BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001P18

Length=521
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_002314066.1|  hypothetical protein POPTR_0009s05960g           53.9    1e-05   
ref|XP_011025515.1|  PREDICTED: pheophytinase, chloroplastic          50.4    2e-04   Populus euphratica



>ref|XP_002314066.1| hypothetical protein POPTR_0009s05960g [Populus trichocarpa]
 gb|EEE88021.1| hypothetical protein POPTR_0009s05960g [Populus trichocarpa]
Length=566

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 37/100 (37%), Positives = 54/100 (54%), Gaps = 4/100 (4%)
 Frame = +2

Query  224  MEMVSCYSGACCYVVNVRRELIDRTPSLTQLRIPTRPGRSWCCAAV-IRSGDLRHSGLGN  400
            ME+++  + +CC VVN+R +L +   + +QL++PT   R    A    R+G LR S +  
Sbjct  42   MEILTSSTASCCLVVNLRWKLAENGSNSSQLKLPTSRERKILFARTNQRNGSLRFSSVDK  101

Query  401  FRSKKLI--RRSRGYPIASALKESSSGLLSGNYDSYVVDG  514
            F  KKL   + SR       LK  +S + SGN  SYVV G
Sbjct  102  FL-KKLNHGKGSRSLDSFGGLKNGNSKVFSGNSSSYVVGG  140



>ref|XP_011025515.1| PREDICTED: pheophytinase, chloroplastic [Populus euphratica]
Length=533

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 37/107 (35%), Positives = 53/107 (50%), Gaps = 10/107 (9%)
 Frame = +2

Query  224  MEMVSCYSGACCYVVNVRRELIDRTPSLTQLRIPTRPGRSWCCAAV-IRSGDLRHSGLGN  400
            ME+++  + +CC VVN+R +L +   + +QL++PT   R    A    R+G LR S +  
Sbjct  1    MEILTSSTASCCLVVNLRWKLAENGSNSSQLKLPTSRERKILFARTNQRNGSLRFSSVDK  60

Query  401  FRSK----KLIRR-----SRGYPIASALKESSSGLLSGNYDSYVVDG  514
            F  K    K  R      SR       LK  +S + SGN  SYVV G
Sbjct  61   FLKKLNHGKGSRSLDSFGSRSLDSFGGLKNGNSKVFSGNSSSYVVGG  107



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 566636427000