   MAIFLALQSPEVEVIGLTTIYGNVYTTLATRNALHLLEIAGRTDIPVAEGSHLTITKGTK  78

Query  429  PRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             RIADFVHG DGLGN N PPPK K IEQSA DFL+ + S +P +V+++ALG
Sbjct  79   LRIADFVHGTDGLGNQNFPPPKGKAIEQSAVDFLIQQTSLYPGKVTVVALG  129



>gb|KCW88014.1| hypothetical protein EUGRSUZ_A00423 [Eucalyptus grandis]
Length=286

 Score =   141 bits (355),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 88/111 (79%), Gaps = 1/111 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRG-K  428
            +AI +A Q+P +E++GLTTI+GNV T  ATRNAL L EVAGR D+PVAEGS   + +G K
Sbjct  20   MAIFVALQSPEVEVIGLTTIYGNVYTTLATRNALHLLEVAGRTDIPVAEGSHVTITKGTK  79

Query  429  PRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             RIADFVHGADGLGN N PPPK K IEQSA+ FL+++ + +P EV+++ALG
Sbjct  80   LRIADFVHGADGLGNQNFPPPKGKPIEQSAATFLIEQANLYPGEVTVVALG  130



>ref|XP_011074011.1| PREDICTED: probable uridine nucleosidase 2 isoform X1 [Sesamum 
indicum]
Length=320

 Score =   142 bits (357),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 86/111 (77%), Gaps = 1/111 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRG-K  428
            +AI +A Q+P +E++GLTTI+GNV T  ATRNAL L E+AGR D+PVAEGS   + +G K
Sbjct  19   MAIFLALQSPEVEVIGLTTIYGNVYTTLATRNALHLLEIAGRTDIPVAEGSHLTITKGTK  78

Query  429  PRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             RIADFVHG DGLGN N PPPK K IEQSA DFL+ + S +P +V+++ALG
Sbjct  79   LRIADFVHGTDGLGNQNFPPPKGKAIEQSAVDFLIQQTSLYPGKVTVVALG  129



>ref|XP_010068713.1| PREDICTED: probable uridine nucleosidase 2 [Eucalyptus grandis]
 gb|KCW88012.1| hypothetical protein EUGRSUZ_A00423 [Eucalyptus grandis]
Length=321

 Score =   141 bits (355),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 88/111 (79%), Gaps = 1/111 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRG-K  428
            +AI +A Q+P +E++GLTTI+GNV T  ATRNAL L EVAGR D+PVAEGS   + +G K
Sbjct  20   MAIFVALQSPEVEVIGLTTIYGNVYTTLATRNALHLLEVAGRTDIPVAEGSHVTITKGTK  79

Query  429  PRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             RIADFVHGADGLGN N PPPK K IEQSA+ FL+++ + +P EV+++ALG
Sbjct  80   LRIADFVHGADGLGNQNFPPPKGKPIEQSAATFLIEQANLYPGEVTVVALG  130



>gb|KCW88013.1| hypothetical protein EUGRSUZ_A00423 [Eucalyptus grandis]
Length=320

 Score =   141 bits (355),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 88/111 (79%), Gaps = 1/111 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRG-K  428
            +AI +A Q+P +E++GLTTI+GNV T  ATRNAL L EVAGR D+PVAEGS   + +G K
Sbjct  20   MAIFVALQSPEVEVIGLTTIYGNVYTTLATRNALHLLEVAGRTDIPVAEGSHVTITKGTK  79

Query  429  PRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             RIADFVHGADGLGN N PPPK K IEQSA+ FL+++ + +P EV+++ALG
Sbjct  80   LRIADFVHGADGLGNQNFPPPKGKPIEQSAATFLIEQANLYPGEVTVVALG  130



>ref|XP_010683131.1| PREDICTED: probable uridine nucleosidase 2 [Beta vulgaris subsp. 
vulgaris]
Length=323

 Score =   140 bits (354),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 87/111 (78%), Gaps = 1/111 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRG-K  428
            +AI +A Q+P LE++GLTTI+GNV T  ATRNAL L EVAGR D+PVAEGS   + +G K
Sbjct  22   MAIFVALQSPELEVIGLTTIYGNVYTTLATRNALHLLEVAGRTDIPVAEGSHVTITKGTK  81

Query  429  PRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             RIADFVHG DGLGN N PPP  K IEQSA+ FLV++ +++P EV+++ALG
Sbjct  82   LRIADFVHGTDGLGNQNFPPPNGKPIEQSAATFLVEQANKYPGEVTVVALG  132



>ref|XP_008383887.1| PREDICTED: probable uridine nucleosidase 2 isoform X4 [Malus 
domestica]
Length=289

 Score =   140 bits (352),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 88/111 (79%), Gaps = 1/111 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRG-K  428
            +AI +A Q+P ++++GLTTI+GNV T  ATRNAL L EVAGR D+PVAEGS   + +G K
Sbjct  24   MAIFVALQSPEVQVIGLTTIYGNVYTTLATRNALHLLEVAGRXDIPVAEGSHVTITKGTK  83

Query  429  PRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             RIADFVHGADGLGN N PPPK K IEQSA+ FLV++ S +P +V+++ALG
Sbjct  84   LRIADFVHGADGLGNQNFPPPKGKPIEQSAAAFLVEQASLYPGKVTVVALG  134



>ref|XP_008383895.1| PREDICTED: probable uridine nucleosidase 2 isoform X5 [Malus 
domestica]
Length=286

 Score =   139 bits (351),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 88/111 (79%), Gaps = 1/111 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRG-K  428
            +AI +A Q+P ++++GLTTI+GNV T  ATRNAL L EVAGR D+PVAEGS   + +G K
Sbjct  24   MAIFVALQSPEVQVIGLTTIYGNVYTTLATRNALHLLEVAGRXDIPVAEGSHVTITKGTK  83

Query  429  PRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             RIADFVHGADGLGN N PPPK K IEQSA+ FLV++ S +P +V+++ALG
Sbjct  84   LRIADFVHGADGLGNQNFPPPKGKPIEQSAAAFLVEQASLYPGKVTVVALG  134



>ref|XP_007204702.1| hypothetical protein PRUPE_ppa009563mg [Prunus persica]
 gb|EMJ05901.1| hypothetical protein PRUPE_ppa009563mg [Prunus persica]
Length=287

 Score =   139 bits (351),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 88/111 (79%), Gaps = 1/111 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRG-K  428
            +AI +A Q+P +E++GLTTI+GNV T  ATRNAL L EVAGR D+PVAEGS   + +G K
Sbjct  21   MAIFVALQSPEVEVIGLTTIYGNVYTTLATRNALHLLEVAGRTDIPVAEGSHVTITKGTK  80

Query  429  PRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             RIADFVHGADGLGN N PPPK K IEQSA+ FLV++ + +P +V+++ALG
Sbjct  81   LRIADFVHGADGLGNQNFPPPKGKPIEQSAAAFLVEQANLYPGKVTVVALG  131



>ref|XP_008383874.1| PREDICTED: probable uridine nucleosidase 2 isoform X2 [Malus 
domestica]
Length=323

 Score =   140 bits (353),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 88/111 (79%), Gaps = 1/111 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRG-K  428
            +AI +A Q+P ++++GLTTI+GNV T  ATRNAL L EVAGR D+PVAEGS   + +G K
Sbjct  22   MAIFVALQSPEVQVIGLTTIYGNVYTTLATRNALHLLEVAGRXDIPVAEGSHVTITKGTK  81

Query  429  PRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             RIADFVHGADGLGN N PPPK K IEQSA+ FLV++ S +P +V+++ALG
Sbjct  82   LRIADFVHGADGLGNQNFPPPKGKPIEQSAAAFLVEQASLYPGKVTVVALG  132



>ref|XP_008383880.1| PREDICTED: probable uridine nucleosidase 2 isoform X3 [Malus 
domestica]
Length=322

 Score =   140 bits (353),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 88/111 (79%), Gaps = 1/111 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRG-K  428
            +AI +A Q+P ++++GLTTI+GNV T  ATRNAL L EVAGR D+PVAEGS   + +G K
Sbjct  24   MAIFVALQSPEVQVIGLTTIYGNVYTTLATRNALHLLEVAGRXDIPVAEGSHVTITKGTK  83

Query  429  PRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             RIADFVHGADGLGN N PPPK K IEQSA+ FLV++ S +P +V+++ALG
Sbjct  84   LRIADFVHGADGLGNQNFPPPKGKPIEQSAAAFLVEQASLYPGKVTVVALG  134



>ref|XP_008383867.1| PREDICTED: probable uridine nucleosidase 2 isoform X1 [Malus 
domestica]
Length=325

 Score =   140 bits (353),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 88/111 (79%), Gaps = 1/111 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRG-K  428
            +AI +A Q+P ++++GLTTI+GNV T  ATRNAL L EVAGR D+PVAEGS   + +G K
Sbjct  24   MAIFVALQSPEVQVIGLTTIYGNVYTTLATRNALHLLEVAGRXDIPVAEGSHVTITKGTK  83

Query  429  PRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             RIADFVHGADGLGN N PPPK K IEQSA+ FLV++ S +P +V+++ALG
Sbjct  84   LRIADFVHGADGLGNQNFPPPKGKPIEQSAAAFLVEQASLYPGKVTVVALG  134



>ref|XP_008367729.1| PREDICTED: probable uridine nucleosidase 2 [Malus domestica]
Length=215

 Score =   137 bits (345),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 87/111 (78%), Gaps = 1/111 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRG-K  428
            +AI +A Q+P ++++G+TTI+GNV T  ATRNAL L EVAGR D+PVAEGS   + +G K
Sbjct  24   MAIFVALQSPEVQVIGITTIYGNVYTTLATRNALHLLEVAGRTDIPVAEGSHVTITKGTK  83

Query  429  PRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             RIADFVHG DGLGN N PPPK K IEQSA+ FLV++ S +P +V+++ALG
Sbjct  84   LRIADFVHGVDGLGNQNFPPPKGKPIEQSAAAFLVEQASLYPGKVTVVALG  134



>ref|XP_008243078.1| PREDICTED: probable uridine nucleosidase 2 [Prunus mume]
Length=322

 Score =   140 bits (352),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 88/111 (79%), Gaps = 1/111 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRG-K  428
            +AI +A Q+P +E++GLTTI+GNV T  ATRNAL L EVAGR D+PVAEGS   + +G K
Sbjct  21   MAIFVALQSPEVEVIGLTTIYGNVYTTLATRNALHLLEVAGRTDIPVAEGSHVTITKGTK  80

Query  429  PRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             RIADFVHGADGLGN N PPPK K IEQSA+ FLV++ + +P +V+++ALG
Sbjct  81   LRIADFVHGADGLGNQNFPPPKGKPIEQSAAAFLVEQANLYPGKVTVVALG  131



>emb|CDP19150.1| unnamed protein product [Coffea canephora]
Length=321

 Score =   139 bits (350),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 86/111 (77%), Gaps = 1/111 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRG-K  428
            +AI +A Q+P +E++GLTTI+GNV T  ATRNAL L E+AGR D+PVAEGS   + +G K
Sbjct  20   MAIFLALQSPEVEVIGLTTIYGNVYTALATRNALHLLEIAGRTDIPVAEGSHVTITKGTK  79

Query  429  PRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             RIADFVHG DGLGN N PPPK K IE SA+DFL+ + S +P +V+++ALG
Sbjct  80   LRIADFVHGTDGLGNQNFPPPKGKPIELSAADFLIQQASCYPGKVTVVALG  130



>ref|XP_009379911.1| PREDICTED: probable uridine nucleosidase 2 [Musa acuminata subsp. 
malaccensis]
Length=319

 Score =   139 bits (349),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 87/111 (78%), Gaps = 1/111 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRG-K  428
            +AI +A  +P +E++GLTTI+GNV T  ATRNAL L EVA R D+PVAEGS   + +G K
Sbjct  18   MAIFVALNSPEIEVIGLTTIYGNVYTTLATRNALHLLEVAERSDIPVAEGSHVTITKGTK  77

Query  429  PRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             RIADFVHG+DGLGN N PPPK K I++SA+ FLV+K S+FP EV+++ALG
Sbjct  78   LRIADFVHGSDGLGNQNFPPPKGKAIDESAATFLVEKASQFPGEVTVVALG  128



>ref|XP_010912743.1| PREDICTED: probable uridine nucleosidase 2 [Elaeis guineensis]
 ref|XP_010910645.1| PREDICTED: probable uridine nucleosidase 2 [Elaeis guineensis]
Length=322

 Score =   139 bits (349),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 88/111 (79%), Gaps = 1/111 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRG-K  428
            +AI +A  +P +E++GLTTI+GNV T  ATRNAL L E+AGR D+PVAEGS   + +G K
Sbjct  21   MAIFVALNSPEIEVIGLTTIYGNVYTTLATRNALHLLEIAGRTDIPVAEGSHVTITKGTK  80

Query  429  PRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             RIADFVHGADGLGNLN PPPK K I+QSA+ FLV++ + +P +V+++ALG
Sbjct  81   LRIADFVHGADGLGNLNFPPPKGKPIDQSAAAFLVEQANLYPGKVTVVALG  131



>ref|XP_006858723.1| hypothetical protein AMTR_s00066p00114470 [Amborella trichopoda]
 gb|ERN20190.1| hypothetical protein AMTR_s00066p00114470 [Amborella trichopoda]
Length=320

 Score =   138 bits (348),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 88/111 (79%), Gaps = 1/111 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKR-GK  428
            +AI +A ++P ++++GLTTIFGNV T  ATRNAL L EVA R ++PVAEGS   LK+  K
Sbjct  19   MAIFLALKSPEVDVIGLTTIFGNVYTTLATRNALHLLEVAERQEIPVAEGSHVTLKKVTK  78

Query  429  PRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             RIADFVHGADGLGN N PPPK K I+QSA+ FLV+K ++FP EV+++ALG
Sbjct  79   LRIADFVHGADGLGNHNYPPPKGKPIDQSAASFLVEKANQFPGEVTVVALG  129



>ref|XP_010251428.1| PREDICTED: probable uridine nucleosidase 2 isoform X2 [Nelumbo 
nucifera]
Length=302

 Score =   137 bits (346),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 86/111 (77%), Gaps = 1/111 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRG-K  428
            +AI +A Q+P +E++GLTTI+GNV T  ATRNAL L E+AGR D+PVAEGS   + +G K
Sbjct  1    MAIFLALQSPEVEVIGLTTIYGNVYTTLATRNALHLLEIAGRQDIPVAEGSHVTITKGTK  60

Query  429  PRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             RIADFVHGADGLGN N PPPK K IEQSA+ FL+ + +  P +V+++ALG
Sbjct  61   LRIADFVHGADGLGNQNFPPPKGKPIEQSAASFLIQQANLHPGKVTVVALG  111



>ref|XP_006493127.1| PREDICTED: probable uridine nucleosidase 2-like [Citrus sinensis]
Length=321

 Score =   138 bits (347),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 89/111 (80%), Gaps = 1/111 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRG-K  428
            +AIL+A ++P +E++GLTTI+GNV T  ATRNAL L E+AGR D+PVAEGS   + +G K
Sbjct  20   MAILLALRSPEVEVIGLTTIYGNVYTTLATRNALHLLEIAGRTDIPVAEGSHVTITQGTK  79

Query  429  PRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             RIADFVHGADGLGN N  PPK K IEQSA+DF+V++ + +P +++++ALG
Sbjct  80   LRIADFVHGADGLGNQNFHPPKGKPIEQSAADFIVEQANLYPGKITVVALG  130



>ref|XP_009343682.1| PREDICTED: probable uridine nucleosidase 2 [Pyrus x bretschneideri]
Length=325

 Score =   138 bits (347),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 87/111 (78%), Gaps = 1/111 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRG-K  428
            +AI +A Q+P ++++G+TTI+GNV T  ATRNAL L EVAGR D+PVAEGS   + +G K
Sbjct  24   MAIFVALQSPEVQVIGITTIYGNVYTTLATRNALHLLEVAGRTDIPVAEGSHVTITKGTK  83

Query  429  PRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             RIADFVHG DGLGN N PPPK K IEQSA+ FLV++ S +P +V+++ALG
Sbjct  84   LRIADFVHGVDGLGNQNFPPPKGKPIEQSAAAFLVEQASLYPGKVTVVALG  134



>ref|XP_010251427.1| PREDICTED: probable uridine nucleosidase 2 isoform X1 [Nelumbo 
nucifera]
Length=320

 Score =   137 bits (346),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 86/111 (77%), Gaps = 1/111 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRG-K  428
            +AI +A Q+P +E++GLTTI+GNV T  ATRNAL L E+AGR D+PVAEGS   + +G K
Sbjct  19   MAIFLALQSPEVEVIGLTTIYGNVYTTLATRNALHLLEIAGRQDIPVAEGSHVTITKGTK  78

Query  429  PRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             RIADFVHGADGLGN N PPPK K IEQSA+ FL+ + +  P +V+++ALG
Sbjct  79   LRIADFVHGADGLGNQNFPPPKGKPIEQSAASFLIQQANLHPGKVTVVALG  129



>gb|EEC84027.1| hypothetical protein OsI_30252 [Oryza sativa Indica Group]
Length=327

 Score =   137 bits (344),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/96 (67%), Positives = 83/96 (86%), Gaps = 0/96 (0%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKP  431
            + ILMAF+ P +EI+GLTTIFGN TT+NAT+NALLL E AG P+VPVAEGS E LK G+P
Sbjct  48   MTILMAFRAPTVEIIGLTTIFGNTTTKNATQNALLLCERAGHPEVPVAEGSAEPLKGGEP  107

Query  432  RIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDK  539
            R+ADFVHG+DGLGNL +P P SKK++++A++F+V+K
Sbjct  108  RVADFVHGSDGLGNLFLPAPTSKKVDENAAEFMVNK  143



>ref|XP_003555679.1| PREDICTED: probable uridine nucleosidase 2-like [Glycine max]
 gb|KHM99085.1| Putative uridine nucleosidase 2 [Glycine soja]
Length=323

 Score =   136 bits (342),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 84/111 (76%), Gaps = 1/111 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRG-K  428
            +AI +A Q+P +E++GLTTIFGNV T  ATRNAL L EVAGR D+PVAEGS   L  G K
Sbjct  22   MAIFLALQSPEVEVIGLTTIFGNVYTTLATRNALHLLEVAGRTDIPVAEGSHVTLTNGTK  81

Query  429  PRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             RIADFVHGADGLGN N PPPK K IE+SA+ FLV +    P +V+++ALG
Sbjct  82   LRIADFVHGADGLGNQNFPPPKGKPIEESAASFLVHQAKVNPGKVTVVALG  132



>ref|XP_001771662.1| predicted protein [Physcomitrella patens]
 gb|EDQ63576.1| predicted protein [Physcomitrella patens]
Length=328

 Score =   136 bits (342),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 86/110 (78%), Gaps = 0/110 (0%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKP  431
            +AI MAF+ P +E++GLTTIFGNV  + AT+NAL L E+ G P++PVAEG  E LKR KP
Sbjct  28   MAIFMAFEAPGIEVIGLTTIFGNVDIDLATKNALHLCEMTGHPEIPVAEGPSEPLKRVKP  87

Query  432  RIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
            RIA FVHG+DGLGN     PK +K  +SA+DFL++KV+EFP EV+++ALG
Sbjct  88   RIAYFVHGSDGLGNTFQANPKGQKSSKSAADFLLEKVAEFPGEVTVVALG  137



>gb|KDP29547.1| hypothetical protein JCGZ_19260 [Jatropha curcas]
Length=321

 Score =   136 bits (342),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 87/111 (78%), Gaps = 1/111 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRG-K  428
            +AI +A ++P +E++GLTTI+GNV T  ATRNAL L E+AGR D+PVAEGS   + +G K
Sbjct  20   MAIFLALRSPEVEVIGLTTIYGNVYTTLATRNALHLLEIAGRTDIPVAEGSHVTITKGTK  79

Query  429  PRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             RIADFVHGADGLGN + PPPK K IEQSA++FLV + +  P +V+++ALG
Sbjct  80   LRIADFVHGADGLGNQDFPPPKGKPIEQSAAEFLVKQANHHPGKVTVVALG  130



>ref|XP_002529114.1| inosine-uridine preferring nucleoside hydrolase, putative [Ricinus 
communis]
 gb|EEF33298.1| inosine-uridine preferring nucleoside hydrolase, putative [Ricinus 
communis]
Length=286

 Score =   135 bits (340),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 88/111 (79%), Gaps = 1/111 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRG-K  428
            +AI +A ++P +E++GLTTI+GNV T  ATRNAL L EVAGR D+PVAEGS  ++ +G K
Sbjct  20   MAIFLALKSPEVEVIGLTTIYGNVYTTLATRNALHLLEVAGRTDIPVAEGSHVSITKGAK  79

Query  429  PRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
              IADFVHGA+GLGN N PPPK K IEQSA  FLV++V+ +P +V+++ALG
Sbjct  80   LHIADFVHGAEGLGNQNFPPPKGKPIEQSAPAFLVEQVNLYPGKVTVVALG  130



>gb|AFZ84928.1| nucleoside N-ribohydrolase 2 [Physcomitrella patens]
Length=341

 Score =   136 bits (342),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 86/110 (78%), Gaps = 0/110 (0%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKP  431
            +AI MAF+ P +E++GLTTIFGNV  + AT+NAL L E+ G P++PVAEG  E LKR KP
Sbjct  41   MAIFMAFEAPGIEVIGLTTIFGNVDIDLATKNALHLCEMTGHPEIPVAEGPSEPLKRVKP  100

Query  432  RIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
            RIA FVHG+DGLGN     PK +K  +SA+DFL++KV+EFP EV+++ALG
Sbjct  101  RIAYFVHGSDGLGNTFQANPKGQKSSKSAADFLLEKVAEFPGEVTVVALG  150



>gb|EPS73547.1| hypothetical protein M569_01207 [Genlisea aurea]
Length=321

 Score =   135 bits (340),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 85/111 (77%), Gaps = 1/111 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRG-K  428
            +AI +A Q+P +E++GLTTIFGNV T  AT NAL L +VAGRPD+PVAEGS   +  G K
Sbjct  19   MAIFLALQSPEVEVIGLTTIFGNVNTTLATTNALHLLDVAGRPDIPVAEGSHVTITNGTK  78

Query  429  PRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             RIADFVHG DGLGN N PPP+ K IE SA++FL+ + S +P E++++ALG
Sbjct  79   LRIADFVHGTDGLGNQNFPPPRGKPIELSAAEFLMQQASLYPEEITLVALG  129



>ref|XP_007026485.1| Uridine-ribohydrolase 2 [Theobroma cacao]
 gb|EOY06987.1| Uridine-ribohydrolase 2 [Theobroma cacao]
Length=322

 Score =   135 bits (340),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 87/111 (78%), Gaps = 1/111 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRG-K  428
            +AI +A ++P +E++GLTTI+GNV T  ATRNAL L EVAGR D+PVAEGS   + +G K
Sbjct  21   MAIFLALRSPEVEVIGLTTIYGNVYTTLATRNALHLLEVAGRTDIPVAEGSHVTITKGTK  80

Query  429  PRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             RIADFVHGADGLGN N PPPK K I+ SA+ FLV++ + +P +V+++ALG
Sbjct  81   LRIADFVHGADGLGNQNFPPPKGKPIDMSAAAFLVEQANLYPGKVTVVALG  131



>gb|KJB77093.1| hypothetical protein B456_012G120100 [Gossypium raimondii]
Length=250

 Score =   133 bits (335),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 87/111 (78%), Gaps = 1/111 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRG-K  428
            +AI +A ++P +E++GLTTI+GNV T  ATRNAL L EVA R D+PVAEGS   + +G K
Sbjct  23   MAIFVALRSPEVEVIGLTTIYGNVYTTLATRNALHLLEVADRTDIPVAEGSHVTITKGTK  82

Query  429  PRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             RIADFVHGADGLGN N PPP+ K I+ SA+DFLV++ + +P +V+++ALG
Sbjct  83   LRIADFVHGADGLGNQNFPPPEGKPIDMSATDFLVEQANLYPGKVTVVALG  133



>emb|CDY06176.1| BnaA09g50270D [Brassica napus]
Length=322

 Score =   134 bits (338),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 100/129 (78%), Gaps = 1/129 (1%)
 Frame = +3

Query  198  GENREKiiidtdpgiddtVAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGR  377
            GE R+KIIIDTDPGIDD +AI +A  +P ++++GLTTI+GNV T  ATRNAL L EVAGR
Sbjct  3    GEQRKKIIIDTDPGIDDAMAIFVALNSPEVDVIGLTTIYGNVYTTLATRNALHLLEVAGR  62

Query  378  PDVPVAEGSPEALKRG-KPRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFP  554
             D+PVAEG+ + +  G K RIADFVHG DGLGN N PPPK K IE+SA +FLV++    P
Sbjct  63   TDIPVAEGTHKTIMNGTKLRIADFVHGKDGLGNQNFPPPKGKPIEKSAPEFLVEQAKLHP  122

Query  555  SEVSILALG  581
             E+S++ALG
Sbjct  123  GEISVVALG  131



>gb|KJB77094.1| hypothetical protein B456_012G120100 [Gossypium raimondii]
Length=298

 Score =   134 bits (336),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 87/111 (78%), Gaps = 1/111 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRG-K  428
            +AI +A ++P +E++GLTTI+GNV T  ATRNAL L EVA R D+PVAEGS   + +G K
Sbjct  23   MAIFVALRSPEVEVIGLTTIYGNVYTTLATRNALHLLEVADRTDIPVAEGSHVTITKGTK  82

Query  429  PRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             RIADFVHGADGLGN N PPP+ K I+ SA+DFLV++ + +P +V+++ALG
Sbjct  83   LRIADFVHGADGLGNQNFPPPEGKPIDMSATDFLVEQANLYPGKVTVVALG  133



>ref|XP_007153015.1| hypothetical protein PHAVU_003G000600g [Phaseolus vulgaris]
 gb|ESW25009.1| hypothetical protein PHAVU_003G000600g [Phaseolus vulgaris]
Length=323

 Score =   134 bits (337),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 85/111 (77%), Gaps = 1/111 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRG-K  428
            +AI +A Q+P +E++GLTTI+GNV T  ATRNAL L EVAGR D+PVAEG+   L +G K
Sbjct  22   MAIFVALQSPEIEVIGLTTIYGNVYTTLATRNALHLLEVAGRTDIPVAEGTHLTLTKGTK  81

Query  429  PRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             RIADFVHGADGLGN N PPPK K IE+SA+ FLV +    P +V+++ALG
Sbjct  82   LRIADFVHGADGLGNQNFPPPKGKPIEESAASFLVRQAKLNPGKVTVVALG  132



>ref|XP_009118579.1| PREDICTED: probable uridine nucleosidase 2 [Brassica rapa]
Length=322

 Score =   133 bits (335),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 79/129 (61%), Positives = 100/129 (78%), Gaps = 1/129 (1%)
 Frame = +3

Query  198  GENREKiiidtdpgiddtVAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGR  377
            GE R+KIIIDTDPGIDD +AI +A  +P ++++GLTTI+GNV T  ATRNAL L EVAGR
Sbjct  3    GEQRKKIIIDTDPGIDDAMAIFVALNSPEVDVIGLTTIYGNVYTTLATRNALHLLEVAGR  62

Query  378  PDVPVAEGSPEALKRG-KPRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFP  554
             D+PVAEG+ + +  G K RIADFVHG DGLGN N PPPK K IE+SA +FLV++    P
Sbjct  63   TDIPVAEGTHKTIMNGTKLRIADFVHGKDGLGNQNFPPPKGKPIEKSAPEFLVEQAKLHP  122

Query  555  SEVSILALG  581
             E++++ALG
Sbjct  123  GEITVVALG  131



>emb|CDY10016.1| BnaC08g44350D [Brassica napus]
Length=322

 Score =   133 bits (335),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 79/129 (61%), Positives = 100/129 (78%), Gaps = 1/129 (1%)
 Frame = +3

Query  198  GENREKiiidtdpgiddtVAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGR  377
            GE R+KIIIDTDPGIDD +AI +A  +P ++++GLTTI+GNV T  ATRNAL L EVAGR
Sbjct  3    GEQRKKIIIDTDPGIDDAMAIFVALNSPEVDVIGLTTIYGNVYTTLATRNALHLLEVAGR  62

Query  378  PDVPVAEGSPEALKRG-KPRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFP  554
             D+PVAEG+ + +  G K RIADFVHG DGLGN N PPPK K IE+SA +FLV++    P
Sbjct  63   TDIPVAEGTHKTIMNGTKLRIADFVHGKDGLGNQNFPPPKGKPIEKSAPEFLVEQAKLHP  122

Query  555  SEVSILALG  581
             E++++ALG
Sbjct  123  GEITVVALG  131



>gb|KJB77097.1| hypothetical protein B456_012G120100 [Gossypium raimondii]
Length=323

 Score =   133 bits (335),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 87/111 (78%), Gaps = 1/111 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRG-K  428
            +AI +A ++P +E++GLTTI+GNV T  ATRNAL L EVA R D+PVAEGS   + +G K
Sbjct  23   MAIFVALRSPEVEVIGLTTIYGNVYTTLATRNALHLLEVADRTDIPVAEGSHVTITKGTK  82

Query  429  PRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             RIADFVHGADGLGN N PPP+ K I+ SA+DFLV++ + +P +V+++ALG
Sbjct  83   LRIADFVHGADGLGNQNFPPPEGKPIDMSATDFLVEQANLYPGKVTVVALG  133



>ref|XP_004138951.1| PREDICTED: probable uridine nucleosidase 2-like [Cucumis sativus]
 ref|XP_004164122.1| PREDICTED: probable uridine nucleosidase 2-like [Cucumis sativus]
 gb|KGN61455.1| hypothetical protein Csa_2G129140 [Cucumis sativus]
Length=321

 Score =   133 bits (335),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 85/111 (77%), Gaps = 1/111 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRG-K  428
            +AI +A Q+P LE+LGLTTIFGNV T  +T+NAL L E+AGR D+PVAEGS   +  G K
Sbjct  20   MAIFLALQSPELEVLGLTTIFGNVYTTLSTKNALHLLEIAGRTDIPVAEGSHVTITNGTK  79

Query  429  PRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             R+ADFVHG DGLGN N PPP  K I+Q+A+ FLV++ + +P EV+++ALG
Sbjct  80   LRVADFVHGNDGLGNQNFPPPNGKPIDQAAAVFLVEQANLYPGEVTVVALG  130



>gb|KEH40954.1| inosine-uridine preferring nucleoside hydrolase [Medicago truncatula]
Length=301

 Score =   132 bits (333),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 85/111 (77%), Gaps = 1/111 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRG-K  428
            +AI +A ++P ++++GLTTI+GNV T  ATRNAL L EVAGR D+PVAEGS   L +G K
Sbjct  1    MAIFLALRSPEVQVIGLTTIYGNVYTTLATRNALHLLEVAGRTDIPVAEGSHVTLTKGTK  60

Query  429  PRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             RIADFVHGADGLGN N PPP  K IE+SA+ FLV++    P +++++ALG
Sbjct  61   LRIADFVHGADGLGNQNFPPPNGKPIEESAASFLVNQAKANPGKITVVALG  111



>ref|XP_008457260.1| PREDICTED: probable uridine nucleosidase 2 [Cucumis melo]
Length=321

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 85/111 (77%), Gaps = 1/111 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRG-K  428
            +AI +A Q+P LE+LGLTTIFGNV T  +T+NAL L E+AGR D+PVAEGS   +  G K
Sbjct  20   MAIFLALQSPELEVLGLTTIFGNVYTTLSTKNALHLLEIAGRTDIPVAEGSHVTITNGTK  79

Query  429  PRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             R+ADFVHG DGLGN N PPP  K I+Q+A+ FLV++ + +P EV+++ALG
Sbjct  80   LRVADFVHGNDGLGNQNFPPPNGKPIDQAAAVFLVEQANLYPGEVTLVALG  130



>emb|CDM81367.1| unnamed protein product [Triticum aestivum]
Length=324

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 85/111 (77%), Gaps = 1/111 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRG-K  428
            +AI +A ++P LE++GLTTIFGNV T  ATRNAL L E AGR D+PVAEGS   +K+  K
Sbjct  22   MAIFVALRSPELEVVGLTTIFGNVYTALATRNALHLLETAGRTDIPVAEGSHVTIKKATK  81

Query  429  PRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             RIA FVHG+DGLGN N PPP  K +EQSA+ FLV++ + +P +V+++ALG
Sbjct  82   LRIASFVHGSDGLGNQNFPPPAGKAVEQSAAAFLVEQANLYPGQVTVVALG  132



>gb|AFZ84927.1| nucleoside N-ribohydrolase 3_v4 [Physcomitrella patens]
Length=389

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 83/110 (75%), Gaps = 0/110 (0%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKP  431
            +AILMAFQ P +E++GLTTIFGNV T+ AT NAL L E+AG P++PVAEG  E LKR KP
Sbjct  35   MAILMAFQAPEIEVIGLTTIFGNVNTDLATINALHLCEMAGHPEIPVAEGPSEPLKRVKP  94

Query  432  RIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
            RIA F HG+DGLG      P  +K+ + A+DFL++ V+EFP EV+++ LG
Sbjct  95   RIAYFEHGSDGLGETYQAKPNFQKLSKDAADFLIENVTEFPGEVTVVGLG  144



>gb|ACU23843.1| unknown [Glycine max]
Length=221

 Score =   130 bits (327),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 82/111 (74%), Gaps = 1/111 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRG-K  428
            +AI +A Q+P +E++GLTTIFGNV T  ATRNAL L EVAGR D+PVAEGS      G K
Sbjct  22   MAIFLALQSPEVEVIGLTTIFGNVYTTLATRNALHLLEVAGRTDIPVAEGSHVTSTNGTK  81

Query  429  PRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             R+ADFVHG DGLGN N PPPK K IE+SA+ FLV +    P +V+++ALG
Sbjct  82   LRVADFVHGVDGLGNQNFPPPKGKPIEESAASFLVHQAKVNPGKVTVVALG  132



>gb|AFZ84925.1| nucleoside N-ribohydrolase 3_v2 [Physcomitrella patens]
Length=350

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 83/110 (75%), Gaps = 0/110 (0%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKP  431
            +AILMAFQ P +E++GLTTIFGNV T+ AT NAL L E+AG P++PVAEG  E LKR KP
Sbjct  35   MAILMAFQAPEIEVIGLTTIFGNVNTDLATINALHLCEMAGHPEIPVAEGPSEPLKRVKP  94

Query  432  RIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
            RIA F HG+DGLG      P  +K+ + A+DFL++ V+EFP EV+++ LG
Sbjct  95   RIAYFEHGSDGLGETYQAKPNFQKLSKDAADFLIENVTEFPGEVTVVGLG  144



>gb|AFZ84924.1| nucleoside N-ribohydrolase 3 [Physcomitrella patens]
Length=338

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 83/110 (75%), Gaps = 0/110 (0%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKP  431
            +AILMAFQ P +E++GLTTIFGNV T+ AT NAL L E+AG P++PVAEG  E LKR KP
Sbjct  35   MAILMAFQAPEIEVIGLTTIFGNVNTDLATINALHLCEMAGHPEIPVAEGPSEPLKRVKP  94

Query  432  RIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
            RIA F HG+DGLG      P  +K+ + A+DFL++ V+EFP EV+++ LG
Sbjct  95   RIAYFEHGSDGLGETYQAKPNFQKLSKDAADFLIENVTEFPGEVTVVGLG  144



>gb|ACJ85074.1| unknown [Medicago truncatula]
 gb|AES60051.2| inosine-uridine preferring nucleoside hydrolase [Medicago truncatula]
Length=322

 Score =   132 bits (333),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 85/111 (77%), Gaps = 1/111 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRG-K  428
            +AI +A ++P ++++GLTTI+GNV T  ATRNAL L EVAGR D+PVAEGS   L +G K
Sbjct  22   MAIFLALRSPEVQVIGLTTIYGNVYTTLATRNALHLLEVAGRTDIPVAEGSHVTLTKGTK  81

Query  429  PRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             RIADFVHGADGLGN N PPP  K IE+SA+ FLV++    P +++++ALG
Sbjct  82   LRIADFVHGADGLGNQNFPPPNGKPIEESAASFLVNQAKANPGKITVVALG  132



>ref|XP_001752621.1| predicted protein [Physcomitrella patens]
 gb|EDQ82492.1| predicted protein [Physcomitrella patens]
Length=348

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 83/110 (75%), Gaps = 0/110 (0%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKP  431
            +AILMAFQ P +E++GLTTIFGNV T+ AT NAL L E+AG P++PVAEG  E LKR KP
Sbjct  22   MAILMAFQAPEIEVIGLTTIFGNVNTDLATINALHLCEMAGHPEIPVAEGPSEPLKRVKP  81

Query  432  RIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
            RIA F HG+DGLG      P  +K+ + A+DFL++ V+EFP EV+++ LG
Sbjct  82   RIAYFEHGSDGLGETYQAKPNFQKLSKDAADFLIENVTEFPGEVTVVGLG  131



>gb|AFZ84926.1| nucleoside N-ribohydrolase 3_v3 [Physcomitrella patens]
Length=377

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 83/110 (75%), Gaps = 0/110 (0%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKP  431
            +AILMAFQ P +E++GLTTIFGNV T+ AT NAL L E+AG P++PVAEG  E LKR KP
Sbjct  35   MAILMAFQAPEIEVIGLTTIFGNVNTDLATINALHLCEMAGHPEMPVAEGPSEPLKRVKP  94

Query  432  RIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
            RIA F HG+DGLG      P  +K+ + A+DFL++ V+EFP EV+++ LG
Sbjct  95   RIAYFEHGSDGLGETYQAKPNFQKLSKDAADFLIENVTEFPGEVTVVGLG  144



>ref|XP_011005265.1| PREDICTED: probable uridine nucleosidase 2 [Populus euphratica]
Length=321

 Score =   132 bits (332),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 85/111 (77%), Gaps = 1/111 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRG-K  428
            +AI +A ++P +E++GLTTI+GNV T  ATRNAL L EVAGR D+PVAEGS   + +G K
Sbjct  20   MAIFLALRSPEVEVIGLTTIYGNVYTTLATRNALHLLEVAGRTDIPVAEGSHVTITKGTK  79

Query  429  PRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             RIADFVHGADGLGN N  PPK K +EQSA+ FLV++    P +V+++ALG
Sbjct  80   LRIADFVHGADGLGNQNFDPPKGKPVEQSAAAFLVEQAKLHPGKVTVVALG  130



>ref|XP_002310384.1| inosine-uridine preferring nucleoside hydrolase family protein 
[Populus trichocarpa]
 gb|EEE90834.1| inosine-uridine preferring nucleoside hydrolase family protein 
[Populus trichocarpa]
Length=321

 Score =   132 bits (332),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 85/111 (77%), Gaps = 1/111 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRG-K  428
            +AI +A ++P +E++GLTTI+GNV T  ATRNAL L EVAGR D+PVAEGS   + +G K
Sbjct  20   MAIFLALRSPEVEVIGLTTIYGNVYTTLATRNALHLLEVAGRTDIPVAEGSHVTITKGTK  79

Query  429  PRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             RIADFVHGADGLGN N  PPK K +EQSA+ FLV++    P +V+++ALG
Sbjct  80   LRIADFVHGADGLGNQNFDPPKGKPVEQSAAAFLVEQAKLHPGKVTVVALG  130



>ref|XP_006353123.1| PREDICTED: probable uridine nucleosidase 2-like [Solanum tuberosum]
Length=321

 Score =   132 bits (332),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 85/111 (77%), Gaps = 1/111 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRG-K  428
            +AI +A ++P +E++GLTTI+GNV T  ATRNAL L ++AGR D+PVAEGS   + +G K
Sbjct  20   MAIFVALESPEVEMIGLTTIYGNVYTTLATRNALHLLDIAGRTDIPVAEGSHVTITKGTK  79

Query  429  PRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             RIADFVHG DGLGN N P P  K IEQ+A+DFLV + S +P +V+++ALG
Sbjct  80   LRIADFVHGTDGLGNQNFPAPNGKPIEQNAADFLVQQASLYPGKVTVVALG  130



>gb|EMS60980.1| hypothetical protein TRIUR3_20777 [Triticum urartu]
Length=303

 Score =   132 bits (331),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 85/111 (77%), Gaps = 1/111 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRG-K  428
            +AI +A ++P LE++GLTTIFGNV T  ATRNAL L E AGR D+PVAEGS   +K+  K
Sbjct  1    MAIFVALRSPELEVVGLTTIFGNVYTALATRNALHLLETAGRTDIPVAEGSHVTIKKATK  60

Query  429  PRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             RIA FVHG+DGLGN N PPP  K ++QSA+ FLV++ + +P +V+++ALG
Sbjct  61   LRIASFVHGSDGLGNQNFPPPAGKALDQSAAAFLVEQANLYPGQVTVIALG  111



>ref|XP_002280271.1| PREDICTED: probable uridine nucleosidase 2 [Vitis vinifera]
 emb|CBI24758.3| unnamed protein product [Vitis vinifera]
Length=320

 Score =   132 bits (331),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 85/111 (77%), Gaps = 1/111 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRG-K  428
            +AI +A Q+P ++++GLTTI+GNV T  ATRNAL L E+AGR D+PVAEGS   + +G K
Sbjct  19   MAIFVALQSPEVDVIGLTTIYGNVYTTLATRNALHLLEIAGRTDIPVAEGSHVTITKGTK  78

Query  429  PRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             RIADFVHGADGLGN N PP   K IEQSA+ FL+++   +P +V+++ALG
Sbjct  79   LRIADFVHGADGLGNQNFPPSAGKPIEQSAAAFLIEQAKLYPGKVTVVALG  129



>ref|XP_004251983.1| PREDICTED: probable uridine nucleosidase 2 [Solanum lycopersicum]
Length=321

 Score =   132 bits (331),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/111 (57%), Positives = 85/111 (77%), Gaps = 1/111 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRG-K  428
            +AI +A ++P +E++GLTTI+GNV T  ATRNAL L ++AGR D+PVAEGS   + +G K
Sbjct  20   MAIFVALESPEVEVIGLTTIYGNVYTTLATRNALHLLDIAGRTDIPVAEGSHVTITKGTK  79

Query  429  PRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             RIADFVHG DGLGN N P P  K IEQ+A+DFLV + S +P +++++ALG
Sbjct  80   LRIADFVHGTDGLGNQNFPAPNGKPIEQNAADFLVQQASLYPGKITVVALG  130



>ref|XP_004498093.1| PREDICTED: probable uridine nucleosidase 2-like [Cicer arietinum]
Length=322

 Score =   132 bits (331),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 85/111 (77%), Gaps = 1/111 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRG-K  428
            +AI +A ++P +E++GLTTI+GNV T  ATRNAL L EVAGR D+PVAEGS   L +G K
Sbjct  22   MAIFLALRSPEVEVIGLTTIYGNVYTTLATRNALHLLEVAGRTDIPVAEGSHVTLTKGTK  81

Query  429  PRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             RIADFVHGADGLGN N PPP  K +E+SA+ FLV++    P +++++ALG
Sbjct  82   LRIADFVHGADGLGNQNFPPPNGKPLEESAAAFLVNQAKANPGKITVVALG  132



>ref|XP_009610288.1| PREDICTED: probable uridine nucleosidase 2 [Nicotiana tomentosiformis]
 ref|XP_009610289.1| PREDICTED: probable uridine nucleosidase 2 [Nicotiana tomentosiformis]
Length=321

 Score =   132 bits (331),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 63/111 (57%), Positives = 85/111 (77%), Gaps = 1/111 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRG-K  428
            +AI +A Q+P +E++GLTTI+GNV T  ATRNAL L +VAGR D+PVAEGS   + +G K
Sbjct  20   MAIFVALQSPEIEVIGLTTIYGNVYTSLATRNALHLLDVAGRTDIPVAEGSHVTITKGTK  79

Query  429  PRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             RIADFVHG DGLGN N P P  K I+Q+A++FL+ + S +P +V+++ALG
Sbjct  80   LRIADFVHGTDGLGNQNFPAPNGKPIDQNAAEFLIQQASLYPGKVTVVALG  130



>ref|XP_004287181.1| PREDICTED: probable uridine nucleosidase 2 [Fragaria vesca subsp. 
vesca]
Length=322

 Score =   132 bits (331),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 85/111 (77%), Gaps = 1/111 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRG-K  428
            +AI +A ++P +E++GLTTI+GNV T  ATRNAL L E AGR D+PVAEGS   + +G K
Sbjct  21   MAIFVALKSPEVEVIGLTTIYGNVYTTLATRNALHLLEFAGRTDIPVAEGSHVTITQGTK  80

Query  429  PRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             RIADFVHG DGLGN N PPPK K IEQSA+ FLV++ +  P +V+++ALG
Sbjct  81   LRIADFVHGTDGLGNQNFPPPKGKPIEQSAAAFLVEQANLHPGKVTLVALG  131



>ref|XP_006606983.1| PREDICTED: probable uridine nucleosidase 2-like isoform X2 [Glycine 
max]
Length=287

 Score =   130 bits (328),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 82/111 (74%), Gaps = 1/111 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRG-K  428
            +AI +A Q+P +E++GLTTIFGNV T  ATRNAL L EVAGR D+PVAEGS      G K
Sbjct  22   MAIFLALQSPEVEVIGLTTIFGNVYTTLATRNALHLLEVAGRTDIPVAEGSHVTSTNGTK  81

Query  429  PRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             R+ADFVHG DGLGN N PPPK K IE+SA+ FLV +    P +V+++ALG
Sbjct  82   LRVADFVHGVDGLGNQNFPPPKGKPIEESAASFLVHQAKVNPGKVTVVALG  132



>ref|XP_006418002.1| hypothetical protein EUTSA_v10008223mg [Eutrema salsugineum]
 gb|ESQ36355.1| hypothetical protein EUTSA_v10008223mg [Eutrema salsugineum]
Length=320

 Score =   131 bits (330),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 63/111 (57%), Positives = 86/111 (77%), Gaps = 1/111 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRG-K  428
            +AI +A ++P ++++GLTTI+GNV T  ATRNAL L EVAGR D+PVAEG+ + +  G K
Sbjct  19   MAIFVALKSPEVDVIGLTTIYGNVYTTLATRNALHLLEVAGRTDIPVAEGTQKTILNGTK  78

Query  429  PRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             RIADFVHG DGLGN N PPPK K IE++A +FLV++   +P E++++ALG
Sbjct  79   LRIADFVHGKDGLGNQNFPPPKGKPIEKTAPEFLVEQAKLYPGEITVVALG  129



>ref|XP_010228384.1| PREDICTED: probable uridine nucleosidase 2 [Brachypodium distachyon]
Length=329

 Score =   131 bits (330),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 65/112 (58%), Positives = 88/112 (79%), Gaps = 2/112 (2%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRG-K  428
            +AI +A ++P LE+LGLTT+FGNV T  ATRNAL L E+AGR D+PVAEGSP  +K+  K
Sbjct  26   MAIFVALRSPELEVLGLTTVFGNVHTALATRNALHLLEIAGRTDIPVAEGSPVTVKKATK  85

Query  429  PRIADFVHGADGLGNLNVPPPKSKKIE-QSASDFLVDKVSEFPSEVSILALG  581
             RIA FVHG+DGLGN N PPP  K ++ QSA++FLV++ + +P +V+++ALG
Sbjct  86   LRIASFVHGSDGLGNQNFPPPAGKPLDGQSAAEFLVEQANLYPGQVTVVALG  137



>ref|XP_010457655.1| PREDICTED: probable uridine nucleosidase 2 isoform X4 [Camelina 
sativa]
Length=311

 Score =   131 bits (329),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 83/111 (75%), Gaps = 1/111 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEA-LKRGK  428
            +AI +A  +P ++++GLTTIFGNV T  ATRNAL L EVAGR D+PVAEG+ +  L   K
Sbjct  1    MAIFVALNSPEVDVIGLTTIFGNVYTTLATRNALHLLEVAGRTDIPVAEGTHQTFLNEKK  60

Query  429  PRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             RIADFVHG DGLGN N PPPK K IE+S  +FLV++   +P E++++ALG
Sbjct  61   VRIADFVHGKDGLGNQNFPPPKGKPIEKSGPEFLVEQAKLYPGEITVVALG  111



>gb|KHN08006.1| Putative uridine nucleosidase 2 [Glycine soja]
Length=323

 Score =   131 bits (329),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 82/111 (74%), Gaps = 1/111 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRG-K  428
            +AI +A Q+P +E++GLTTIFGNV T  ATRNAL L EVAGR D+PVAEGS      G K
Sbjct  22   MAIFLALQSPEVEVIGLTTIFGNVYTTLATRNALHLLEVAGRTDIPVAEGSHVTSTNGTK  81

Query  429  PRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             R+ADFVHG DGLGN N PPPK K IE+SA+ FLV +    P +V+++ALG
Sbjct  82   LRVADFVHGVDGLGNQNFPPPKGKPIEESAASFLVHQAKVNPGKVTVVALG  132



>ref|XP_002963726.1| hypothetical protein SELMODRAFT_80581 [Selaginella moellendorffii]
 gb|EFJ35597.1| hypothetical protein SELMODRAFT_80581 [Selaginella moellendorffii]
Length=326

 Score =   131 bits (329),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 84/111 (76%), Gaps = 1/111 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALK-RGK  428
            +AIL+AFQ+P L+++GLTT FGNV+T  AT+NAL L E+AGR D+PVA+G  ++LK   K
Sbjct  25   MAILLAFQSPELDVIGLTTTFGNVSTSMATQNALHLCELAGREDIPVAQGLHKSLKGDTK  84

Query  429  PRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
                DF+HG DGLGN N P PK K I+ +AS+F + KV EFP EV+I+ALG
Sbjct  85   EHAVDFIHGKDGLGNTNPPAPKGKPIDMTASEFFISKVKEFPGEVTIIALG  135



>ref|XP_003556968.1| PREDICTED: probable uridine nucleosidase 2-like isoform X1 [Glycine 
max]
Length=323

 Score =   131 bits (329),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 82/111 (74%), Gaps = 1/111 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRG-K  428
            +AI +A Q+P +E++GLTTIFGNV T  ATRNAL L EVAGR D+PVAEGS      G K
Sbjct  22   MAIFLALQSPEVEVIGLTTIFGNVYTTLATRNALHLLEVAGRTDIPVAEGSHVTSTNGTK  81

Query  429  PRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             R+ADFVHG DGLGN N PPPK K IE+SA+ FLV +    P +V+++ALG
Sbjct  82   LRVADFVHGVDGLGNQNFPPPKGKPIEESAASFLVHQAKVNPGKVTVVALG  132



>ref|XP_010457653.1| PREDICTED: probable uridine nucleosidase 2 isoform X2 [Camelina 
sativa]
Length=322

 Score =   131 bits (329),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 83/111 (75%), Gaps = 1/111 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEA-LKRGK  428
            +AI +A  +P ++++GLTTIFGNV T  ATRNAL L EVAGR D+PVAEG+ +  L   K
Sbjct  19   MAIFVALNSPEVDVIGLTTIFGNVYTTLATRNALHLLEVAGRTDIPVAEGTHQTFLNEKK  78

Query  429  PRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             RIADFVHG DGLGN N PPPK K IE+S  +FLV++   +P E++++ALG
Sbjct  79   VRIADFVHGKDGLGNQNFPPPKGKPIEKSGPEFLVEQAKLYPGEITVVALG  129



>gb|ABR16229.1| unknown [Picea sitchensis]
Length=326

 Score =   131 bits (329),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 84/111 (76%), Gaps = 1/111 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRG-K  428
            +AI +A Q+P ++++GLTTI+GNV T  AT NAL L EVAGR D+PVAEGS  ++K   K
Sbjct  25   MAIFLALQSPEVDVIGLTTIYGNVRTTLATTNALHLLEVAGREDIPVAEGSHTSIKEVPK  84

Query  429  PRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             R A F HG DGLG +N+ PPK K I QSASDFL++K +EFP EV+++ALG
Sbjct  85   LRFAAFAHGCDGLGEINIVPPKGKPIPQSASDFLIEKANEFPGEVTVVALG  135



>dbj|BAJ94046.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86429.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96661.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=326

 Score =   131 bits (329),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 84/111 (76%), Gaps = 1/111 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRG-K  428
            +AI  A ++P LE++GLTTIFGNV T  ATRNAL L E AGR D+PVAEGS   +K+  K
Sbjct  24   MAIFAALRSPELEVVGLTTIFGNVYTALATRNALHLLETAGRTDIPVAEGSHVTIKKATK  83

Query  429  PRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             RIA FVHG+DGLGN N PPP  K ++QSA+ FLV++ + +P +V+++ALG
Sbjct  84   LRIASFVHGSDGLGNQNFPPPAGKAVDQSAAAFLVEQANLYPGQVTVVALG  134



>ref|XP_010485120.1| PREDICTED: probable uridine nucleosidase 2 [Camelina sativa]
Length=320

 Score =   130 bits (328),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 83/111 (75%), Gaps = 1/111 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEA-LKRGK  428
            +AI +A  +P ++++GLTTIFGNV T  ATRNAL L EVAGR D+PVAEG+ +  L   K
Sbjct  19   MAIFVALNSPEVDVIGLTTIFGNVYTTLATRNALHLLEVAGRTDIPVAEGTHQTFLNEKK  78

Query  429  PRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             RIADFVHG DGLGN N PPPK K IE+S  +FLV++   +P E++++ALG
Sbjct  79   VRIADFVHGKDGLGNQNFPPPKGKPIEKSGPEFLVEQAKLYPGEITVVALG  129



>gb|AFK46096.1| unknown [Medicago truncatula]
Length=322

 Score =   130 bits (328),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 84/111 (76%), Gaps = 1/111 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRG-K  428
            +AI +A ++P ++++GLTTI+GNV T  ATRNAL L EVAGR D+PVAEGS   L +G K
Sbjct  22   MAIFLALRSPEVQVIGLTTIYGNVYTTLATRNALHLLEVAGRTDIPVAEGSHVTLTKGTK  81

Query  429  PRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             RIADFVHGADGLGN N PPP  K IE+SA+ FLV++    P ++++ ALG
Sbjct  82   LRIADFVHGADGLGNQNFPPPNGKPIEESAASFLVNQAKANPGKITVEALG  132



>ref|XP_010457654.1| PREDICTED: probable uridine nucleosidase 2 isoform X3 [Camelina 
sativa]
Length=320

 Score =   130 bits (328),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 83/111 (75%), Gaps = 1/111 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEA-LKRGK  428
            +AI +A  +P ++++GLTTIFGNV T  ATRNAL L EVAGR D+PVAEG+ +  L   K
Sbjct  19   MAIFVALNSPEVDVIGLTTIFGNVYTTLATRNALHLLEVAGRTDIPVAEGTHQTFLNEKK  78

Query  429  PRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             RIADFVHG DGLGN N PPPK K IE+S  +FLV++   +P E++++ALG
Sbjct  79   VRIADFVHGKDGLGNQNFPPPKGKPIEKSGPEFLVEQAKLYPGEITVVALG  129



>ref|XP_010457651.1| PREDICTED: probable uridine nucleosidase 2 isoform X1 [Camelina 
sativa]
Length=329

 Score =   130 bits (328),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 83/111 (75%), Gaps = 1/111 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEA-LKRGK  428
            +AI +A  +P ++++GLTTIFGNV T  ATRNAL L EVAGR D+PVAEG+ +  L   K
Sbjct  19   MAIFVALNSPEVDVIGLTTIFGNVYTTLATRNALHLLEVAGRTDIPVAEGTHQTFLNEKK  78

Query  429  PRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             RIADFVHG DGLGN N PPPK K IE+S  +FLV++   +P E++++ALG
Sbjct  79   VRIADFVHGKDGLGNQNFPPPKGKPIEKSGPEFLVEQAKLYPGEITVVALG  129



>gb|EMS58664.1| hypothetical protein TRIUR3_01534 [Triticum urartu]
Length=319

 Score =   130 bits (328),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 84/110 (76%), Gaps = 9/110 (8%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKP  431
            VAI+MAFQ P +E+LGLTTIFGN TT  ATRNAL+L     R  +    GS      GKP
Sbjct  29   VAIMMAFQAPGVEVLGLTTIFGNCTTAYATRNALIL----ARKILFDWLGS-----GGKP  79

Query  432  RIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
            ++ADFVHG+DGLGN++VP P +KK EQ+A++FLVDKVS+FP EVS+LALG
Sbjct  80   QVADFVHGSDGLGNVSVPEPTTKKAEQTAAEFLVDKVSQFPGEVSVLALG  129



>ref|XP_009761342.1| PREDICTED: probable uridine nucleosidase 2 [Nicotiana sylvestris]
Length=321

 Score =   130 bits (327),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/111 (57%), Positives = 84/111 (76%), Gaps = 1/111 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRG-K  428
            +AI +A Q+P +E++GLTTI+GNV T  ATRNAL L +VAGR D+PVAEGS   + +G K
Sbjct  20   MAIFVALQSPEIEVIGLTTIYGNVYTSLATRNALHLLDVAGRTDIPVAEGSHVTITKGTK  79

Query  429  PRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             RIADFVHG DGLGN N P P  K I+Q+A++FL+ + S +P +V ++ALG
Sbjct  80   LRIADFVHGTDGLGNQNFPAPNGKPIDQNAAEFLIQQASLYPGKVIVVALG  130



>ref|XP_007027687.1| Uridine-ribohydrolase 1 isoform 2, partial [Theobroma cacao]
 gb|EOY08189.1| Uridine-ribohydrolase 1 isoform 2, partial [Theobroma cacao]
Length=275

 Score =   129 bits (324),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/82 (77%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = +3

Query  336  ATRNALLLREVAGRPDVPVAEGSPEALKRGKPRIADFVHGADGLGNLNVPPPKSKKIEQS  515
            AT NALLL E+AG PDVPVAEGSPE LK G+PRIADFVHG+DGLGN+ +PP K+KK E+S
Sbjct  1    ATCNALLLCEIAGCPDVPVAEGSPEPLKGGRPRIADFVHGSDGLGNIFLPPQKTKKSEKS  60

Query  516  ASDFLVDKVSEFPSEVSILALG  581
            AS+FLV+KVSE+P EVSILALG
Sbjct  61   ASEFLVEKVSEYPGEVSILALG  82



>ref|XP_010314790.1| PREDICTED: probable uridine nucleosidase 2 isoform X2 [Solanum 
lycopersicum]
Length=313

 Score =   130 bits (326),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/111 (55%), Positives = 85/111 (77%), Gaps = 1/111 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRG-K  428
            +AI +A Q+P +E++GLTTIFGNV T  +TRNAL L E+AGR D+PVAEGS   +  G K
Sbjct  20   IAIFVALQSPEIEVIGLTTIFGNVQTTLSTRNALHLLEIAGRTDIPVAEGSHVTITEGVK  79

Query  429  PRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             + + +VHGADGLGN N+ PPK K IEQ+A++FL+ + S +P +V+++ALG
Sbjct  80   LQSSGYVHGADGLGNQNISPPKGKAIEQTAAEFLIQQTSLYPGKVTVVALG  130



>ref|XP_009111046.1| PREDICTED: probable uridine nucleosidase 2 [Brassica rapa]
Length=322

 Score =   130 bits (326),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 86/111 (77%), Gaps = 1/111 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRG-K  428
            +AI +A ++P ++++GLTTI+GNV T  ATRNAL L EVAGR D+PVAEG+ + +  G K
Sbjct  21   MAIFVALKSPEVDVIGLTTIYGNVYTALATRNALHLLEVAGRTDIPVAEGTHKTILNGTK  80

Query  429  PRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             R+ADFVHG DGLGN N PPP+ K IE+SA +FLV++   +P E++++ALG
Sbjct  81   LRVADFVHGKDGLGNQNFPPPEGKPIEKSAPEFLVEQAKLYPGEITVVALG  131



>ref|XP_006305378.1| hypothetical protein CARUB_v10009769mg [Capsella rubella]
 gb|EOA38276.1| hypothetical protein CARUB_v10009769mg [Capsella rubella]
Length=320

 Score =   129 bits (325),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 83/111 (75%), Gaps = 1/111 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEA-LKRGK  428
            +AI +A  +P ++++GLTTIFGNV T  ATRNAL L EVAGR D+PVAEG+ +  LK  K
Sbjct  19   MAIFVALNSPEVDVIGLTTIFGNVYTTLATRNALHLLEVAGRTDIPVAEGTHQTFLKEKK  78

Query  429  PRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             RIADFVHG DGLGN N PPPK K IE+S  +FLV++    P +++++ALG
Sbjct  79   VRIADFVHGKDGLGNQNFPPPKGKPIEKSGPEFLVEQAKLHPGQITVVALG  129



>ref|XP_004253041.1| PREDICTED: probable uridine nucleosidase 2 isoform X1 [Solanum 
lycopersicum]
Length=321

 Score =   129 bits (325),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/111 (55%), Positives = 85/111 (77%), Gaps = 1/111 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRG-K  428
            +AI +A Q+P +E++GLTTIFGNV T  +TRNAL L E+AGR D+PVAEGS   +  G K
Sbjct  20   IAIFVALQSPEIEVIGLTTIFGNVQTTLSTRNALHLLEIAGRTDIPVAEGSHVTITEGVK  79

Query  429  PRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             + + +VHGADGLGN N+ PPK K IEQ+A++FL+ + S +P +V+++ALG
Sbjct  80   LQSSGYVHGADGLGNQNISPPKGKAIEQTAAEFLIQQTSLYPGKVTVVALG  130



>emb|CDY15547.1| BnaA08g28310D [Brassica napus]
Length=322

 Score =   129 bits (325),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 86/111 (77%), Gaps = 1/111 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRG-K  428
            +AI +A ++P ++++GLTTI+GNV T  ATRNAL L EVAGR D+PVAEG+ + +  G K
Sbjct  21   MAIFVALKSPEVDVIGLTTIYGNVYTALATRNALHLLEVAGRTDIPVAEGTHKTILNGTK  80

Query  429  PRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             R+ADFVHG DGLGN N PPP+ K IE+SA +FLV++   +P E++++ALG
Sbjct  81   LRVADFVHGKDGLGNQNFPPPEGKPIEKSAPEFLVEQAKLYPGEITVVALG  131



>gb|KJB77096.1| hypothetical protein B456_012G120100 [Gossypium raimondii]
Length=302

 Score =   129 bits (324),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 65/115 (57%), Positives = 86/115 (75%), Gaps = 5/115 (4%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEAL-----  416
            +AI +A ++P +E++GLTTI+GNV T  ATRNAL L EVA R D+PVAEGS   +     
Sbjct  23   MAIFVALRSPEVEVIGLTTIYGNVYTTLATRNALHLLEVADRTDIPVAEGSHVTITFCTQ  82

Query  417  KRGKPRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
            K  K RIADFVHGADGLGN N PPP+ K I+ SA+DFLV++ + +P +V+++ALG
Sbjct  83   KGTKLRIADFVHGADGLGNQNFPPPEGKPIDMSATDFLVEQANLYPGKVTVVALG  137



>gb|AAS07209.1| putative inosine-uridine preferring nucleoside hydrolase (with 
alternative splicing) [Oryza sativa Japonica Group]
 gb|AAW34239.1| putative inosine-uridine preferring nucleoside hydrolase [Oryza 
sativa Japonica Group]
 gb|ABF96708.1| Inosine-uridine preferring nucleoside hydrolase family protein, 
expressed [Oryza sativa Japonica Group]
Length=258

 Score =   128 bits (321),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/111 (57%), Positives = 84/111 (76%), Gaps = 1/111 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRG-K  428
            +AI +A ++P +E+LGLTTIFGNV T  ATRNAL L E  GR D+PVAEGS   +K+  K
Sbjct  20   MAIFVALRSPEVELLGLTTIFGNVYTTLATRNALHLLEAVGRTDIPVAEGSHVTIKKATK  79

Query  429  PRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             RIA FVHG+DGLGN N PPP  K ++QSA+ FLV++ + +P +V+++ALG
Sbjct  80   LRIASFVHGSDGLGNQNFPPPTGKPLDQSAAAFLVEQANLYPGQVTVVALG  130



>ref|XP_002889557.1| inosine-uridine preferring nucleoside hydrolase family protein 
[Arabidopsis lyrata subsp. lyrata]
 gb|EFH65816.1| inosine-uridine preferring nucleoside hydrolase family protein 
[Arabidopsis lyrata subsp. lyrata]
Length=322

 Score =   129 bits (325),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 83/111 (75%), Gaps = 1/111 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEA-LKRGK  428
            +AI +A  +P ++++GLTTIFGNV T  ATRNAL L EVAGR D+PVAEG+ +  L   K
Sbjct  21   MAIFVALNSPEVDVIGLTTIFGNVYTTLATRNALHLLEVAGRTDIPVAEGTHKTFLNDTK  80

Query  429  PRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             RIADFVHG DGLGN N PPPK K IE+S  +FLV++   +P E++++ALG
Sbjct  81   LRIADFVHGKDGLGNQNFPPPKGKPIEKSGPEFLVEQAKLYPGEITVVALG  131



>gb|KJB77095.1| hypothetical protein B456_012G120100 [Gossypium raimondii]
Length=327

 Score =   129 bits (324),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 65/115 (57%), Positives = 86/115 (75%), Gaps = 5/115 (4%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEAL-----  416
            +AI +A ++P +E++GLTTI+GNV T  ATRNAL L EVA R D+PVAEGS   +     
Sbjct  23   MAIFVALRSPEVEVIGLTTIYGNVYTTLATRNALHLLEVADRTDIPVAEGSHVTITFCTQ  82

Query  417  KRGKPRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
            K  K RIADFVHGADGLGN N PPP+ K I+ SA+DFLV++ + +P +V+++ALG
Sbjct  83   KGTKLRIADFVHGADGLGNQNFPPPEGKPIDMSATDFLVEQANLYPGKVTVVALG  137



>emb|CAN75814.1| hypothetical protein VITISV_004635 [Vitis vinifera]
Length=316

 Score =   129 bits (323),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 83/110 (75%), Gaps = 3/110 (3%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKP  431
            +AI +A Q+P ++++GLTTI+GNV T  ATRNAL L E+AGR D+PVAEGS    K  K 
Sbjct  19   MAIFVALQSPEVDVIGLTTIYGNVYTTLATRNALHLLEIAGRTDIPVAEGSH---KGTKL  75

Query  432  RIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
            RIADFVHGADGLGN N PP   K IEQSA+ FL+++   +P +V+++ALG
Sbjct  76   RIADFVHGADGLGNQNFPPSAGKPIEQSAAAFLIEQAKLYPGKVTVVALG  125



>gb|AFW79716.1| hypothetical protein ZEAMMB73_657631 [Zea mays]
Length=303

 Score =   128 bits (322),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 84/111 (76%), Gaps = 1/111 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRG-K  428
            +AI +A ++P LE+LGLTT FGNV T  ATRNAL L E  GR D+PVAEGS   +K+  K
Sbjct  1    MAIFVALRSPELEVLGLTTTFGNVHTALATRNALHLLEAVGRTDIPVAEGSHVTIKKATK  60

Query  429  PRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             RIA FVHG+DGLGN + PPP +K I+QSA+ FLV++ + +P +V+I+ALG
Sbjct  61   LRIASFVHGSDGLGNQDFPPPATKPIDQSAAAFLVEQANLYPGQVTIVALG  111



>tpg|DAA53927.1| TPA: hypothetical protein ZEAMMB73_327365 [Zea mays]
Length=303

 Score =   128 bits (322),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 63/111 (57%), Positives = 84/111 (76%), Gaps = 1/111 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRG-K  428
            +AI +A ++P LE+LGLTT FGNV T  ATRNAL L E  GR D+PVAEGS   +K+  K
Sbjct  1    MAIFLALRSPELEVLGLTTTFGNVHTALATRNALHLLEAVGRTDIPVAEGSHVTIKKATK  60

Query  429  PRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             RIA FVHG+DGLGN + PPP +K ++QSA+ FLV++ + +P +VS++ALG
Sbjct  61   LRIASFVHGSDGLGNQDFPPPATKPVDQSAAAFLVEQANLYPGQVSVVALG  111



>gb|EMT01801.1| hypothetical protein F775_09054 [Aegilops tauschii]
Length=303

 Score =   128 bits (322),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 63/111 (57%), Positives = 84/111 (76%), Gaps = 1/111 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRG-K  428
            +AI +A ++P LE++GLTTIFGNV T  ATRNAL L E AGR D+PVAEGS   +K+  K
Sbjct  1    MAIFVALRSPELEVVGLTTIFGNVYTALATRNALHLLETAGRTDIPVAEGSHVTIKKATK  60

Query  429  PRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             RIA FVHG+DGLGN N PPP  K  EQ+A+ FLV++ + +P +++++ALG
Sbjct  61   LRIASFVHGSDGLGNQNFPPPAGKAGEQAAAAFLVEQANLYPGQITVVALG  111



>ref|XP_002974810.1| hypothetical protein SELMODRAFT_101709 [Selaginella moellendorffii]
 gb|EFJ24330.1| hypothetical protein SELMODRAFT_101709 [Selaginella moellendorffii]
Length=326

 Score =   129 bits (323),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 63/111 (57%), Positives = 83/111 (75%), Gaps = 1/111 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALK-RGK  428
            +AIL+AFQ+P L+++GLTT FGNV+T  AT+NAL L E+AGR D+PVA+G  ++LK   K
Sbjct  25   MAILLAFQSPELDVIGLTTTFGNVSTSMATQNALHLCELAGREDIPVAQGLHKSLKGDTK  84

Query  429  PRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
                DF+HG DGLGN N P PK K I+ +A +F + KV EFP EV+I+ALG
Sbjct  85   EHAVDFIHGKDGLGNTNPPAPKGKPIDMTAPEFFISKVKEFPGEVTIIALG  135



>emb|CDX86570.1| BnaC08g01330D [Brassica napus]
Length=209

 Score =   125 bits (315),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 85/111 (77%), Gaps = 1/111 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRG-K  428
            +AI +A ++P ++++GLTTI+GNV T  ATRNAL L EVAGR D+PVAEG+ + +  G K
Sbjct  21   MAIFVALKSPEVDVIGLTTIYGNVYTTLATRNALHLLEVAGRTDIPVAEGTHKTILNGTK  80

Query  429  PRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             R+ADFVHG DGLGN N PPP+ K IE+SA +FLV++    P E++++ALG
Sbjct  81   LRVADFVHGEDGLGNQNFPPPEGKPIEKSAPEFLVEQAKLHPGEITVVALG  131



>ref|NP_001150443.1| nucleoside N-ribohydrolase 1a [Zea mays]
 gb|ACF82876.1| unknown [Zea mays]
 gb|ACG39125.1| pyrimidine-specific ribonucleoside hydrolase rihA [Zea mays]
 gb|AFW79717.1| Pyrimidine-specific ribonucleoside hydrolase rihA [Zea mays]
Length=326

 Score =   128 bits (322),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 84/111 (76%), Gaps = 1/111 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRG-K  428
            +AI +A ++P LE+LGLTT FGNV T  ATRNAL L E  GR D+PVAEGS   +K+  K
Sbjct  24   MAIFVALRSPELEVLGLTTTFGNVHTALATRNALHLLEAVGRTDIPVAEGSHVTIKKATK  83

Query  429  PRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             RIA FVHG+DGLGN + PPP +K I+QSA+ FLV++ + +P +V+I+ALG
Sbjct  84   LRIASFVHGSDGLGNQDFPPPATKPIDQSAAAFLVEQANLYPGQVTIVALG  134



>gb|AAS07208.1| putative inosine-uridine preferring nucleoside hydrolase, 3'-partial 
(with alternative splicing) [Oryza sativa Japonica Group]
Length=313

 Score =   128 bits (322),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 63/111 (57%), Positives = 84/111 (76%), Gaps = 1/111 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRG-K  428
            +AI +A ++P +E+LGLTTIFGNV T  ATRNAL L E  GR D+PVAEGS   +K+  K
Sbjct  20   MAIFVALRSPEVELLGLTTIFGNVYTTLATRNALHLLEAVGRTDIPVAEGSHVTIKKATK  79

Query  429  PRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             RIA FVHG+DGLGN N PPP  K ++QSA+ FLV++ + +P +V+++ALG
Sbjct  80   LRIASFVHGSDGLGNQNFPPPTGKPLDQSAAAFLVEQANLYPGQVTVVALG  130



>gb|ADX07370.1| nucleoside N-ribohydrolase 1b [Zea mays]
Length=325

 Score =   128 bits (322),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 63/111 (57%), Positives = 84/111 (76%), Gaps = 1/111 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRG-K  428
            +AI +A ++P LE+LGLTT FGNV T  ATRNAL L E  GR D+PVAEGS   +K+  K
Sbjct  23   MAIFLALRSPELEVLGLTTTFGNVHTALATRNALHLLEAVGRTDIPVAEGSHVTIKKATK  82

Query  429  PRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             RIA FVHG+DGLGN + PPP +K ++QSA+ FLV++ + +P +VS++ALG
Sbjct  83   LRIASFVHGSDGLGNQDFPPPATKPVDQSAAAFLVEQANLYPGQVSVVALG  133



>ref|NP_001050402.1| Os03g0425200 [Oryza sativa Japonica Group]
 gb|AAP20832.1| putative inosine-uridine preferring nucleoside hydrolase [Oryza 
sativa Japonica Group]
 gb|ABF96707.1| Inosine-uridine preferring nucleoside hydrolase family protein, 
expressed [Oryza sativa Japonica Group]
 dbj|BAF12316.1| Os03g0425200 [Oryza sativa Japonica Group]
 gb|EEC75517.1| hypothetical protein OsI_12125 [Oryza sativa Indica Group]
 gb|EEE59292.1| hypothetical protein OsJ_11337 [Oryza sativa Japonica Group]
Length=322

 Score =   128 bits (322),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 63/111 (57%), Positives = 84/111 (76%), Gaps = 1/111 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRG-K  428
            +AI +A ++P +E+LGLTTIFGNV T  ATRNAL L E  GR D+PVAEGS   +K+  K
Sbjct  20   MAIFVALRSPEVELLGLTTIFGNVYTTLATRNALHLLEAVGRTDIPVAEGSHVTIKKATK  79

Query  429  PRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             RIA FVHG+DGLGN N PPP  K ++QSA+ FLV++ + +P +V+++ALG
Sbjct  80   LRIASFVHGSDGLGNQNFPPPTGKPLDQSAAAFLVEQANLYPGQVTVVALG  130



>ref|NP_001132212.1| uncharacterized protein LOC100193643 [Zea mays]
 gb|ACF80973.1| unknown [Zea mays]
Length=325

 Score =   128 bits (322),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 63/111 (57%), Positives = 84/111 (76%), Gaps = 1/111 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRG-K  428
            +AI +A ++P LE+LGLTT FGNV T  ATRNAL L E  GR D+PVAEGS   +K+  K
Sbjct  23   MAIFLALRSPELEVLGLTTTFGNVHTALATRNALHLLEAVGRTDIPVAEGSHVTIKKATK  82

Query  429  PRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             RIA FVHG+DGLGN + PPP +K ++QSA+ FLV++ + +P +VS++ALG
Sbjct  83   LRIASFVHGSDGLGNQDFPPPATKPVDQSAAAFLVEQANLYPGQVSVVALG  133



>tpg|DAA53926.1| TPA: pyrimidine-specific ribonucleoside hydrolase rihA [Zea mays]
Length=325

 Score =   128 bits (322),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 63/111 (57%), Positives = 84/111 (76%), Gaps = 1/111 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRG-K  428
            +AI +A ++P LE+LGLTT FGNV T  ATRNAL L E  GR D+PVAEGS   +K+  K
Sbjct  23   MAIFLALRSPELEVLGLTTTFGNVHTALATRNALHLLEAVGRTDIPVAEGSHVTIKKATK  82

Query  429  PRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             RIA FVHG+DGLGN + PPP +K ++QSA+ FLV++ + +P +VS++ALG
Sbjct  83   LRIASFVHGSDGLGNQDFPPPATKPVDQSAAAFLVEQANLYPGQVSVVALG  133



>ref|NP_001117234.1| inosine nucleoside hydrolase [Arabidopsis thaliana]
 gb|AEE27867.1| putative uridine nucleosidase 2 [Arabidopsis thaliana]
Length=302

 Score =   127 bits (320),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 82/111 (74%), Gaps = 1/111 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEA-LKRGK  428
            +AI +A  +P ++++GLTTIFGNV T  ATRNAL L EVAGR D+PVAEG+ +  L   K
Sbjct  1    MAIFVALNSPEVDVIGLTTIFGNVYTTLATRNALHLLEVAGRTDIPVAEGTHKTFLNDTK  60

Query  429  PRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             RIADFVHG DGLGN N PPPK K IE+S  +FLV++    P E++++ALG
Sbjct  61   LRIADFVHGKDGLGNQNFPPPKGKPIEKSGPEFLVEQAKLCPGEITVVALG  111



>ref|XP_009619043.1| PREDICTED: uridine nucleosidase 1-like, partial [Nicotiana tomentosiformis]
Length=274

 Score =   127 bits (318),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +3

Query  342  RNALLLREVAGRPDVPVAEGSPEALKRGKPRIADFVHGADGLGNLNVPPPKSKKIEQSAS  521
            RNAL+L E  G PD+PVAEGS E+LKRG+P +ADFVHG+DGLGNL +P P SKKIE+SAS
Sbjct  4    RNALILCETEGYPDIPVAEGSLESLKRGEPHVADFVHGSDGLGNLCLPAPNSKKIEKSAS  63

Query  522  DFLVDKVSEFPSEVSILALG  581
            +FLVDKVSE+P EVSILALG
Sbjct  64   EFLVDKVSEYPGEVSILALG  83



>gb|ADX07369.1| nucleoside N-ribohydrolase 1a [Zea mays]
Length=326

 Score =   128 bits (321),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 63/111 (57%), Positives = 84/111 (76%), Gaps = 1/111 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRG-K  428
            +AI +A ++P LE+LGLTT FGNV T  ATRNAL L E  GR D+PVAEGS   +K+  K
Sbjct  24   MAIFVALRSPELEVLGLTTTFGNVHTALATRNALHLLEAVGRTDIPVAEGSHVTIKKATK  83

Query  429  PRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             RIA FVHG+DGLGN + PPP +K ++QSA+ FLV++ + +P +V+I+ALG
Sbjct  84   LRIASFVHGSDGLGNQDFPPPATKPVDQSAAAFLVEQANLYPGQVTIVALG  134



>ref|NP_563745.1| inosine nucleoside hydrolase [Arabidopsis thaliana]
 sp|Q8LAC4.1|URH2_ARATH RecName: Full=Probable uridine nucleosidase 2; AltName: Full=Uridine 
ribohydrolase 2 [Arabidopsis thaliana]
 gb|AAM65464.1| unknown [Arabidopsis thaliana]
 gb|AAN72060.1| expressed protein [Arabidopsis thaliana]
 gb|AAP42733.1| At1g05620 [Arabidopsis thaliana]
 gb|AEE27866.1| putative uridine nucleosidase 2 [Arabidopsis thaliana]
Length=322

 Score =   127 bits (320),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 82/111 (74%), Gaps = 1/111 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEA-LKRGK  428
            +AI +A  +P ++++GLTTIFGNV T  ATRNAL L EVAGR D+PVAEG+ +  L   K
Sbjct  21   MAIFVALNSPEVDVIGLTTIFGNVYTTLATRNALHLLEVAGRTDIPVAEGTHKTFLNDTK  80

Query  429  PRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             RIADFVHG DGLGN N PPPK K IE+S  +FLV++    P E++++ALG
Sbjct  81   LRIADFVHGKDGLGNQNFPPPKGKPIEKSGPEFLVEQAKLCPGEITVVALG  131



>ref|XP_010475268.1| PREDICTED: probable uridine nucleosidase 2 [Camelina sativa]
Length=321

 Score =   127 bits (320),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 82/111 (74%), Gaps = 1/111 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEA-LKRGK  428
            +AI +A  +P ++++GLTTIFGNV T  ATRNAL L EVAGR D+PVAEG+ +  +   K
Sbjct  19   MAIFVALNSPEVDVIGLTTIFGNVYTTLATRNALHLLEVAGRTDIPVAEGTHQTFMNEKK  78

Query  429  PRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             RIADFVHG DGLGN   PPPK K IE+S  +FLV++   +P E++++ALG
Sbjct  79   VRIADFVHGKDGLGNQYFPPPKGKPIEKSGPEFLVEQAKLYPGEITVVALG  129



>ref|XP_002455360.1| hypothetical protein SORBIDRAFT_03g009290 [Sorghum bicolor]
 gb|EES00480.1| hypothetical protein SORBIDRAFT_03g009290 [Sorghum bicolor]
Length=326

 Score =   127 bits (319),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 84/111 (76%), Gaps = 1/111 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRG-K  428
            +AI +A ++P LE+LGLTT FGNV T  ATRNAL L E  GR D+PVAEGS   +K+  K
Sbjct  24   MAIFVALRSPELEVLGLTTTFGNVHTALATRNALHLLEAVGRTDIPVAEGSHVTIKKATK  83

Query  429  PRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             RIA FVHG+DGLGN + PPP +K ++QSA+ FLV++ + +P +V+++ALG
Sbjct  84   LRIASFVHGSDGLGNQDFPPPATKPVDQSAAAFLVEQANLYPGQVTVVALG  134



>gb|AAD30614.1|AC007153_6 Hypothetical protein [Arabidopsis thaliana]
Length=358

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 82/111 (74%), Gaps = 1/111 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEA-LKRGK  428
            +AI +A  +P ++++GLTTIFGNV T  ATRNAL L EVAGR D+PVAEG+ +  L   K
Sbjct  36   MAIFVALNSPEVDVIGLTTIFGNVYTTLATRNALHLLEVAGRTDIPVAEGTHKTFLNDTK  95

Query  429  PRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             RIADFVHG DGLGN N PPPK K IE+S  +FLV++    P E++++ALG
Sbjct  96   LRIADFVHGKDGLGNQNFPPPKGKPIEKSGPEFLVEQAKLCPGEITVVALG  146



>ref|XP_010522248.1| PREDICTED: probable uridine nucleosidase 2 [Tarenaya hassleriana]
Length=322

 Score =   127 bits (318),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 82/111 (74%), Gaps = 1/111 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRG-K  428
            +AI +A ++P ++++GLTTI+GNV T  ATRNAL L EVA R D+PVAEG+   +  G K
Sbjct  21   MAIFVALKSPEVDVIGLTTIYGNVYTTLATRNALHLLEVADRTDIPVAEGTHTTITNGTK  80

Query  429  PRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             RIADFVHG DGLGN N PPPK K IE+SA ++L ++    P E+S++ALG
Sbjct  81   LRIADFVHGTDGLGNQNFPPPKGKAIEKSAPEYLAEQAKLHPGEISVVALG  131



>ref|XP_006342441.1| PREDICTED: probable uridine nucleosidase 2-like [Solanum tuberosum]
Length=321

 Score =   126 bits (317),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 84/111 (76%), Gaps = 1/111 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRG-K  428
            +AI +A Q+P +E++GLTTIFGNV T  +TRNAL L E+AGR D+PVAEGS   +  G K
Sbjct  20   IAIFVALQSPEIEVIGLTTIFGNVHTTLSTRNALHLLEIAGRTDIPVAEGSHVTVTEGVK  79

Query  429  PRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             + + +VHG DGLGN N+ PPK K IEQ+A++FL+ + S +P +V+++ALG
Sbjct  80   LQSSGYVHGTDGLGNQNISPPKGKPIEQTAAEFLIQQASLYPGKVTVVALG  130



>ref|NP_001148640.1| pyrimidine-specific ribonucleoside hydrolase rihA [Zea mays]
 gb|ACG32356.1| pyrimidine-specific ribonucleoside hydrolase rihA [Zea mays]
Length=325

 Score =   126 bits (317),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 83/111 (75%), Gaps = 1/111 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRG-K  428
            +AI +A ++P LE+LGLTT FGNV T  ATRNAL L E  GR D+PVAEGS   +K+  K
Sbjct  23   MAIFLALRSPELEVLGLTTTFGNVHTALATRNALHLLEAVGRTDIPVAEGSHLTIKKATK  82

Query  429  PRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             RIA FVHG+DGLGN + PPP +K + QSA+ FLV++ + +P +V+++ALG
Sbjct  83   LRIASFVHGSDGLGNQDFPPPATKPVNQSAAAFLVEQANLYPGQVTVVALG  133



>ref|XP_008676026.1| PREDICTED: probable uridine nucleosidase 2 [Zea mays]
Length=175

 Score =   121 bits (304),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 81/111 (73%), Gaps = 1/111 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRG-K  428
            +AI +A ++P LE+LGLTT FGNV T  ATRNAL L E  GR D+PVAEGS   +K+  K
Sbjct  23   IAIFLALRSPELEVLGLTTTFGNVHTALATRNALHLLEAVGRTDIPVAEGSHLTIKKATK  82

Query  429  PRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             RIA FVHG DGLGN + P P +K ++QSA+ FLV++ + +P +V+++ LG
Sbjct  83   LRIASFVHGTDGLGNQDFPRPATKPVDQSAAVFLVEQTNLYPGQVTVVTLG  133



>ref|XP_010557049.1| PREDICTED: probable uridine nucleosidase 2 [Tarenaya hassleriana]
Length=322

 Score =   124 bits (312),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/111 (55%), Positives = 82/111 (74%), Gaps = 1/111 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRG-K  428
            +AI +A ++P ++++GLTTI+GNV T  ATRNAL L E A R D+PV+EG+   +  G K
Sbjct  21   MAIFVALRSPEVDVIGLTTIYGNVYTTLATRNALHLLEAADRTDIPVSEGTHTTITNGTK  80

Query  429  PRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             RIADFVHG DGLGN N PPPK K IE+SA ++LV++    P E++I+ALG
Sbjct  81   LRIADFVHGTDGLGNQNFPPPKGKPIEKSAPEYLVEQAKLHPGEITIVALG  131



>ref|XP_004967883.1| PREDICTED: probable uridine nucleosidase 2-like [Setaria italica]
Length=325

 Score =   123 bits (309),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 83/111 (75%), Gaps = 1/111 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRG-K  428
            +AI +A ++P LE+LGLTT FGNV T  ATRNAL L E  GR D+PVAEGS   +K+  K
Sbjct  23   MAIFVALRSPELEVLGLTTTFGNVHTALATRNALHLLEAVGRTDIPVAEGSHVTIKKASK  82

Query  429  PRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             RIA FVHG+DGLGN + P P +K ++Q+A+ F+V++ + +P +V+I+ALG
Sbjct  83   LRIASFVHGSDGLGNQDFPAPATKPVDQTAAAFMVEQANLYPGQVTIVALG  133



>ref|XP_006651516.1| PREDICTED: probable uridine nucleosidase 2-like [Oryza brachyantha]
Length=317

 Score =   122 bits (306),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 84/125 (67%), Gaps = 15/125 (12%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKR---  422
            +AI +A ++P LE+LGLTTIFGNV T  ATRNAL L E  GR D+PVAEGS   +K+   
Sbjct  1    MAIFVALRSPELELLGLTTIFGNVYTTLATRNALHLLEAVGRTDIPVAEGSHVTVKQVIS  60

Query  423  ------------GKPRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVS  566
                         K RIA FVHG+DGLGN N PPP  + ++QSA+ FLV++ + +P +V+
Sbjct  61   YLISLSRVTKKATKLRIASFVHGSDGLGNQNFPPPAGRPVDQSAAAFLVEQANLYPGQVT  120

Query  567  ILALG  581
            ++ALG
Sbjct  121  VVALG  125



>gb|ABR26176.1| pyrimidine-specific ribonucleoside hydrolase riha [Oryza sativa 
Indica Group]
Length=266

 Score =   119 bits (297),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 59/99 (60%), Positives = 75/99 (76%), Gaps = 1/99 (1%)
 Frame = +3

Query  288  EILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRG-KPRIADFVHGADG  464
            E+LGLTTIFGNV T  ATRNAL L E  GR D+PVAEGS   +K+  K RIA FVHG+DG
Sbjct  1    ELLGLTTIFGNVYTTLATRNALHLLEAVGRTDIPVAEGSHVTIKKATKLRIASFVHGSDG  60

Query  465  LGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
            LGN N PPP  K ++QSA+ FLV++ + +P +V+++ALG
Sbjct  61   LGNQNFPPPTGKPLDQSAAAFLVEQANLYPGQVTVVALG  99



>ref|XP_002972452.1| hypothetical protein SELMODRAFT_97048 [Selaginella moellendorffii]
 gb|EFJ26538.1| hypothetical protein SELMODRAFT_97048 [Selaginella moellendorffii]
Length=334

 Score =   117 bits (294),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 78/110 (71%), Gaps = 0/110 (0%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKP  431
            +AI+MA ++P +E++G+TTIFG+  T + TRNAL L EV G   VPVAEG+ + +  G P
Sbjct  32   MAIIMALRSPEVEVIGITTIFGSAHTPDVTRNALHLLEVMGSTHVPVAEGNIKPMAGGVP  91

Query  432  RIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             I DF +G DGLGN+    P +KK   SA DFLVD VS++P E++I+ALG
Sbjct  92   YIQDFANGLDGLGNIATAEPATKKSAMSACDFLVDTVSKYPGEITIVALG  141



>ref|XP_002984283.1| hypothetical protein SELMODRAFT_180819 [Selaginella moellendorffii]
 gb|EFJ14793.1| hypothetical protein SELMODRAFT_180819 [Selaginella moellendorffii]
Length=334

 Score =   117 bits (294),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 78/110 (71%), Gaps = 0/110 (0%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKP  431
            +AI+MA ++P +E++G+TTIFG+  T + TRNAL L EV G   VPVAEG+ + +  G P
Sbjct  32   MAIIMALRSPEVEVIGITTIFGSAHTPDVTRNALHLLEVMGSTHVPVAEGNIKPMAGGVP  91

Query  432  RIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             I DF +G DGLGN+    P +KK   SA DFLVD VS++P E++I+ALG
Sbjct  92   YIQDFANGLDGLGNIATADPATKKSAMSACDFLVDTVSKYPGEITIVALG  141



>ref|WP_012069248.1| nucleoside hydrolase [Marinomonas sp. MWYL1]
 ref|YP_001340398.1| inosine/uridine-preferring nucleoside hydrolase [Marinomonas 
sp. MWYL1]
 gb|ABR70463.1| Inosine/uridine-preferring nucleoside hydrolase [Marinomonas 
sp. MWYL1]
Length=313

 Score =   115 bits (288),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 60/110 (55%), Positives = 77/110 (70%), Gaps = 1/110 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKP  431
            +AI  AFQ   LE+LGLTT FGNV+ + AT+NA+ L E+A + +VPVA+G     K    
Sbjct  17   MAIFFAFQASQLEVLGLTTTFGNVSVDLATQNAITLTEIA-KVNVPVAKGVAVPSKIAPR  75

Query  432  RIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
               DFVHGADG GN++ P PK K IE+SA+ F+VD V EFP EV+I+ALG
Sbjct  76   PHPDFVHGADGFGNIDWPAPKGKAIEKSAAQFIVDTVREFPGEVTIIALG  125



>ref|WP_024022427.1| nucleoside hydrolase [Marinomonas profundimaris]
 gb|ETI62358.1| nucleoside hydrolase [Marinomonas profundimaris]
Length=313

 Score =   114 bits (285),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 58/110 (53%), Positives = 75/110 (68%), Gaps = 1/110 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKP  431
            +AI  AFQ P L++LGLTT FGNV  E AT+NA+ L E+A + DVPVA+G          
Sbjct  17   MAIFFAFQAPQLDVLGLTTTFGNVPVELATQNAITLTEIA-KVDVPVAQGVSVPFVIAPR  75

Query  432  RIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
               DFVHG DG GN+N P PK K I++SA+ F+VD V ++P EV+I+ALG
Sbjct  76   PHPDFVHGKDGFGNINWPAPKGKAIDKSAAQFIVDTVRKYPGEVTIIALG  125



>ref|WP_036160357.1| nucleoside hydrolase [Marinomonas ushuaiensis]
 gb|ETX11333.1| nucleoside hydrolase [Marinomonas ushuaiensis DSM 15871]
Length=313

 Score =   113 bits (283),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 80/113 (71%), Gaps = 7/113 (6%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGS--PEALK-R  422
            +AI  AFQ P L++LGLTT FGNV+ + AT+NA+ L E+A + DVPVA+G   P  +  R
Sbjct  17   MAIFFAFQAPQLDVLGLTTTFGNVSVDLATQNAITLAEIA-KVDVPVAKGVAVPSVIAPR  75

Query  423  GKPRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
              P   DFVHG DG GN+N P PK K I++SA+ F+VD V ++P EV+I+ALG
Sbjct  76   PHP---DFVHGKDGFGNINWPAPKGKAIDKSAAQFIVDTVRQYPGEVTIIALG  125



>gb|AES60050.2| inosine-uridine preferring nucleoside hydrolase [Medicago truncatula]
Length=322

 Score =   113 bits (283),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 78/111 (70%), Gaps = 1/111 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEAL-KRGK  428
            +AI +A ++P ++++GLTTI+GNV T  ATRNAL L E AGR D+PVAEGS   L K  K
Sbjct  22   MAIFLALRSPEVQVIGLTTIYGNVYTTLATRNALHLLEFAGRTDIPVAEGSHVTLTKETK  81

Query  429  PRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
              I D VHGADGLGN N PPP  K +E+SA+ F V++      +++++ALG
Sbjct  82   LHIRDSVHGADGLGNQNFPPPNGKPLEESAAAFFVNQAKANRGKITVVALG  132



>ref|XP_002502123.1| inosine-uridine preferring nucleoside hydrolase [Micromonas sp. 
RCC299]
 gb|ACO63381.1| inosine-uridine preferring nucleoside hydrolase [Micromonas sp. 
RCC299]
Length=339

 Score =   113 bits (282),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 81/110 (74%), Gaps = 2/110 (2%)
 Frame = +3

Query  255  AILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRG-KP  431
            AI +A ++P +E++G+T++FGNV T+ AT+NAL L E  GRPD+PV EGS  ++    K 
Sbjct  27   AICLALRSPEVEVIGITSLFGNVRTKMATQNALYLMEKFGRPDIPVVEGSLTSIVGAEKE  86

Query  432  RIADFVHGADGLGNLNVPPPKSKKIE-QSASDFLVDKVSEFPSEVSILAL  578
            RIADFVHG DG GN N P P    +E ++A+DF+V+K +EFP +V+++A+
Sbjct  87   RIADFVHGDDGFGNTNQPKPTLVAVEGKTAADFIVEKANEFPGQVTVVAM  136



>ref|XP_005652379.1| hypothetical protein COCSUDRAFT_83455 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE27835.1| hypothetical protein COCSUDRAFT_83455 [Coccomyxa subellipsoidea 
C-169]
Length=319

 Score =   112 bits (281),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 76/112 (68%), Gaps = 3/112 (3%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKP  431
            +AIL AF +P +E++GLTT+FGNV T+ ATRNA  L E+A    VPVAEG+   L  G P
Sbjct  20   MAILAAFNSPEVEVIGLTTVFGNVYTQTATRNAFKLLELAEMTQVPVAEGAHVTLN-GTP  78

Query  432  R--IADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
            +  +ADFVHG DG GN+N+   +  K    A++F+V  V E P EVSILALG
Sbjct  79   KTWVADFVHGTDGFGNINIDIAEGTKWSGCAAEFIVQTVRENPGEVSILALG  130



>ref|XP_001783230.1| predicted protein [Physcomitrella patens]
 gb|EDQ51925.1| predicted protein [Physcomitrella patens]
 gb|AFR46616.1| nucleoside N-ribohydrolase 1 [Physcomitrella patens]
Length=333

 Score =   113 bits (282),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 78/112 (70%), Gaps = 3/112 (3%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRG--  425
            +AI  A ++P L+++ LTTI+GNV T  AT NAL L E AGR D+PV+EG   +L RG  
Sbjct  32   MAIFFALKSPELDVIALTTIYGNVRTPTATVNALHLLEFAGREDIPVSEGFRTSL-RGEL  90

Query  426  KPRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
            K RIADFVHGADGLGN        K I+  A D+L+ KV+EFP E++I+ALG
Sbjct  91   KERIADFVHGADGLGNTYPTLSDRKPIDTFAPDYLIQKVNEFPGEITIVALG  142



>pdb|4KPN|A Chain A, Plant Nucleoside Hydrolase - Ppnrh1 Enzyme
 pdb|4KPN|B Chain B, Plant Nucleoside Hydrolase - Ppnrh1 Enzyme
 pdb|4KPN|C Chain C, Plant Nucleoside Hydrolase - Ppnrh1 Enzyme
 pdb|4KPN|D Chain D, Plant Nucleoside Hydrolase - Ppnrh1 Enzyme
 pdb|4KPN|E Chain E, Plant Nucleoside Hydrolase - Ppnrh1 Enzyme
 pdb|4KPN|F Chain F, Plant Nucleoside Hydrolase - Ppnrh1 Enzyme
 pdb|4KPN|G Chain G, Plant Nucleoside Hydrolase - Ppnrh1 Enzyme
 pdb|4KPN|H Chain H, Plant Nucleoside Hydrolase - Ppnrh1 Enzyme
Length=345

 Score =   112 bits (281),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 78/112 (70%), Gaps = 3/112 (3%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRG--  425
            +AI  A ++P L+++ LTTI+GNV T  AT NAL L E AGR D+PV+EG   +L RG  
Sbjct  44   MAIFFALKSPELDVIALTTIYGNVRTPTATVNALHLLEFAGREDIPVSEGFRTSL-RGEL  102

Query  426  KPRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
            K RIADFVHGADGLGN        K I+  A D+L+ KV+EFP E++I+ALG
Sbjct  103  KERIADFVHGADGLGNTYPTLSDRKPIDTFAPDYLIQKVNEFPGEITIVALG  154



>ref|WP_013796756.1| nucleoside hydrolase [Marinomonas posidonica]
 gb|AEF55281.1| Inosine/uridine-preferring nucleoside hydrolase [Marinomonas 
posidonica IVIA-Po-181]
Length=313

 Score =   110 bits (276),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 79/113 (70%), Gaps = 7/113 (6%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGS--PEALK-R  422
            +AI  AFQ P LE+LGLTT FGNV+ + AT+NA+ L E+A + DVPVA+G   P  +  R
Sbjct  17   MAIFFAFQAPQLEVLGLTTTFGNVSVDLATQNAITLTEIA-KVDVPVAKGVAVPSVIAPR  75

Query  423  GKPRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
              P   DFVHGADG GN++ P P+ + +EQSA+ F+VD V   P EV+I+ALG
Sbjct  76   PHP---DFVHGADGFGNIDWPAPQGQAVEQSAAQFIVDAVRANPGEVTIVALG  125



>ref|XP_006430246.1| hypothetical protein CICLE_v10012143mg [Citrus clementina]
 gb|ESR43486.1| hypothetical protein CICLE_v10012143mg [Citrus clementina]
Length=263

 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 64/72 (89%), Gaps = 0/72 (0%)
 Frame = +3

Query  366  VAGRPDVPVAEGSPEALKRGKPRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVS  545
            +AG P VPVAEGSPE LK GKPR+A+F HG+DG+GN+++ PPK+KK +++AS+FLVDKVS
Sbjct  1    MAGCPGVPVAEGSPEPLKGGKPRVAEFAHGSDGMGNISLTPPKAKKCDKNASEFLVDKVS  60

Query  546  EFPSEVSILALG  581
            E+P EVSILALG
Sbjct  61   EYPGEVSILALG  72



>gb|KDO61098.1| hypothetical protein CISIN_1g019503mg [Citrus sinensis]
 gb|KDO61099.1| hypothetical protein CISIN_1g019503mg [Citrus sinensis]
Length=263

 Score =   109 bits (273),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 64/72 (89%), Gaps = 0/72 (0%)
 Frame = +3

Query  366  VAGRPDVPVAEGSPEALKRGKPRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVS  545
            +AG P VPVAEGSPE LK GKPR+A+F HG+DG+GN+++ PPK+KK +++AS+FLVDKVS
Sbjct  1    MAGCPGVPVAEGSPEPLKGGKPRVAEFAHGSDGMGNISLTPPKAKKCDKNASEFLVDKVS  60

Query  546  EFPSEVSILALG  581
            E+P EVSILALG
Sbjct  61   EYPGEVSILALG  72



>gb|KJB23785.1| hypothetical protein B456_004G115000 [Gossypium raimondii]
Length=89

 Score =   102 bits (254),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 59/76 (78%), Gaps = 0/76 (0%)
 Frame = +3

Query  267  AFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKPRIADF  446
            + Q P  EILGLTTI GNV TE+ATRNALLL E+A RPDVPVA+GS E L  G+P +ADF
Sbjct  6    SLQNPEYEILGLTTIVGNVQTEDATRNALLLCEIARRPDVPVAQGSLEPLTGGRPIVADF  65

Query  447  VHGADGLGNLNVPPPK  494
            VHG+ GLGN+ + PP 
Sbjct  66   VHGSGGLGNIFLSPPN  81



>gb|KCW88020.1| hypothetical protein EUGRSUZ_A00427 [Eucalyptus grandis]
Length=286

 Score =   106 bits (265),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 55/104 (53%), Positives = 70/104 (67%), Gaps = 5/104 (5%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKP  431
            +AI +  ++P +E++GLTT +G V T  ATR+AL L EVAGR D+PVAE      K  K 
Sbjct  20   MAIFVVLRSPQVEVIGLTTTYGKVYTTLATRDALHLLEVAGRTDIPVAER-----KGAKL  74

Query  432  RIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEV  563
            RI DFVHGADGLGN   PPPK K IEQSA+ FL+ + + +   V
Sbjct  75   RIVDFVHGADGLGNQKFPPPKGKPIEQSAATFLIKQANLYLGNV  118



>ref|XP_002945850.1| hypothetical protein VOLCADRAFT_55637 [Volvox carteri f. nagariensis]
 gb|EFJ52845.1| hypothetical protein VOLCADRAFT_55637 [Volvox carteri f. nagariensis]
Length=327

 Score =   106 bits (265),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 57/113 (50%), Positives = 82/113 (73%), Gaps = 4/113 (4%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAG-RPDVPVAEGSPEALKRGK  428
            +AILMA  +P +++LG+TT++GNV T  AT+NAL L E++G R  V VA+G+  +LK G 
Sbjct  25   MAILMAANSPEVQLLGITTVYGNVPTALATQNALRLLEMSGLRERVTVAQGAARSLKAGT  84

Query  429  P--RIADFVHGADGLGNLNVPPPKSKKI-EQSASDFLVDKVSEFPSEVSILAL  578
               RIADFVHGADG G++ +PPP+ + + + SA++FLV  V+  P  V+ILAL
Sbjct  85   DIERIADFVHGADGFGDIGLPPPQGQHLMDCSAAEFLVRSVNHHPGRVTILAL  137



>ref|WP_013662054.1| nucleoside hydrolase [Marinomonas mediterranea]
 gb|ADZ92151.1| Inosine/uridine-preferring nucleoside hydrolase [Marinomonas 
mediterranea MMB-1]
Length=314

 Score =   106 bits (264),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 77/111 (69%), Gaps = 3/111 (3%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEG-SPEALKRGK  428
            +AI  AFQ   LE+LGLTT+FGNV    AT NAL L E+AG  DVPVAEG S  ++   +
Sbjct  17   MAIFFAFQAKELEVLGLTTVFGNVPVSLATDNALRLTEIAGV-DVPVAEGVSVPSVIEPR  75

Query  429  PRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
            P   DFVHG DG GN++ P PK K +  SA++F+V++V ++P EV+I+AL 
Sbjct  76   PH-PDFVHGTDGFGNIDWPAPKGKAVTLSAAEFIVEQVRKYPGEVTIVALA  125



>ref|WP_028671561.1| nucleoside hydrolase [Saccharospirillum impatiens]
Length=314

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 76/110 (69%), Gaps = 1/110 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKP  431
            +AIL AF+   +E+LGLTT+FGNV+ E AT NAL L ++AG+  VPVA+G+   L     
Sbjct  17   MAILFAFRAEQIEVLGLTTVFGNVSAERATVNALTLSQLAGKT-VPVAKGANTPLMMAPR  75

Query  432  RIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
            + AD+VHG DG GN+N P   +K+  +SA  F+VD V+  P E++++ALG
Sbjct  76   KHADYVHGQDGFGNINWPEATAKRDVRSAPHFIVDTVNAHPGEITLVALG  125



>ref|XP_005845976.1| hypothetical protein CHLNCDRAFT_59718 [Chlorella variabilis]
 gb|EFN53874.1| hypothetical protein CHLNCDRAFT_59718 [Chlorella variabilis]
Length=317

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 76/110 (69%), Gaps = 1/110 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALK-RGK  428
            +AIL AF +P +E++GLT+I+GNV T  ATRNAL L  +AGRPDVPV EG+ ++L+   K
Sbjct  18   MAILAAFNSPEVEVIGLTSIYGNVPTAMATRNALTLCHLAGRPDVPVVEGAHKSLRGAAK  77

Query  429  PRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILAL  578
             RIADFVHG DG GN N P  ++     SA++F+V      P +V +LAL
Sbjct  78   ERIADFVHGRDGFGNTNPPLAQAAAAPGSAAEFIVGMAGRHPGQVVVLAL  127



>ref|WP_043525939.1| nucleoside hydrolase [Halomonas xinjiangensis]
Length=313

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 52/109 (48%), Positives = 76/109 (70%), Gaps = 1/109 (1%)
 Frame = +3

Query  255  AILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKPR  434
            AI +A + P +E+LGLTT +GNV  E AT NALLL E+AG+  +PVA+G+   L + K  
Sbjct  18   AIAIALRHPDIELLGLTTTYGNVNIETATHNALLLSELAGQ-SIPVAQGAAAPLAKTKYP  76

Query  435  IADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
               F+HG +GLGN+ +PP   K + QSA++F+VD V+  P EV+++A+G
Sbjct  77   APAFIHGDNGLGNIELPPVSGKAVSQSAAEFIVDTVNARPGEVTLVAVG  125



>ref|WP_010628627.1| nucleoside hydrolase [Halomonas sp. KM-1]
Length=314

 Score =   104 bits (259),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 53/109 (49%), Positives = 76/109 (70%), Gaps = 0/109 (0%)
 Frame = +3

Query  255  AILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKPR  434
            AI +A + P +E+LGLTT +GNV  E AT N LLL E+AGR DVPVA+G+   + + +  
Sbjct  18   AIAIALRHPDIELLGLTTTYGNVDIETATHNGLLLCELAGRGDVPVAQGAAGPMVKPRHP  77

Query  435  IADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
                +HGA+GLGN+ +P  K KK  +SA+ F+VD V+E P EV+++A+G
Sbjct  78   APAHIHGANGLGNIELPEVKGKKDPRSAAQFIVDTVNERPGEVTLVAVG  126



>gb|EWH01315.1| nucleoside hydrolase [Halomonas sp. BC04]
Length=315

 Score =   104 bits (259),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 53/109 (49%), Positives = 75/109 (69%), Gaps = 0/109 (0%)
 Frame = +3

Query  255  AILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKPR  434
            AI +A + P +E+LGLTT +GNV  E AT NALLL E+AGR DVPVA+G+   + + +  
Sbjct  18   AIAIALRHPEIELLGLTTTYGNVDVETATHNALLLSELAGRDDVPVAQGAAGPMVKPRHP  77

Query  435  IADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
                +HGA+GLGN+ +P  K KK  +SA+ F+VD V   P EV+++A+G
Sbjct  78   APAHIHGANGLGNIELPDVKGKKDPRSAAQFIVDTVDARPGEVTLVAVG  126



>ref|XP_001696220.1| hypothetical protein CHLREDRAFT_23981 [Chlamydomonas reinhardtii]
 gb|EDP08197.1| predicted protein [Chlamydomonas reinhardtii]
Length=300

 Score =   103 bits (258),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 77/112 (69%), Gaps = 3/112 (3%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGR-PDVPVAEGSPEALKRGK  428
            +AIL+A  +P + ++GLTT++GNV T  AT NAL L E+AG   DV VA+G+  +LK G 
Sbjct  21   MAILLAANSPEVRLVGLTTVYGNVPTALATANALRLLEMAGLGQDVVVAQGAARSLKAGM  80

Query  429  P--RIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILAL  578
               RIADFVHGADG G++ +PPPK    + SA++F+V    + P  V+ILAL
Sbjct  81   DVERIADFVHGADGFGDIGLPPPKGAAADCSAAEFIVRTCRQHPGRVTILAL  132



>ref|WP_022953052.1| nucleoside hydrolase [Leucothrix mucor]
Length=315

 Score =   103 bits (257),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 75/110 (68%), Gaps = 1/110 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKP  431
            +AI  A  +P L++LGLTT FGNV+ + AT NAL L E+ G+ D+PVA G+     +   
Sbjct  17   MAIFFALNSPELDVLGLTTTFGNVSVDMATDNALRLLEMIGK-DIPVARGASTPWAQNLL  75

Query  432  RIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
               DFVHGADG GN+N+P PK   IE +A++F+V +V   P+EV+++A+G
Sbjct  76   PYPDFVHGADGFGNVNLPAPKGSPIELTAAEFIVQQVLANPNEVTLVAVG  125



>ref|XP_003589799.1| Pyrimidine-specific ribonucleoside hydrolase rihA [Medicago truncatula]
Length=324

 Score =   103 bits (256),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 58/128 (45%), Positives = 78/128 (61%), Gaps = 18/128 (14%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLL-----------------REVAGRP  380
            +AI +A ++P ++++GLTTI+GNV T  ATRNAL L                  E AGR 
Sbjct  22   MAIFLALRSPEVQVIGLTTIYGNVYTTLATRNALHLIGELLSPADVGQFKPNRLEFAGRT  81

Query  381  DVPVAEGSPEAL-KRGKPRIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPS  557
            D+PVAEGS   L K  K  I D VHGADGLGN N PPP  K +E+SA+ F V++      
Sbjct  82   DIPVAEGSHVTLTKETKLHIRDSVHGADGLGNQNFPPPNGKPLEESAAAFFVNQAKANRG  141

Query  558  EVSILALG  581
            +++++ALG
Sbjct  142  KITVVALG  149



>ref|WP_019366390.1| hypothetical protein [Pseudomonas luteola]
Length=316

 Score =   101 bits (252),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 79/110 (72%), Gaps = 3/110 (3%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKP  431
            +AI+MA   P +E++GLTT FGNV+ E ATRNAL L E+AG+ D+PVA+G    L++   
Sbjct  19   IAIIMA--DPGIEVVGLTTTFGNVSIETATRNALSLVELAGQ-DIPVAQGMGTPLEKTPH  75

Query  432  RIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             +   VHG DGLGNLN+P P  + + QSA++F+V++  + P E++++A+G
Sbjct  76   PVPAHVHGDDGLGNLNLPAPTRQAVSQSAAEFIVEETRKRPGEITLVAVG  125



>ref|WP_010795783.1| hypothetical protein [Pseudomonas sp. HPB0071]
 gb|ENA35049.1| hypothetical protein HMPREF1487_05577 [Pseudomonas sp. HPB0071]
Length=316

 Score =   101 bits (252),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 79/110 (72%), Gaps = 3/110 (3%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKP  431
            +AI+MA   P +E++GLTT FGNV+ E ATRNAL L E+AG+ D+PVA+G    L++   
Sbjct  19   IAIIMA--DPGIEVVGLTTTFGNVSIETATRNALSLVELAGQ-DIPVAQGMGTPLEKTPH  75

Query  432  RIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             +   VHG DGLGNLN+P P  + + QSA++F+V++  + P E++++A+G
Sbjct  76   PVPAHVHGDDGLGNLNLPAPTRQAVSQSAAEFIVEETRKRPGEITLVAVG  125



>ref|WP_043893339.1| nucleoside hydrolase, partial [Osedax symbiont Rs2]
Length=159

 Score = 98.6 bits (244),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 71/110 (65%), Gaps = 1/110 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKP  431
            +AI  A   P +E+L LTT FGNV+ E AT NAL L E+AG  D+PVA+G          
Sbjct  16   MAIFTAMAHPQIELLALTTTFGNVSVEQATTNALSLVEMAGL-DIPVAKGVASPWVNELN  74

Query  432  RIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
               DFVHG DG GN+N+  PK + I QSA+ F+V++V+  P E++++A+G
Sbjct  75   PFPDFVHGVDGFGNVNLAAPKGQPIAQSAAQFIVEQVNAHPGEITLVAVG  124



>ref|XP_003057409.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH59054.1| predicted protein [Micromonas pusilla CCMP1545]
Length=365

 Score =   101 bits (252),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 82/112 (73%), Gaps = 5/112 (4%)
 Frame = +3

Query  255  AILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKPR  434
            A+L+A ++P ++ILG+TT++GNVTT+ AT+NAL L E+ GRPDVPV +GS  +L  G+P+
Sbjct  16   ALLLAIRSPEVQILGVTTLYGNVTTKMATKNALYLLELFGRPDVPVVQGSETSLT-GEPQ  74

Query  435  --IADFVHGADGLGNLNVPPPKSKKI-EQSASDFLVDKVSEF-PSEVSILAL  578
              IADFVHG DG GN     P+   +  ++A++F+V+ V+   P EV+++AL
Sbjct  75   NHIADFVHGDDGFGNTRRSNPRGTAVPGKTAAEFIVETVNAHDPREVTVIAL  126



>ref|WP_025733755.1| nucleoside hydrolase [Carnimonas nigrificans]
Length=314

 Score =   100 bits (248),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 79/110 (72%), Gaps = 3/110 (3%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKP  431
            +AI+MA   P +E++GLTT FGNV  + ATRNALLL E+AG  D+PVA+G+   L +   
Sbjct  19   IAIIMA--DPEIEVVGLTTTFGNVHIDTATRNALLLSELAGH-DIPVAQGAAAPLLKKPF  75

Query  432  RIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
             + D++HGADGLGN  +P    + ++++A++F++D+  + P E++++A+G
Sbjct  76   PVPDWIHGADGLGNQELPEVTGRAVDKTAAEFIIDETRKRPGEITLVAVG  125



>ref|WP_024952902.1| nucleoside hydrolase [Cobetia crustatorum]
Length=317

 Score =   100 bits (248),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 75/109 (69%), Gaps = 1/109 (1%)
 Frame = +3

Query  255  AILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKPR  434
            AI +    P +E LG+TT FGNVT E AT NALLL E+AG+  +PVA+G+ + L + K  
Sbjct  18   AIAICLAHPDIEFLGMTTTFGNVTIETATSNALLLGELAGQ-SIPVAQGASQPLVKDKFP  76

Query  435  IADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
                +HGA+GLGN+++P PK K +  SA  F+V++V+  P E++++A+G
Sbjct  77   APAHIHGANGLGNMDIPTPKGKALAISAPQFIVEQVNARPGEITLVAVG  125



>ref|WP_019950298.1| hypothetical protein [Kushneria aurantia]
Length=317

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 70/109 (64%), Gaps = 0/109 (0%)
 Frame = +3

Query  255  AILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKPR  434
            AI +    P +E++G+TT FGNV    ATRNALLL E+ G+P +PVA+G    L +    
Sbjct  19   AIALIMADPDIEVVGMTTTFGNVRVATATRNALLLAELGGQPQIPVAQGVDHPLCKTPYP  78

Query  435  IADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
            +  F+HG DGLGN  +P P  +   ++A+ FL+DK  E P E+S++A+G
Sbjct  79   VPAFIHGDDGLGNQPLPTPSGQPDARNAAQFLIDKTRERPGEISLVAVG  127



>gb|KDD76385.1| inosine-uridine preferring nucleoside hydrolase [Helicosporidium 
sp. ATCC 50920]
Length=311

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 59/125 (47%), Positives = 77/125 (62%), Gaps = 16/125 (13%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRG--  425
            +AI+ AF +P + +LGLTTIFGNV T  ATRNAL L  +AGR DVPV  G+  +L RG  
Sbjct  1    MAIISAFNSPEVAVLGLTTIFGNVPTAMATRNALYLTHLAGRSDVPVVPGASFSL-RGVE  59

Query  426  KPRIADFVHGADGLGNLNVPPPKSK------KIE-------QSASDFLVDKVSEFPSEVS  566
            K R+ADFVHG DG GN N+  P+++      KI+       + A+ F+       P EV 
Sbjct  60   KSRVADFVHGVDGFGNTNIEHPEARLFRAFLKIDVNLAPSAEPAAQFICRMARAHPGEVV  119

Query  567  ILALG  581
            +LALG
Sbjct  120  LLALG  124



>ref|WP_019810135.1| inosine/uridine-preferring nucleoside hydrolase [Osedax symbiont 
Rs1]
 gb|EPJ46713.1| inosine/uridine-preferring nucleoside hydrolase [Osedax symbiont 
Rs1]
Length=317

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 71/110 (65%), Gaps = 1/110 (1%)
 Frame = +3

Query  252  VAILMAFQTPHLEILGLTTIFGNVTTENATRNALLLREVAGRPDVPVAEGSPEALKRGKP  431
            +AI  A   P +E+LGLTT FGNV+ + AT NAL L E+AG  DVPVA G      +   
Sbjct  16   MAIFTAMAHPEIELLGLTTTFGNVSVDQATTNALSLVEMAGV-DVPVARGVATPWVKDLS  74

Query  432  RIADFVHGADGLGNLNVPPPKSKKIEQSASDFLVDKVSEFPSEVSILALG  581
               DFVHG +G GN+++ PPK   I  SA+ F+VD+V+  P EV+++A+G
Sbjct  75   PFPDFVHGVNGFGNVSLAPPKGTAIAISAAQFIVDQVNANPGEVTLVAIG  124



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 710292972220