BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001P17

Length=531
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009631333.1|  PREDICTED: bifunctional purple acid phosphat...    216   4e-64   Nicotiana tomentosiformis
ref|XP_009799030.1|  PREDICTED: bifunctional purple acid phosphat...    214   1e-63   Nicotiana sylvestris
emb|CDP10471.1|  unnamed protein product                                208   2e-61   Coffea canephora [robusta coffee]
gb|EYU34962.1|  hypothetical protein MIMGU_mgv1a005843mg                205   3e-60   Erythranthe guttata [common monkey flower]
ref|XP_009790276.1|  PREDICTED: bifunctional purple acid phosphat...    204   6e-60   Nicotiana sylvestris
ref|XP_009790275.1|  PREDICTED: bifunctional purple acid phosphat...    205   9e-60   Nicotiana sylvestris
ref|XP_009604288.1|  PREDICTED: bifunctional purple acid phosphat...    204   1e-59   Nicotiana tomentosiformis
ref|XP_011078422.1|  PREDICTED: bifunctional purple acid phosphat...    204   2e-59   
ref|XP_011078424.1|  PREDICTED: bifunctional purple acid phosphat...    203   2e-59   
ref|XP_006381099.1|  hypothetical protein POPTR_0006s06250g             203   3e-59   Populus trichocarpa [western balsam poplar]
ref|XP_006350121.1|  PREDICTED: bifunctional purple acid phosphat...    202   7e-59   Solanum tuberosum [potatoes]
ref|XP_006371756.1|  hypothetical protein POPTR_0018s01990g             199   8e-59   
ref|XP_011020214.1|  PREDICTED: bifunctional purple acid phosphat...    201   2e-58   Populus euphratica
ref|XP_004251734.1|  PREDICTED: bifunctional purple acid phosphat...    201   2e-58   Solanum lycopersicum
ref|XP_006371758.1|  hypothetical protein POPTR_0018s01990g             198   4e-58   
ref|XP_006371757.1|  hypothetical protein POPTR_0018s01990g             198   5e-58   
ref|XP_002530765.1|  Iron(III)-zinc(II) purple acid phosphatase p...    199   7e-58   Ricinus communis
ref|XP_011036592.1|  PREDICTED: bifunctional purple acid phosphat...    199   8e-58   Populus euphratica
gb|AGL44397.1|  calcineurin-like phosphoesterase                        198   2e-57   Manihot esculenta [manioc]
ref|XP_006371754.1|  hypothetical protein POPTR_0018s01990g             197   2e-57   
ref|XP_002324876.1|  hypothetical protein POPTR_0018s01990g             198   2e-57   
ref|XP_006389431.1|  hypothetical protein POPTR_0025s00640g             197   6e-57   Populus trichocarpa [western balsam poplar]
ref|XP_006474401.1|  PREDICTED: bifunctional purple acid phosphat...    196   6e-57   
ref|XP_006453106.1|  hypothetical protein CICLE_v10008153mg             197   8e-57   Citrus clementina [clementine]
ref|XP_008242837.1|  PREDICTED: bifunctional purple acid phosphat...    197   8e-57   Prunus mume [ume]
ref|XP_008242841.1|  PREDICTED: bifunctional purple acid phosphat...    196   9e-57   
ref|XP_010557615.1|  PREDICTED: bifunctional purple acid phosphat...    196   1e-56   Tarenaya hassleriana [spider flower]
ref|XP_007202018.1|  hypothetical protein PRUPE_ppa004955mg             195   3e-56   Prunus persica
ref|XP_010687874.1|  PREDICTED: bifunctional purple acid phosphat...    194   4e-56   Beta vulgaris subsp. vulgaris [field beet]
gb|EYU40133.1|  hypothetical protein MIMGU_mgv1a005618mg                194   4e-56   Erythranthe guttata [common monkey flower]
ref|XP_002870408.1|  ATPAP26/PAP26                                      194   5e-56   
gb|KDO73457.1|  hypothetical protein CISIN_1g011679mg                   194   5e-56   Citrus sinensis [apfelsine]
gb|KDO73456.1|  hypothetical protein CISIN_1g011679mg                   194   5e-56   Citrus sinensis [apfelsine]
ref|XP_008373401.1|  PREDICTED: bifunctional purple acid phosphat...    193   9e-56   
ref|XP_011017864.1|  PREDICTED: bifunctional purple acid phosphat...    194   1e-55   Populus euphratica
ref|NP_001275256.1|  purple acid phosphatase 3 precursor                193   1e-55   Solanum tuberosum [potatoes]
ref|XP_010435390.1|  PREDICTED: bifunctional purple acid phosphat...    192   1e-55   
ref|XP_004242741.1|  PREDICTED: bifunctional purple acid phosphat...    193   2e-55   Solanum lycopersicum
ref|XP_010250242.1|  PREDICTED: bifunctional purple acid phosphat...    194   2e-55   Nelumbo nucifera [Indian lotus]
ref|XP_010435389.1|  PREDICTED: bifunctional purple acid phosphat...    193   2e-55   Camelina sativa [gold-of-pleasure]
ref|XP_006359491.1|  PREDICTED: bifunctional purple acid phosphat...    193   2e-55   Solanum tuberosum [potatoes]
ref|NP_198334.1|  purple acid phosphatase 26                            193   2e-55   Arabidopsis thaliana [mouse-ear cress]
gb|AAW29950.1|  putative purple acid phosphatase                        192   2e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010450339.1|  PREDICTED: bifunctional purple acid phosphat...    191   6e-55   
ref|XP_010450337.1|  PREDICTED: bifunctional purple acid phosphat...    191   7e-55   
ref|XP_002515485.1|  Iron(III)-zinc(II) purple acid phosphatase p...    189   4e-54   Ricinus communis
ref|XP_004287267.1|  PREDICTED: bifunctional purple acid phosphat...    189   4e-54   Fragaria vesca subsp. vesca
ref|XP_010096988.1|  Bifunctional purple acid phosphatase 26            188   4e-54   
gb|KDP30232.1|  hypothetical protein JCGZ_17014                         189   4e-54   Jatropha curcas
ref|XP_010440689.1|  PREDICTED: bifunctional purple acid phosphat...    189   5e-54   
ref|XP_007155068.1|  hypothetical protein PHAVU_003G170500g             189   5e-54   Phaseolus vulgaris [French bean]
ref|XP_007155069.1|  hypothetical protein PHAVU_003G170500g             189   5e-54   Phaseolus vulgaris [French bean]
ref|XP_006403101.1|  hypothetical protein EUTSA_v10003451mg             189   6e-54   Eutrema salsugineum [saltwater cress]
ref|XP_010440687.1|  PREDICTED: bifunctional purple acid phosphat...    189   6e-54   Camelina sativa [gold-of-pleasure]
ref|XP_009363959.1|  PREDICTED: bifunctional purple acid phosphat...    188   1e-53   Pyrus x bretschneideri [bai li]
gb|AGV54598.1|  acid phosphatase                                        188   1e-53   Phaseolus vulgaris [French bean]
ref|XP_002264680.1|  PREDICTED: bifunctional purple acid phosphat...    188   1e-53   Vitis vinifera
emb|CBI25544.3|  unnamed protein product                                187   1e-53   Vitis vinifera
ref|XP_010241603.1|  PREDICTED: bifunctional purple acid phosphat...    187   2e-53   Nelumbo nucifera [Indian lotus]
gb|KCW79137.1|  hypothetical protein EUGRSUZ_C00583                     186   2e-53   Eucalyptus grandis [rose gum]
ref|XP_009363960.1|  PREDICTED: bifunctional purple acid phosphat...    187   2e-53   Pyrus x bretschneideri [bai li]
ref|XP_004508441.1|  PREDICTED: bifunctional purple acid phosphat...    187   2e-53   Cicer arietinum [garbanzo]
emb|CAN71549.1|  hypothetical protein VITISV_030234                     187   2e-53   Vitis vinifera
ref|XP_010241604.1|  PREDICTED: bifunctional purple acid phosphat...    187   2e-53   
ref|XP_010648745.1|  PREDICTED: bifunctional purple acid phosphat...    187   3e-53   Vitis vinifera
ref|XP_004508439.1|  PREDICTED: bifunctional purple acid phosphat...    187   3e-53   Cicer arietinum [garbanzo]
gb|KCW79138.1|  hypothetical protein EUGRSUZ_C00583                     185   3e-53   Eucalyptus grandis [rose gum]
ref|XP_006283714.1|  hypothetical protein CARUB_v10004784mg             186   6e-53   
ref|XP_009358556.1|  PREDICTED: bifunctional purple acid phosphat...    186   9e-53   Pyrus x bretschneideri [bai li]
ref|XP_007011812.1|  Purple acid phosphatase 26 isoform 2               186   9e-53   
ref|XP_007011811.1|  Purple acid phosphatase 26 isoform 1               186   1e-52   
ref|XP_010047261.1|  PREDICTED: bifunctional purple acid phosphat...    185   1e-52   Eucalyptus grandis [rose gum]
ref|XP_008362886.1|  PREDICTED: bifunctional purple acid phosphat...    185   1e-52   
ref|XP_008362885.1|  PREDICTED: bifunctional purple acid phosphat...    185   2e-52   
emb|CDY12397.1|  BnaC08g08080D                                          185   2e-52   Brassica napus [oilseed rape]
gb|AGL44396.1|  calcineurin-like phosphoesterase                        184   4e-52   Manihot esculenta [manioc]
gb|AFY06665.1|  purple acid phosphatase                                 184   5e-52   Citrus trifoliata [hardy orange]
ref|NP_001236677.1|  purple acid phosphatase-like protein               184   6e-52   Glycine max [soybeans]
ref|XP_009108064.1|  PREDICTED: bifunctional purple acid phosphat...    183   9e-52   Brassica rapa
ref|XP_008361111.1|  PREDICTED: bifunctional purple acid phosphat...    183   9e-52   
ref|XP_008336971.1|  PREDICTED: bifunctional purple acid phosphat...    183   1e-51   
ref|XP_009108063.1|  PREDICTED: bifunctional purple acid phosphat...    183   1e-51   Brassica rapa
ref|NP_001239650.1|  uncharacterized protein LOC100818438 precursor     182   2e-51   Glycine max [soybeans]
gb|KHG06954.1|  Bifunctional purple acid phosphatase 26 -like pro...    182   2e-51   Gossypium arboreum [tree cotton]
gb|KHN47108.1|  Bifunctional purple acid phosphatase 26                 182   2e-51   Glycine soja [wild soybean]
ref|XP_006852875.1|  hypothetical protein AMTR_s00033p00208170          182   3e-51   
ref|XP_006593472.1|  PREDICTED: uncharacterized protein LOC100818...    182   3e-51   
emb|CDY47560.1|  BnaA08g07270D                                          181   5e-51   Brassica napus [oilseed rape]
gb|KHG11290.1|  Bifunctional purple acid phosphatase 26 -like pro...    181   6e-51   Gossypium arboreum [tree cotton]
gb|KJB65857.1|  hypothetical protein B456_010G116200                    179   6e-51   Gossypium raimondii
emb|CAD30328.1|  acid phosphatase                                       180   1e-50   Lupinus luteus
ref|XP_006450381.1|  hypothetical protein CICLE_v10008150mg             178   1e-50   
gb|KGN65112.1|  hypothetical protein Csa_1G225410                       179   2e-50   Cucumis sativus [cucumbers]
ref|XP_010913336.1|  PREDICTED: phosphoenolpyruvate phosphatase i...    179   3e-50   Elaeis guineensis
ref|XP_008443931.1|  PREDICTED: bifunctional purple acid phosphat...    179   3e-50   Cucumis melo [Oriental melon]
ref|XP_010913337.1|  PREDICTED: phosphoenolpyruvate phosphatase i...    179   3e-50   Elaeis guineensis
gb|KJB64666.1|  hypothetical protein B456_010G060100                    179   3e-50   Gossypium raimondii
gb|KJB64663.1|  hypothetical protein B456_010G060100                    179   4e-50   Gossypium raimondii
gb|KJB65854.1|  hypothetical protein B456_010G116200                    179   4e-50   Gossypium raimondii
gb|KJB64662.1|  hypothetical protein B456_010G060100                    178   4e-50   Gossypium raimondii
gb|KJB64668.1|  hypothetical protein B456_010G060100                    179   4e-50   Gossypium raimondii
ref|XP_006483400.1|  PREDICTED: bifunctional purple acid phosphat...    178   1e-49   Citrus sinensis [apfelsine]
ref|XP_006450380.1|  hypothetical protein CICLE_v10008150mg             178   1e-49   Citrus clementina [clementine]
ref|XP_008795838.1|  PREDICTED: phosphoenolpyruvate phosphatase         177   2e-49   Phoenix dactylifera
ref|XP_007155070.1|  hypothetical protein PHAVU_003G170600g             176   2e-49   Phaseolus vulgaris [French bean]
ref|XP_007013582.1|  Purple acid phosphatase 26 isoform 1               177   2e-49   
ref|XP_004150527.1|  PREDICTED: bifunctional purple acid phosphat...    177   2e-49   
ref|XP_007013583.1|  Purple acid phosphatase 26 isoform 2               177   2e-49   
ref|XP_007013584.1|  Purple acid phosphatase 26 isoform 3               177   2e-49   
ref|XP_003609435.1|  Purple acid phosphatase-like protein               175   8e-49   Medicago truncatula
gb|AFK47719.1|  unknown                                                 175   8e-49   Medicago truncatula
gb|KJB83221.1|  hypothetical protein B456_013G236000                    175   9e-49   Gossypium raimondii
gb|AET86956.1|  PAP26                                                   175   1e-48   Gossypium hirsutum [American cotton]
gb|EPS64420.1|  hypothetical protein M569_10360                         175   1e-48   Genlisea aurea
gb|KJB83219.1|  hypothetical protein B456_013G236000                    175   1e-48   Gossypium raimondii
ref|XP_010050094.1|  PREDICTED: bifunctional purple acid phosphat...    173   5e-48   Eucalyptus grandis [rose gum]
ref|XP_009418189.1|  PREDICTED: phosphoenolpyruvate phosphatase-like    172   2e-47   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007202017.1|  hypothetical protein PRUPE_ppa004955mg             169   7e-47   
gb|AGT17175.1|  acid phosphatase precursor                              169   2e-46   Saccharum hybrid cultivar R570
ref|XP_009392136.1|  PREDICTED: phosphoenolpyruvate phosphatase-like    168   3e-46   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACR23330.1|  mitochondrial acid phosphatase                          167   7e-46   Triticum aestivum [Canadian hard winter wheat]
gb|AGT17000.1|  acid phosphatase precursor                              167   7e-46   Saccharum hybrid cultivar R570
gb|AGT16225.1|  purple acid phosphatase precursor                       166   3e-45   Saccharum hybrid cultivar R570
gb|AGT16393.1|  purple acid phosphatase precursor                       164   5e-45   Saccharum hybrid cultivar R570
ref|NP_001147979.1|  purple acid phosphatase precursor                  164   8e-45   Zea mays [maize]
gb|ACF84615.1|  unknown                                                 164   8e-45   Zea mays [maize]
dbj|BAJ92186.1|  predicted protein                                      164   9e-45   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EEC81063.1|  hypothetical protein OsI_23873                          164   9e-45   Oryza sativa Indica Group [Indian rice]
gb|AGT15919.1|  purple acid phosphatase precursor                       164   1e-44   Saccharum hybrid cultivar R570
ref|NP_001058182.1|  Os06g0643900                                       163   3e-44   
dbj|BAB88215.1|  putative secretory acid phosphatase precursor          163   4e-44   Oryza sativa Japonica Group [Japonica rice]
gb|EMT07067.1|  Bifunctional purple acid phosphatase 26                 163   4e-44   
ref|XP_004965755.1|  PREDICTED: phosphoenolpyruvate phosphatase-like    162   1e-43   Setaria italica
ref|XP_010696563.1|  PREDICTED: bifunctional purple acid phosphat...    161   1e-43   
ref|XP_006656291.1|  PREDICTED: phosphoenolpyruvate phosphatase-l...    160   4e-43   Oryza brachyantha
gb|ABK24726.1|  unknown                                                 160   9e-43   Picea sitchensis
ref|XP_003563304.2|  PREDICTED: phosphoenolpyruvate phosphatase         159   3e-42   Brachypodium distachyon [annual false brome]
gb|EMS63219.1|  Bifunctional purple acid phosphatase 26                 150   2e-39   Triticum urartu
ref|XP_010933142.1|  PREDICTED: purple acid phosphatase-like            145   8e-38   Elaeis guineensis
ref|XP_008793996.1|  PREDICTED: purple acid phosphatase 2-like          145   9e-38   Phoenix dactylifera
ref|XP_010910529.1|  PREDICTED: purple acid phosphatase-like            145   9e-38   Elaeis guineensis
ref|XP_008796614.1|  PREDICTED: purple acid phosphatase 2-like          144   2e-37   Phoenix dactylifera
ref|XP_009408475.1|  PREDICTED: purple acid phosphatase 2-like          142   8e-37   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009397025.1|  PREDICTED: purple acid phosphatase 2               142   1e-36   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010687873.1|  PREDICTED: bifunctional purple acid phosphat...    139   1e-35   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009398390.1|  PREDICTED: purple acid phosphatase 2-like          138   3e-35   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011088457.1|  PREDICTED: purple acid phosphatase 2               138   4e-35   Sesamum indicum [beniseed]
dbj|BAA92365.1|  purple acid phosphatase                                137   5e-35   Landoltia punctata
ref|XP_006646385.1|  PREDICTED: purple acid phosphatase 2-like          139   6e-35   Oryza brachyantha
gb|EPS60425.1|  hypothetical protein M569_14376                         137   1e-34   Genlisea aurea
sp|Q93WP4.1|PEPP_ALLCE  RecName: Full=Phosphoenolpyruvate phospha...    137   1e-34   Allium cepa
gb|EYU37832.1|  hypothetical protein MIMGU_mgv1a005923mg                136   2e-34   Erythranthe guttata [common monkey flower]
ref|NP_001044416.1|  Os01g0776600                                       136   2e-34   
gb|KFK32700.1|  hypothetical protein AALP_AA6G277500                    135   3e-34   Arabis alpina [alpine rockcress]
ref|XP_010271524.1|  PREDICTED: purple acid phosphatase                 135   3e-34   Nelumbo nucifera [Indian lotus]
tpg|DAA57388.1|  TPA: hypothetical protein ZEAMMB73_877733              132   3e-34   
ref|XP_010030674.1|  PREDICTED: purple acid phosphatase 2-like          135   5e-34   Eucalyptus grandis [rose gum]
ref|XP_002512962.1|  Purple acid phosphatase precursor, putative        135   5e-34   
ref|XP_006838700.1|  hypothetical protein AMTR_s00002p00249280          134   9e-34   Amborella trichopoda
ref|XP_004230906.1|  PREDICTED: purple acid phosphatase 2               134   1e-33   Solanum lycopersicum
gb|AFK42558.1|  unknown                                                 128   1e-33   Lotus japonicus
ref|XP_011017866.1|  PREDICTED: bifunctional purple acid phosphat...    133   2e-33   Populus euphratica
ref|XP_002458586.1|  hypothetical protein SORBIDRAFT_03g036210          133   2e-33   Sorghum bicolor [broomcorn]
gb|KJB58168.1|  hypothetical protein B456_009G197600                    129   3e-33   Gossypium raimondii
emb|CAA06921.1|  purple acid phosphatase                                133   3e-33   Ipomoea batatas [batate]
ref|XP_002274392.1|  PREDICTED: purple acid phosphatase                 133   3e-33   Vitis vinifera
ref|XP_008448074.1|  PREDICTED: purple acid phosphatase 2               132   3e-33   Cucumis melo [Oriental melon]
ref|XP_010061253.1|  PREDICTED: purple acid phosphatase-like isof...    132   4e-33   Eucalyptus grandis [rose gum]
sp|Q9SDZ9.1|PPAF2_IPOBA  RecName: Full=Purple acid phosphatase 2;...    132   4e-33   Ipomoea batatas [batate]
ref|NP_001141970.1|  hypothetical protein precursor                     132   4e-33   Zea mays [maize]
gb|KJB63548.1|  hypothetical protein B456_010G007100                    131   4e-33   Gossypium raimondii
ref|XP_007017662.1|  Purple acid phosphatase 10 isoform 1               132   4e-33   
gb|KHN22217.1|  Purple acid phosphatase 2                               130   6e-33   Glycine soja [wild soybean]
ref|XP_007017665.1|  Purple acid phosphatase 10 isoform 2               130   6e-33   
gb|KJB63549.1|  hypothetical protein B456_010G007100                    131   8e-33   Gossypium raimondii
ref|XP_006581009.1|  PREDICTED: uncharacterized protein LOC100794...    131   9e-33   Glycine max [soybeans]
gb|EYU37834.1|  hypothetical protein MIMGU_mgv1a005856mg                131   9e-33   Erythranthe guttata [common monkey flower]
ref|XP_009762746.1|  PREDICTED: purple acid phosphatase 2-like          131   1e-32   Nicotiana sylvestris
ref|NP_001239689.1|  uncharacterized protein LOC100794124               131   1e-32   Glycine max [soybeans]
ref|XP_010315506.1|  PREDICTED: LOW QUALITY PROTEIN: purple acid ...    131   1e-32   
gb|ABV89758.1|  purple acid phosphatase 12 protein family isoform...    130   1e-32   Brassica napus [oilseed rape]
ref|XP_003527865.2|  PREDICTED: purple acid phosphatase 2-like          131   1e-32   Glycine max [soybeans]
gb|ACU17971.1|  unknown                                                 129   1e-32   Glycine max [soybeans]
gb|AET86954.1|  PAP12                                                   131   1e-32   Gossypium hirsutum [American cotton]
gb|KGN43158.1|  hypothetical protein Csa_7G004110                       131   1e-32   Cucumis sativus [cucumbers]
ref|XP_010690819.1|  PREDICTED: purple acid phosphatase 2-like is...    131   1e-32   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB63547.1|  hypothetical protein B456_010G007100                    131   1e-32   Gossypium raimondii
ref|XP_004148530.1|  PREDICTED: purple acid phosphatase 2-like          131   1e-32   Cucumis sativus [cucumbers]
ref|XP_010690820.1|  PREDICTED: purple acid phosphatase 2-like is...    131   2e-32   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010510800.1|  PREDICTED: fe(3+)-Zn(2+) purple acid phospha...    130   2e-32   Camelina sativa [gold-of-pleasure]
gb|ABV89741.1|  purple acid phosphatase 12 protein family isoform 2     130   2e-32   Brassica napus [oilseed rape]
ref|XP_004152670.1|  PREDICTED: purple acid phosphatase 2-like          130   2e-32   Cucumis sativus [cucumbers]
gb|ABV89739.1|  purple acid phosphatase 12 protein family isoform 1     130   2e-32   Brassica napus [oilseed rape]
gb|ABV89757.1|  purple acid phosphatase 12 protein family isoform 7     130   2e-32   Brassica napus [oilseed rape]
gb|ABV89751.1|  purple acid phosphatase 12 protein family isoform...    127   2e-32   Brassica napus [oilseed rape]
ref|XP_011048850.1|  PREDICTED: purple acid phosphatase 2-like is...    129   2e-32   Populus euphratica
gb|KHG20719.1|  Purple acid phosphatase 2                               130   2e-32   Gossypium arboreum [tree cotton]
gb|KJB58169.1|  hypothetical protein B456_009G197600                    129   2e-32   Gossypium raimondii
ref|XP_002307690.1|  Iron(III)-zinc(II) purple acid phosphatase p...    130   2e-32   Populus trichocarpa [western balsam poplar]
ref|XP_002280883.1|  PREDICTED: purple acid phosphatase 2 isoform X1    130   3e-32   Vitis vinifera
ref|XP_007017664.1|  Purple acid phosphatase 12 isoform 1               130   3e-32   
gb|ABV89743.1|  purple acid phosphatase 12 protein family isoform 3     130   3e-32   Brassica napus [oilseed rape]
ref|XP_002280873.1|  PREDICTED: purple acid phosphatase 2               130   3e-32   Vitis vinifera
gb|KJB58170.1|  hypothetical protein B456_009G197600                    129   3e-32   Gossypium raimondii
ref|XP_009777042.1|  PREDICTED: purple acid phosphatase 2 isoform X2    130   4e-32   Nicotiana sylvestris
ref|XP_010417871.1|  PREDICTED: fe(3+)-Zn(2+) purple acid phospha...    130   4e-32   Camelina sativa [gold-of-pleasure]
ref|XP_009777041.1|  PREDICTED: purple acid phosphatase 2 isoform X1    130   4e-32   Nicotiana sylvestris
ref|XP_004172093.1|  PREDICTED: purple acid phosphatase 2-like          130   4e-32   
ref|XP_011083627.1|  PREDICTED: purple acid phosphatase 2-like          129   5e-32   Sesamum indicum [beniseed]
ref|XP_002874764.1|  secreted purple acid phosphatase precursor         129   5e-32   
gb|KJB58167.1|  hypothetical protein B456_009G197600                    129   5e-32   Gossypium raimondii
ref|XP_009335656.1|  PREDICTED: purple acid phosphatase 2               130   5e-32   Pyrus x bretschneideri [bai li]
ref|XP_011048849.1|  PREDICTED: purple acid phosphatase 2-like is...    129   5e-32   Populus euphratica
gb|KHG11060.1|  Purple acid phosphatase 2                               129   5e-32   Gossypium arboreum [tree cotton]
gb|AET86953.1|  PAP1                                                    129   6e-32   Gossypium hirsutum [American cotton]
emb|CDY48179.1|  BnaA04g15430D                                          129   7e-32   Brassica napus [oilseed rape]
gb|KHG20720.1|  Purple acid phosphatase 2                               129   7e-32   Gossypium arboreum [tree cotton]
gb|AAA91803.1|  secreted purple acid phosphatase precursor              129   8e-32   Arabidopsis thaliana [mouse-ear cress]
emb|CDY48178.1|  BnaA04g15420D                                          129   8e-32   Brassica napus [oilseed rape]
gb|AAT37527.1|  purple acid phosphatase 2                               129   8e-32   Solanum tuberosum [potatoes]
dbj|BAC55157.1|  purple acid phosphatase                                129   9e-32   Nicotiana tabacum [American tobacco]
gb|ABQ50886.1|  purple acid phosphatase                                 128   9e-32   Lolium multiflorum
ref|XP_009610724.1|  PREDICTED: purple acid phosphatase 2-like          129   9e-32   Nicotiana tomentosiformis
ref|XP_009140744.1|  PREDICTED: fe(3+)-Zn(2+) purple acid phospha...    128   1e-31   Brassica rapa
ref|XP_007222938.1|  hypothetical protein PRUPE_ppa005293mg             128   1e-31   Prunus persica
ref|XP_004970155.1|  PREDICTED: purple acid phosphatase 2-like          128   1e-31   Setaria italica
gb|KDP41744.1|  hypothetical protein JCGZ_26762                         128   1e-31   Jatropha curcas
gb|AAX20028.1|  purple acid phosphatase                                 128   1e-31   Medicago truncatula
dbj|BAC55155.1|  purple acid phosphatase                                128   2e-31   Nicotiana tabacum [American tobacco]
gb|AGL44395.1|  calcineurin-like phosphoesterase                        128   2e-31   Manihot esculenta [manioc]
dbj|BAJ53173.1|  JHL18I08.7                                             128   2e-31   Jatropha curcas
ref|XP_002880886.1|  secreted purple acid phosphatase precursor         128   2e-31   Arabidopsis lyrata subsp. lyrata
ref|XP_010028627.1|  PREDICTED: purple acid phosphatase 2-like          128   2e-31   Eucalyptus grandis [rose gum]
ref|XP_008387992.1|  PREDICTED: purple acid phosphatase 2-like          128   2e-31   
ref|XP_002264113.1|  PREDICTED: purple acid phosphatase                 128   2e-31   Vitis vinifera
gb|EPS60513.1|  hypothetical protein M569_14289                         127   2e-31   Genlisea aurea
ref|NP_001240926.1|  uncharacterized protein LOC100807555 precursor     128   2e-31   Glycine max [soybeans]
ref|XP_003564342.1|  PREDICTED: purple acid phosphatase 2               127   2e-31   Brachypodium distachyon [annual false brome]
gb|ABV89753.1|  purple acid phosphatase 12 protein family isoform...    127   2e-31   Brassica napus [oilseed rape]
gb|ABV89750.1|  purple acid phosphatase 12 protein family isoform...    127   2e-31   Brassica napus [oilseed rape]
gb|EMT02488.1|  Purple acid phosphatase 2                               127   2e-31   
ref|XP_002263937.1|  PREDICTED: purple acid phosphatase                 127   3e-31   Vitis vinifera
gb|AAK51700.1|AF317218_1  secreted acid phosphatase                     127   3e-31   Lupinus albus
ref|XP_010028626.1|  PREDICTED: purple acid phosphatase-like            127   3e-31   Eucalyptus grandis [rose gum]
ref|XP_007042078.1|  Purple acid phosphatase 10                         127   3e-31   
dbj|BAA97745.1|  secretory acid phosphatase precursor                   127   3e-31   Lupinus albus
gb|ABV89749.1|  purple acid phosphatase 12 protein family isoform 5     127   3e-31   Brassica napus [oilseed rape]
ref|XP_002300736.2|  hypothetical protein POPTR_0002s03080g             127   3e-31   Populus trichocarpa [western balsam poplar]
ref|NP_001242830.1|  uncharacterized protein LOC100815854 precursor     127   3e-31   
ref|XP_009614460.1|  PREDICTED: purple acid phosphatase 2-like          127   3e-31   Nicotiana tomentosiformis
gb|EMS53150.1|  Purple acid phosphatase 2                               128   4e-31   Triticum urartu
ref|XP_010028628.1|  PREDICTED: purple acid phosphatase 2-like          127   4e-31   Eucalyptus grandis [rose gum]
ref|XP_006362022.1|  PREDICTED: purple acid phosphatase 2-like          127   4e-31   Solanum tuberosum [potatoes]
ref|XP_008382344.1|  PREDICTED: purple acid phosphatase 2-like          127   4e-31   
ref|XP_007200250.1|  hypothetical protein PRUPE_ppa015069mg             127   4e-31   
gb|KCW55391.1|  hypothetical protein EUGRSUZ_I01302                     127   5e-31   Eucalyptus grandis [rose gum]
ref|NP_180287.2|  Fe(3+)-Zn(2+) purple acid phosphatase 12              127   5e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011028930.1|  PREDICTED: purple acid phosphatase 2-like is...    126   5e-31   Populus euphratica
gb|KHN11683.1|  Purple acid phosphatase                                 126   5e-31   Glycine soja [wild soybean]
ref|XP_010028629.1|  PREDICTED: purple acid phosphatase 2-like          126   5e-31   Eucalyptus grandis [rose gum]
sp|Q09131.2|PPAF_SOYBN  RecName: Full=Purple acid phosphatase; Al...    126   6e-31   Glycine max [soybeans]
ref|XP_006586710.1|  PREDICTED: uncharacterized protein LOC100815...    126   6e-31   
gb|AFH08750.1|  purple acid phosphatase 14                              126   6e-31   Glycine max [soybeans]
ref|XP_006294169.1|  hypothetical protein CARUB_v10023164mg             126   7e-31   Capsella rubella
ref|XP_010664753.1|  PREDICTED: purple acid phosphatase 2 isoform X2    126   7e-31   Vitis vinifera
emb|CDX77044.1|  BnaC04g38390D                                          126   8e-31   
emb|CDM84477.1|  unnamed protein product                                126   8e-31   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009373020.1|  PREDICTED: purple acid phosphatase 2-like          126   9e-31   Pyrus x bretschneideri [bai li]
ref|XP_002530767.1|  Purple acid phosphatase precursor, putative        125   1e-30   
gb|EAY84038.1|  hypothetical protein OsI_39268                          125   1e-30   Oryza sativa Indica Group [Indian rice]
ref|XP_008444763.1|  PREDICTED: purple acid phosphatase-like            125   1e-30   Cucumis melo [Oriental melon]
gb|AAD20634.1|  purple acid phosphatase precursor                       125   1e-30   Anchusa officinalis
ref|XP_011028929.1|  PREDICTED: purple acid phosphatase 2-like is...    125   1e-30   Populus euphratica
dbj|BAB88216.1|  secretory acid phosphatase precursor                   125   1e-30   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001067369.1|  Os12g0637100                                       125   1e-30   
ref|XP_010473111.1|  PREDICTED: fe(3+)-Zn(2+) purple acid phospha...    125   1e-30   Camelina sativa [gold-of-pleasure]
ref|XP_009787761.1|  PREDICTED: purple acid phosphatase 2-like          125   2e-30   Nicotiana sylvestris
ref|XP_008237014.1|  PREDICTED: purple acid phosphatase 2-like          125   2e-30   Prunus mume [ume]
ref|XP_004963326.1|  PREDICTED: purple acid phosphatase 2-like          125   2e-30   Setaria italica
dbj|BAJ85173.1|  predicted protein                                      125   2e-30   
ref|XP_006664780.1|  PREDICTED: purple acid phosphatase 2-like          125   2e-30   
ref|XP_009140743.1|  PREDICTED: fe(3+)-Zn(2+) purple acid phospha...    125   2e-30   
gb|KJB32559.1|  hypothetical protein B456_005G246900                    124   2e-30   
ref|XP_004963327.1|  PREDICTED: purple acid phosphatase 2-like          124   3e-30   
ref|XP_010105263.1|  Purple acid phosphatase 2                          125   3e-30   
gb|KEH16424.1|  purple acid phosphatase superfamily protein             124   3e-30   
ref|XP_007131378.1|  hypothetical protein PHAVU_011G008700g             124   3e-30   
emb|CDO97010.1|  unnamed protein product                                124   5e-30   
gb|KFK40055.1|  hypothetical protein AALP_AA3G324700                    124   5e-30   
gb|KJB32560.1|  hypothetical protein B456_005G246900                    123   7e-30   
gb|AFB18640.1|  PAP10                                                   123   7e-30   
gb|ADM16565.2|  purple acid phosphatase precursor                       123   7e-30   
ref|XP_006838701.1|  hypothetical protein AMTR_s00002p00249330          123   9e-30   
ref|XP_009611298.1|  PREDICTED: purple acid phosphatase 2-like          123   9e-30   
dbj|BAC55156.1|  purple acid phosphatase                                123   9e-30   
gb|AAM15913.1|AF492664_1  purple acid phosphatase                       123   9e-30   
dbj|BAA97038.2|  acid phosphatase precursor                             122   1e-29   
ref|XP_009136308.1|  PREDICTED: purple acid phosphatase 10              122   1e-29   
emb|CDY02257.1|  BnaA03g39100D                                          122   1e-29   
gb|EMT18687.1|  Purple acid phosphatase 2                               122   1e-29   
ref|XP_008236963.1|  PREDICTED: purple acid phosphatase 2-like is...    122   1e-29   
gb|KCW55390.1|  hypothetical protein EUGRSUZ_I01300                     122   2e-29   
emb|CAA07280.1|  purple acid phosphatase                                122   2e-29   
ref|XP_008236964.1|  PREDICTED: purple acid phosphatase 2-like is...    122   2e-29   
ref|XP_010107842.1|  Purple acid phosphatase 2                          122   2e-29   
ref|XP_004506328.1|  PREDICTED: purple acid phosphatase-like            122   2e-29   
dbj|BAJ94392.1|  predicted protein                                      122   2e-29   
ref|XP_002306126.2|  Fe(III)-Zn(II) purple acid phosphatase famil...    122   3e-29   
ref|XP_010530813.1|  PREDICTED: purple acid phosphatase 10              121   3e-29   
ref|XP_007199139.1|  hypothetical protein PRUPE_ppa019514mg             121   4e-29   
gb|ABV89745.1|  purple acid phosphatase 12 protein family isoform 4     122   4e-29   
ref|XP_010672424.1|  PREDICTED: purple acid phosphatase-like            121   4e-29   
dbj|BAO58596.1|  purple acid phosphatase                                121   4e-29   
ref|XP_006423399.1|  hypothetical protein CICLE_v10028320mg             121   4e-29   
gb|ABV89755.1|  purple acid phosphatase 12 protein family isoform 6     121   4e-29   
ref|XP_002510464.1|  Iron(III)-zinc(II) purple acid phosphatase p...    120   6e-29   
ref|XP_002313026.2|  hypothetical protein POPTR_0009s12400g             121   6e-29   
ref|XP_007131379.1|  hypothetical protein PHAVU_011G008800g             120   6e-29   
emb|CDX89726.1|  BnaC03g46400D                                          120   7e-29   
ref|XP_004291401.1|  PREDICTED: purple acid phosphatase 2               120   8e-29   
gb|KHG24062.1|  Purple acid phosphatase 2                               123   8e-29   
ref|XP_011047731.1|  PREDICTED: purple acid phosphatase 2               120   8e-29   
gb|KHG24063.1|  Purple acid phosphatase 2                               123   8e-29   
sp|P80366.3|PPAF_PHAVU  RecName: Full=Fe(3+)-Zn(2+) purple acid p...    120   9e-29   
ref|XP_007017663.1|  Purple acid phosphatase 10 isoform 2               119   9e-29   
ref|XP_006409436.1|  hypothetical protein EUTSA_v10022673mg             120   9e-29   
emb|CAD44185.1|  putative acid phosphatase                              120   1e-28   
ref|XP_008377263.1|  PREDICTED: purple acid phosphatase-like            120   1e-28   
ref|XP_011037173.1|  PREDICTED: purple acid phosphatase 2-like          119   1e-28   
gb|KHG15250.1|  Purple acid phosphatase 2                               119   1e-28   
gb|KJB79117.1|  hypothetical protein B456_013G034000                    119   1e-28   
ref|XP_006487340.1|  PREDICTED: purple acid phosphatase 2-like          119   2e-28   
ref|NP_179235.1|  purple acid phosphatase 10                            119   2e-28   
ref|XP_006487338.1|  PREDICTED: purple acid phosphatase 2-like is...    119   2e-28   
ref|XP_006423401.1|  hypothetical protein CICLE_v10028369mg             119   2e-28   
gb|EMT06363.1|  Purple acid phosphatase 2                               119   2e-28   
gb|KEH44359.1|  purple acid phosphatase superfamily protein             119   2e-28   
ref|XP_009794994.1|  PREDICTED: purple acid phosphatase 2-like          119   2e-28   
ref|XP_010549271.1|  PREDICTED: fe(3+)-Zn(2+) purple acid phospha...    119   2e-28   
ref|XP_009112386.1|  PREDICTED: purple acid phosphatase 10-like i...    119   3e-28   
ref|XP_006297613.1|  hypothetical protein CARUB_v10013635mg             118   3e-28   
ref|XP_003579083.1|  PREDICTED: purple acid phosphatase 2-like          119   3e-28   
ref|NP_001149655.1|  purple acid phosphatase                            119   3e-28   
emb|CDY47461.1|  BnaA09g08700D                                          119   3e-28   
dbj|BAC55154.1|  purple acid phosphatase                                119   3e-28   
ref|XP_007199264.1|  hypothetical protein PRUPE_ppa022682mg             118   4e-28   
gb|ACN28207.1|  unknown                                                 118   4e-28   
gb|KHN28032.1|  Purple acid phosphatase 2                               118   5e-28   
ref|XP_007200121.1|  hypothetical protein PRUPE_ppa018522mg             118   6e-28   
ref|XP_006297614.1|  hypothetical protein CARUB_v10013635mg             118   6e-28   
sp|Q9SE00.1|PPAF1_IPOBA  RecName: Full=Purple acid phosphatase 1;...    117   7e-28   
ref|XP_010690822.1|  PREDICTED: purple acid phosphatase 2               117   7e-28   
gb|ABK55715.1|  purple acid phosphatase-like protein                    113   8e-28   
ref|XP_009112387.1|  PREDICTED: purple acid phosphatase 10-like i...    117   9e-28   
ref|XP_010489216.1|  PREDICTED: purple acid phosphatase 10              117   9e-28   
emb|CDP07456.1|  unnamed protein product                                117   9e-28   
ref|XP_010467373.1|  PREDICTED: purple acid phosphatase 10-like         117   1e-27   
ref|NP_001136973.1|  uncharacterized protein LOC100217133 precursor     117   1e-27   
ref|XP_009373026.1|  PREDICTED: LOW QUALITY PROTEIN: purple acid ...    117   1e-27   
emb|CDY26770.1|  BnaC09g08970D                                          117   1e-27   
gb|ACG26714.1|  purple acid phosphatase precursor                       117   1e-27   
emb|CAN75519.1|  hypothetical protein VITISV_011076                     116   2e-27   
ref|XP_010061256.1|  PREDICTED: purple acid phosphatase-like isof...    116   2e-27   
pdb|1KBP|A  Chain A, Kidney Bean Purple Acid Phosphatase                116   2e-27   
dbj|BAJ99889.1|  predicted protein                                      117   2e-27   
dbj|BAK03468.1|  predicted protein                                      116   2e-27   
ref|XP_001778270.1|  predicted protein                                  116   2e-27   
ref|XP_006362021.1|  PREDICTED: purple acid phosphatase 2-like          116   2e-27   
ref|XP_007149618.1|  hypothetical protein PHAVU_005G084900g             116   2e-27   
ref|XP_006473581.1|  PREDICTED: purple acid phosphatase 2-like is...    116   2e-27   
emb|CBI38021.3|  unnamed protein product                                116   3e-27   
gb|KJB32558.1|  hypothetical protein B456_005G246800                    116   3e-27   
ref|XP_007201003.1|  hypothetical protein PRUPE_ppa005275mg             116   3e-27   
pdb|4DSY|A  Chain A, Crystal Structure Of Red Kidney Bean Purple ...    115   3e-27   
ref|XP_006396900.1|  hypothetical protein EUTSA_v10029058mg             110   3e-27   
pdb|2QFP|A  Chain A, Crystal Structure Of Red Kidney Bean Purple ...    115   3e-27   
ref|XP_010516721.1|  PREDICTED: purple acid phosphatase 10-like         115   3e-27   
ref|XP_007131385.1|  hypothetical protein PHAVU_011G009200g             115   5e-27   
ref|XP_006409435.1|  hypothetical protein EUTSA_v10022681mg             115   6e-27   
emb|CDX89713.1|  BnaC03g46270D                                          115   7e-27   
ref|XP_008236957.1|  PREDICTED: purple acid phosphatase-like            115   7e-27   
ref|XP_009136307.1|  PREDICTED: purple acid phosphatase 10-like         115   7e-27   
pdb|1XZW|A  Chain A, Sweet Potato Purple Acid PhosphatasePHOSPHAT...    114   8e-27   
ref|XP_008236961.1|  PREDICTED: purple acid phosphatase-like            114   9e-27   
gb|EMS54176.1|  Purple acid phosphatase 2                               115   9e-27   
ref|XP_008440780.1|  PREDICTED: purple acid phosphatase 5               114   2e-26   
ref|XP_004955085.1|  PREDICTED: purple acid phosphatase 2-like          113   2e-26   
gb|AGL44398.1|  calcineurin-like phosphoesterase                        111   2e-26   
ref|XP_006594791.1|  PREDICTED: purple acid phosphatase 2-like          113   2e-26   
dbj|BAA82130.1|  acid phosphatase                                       113   1e-25   
ref|XP_004290282.1|  PREDICTED: purple acid phosphatase                 111   2e-25   
ref|XP_010320409.1|  PREDICTED: LOW QUALITY PROTEIN: purple acid ...    110   2e-25   
ref|XP_008237016.1|  PREDICTED: purple acid phosphatase 2-like          110   2e-25   
ref|XP_008236962.1|  PREDICTED: purple acid phosphatase-like            110   2e-25   
ref|XP_002440350.1|  hypothetical protein SORBIDRAFT_09g030100          110   2e-25   
ref|NP_001242198.1|  purple acid phosphatase 2-like                     110   3e-25   
ref|XP_002886226.1|  predicted protein                                  110   3e-25   
gb|KDO49482.1|  hypothetical protein CISIN_1g045849mg                   108   6e-25   
gb|AFY06664.1|  purple acid phosphatase                                 109   6e-25   
ref|XP_006487339.1|  PREDICTED: purple acid phosphatase 2-like is...    108   8e-25   
ref|XP_008236959.1|  PREDICTED: purple acid phosphatase-like            109   9e-25   
ref|XP_004169273.1|  PREDICTED: LOW QUALITY PROTEIN: purple acid ...    108   9e-25   
ref|XP_009112469.1|  PREDICTED: purple acid phosphatase 5-like          108   1e-24   
ref|XP_004149978.1|  PREDICTED: purple acid phosphatase 10-like         108   1e-24   
emb|CDY02259.1|  BnaA03g39080D                                          108   2e-24   
ref|XP_001758586.1|  predicted protein                                  107   2e-24   
emb|CDY53278.1|  BnaC09g09650D                                          107   5e-24   
gb|KDO71056.1|  hypothetical protein CISIN_1g046207mg                   107   5e-24   
ref|XP_006425589.1|  hypothetical protein CICLE_v10027113mg             107   5e-24   
ref|XP_011459641.1|  PREDICTED: purple acid phosphatase-like            106   7e-24   
gb|KJB58173.1|  hypothetical protein B456_009G197700                    106   1e-23   
gb|ABA99978.1|  expressed protein                                       106   1e-23   
gb|EEE53671.1|  hypothetical protein OsJ_37000                          105   1e-23   
ref|XP_010467619.1|  PREDICTED: purple acid phosphatase 5-like          105   3e-23   
dbj|BAK05953.1|  predicted protein                                      104   4e-23   
emb|CDY71707.1|  BnaCnng74060D                                          102   4e-23   
gb|EEC69741.1|  hypothetical protein OsI_39267                          104   5e-23   
ref|XP_010413945.1|  PREDICTED: purple acid phosphatase 5               103   7e-23   
ref|XP_006299600.1|  hypothetical protein CARUB_v10015778mg             103   8e-23   
ref|XP_009102277.1|  PREDICTED: purple acid phosphatase 5-like is...    103   1e-22   
ref|XP_009102278.1|  PREDICTED: purple acid phosphatase 25-like i...    102   1e-22   
gb|KJB65855.1|  hypothetical protein B456_010G116200                    102   1e-22   
ref|XP_009138418.1|  PREDICTED: purple acid phosphatase 6               103   1e-22   
emb|CDY59721.1|  BnaA03g59200D                                          103   1e-22   
emb|CDY59690.1|  BnaC07g51090D                                          103   1e-22   
ref|XP_010489510.1|  PREDICTED: purple acid phosphatase 5-like          103   1e-22   
ref|XP_009102276.1|  PREDICTED: purple acid phosphatase 5-like is...    102   2e-22   
emb|CDY46314.1|  BnaA07g01870D                                          102   2e-22   
ref|XP_002993027.1|  hypothetical protein SELMODRAFT_136432             102   2e-22   
gb|EPS60634.1|  hypothetical protein M569_14168                         102   2e-22   
emb|CDP19119.1|  unnamed protein product                                102   2e-22   
ref|XP_003578743.2|  PREDICTED: purple acid phosphatase 2-like          102   2e-22   
gb|KFK40196.1|  purple acid phosphatase                                 102   2e-22   
ref|XP_006412012.1|  hypothetical protein EUTSA_v10027366mg             102   2e-22   
ref|XP_010414981.1|  PREDICTED: purple acid phosphatase 6               101   6e-22   
ref|XP_010531065.1|  PREDICTED: purple acid phosphatase 25              101   7e-22   
ref|XP_010511279.1|  PREDICTED: purple acid phosphatase 6-like          101   7e-22   
ref|XP_006664779.1|  PREDICTED: purple acid phosphatase 2-like          100   8e-22   
ref|XP_002867021.1|  ATPAP25/PAP25                                      101   8e-22   
ref|XP_003560127.1|  PREDICTED: purple acid phosphatase 2-like is...    100   1e-21   
ref|XP_002972138.1|  hypothetical protein SELMODRAFT_96478              100   2e-21   
ref|NP_176033.1|  purple acid phosphatase 6                             100   2e-21   
gb|AAW29947.1|  putative purple acid phosphatase                        100   2e-21   
ref|XP_002993062.1|  hypothetical protein SELMODRAFT_187173           99.8    3e-21   
ref|XP_002971914.1|  hypothetical protein SELMODRAFT_96415            99.8    3e-21   
ref|XP_002894643.1|  ATPAP6/PAP6                                      99.4    3e-21   
ref|XP_002886149.1|  ATPAP11/PAP11                                    98.6    6e-21   
gb|EAY84039.1|  hypothetical protein OsI_39269                        98.6    8e-21   
ref|XP_006409193.1|  hypothetical protein EUTSA_v10022710mg           97.4    9e-21   
ref|XP_006285738.1|  hypothetical protein CARUB_v10007211mg           97.8    1e-20   
ref|XP_010480244.1|  PREDICTED: purple acid phosphatase 6-like        97.8    1e-20   
ref|XP_006414050.1|  hypothetical protein EUTSA_v10025132mg           97.4    2e-20   
ref|XP_010446806.1|  PREDICTED: purple acid phosphatase 25-like       97.4    2e-20   
gb|KJB58171.1|  hypothetical protein B456_009G197600                  95.9    4e-20   
ref|XP_010678958.1|  PREDICTED: purple acid phosphatase 5-like is...  95.5    4e-20   
ref|XP_010437359.1|  PREDICTED: purple acid phosphatase 25            96.3    4e-20   
ref|XP_010678957.1|  PREDICTED: purple acid phosphatase 6-like is...  95.5    5e-20   
ref|XP_006301757.1|  hypothetical protein CARUB_v10022218mg           95.9    7e-20   
ref|XP_011093858.1|  PREDICTED: purple acid phosphatase 5-like is...  95.9    7e-20   
ref|XP_010113480.1|  Purple acid phosphatase 25                       95.1    1e-19   
ref|NP_195353.1|  purple acid phosphatase 25                          94.7    2e-19   
ref|XP_010230374.1|  PREDICTED: purple acid phosphatase 2-like is...  93.2    3e-19   
ref|XP_010432181.1|  PREDICTED: purple acid phosphatase 25-like       93.6    4e-19   
ref|NP_001067372.1|  Os12g0637400                                     89.0    5e-19   
ref|XP_006467153.1|  PREDICTED: purple acid phosphatase 2-like        92.8    5e-19   
emb|CDY24789.1|  BnaA08g15210D                                        93.2    6e-19   
ref|XP_009109316.1|  PREDICTED: purple acid phosphatase 6-like        92.8    9e-19   
gb|EMS66649.1|  Purple acid phosphatase 2                             91.7    2e-18   
emb|CDX89717.1|  BnaC03g46310D                                        91.3    3e-18   
ref|XP_011093857.1|  PREDICTED: purple acid phosphatase 5-like        90.9    3e-18   
gb|EMT29608.1|  hypothetical protein F775_52563                       90.1    4e-18   
ref|XP_002534135.1|  Purple acid phosphatase precursor, putative      90.9    4e-18   
gb|KDO84712.1|  hypothetical protein CISIN_1g040421mg                 89.4    8e-18   
gb|KFK30263.1|  hypothetical protein AALP_AA7G238500                  90.1    8e-18   
gb|EYU25836.1|  hypothetical protein MIMGU_mgv1a026196mg              88.6    4e-17   
gb|KDO49481.1|  hypothetical protein CISIN_1g044242mg                 85.9    5e-17   
gb|ABE97169.1|  calcineurin-like phosphoesterase family protein       84.0    2e-16   
ref|XP_002972261.1|  hypothetical protein SELMODRAFT_97551            85.9    2e-16   
ref|XP_002984175.1|  hypothetical protein SELMODRAFT_120052           85.5    3e-16   
ref|NP_190198.1|  purple acid phosphatase 19                          84.0    5e-16   
ref|NP_564619.1|  purple acid phosphatase 5                           84.0    6e-16   
ref|NP_179405.1|  purple acid phosphatase 11                          83.6    1e-15   
ref|XP_006360542.1|  PREDICTED: purple acid phosphatase 6-like        82.8    3e-15   
ref|XP_010058879.1|  PREDICTED: purple acid phosphatase 2-like        77.8    8e-15   
emb|CDX89724.1|  BnaC03g46380D                                        76.6    5e-14   
ref|XP_004294370.1|  PREDICTED: purple acid phosphatase 18            78.6    7e-14   
ref|XP_008345556.1|  PREDICTED: LOW QUALITY PROTEIN: purple acid ...  76.6    9e-14   
emb|CDX89719.1|  BnaC03g46330D                                        72.8    3e-13   
ref|XP_006435085.1|  hypothetical protein CICLE_v10003671mg           75.5    7e-13   
ref|XP_007020894.1|  Purple acid phosphatase 18                       75.9    7e-13   
ref|XP_007146445.1|  hypothetical protein PHAVU_006G041100g           75.5    8e-13   
ref|XP_006379380.1|  hypothetical protein POPTR_0008s00260g           70.9    8e-13   
gb|ACU17603.1|  unknown                                               73.2    1e-12   
gb|KHN36789.1|  Purple acid phosphatase 2                             75.1    1e-12   
emb|CDY02258.1|  BnaA03g39090D                                        71.2    1e-12   
ref|XP_006346223.1|  PREDICTED: purple acid phosphatase 18-like       75.1    1e-12   
ref|XP_004244128.1|  PREDICTED: purple acid phosphatase 18            75.1    1e-12   
ref|XP_002278488.2|  PREDICTED: purple acid phosphatase 18            74.7    2e-12   
ref|XP_009378488.1|  PREDICTED: purple acid phosphatase 18-like       74.3    2e-12   
ref|XP_009600134.1|  PREDICTED: purple acid phosphatase 18-like       74.3    2e-12   



>ref|XP_009631333.1| PREDICTED: bifunctional purple acid phosphatase 26-like [Nicotiana 
tomentosiformis]
Length=477

 Score =   216 bits (549),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 101/119 (85%), Positives = 110/119 (92%), Gaps = 0/119 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            IENG+AG+TS F R++WPSVDIPL N+ FAVPKG NAPQQVHITQGDYDGKAVIISW+TP
Sbjct  16   IENGNAGITSAFVRTQWPSVDIPLANEVFAVPKGYNAPQQVHITQGDYDGKAVIISWITP  75

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            DEPGSSQVRYGLSEGKYDFTAEGT TNYTFYNYKSG+IHQCLV GL++D KYYYEIG G
Sbjct  76   DEPGSSQVRYGLSEGKYDFTAEGTVTNYTFYNYKSGYIHQCLVTGLQYDTKYYYEIGKG  134



>ref|XP_009799030.1| PREDICTED: bifunctional purple acid phosphatase 26-like [Nicotiana 
sylvestris]
Length=477

 Score =   214 bits (545),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 99/117 (85%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            I+NG+AG+TS F R++WPSVDIPL+N+ FAVPKG NAPQQVHITQGDYDGKAVIISW+TP
Sbjct  16   IDNGNAGITSAFVRTQWPSVDIPLENEVFAVPKGYNAPQQVHITQGDYDGKAVIISWITP  75

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIG  523
            DEPGSSQVRYGLSEGKYDFTAEGT TNYTFYNYKSG+IHQCLV GL++D KYYYEIG
Sbjct  76   DEPGSSQVRYGLSEGKYDFTAEGTVTNYTFYNYKSGYIHQCLVSGLQYDTKYYYEIG  132



>emb|CDP10471.1| unnamed protein product [Coffea canephora]
Length=478

 Score =   208 bits (530),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 97/118 (82%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            + NG AG+TS F RSEWPS DIPLDN+AFA+PKG NAPQQVHITQGDYDGKAVIISWVTP
Sbjct  17   VHNGIAGLTSSFIRSEWPSTDIPLDNEAFALPKGYNAPQQVHITQGDYDGKAVIISWVTP  76

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGN  526
            DEPGSSQVRYG+SEGKYDFTA+GT  NYTF+NYKSG+IH+CLV GLE+D KYYYEIG+
Sbjct  77   DEPGSSQVRYGISEGKYDFTAKGTVKNYTFHNYKSGYIHKCLVDGLEYDTKYYYEIGD  134



>gb|EYU34962.1| hypothetical protein MIMGU_mgv1a005843mg [Erythranthe guttata]
Length=468

 Score =   205 bits (522),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 96/119 (81%), Positives = 109/119 (92%), Gaps = 0/119 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            + + +AG TSGF R+EWPS+DIPLDN+ FAVPKG NAPQQVHITQGDYDGKAVIISWVTP
Sbjct  16   VGSANAGKTSGFTRNEWPSIDIPLDNEVFAVPKGYNAPQQVHITQGDYDGKAVIISWVTP  75

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            DEPGS++V+YGLSEGKYDFTAEGT  NYTFY+YKSG+IHQCLV GL++D KYYYEIGNG
Sbjct  76   DEPGSNKVQYGLSEGKYDFTAEGTVQNYTFYDYKSGYIHQCLVDGLQYDTKYYYEIGNG  134



>ref|XP_009790276.1| PREDICTED: bifunctional purple acid phosphatase 26-like isoform 
X2 [Nicotiana sylvestris]
Length=476

 Score =   204 bits (520),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 92/119 (77%), Positives = 109/119 (92%), Gaps = 0/119 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            I+NG+AG+TS F R+EWPSVDIPLDN+ FAVPKG NAPQQVHITQGDY+GKAV++SW+TP
Sbjct  15   IDNGNAGITSSFIRNEWPSVDIPLDNEVFAVPKGYNAPQQVHITQGDYEGKAVLVSWITP  74

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            D+PG SQVRYGLSEGKY+FTAEG+ TNYTFYNY SG+IHQC + GL++D KYYYEIG+G
Sbjct  75   DKPGPSQVRYGLSEGKYEFTAEGSVTNYTFYNYTSGYIHQCFLDGLQYDTKYYYEIGDG  133



>ref|XP_009790275.1| PREDICTED: bifunctional purple acid phosphatase 26-like isoform 
X1 [Nicotiana sylvestris]
Length=500

 Score =   205 bits (521),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 92/119 (77%), Positives = 109/119 (92%), Gaps = 0/119 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            I+NG+AG+TS F R+EWPSVDIPLDN+ FAVPKG NAPQQVHITQGDY+GKAV++SW+TP
Sbjct  39   IDNGNAGITSSFIRNEWPSVDIPLDNEVFAVPKGYNAPQQVHITQGDYEGKAVLVSWITP  98

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            D+PG SQVRYGLSEGKY+FTAEG+ TNYTFYNY SG+IHQC + GL++D KYYYEIG+G
Sbjct  99   DKPGPSQVRYGLSEGKYEFTAEGSVTNYTFYNYTSGYIHQCFLDGLQYDTKYYYEIGDG  157



>ref|XP_009604288.1| PREDICTED: bifunctional purple acid phosphatase 26-like [Nicotiana 
tomentosiformis]
 ref|XP_009604289.1| PREDICTED: bifunctional purple acid phosphatase 26-like [Nicotiana 
tomentosiformis]
 ref|XP_009604290.1| PREDICTED: bifunctional purple acid phosphatase 26-like [Nicotiana 
tomentosiformis]
Length=476

 Score =   204 bits (519),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 92/119 (77%), Positives = 108/119 (91%), Gaps = 0/119 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            I+NG+AG+TS F R+EWPSVDIPLDN+ FAVPKG NAPQQVHITQ DY+GKAV+ISW+TP
Sbjct  15   IDNGNAGLTSSFIRNEWPSVDIPLDNEVFAVPKGYNAPQQVHITQADYEGKAVLISWITP  74

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            D+PG SQVRYGLSEGKY+FTAEG+ TNYTFYNY SG+IHQC + GL++D KYYYEIG+G
Sbjct  75   DKPGPSQVRYGLSEGKYEFTAEGSVTNYTFYNYTSGYIHQCFLDGLQYDTKYYYEIGDG  133



>ref|XP_011078422.1| PREDICTED: bifunctional purple acid phosphatase 26 isoform X1 
[Sesamum indicum]
 ref|XP_011078423.1| PREDICTED: bifunctional purple acid phosphatase 26 isoform X1 
[Sesamum indicum]
Length=480

 Score =   204 bits (518),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 95/119 (80%), Positives = 106/119 (89%), Gaps = 0/119 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            + NG+AG+TS F R+EWPSVDIPLDN+ FAVPKG NAPQQVHITQGDYDG+AVIISWVT 
Sbjct  16   VSNGNAGVTSSFIRNEWPSVDIPLDNEVFAVPKGYNAPQQVHITQGDYDGRAVIISWVTA  75

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            DEPGS+QVR GLSEGKYDF AEGT  NYTFYNYKSG+IHQCLVG L++D KYYY IG+G
Sbjct  76   DEPGSNQVRVGLSEGKYDFVAEGTVHNYTFYNYKSGYIHQCLVGDLQYDTKYYYAIGDG  134



>ref|XP_011078424.1| PREDICTED: bifunctional purple acid phosphatase 26 isoform X2 
[Sesamum indicum]
Length=446

 Score =   203 bits (516),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 95/119 (80%), Positives = 106/119 (89%), Gaps = 0/119 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            + NG+AG+TS F R+EWPSVDIPLDN+ FAVPKG NAPQQVHITQGDYDG+AVIISWVT 
Sbjct  16   VSNGNAGVTSSFIRNEWPSVDIPLDNEVFAVPKGYNAPQQVHITQGDYDGRAVIISWVTA  75

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            DEPGS+QVR GLSEGKYDF AEGT  NYTFYNYKSG+IHQCLVG L++D KYYY IG+G
Sbjct  76   DEPGSNQVRVGLSEGKYDFVAEGTVHNYTFYNYKSGYIHQCLVGDLQYDTKYYYAIGDG  134



>ref|XP_006381099.1| hypothetical protein POPTR_0006s06250g [Populus trichocarpa]
 gb|ERP58896.1| hypothetical protein POPTR_0006s06250g [Populus trichocarpa]
Length=483

 Score =   203 bits (516),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 92/119 (77%), Positives = 110/119 (92%), Gaps = 0/119 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            ++NG+AG+TS F RSEWPS+DIPLDN+ FAVPKG NAPQQVHITQGDY+GKAVIISWVTP
Sbjct  25   VKNGNAGITSAFIRSEWPSIDIPLDNEVFAVPKGYNAPQQVHITQGDYNGKAVIISWVTP  84

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            DEPG+++V+YG+S+ KYDFTAEGT  NYTFYNYKSG+IHQCLV GLE++ KYYY+IG+G
Sbjct  85   DEPGTNKVQYGVSKKKYDFTAEGTVKNYTFYNYKSGYIHQCLVDGLEYETKYYYKIGSG  143



>ref|XP_006350121.1| PREDICTED: bifunctional purple acid phosphatase 26-like [Solanum 
tuberosum]
Length=477

 Score =   202 bits (513),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 91/119 (76%), Positives = 111/119 (93%), Gaps = 0/119 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            I+NG+AG+TS F RSE+P+VDIPL+N+ FAVPKG NAPQQVHITQGDY+GKAVI+SWVTP
Sbjct  16   IDNGNAGVTSSFIRSEFPAVDIPLENEVFAVPKGYNAPQQVHITQGDYEGKAVIVSWVTP  75

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            D+PGSS+VRYGLS+GKYDFTA+G++TNYTFY YKSG+IH+C + GL++D KYYYEIGNG
Sbjct  76   DKPGSSEVRYGLSKGKYDFTAKGSFTNYTFYTYKSGYIHKCFLNGLQYDTKYYYEIGNG  134



>ref|XP_006371756.1| hypothetical protein POPTR_0018s01990g [Populus trichocarpa]
 gb|ERP49553.1| hypothetical protein POPTR_0018s01990g [Populus trichocarpa]
Length=354

 Score =   199 bits (505),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 90/119 (76%), Positives = 103/119 (87%), Gaps = 0/119 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            +ENG+AG+TS F R++WP+ DIPLDN+ FA+PKG NAPQQVHITQGDYDGKAVIISWVTP
Sbjct  26   VENGNAGLTSTFVRTQWPAADIPLDNEVFAIPKGYNAPQQVHITQGDYDGKAVIISWVTP  85

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            DEPGS  V+YG SE  YDF+AEGT TNYTFY YKSG+IH CLV GLE+D KYYY+IG G
Sbjct  86   DEPGSISVKYGTSENSYDFSAEGTVTNYTFYKYKSGYIHHCLVDGLEYDSKYYYKIGEG  144



>ref|XP_011020214.1| PREDICTED: bifunctional purple acid phosphatase 26 [Populus euphratica]
 ref|XP_011020215.1| PREDICTED: bifunctional purple acid phosphatase 26 [Populus euphratica]
Length=483

 Score =   201 bits (511),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 91/119 (76%), Positives = 109/119 (92%), Gaps = 0/119 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            ++NG+AG+TS F RSEWPS+DIPLDN+ FAVPKG NAPQQVHITQGDY+GKAVIISWVTP
Sbjct  25   VKNGNAGITSAFIRSEWPSIDIPLDNEVFAVPKGYNAPQQVHITQGDYNGKAVIISWVTP  84

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            DEPG+++V+YG+S+ KYDFTAEGT  NYTFYNYKSG+IHQCLV GLE++ KYYY+IG+ 
Sbjct  85   DEPGTNKVQYGVSKKKYDFTAEGTVKNYTFYNYKSGYIHQCLVDGLEYETKYYYKIGSS  143



>ref|XP_004251734.1| PREDICTED: bifunctional purple acid phosphatase 26-like [Solanum 
lycopersicum]
 ref|XP_010313806.1| PREDICTED: bifunctional purple acid phosphatase 26-like [Solanum 
lycopersicum]
 ref|XP_010313807.1| PREDICTED: bifunctional purple acid phosphatase 26-like [Solanum 
lycopersicum]
Length=477

 Score =   201 bits (510),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 90/119 (76%), Positives = 110/119 (92%), Gaps = 0/119 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            I+NG+AG+TS F R E+P+VDIPLDN+ FAVPKG NAPQQVHITQGDY+GK+VI+SWVTP
Sbjct  16   IDNGNAGVTSSFVRKEFPAVDIPLDNEVFAVPKGYNAPQQVHITQGDYEGKSVIVSWVTP  75

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            D+PGSS+VRYGLS+GKYDFTA+G++TNYTFY YKSG+IH+C + GL++D KYYYEIGNG
Sbjct  76   DKPGSSEVRYGLSKGKYDFTAKGSFTNYTFYTYKSGYIHKCFLNGLQYDTKYYYEIGNG  134



>ref|XP_006371758.1| hypothetical protein POPTR_0018s01990g [Populus trichocarpa]
 gb|ERP49555.1| hypothetical protein POPTR_0018s01990g [Populus trichocarpa]
Length=408

 Score =   198 bits (504),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 90/119 (76%), Positives = 103/119 (87%), Gaps = 0/119 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            +ENG+AG+TS F R++WP+ DIPLDN+ FA+PKG NAPQQVHITQGDYDGKAVIISWVTP
Sbjct  26   VENGNAGLTSTFVRTQWPAADIPLDNEVFAIPKGYNAPQQVHITQGDYDGKAVIISWVTP  85

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            DEPGS  V+YG SE  YDF+AEGT TNYTFY YKSG+IH CLV GLE+D KYYY+IG G
Sbjct  86   DEPGSISVKYGTSENSYDFSAEGTVTNYTFYKYKSGYIHHCLVDGLEYDSKYYYKIGEG  144



>ref|XP_006371757.1| hypothetical protein POPTR_0018s01990g [Populus trichocarpa]
 gb|ERP49554.1| hypothetical protein POPTR_0018s01990g [Populus trichocarpa]
Length=406

 Score =   198 bits (503),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 90/119 (76%), Positives = 103/119 (87%), Gaps = 0/119 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            +ENG+AG+TS F R++WP+ DIPLDN+ FA+PKG NAPQQVHITQGDYDGKAVIISWVTP
Sbjct  26   VENGNAGLTSTFVRTQWPAADIPLDNEVFAIPKGYNAPQQVHITQGDYDGKAVIISWVTP  85

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            DEPGS  V+YG SE  YDF+AEGT TNYTFY YKSG+IH CLV GLE+D KYYY+IG G
Sbjct  86   DEPGSISVKYGTSENSYDFSAEGTVTNYTFYKYKSGYIHHCLVDGLEYDSKYYYKIGEG  144



>ref|XP_002530765.1| Iron(III)-zinc(II) purple acid phosphatase precursor, putative 
[Ricinus communis]
 gb|EEF31625.1| Iron(III)-zinc(II) purple acid phosphatase precursor, putative 
[Ricinus communis]
Length=488

 Score =   199 bits (507),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 91/119 (76%), Positives = 105/119 (88%), Gaps = 0/119 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            + N +AG+TS F RSEWPS+DIPLDN+ FAVPKG NAPQQVHITQGDY+GKAVIISWVTP
Sbjct  23   VNNANAGITSSFIRSEWPSIDIPLDNEVFAVPKGYNAPQQVHITQGDYNGKAVIISWVTP  82

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            DEPGSS+V+YG+SE KYDF AEGT  NYTFY YKSG+IHQCL+  LE+D KYYY+IG+G
Sbjct  83   DEPGSSKVQYGVSENKYDFIAEGTARNYTFYQYKSGYIHQCLIDDLEYDTKYYYKIGDG  141



>ref|XP_011036592.1| PREDICTED: bifunctional purple acid phosphatase 26-like [Populus 
euphratica]
 ref|XP_011036593.1| PREDICTED: bifunctional purple acid phosphatase 26-like [Populus 
euphratica]
Length=478

 Score =   199 bits (506),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 90/119 (76%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            +ENG+AG+TS F R++WP+ DIPLDN+ FA+PKG NAPQQVHITQGDYDGKAVIISWVTP
Sbjct  26   VENGNAGLTSTFIRTQWPAADIPLDNEVFAIPKGYNAPQQVHITQGDYDGKAVIISWVTP  85

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            DEPGS+ V+YG SE  YDF+AEGT TNYTFY YKSG+IH CLV GLE+D KYYY+IG G
Sbjct  86   DEPGSNTVKYGTSENSYDFSAEGTVTNYTFYKYKSGYIHHCLVDGLEYDSKYYYKIGEG  144



>gb|AGL44397.1| calcineurin-like phosphoesterase [Manihot esculenta]
Length=477

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 90/119 (76%), Positives = 106/119 (89%), Gaps = 0/119 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            ++NG AG+TS F R+EWPSVDIPLDN+ FAVP G NAPQQVHITQGDY+G+AVIISWVTP
Sbjct  21   VKNGDAGITSSFIRTEWPSVDIPLDNEVFAVPDGHNAPQQVHITQGDYNGEAVIISWVTP  80

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            D PGSS+V+YG+S+ KYDFTAEGT TNYTFY YKSG+IH CL+ GLE+D KYYY+IG+G
Sbjct  81   DNPGSSKVQYGVSKAKYDFTAEGTVTNYTFYKYKSGYIHHCLLDGLEYDTKYYYKIGDG  139



>ref|XP_006371754.1| hypothetical protein POPTR_0018s01990g [Populus trichocarpa]
 gb|ERP49551.1| hypothetical protein POPTR_0018s01990g [Populus trichocarpa]
Length=460

 Score =   197 bits (502),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 90/119 (76%), Positives = 103/119 (87%), Gaps = 0/119 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            +ENG+AG+TS F R++WP+ DIPLDN+ FA+PKG NAPQQVHITQGDYDGKAVIISWVTP
Sbjct  26   VENGNAGLTSTFVRTQWPAADIPLDNEVFAIPKGYNAPQQVHITQGDYDGKAVIISWVTP  85

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            DEPGS  V+YG SE  YDF+AEGT TNYTFY YKSG+IH CLV GLE+D KYYY+IG G
Sbjct  86   DEPGSISVKYGTSENSYDFSAEGTVTNYTFYKYKSGYIHHCLVDGLEYDSKYYYKIGEG  144



>ref|XP_002324876.1| hypothetical protein POPTR_0018s01990g [Populus trichocarpa]
 ref|XP_006371755.1| hypothetical protein POPTR_0018s01990g [Populus trichocarpa]
 gb|EEF03441.1| hypothetical protein POPTR_0018s01990g [Populus trichocarpa]
 gb|ERP49552.1| hypothetical protein POPTR_0018s01990g [Populus trichocarpa]
Length=478

 Score =   198 bits (503),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 90/119 (76%), Positives = 103/119 (87%), Gaps = 0/119 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            +ENG+AG+TS F R++WP+ DIPLDN+ FA+PKG NAPQQVHITQGDYDGKAVIISWVTP
Sbjct  26   VENGNAGLTSTFVRTQWPAADIPLDNEVFAIPKGYNAPQQVHITQGDYDGKAVIISWVTP  85

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            DEPGS  V+YG SE  YDF+AEGT TNYTFY YKSG+IH CLV GLE+D KYYY+IG G
Sbjct  86   DEPGSISVKYGTSENSYDFSAEGTVTNYTFYKYKSGYIHHCLVDGLEYDSKYYYKIGEG  144



>ref|XP_006389431.1| hypothetical protein POPTR_0025s00640g [Populus trichocarpa]
 gb|ERP48345.1| hypothetical protein POPTR_0025s00640g [Populus trichocarpa]
Length=484

 Score =   197 bits (501),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 91/119 (76%), Positives = 106/119 (89%), Gaps = 0/119 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            ++NG+AG+TS F RSEWPS DIPLD++ FAVPKG NAPQQVHITQGDY+GKAVIISWVTP
Sbjct  26   VKNGNAGITSTFIRSEWPSNDIPLDHEVFAVPKGHNAPQQVHITQGDYNGKAVIISWVTP  85

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            DEPG+S+V+YG+S+  YDFTAEG   NYTFYNY SG+IHQCLV GLE+D KYYY+IGNG
Sbjct  86   DEPGTSKVQYGVSKKNYDFTAEGAVRNYTFYNYTSGYIHQCLVDGLEYDTKYYYKIGNG  144



>ref|XP_006474401.1| PREDICTED: bifunctional purple acid phosphatase 26 isoform X2 
[Citrus sinensis]
Length=456

 Score =   196 bits (499),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 92/119 (77%), Positives = 103/119 (87%), Gaps = 0/119 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            +  GSAG+TS F R+EWPS+DIPLDN+AFAVPKG N+PQQVHITQGDYDGKAVIISWVTP
Sbjct  22   VNGGSAGITSKFIRTEWPSIDIPLDNEAFAVPKGHNSPQQVHITQGDYDGKAVIISWVTP  81

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
             EPG S V YG SE K+DFTAEGT  NYTFY YKSG+IHQCLV GLE+D KYYY+IG+G
Sbjct  82   HEPGPSTVSYGTSEDKFDFTAEGTVNNYTFYKYKSGYIHQCLVDGLEYDTKYYYKIGSG  140



>ref|XP_006453106.1| hypothetical protein CICLE_v10008153mg [Citrus clementina]
 ref|XP_006474400.1| PREDICTED: bifunctional purple acid phosphatase 26 isoform X1 
[Citrus sinensis]
 gb|ESR66346.1| hypothetical protein CICLE_v10008153mg [Citrus clementina]
Length=479

 Score =   197 bits (500),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 92/119 (77%), Positives = 103/119 (87%), Gaps = 0/119 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            +  GSAG+TS F R+EWPS+DIPLDN+AFAVPKG N+PQQVHITQGDYDGKAVIISWVTP
Sbjct  22   VNGGSAGITSKFIRTEWPSIDIPLDNEAFAVPKGHNSPQQVHITQGDYDGKAVIISWVTP  81

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
             EPG S V YG SE K+DFTAEGT  NYTFY YKSG+IHQCLV GLE+D KYYY+IG+G
Sbjct  82   HEPGPSTVSYGTSEDKFDFTAEGTVNNYTFYKYKSGYIHQCLVDGLEYDTKYYYKIGSG  140



>ref|XP_008242837.1| PREDICTED: bifunctional purple acid phosphatase 26 isoform X1 
[Prunus mume]
 ref|XP_008242838.1| PREDICTED: bifunctional purple acid phosphatase 26 isoform X1 
[Prunus mume]
 ref|XP_008242839.1| PREDICTED: bifunctional purple acid phosphatase 26 isoform X1 
[Prunus mume]
Length=483

 Score =   197 bits (500),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 91/119 (76%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            + NG+AG+TS F RSE+PSVDIPLDNK FAVP+G NAPQQVHITQGDYDGKAVIISWVTP
Sbjct  25   LRNGNAGITSTFIRSEYPSVDIPLDNKVFAVPRGHNAPQQVHITQGDYDGKAVIISWVTP  84

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            DEPG+S+V+YG SE  Y+ +AEG  TNYTFY YKSG+IH CLV GLEHD KYYY+IG+G
Sbjct  85   DEPGTSKVQYGTSENGYELSAEGIVTNYTFYKYKSGYIHHCLVDGLEHDTKYYYKIGSG  143



>ref|XP_008242841.1| PREDICTED: bifunctional purple acid phosphatase 26 isoform X2 
[Prunus mume]
Length=459

 Score =   196 bits (498),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 91/119 (76%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            + NG+AG+TS F RSE+PSVDIPLDNK FAVP+G NAPQQVHITQGDYDGKAVIISWVTP
Sbjct  25   LRNGNAGITSTFIRSEYPSVDIPLDNKVFAVPRGHNAPQQVHITQGDYDGKAVIISWVTP  84

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            DEPG+S+V+YG SE  Y+ +AEG  TNYTFY YKSG+IH CLV GLEHD KYYY+IG+G
Sbjct  85   DEPGTSKVQYGTSENGYELSAEGIVTNYTFYKYKSGYIHHCLVDGLEHDTKYYYKIGSG  143



>ref|XP_010557615.1| PREDICTED: bifunctional purple acid phosphatase 26 [Tarenaya 
hassleriana]
Length=476

 Score =   196 bits (498),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = +2

Query  182  GSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDEP  361
            G AG+TS F RSEWPSVDIPL ++ F VPKG NAPQQVHITQGDYDGKAVI+SWVTPDEP
Sbjct  21   GEAGITSTFVRSEWPSVDIPLSHEVFKVPKGYNAPQQVHITQGDYDGKAVIVSWVTPDEP  80

Query  362  GSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            GSS+V+YG  +G+YDFTAEGTYTNYTFY YKSG+IHQCLV GLE+D KYYY+I +G
Sbjct  81   GSSKVQYGTVQGQYDFTAEGTYTNYTFYKYKSGYIHQCLVAGLEYDTKYYYKIRSG  136



>ref|XP_007202018.1| hypothetical protein PRUPE_ppa004955mg [Prunus persica]
 gb|EMJ03217.1| hypothetical protein PRUPE_ppa004955mg [Prunus persica]
Length=483

 Score =   195 bits (496),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/119 (76%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            + NG+AG+TS F RSE+PS+DIPLDNK F+VPKG NAPQQVHITQGDYDGKAVIISWVTP
Sbjct  25   LRNGNAGITSTFIRSEYPSMDIPLDNKVFSVPKGHNAPQQVHITQGDYDGKAVIISWVTP  84

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            DEPG+S+V+YG SE  Y+ +AEG  TNYTFY YKSG+IH CLV GLEHD KYYY+IG+G
Sbjct  85   DEPGTSKVQYGTSENGYELSAEGIVTNYTFYKYKSGYIHHCLVDGLEHDTKYYYKIGSG  143



>ref|XP_010687874.1| PREDICTED: bifunctional purple acid phosphatase 26-like [Beta 
vulgaris subsp. vulgaris]
Length=478

 Score =   194 bits (494),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 90/117 (77%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = +2

Query  179  NGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDE  358
             G AG+TS F RSEWP+ DIPLDN+ FAVPKG NAPQQVHITQGDYDGKAVIISWVTPDE
Sbjct  27   KGDAGLTSTFIRSEWPATDIPLDNEVFAVPKGHNAPQQVHITQGDYDGKAVIISWVTPDE  86

Query  359  PGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            PGSS+V+YG SE K+DFTAEGT  NY+FY Y SG IH CLV GLE+D+KYYY+IG+G
Sbjct  87   PGSSKVQYGTSEDKFDFTAEGTVANYSFYKYNSGHIHHCLVDGLEYDKKYYYKIGSG  143



>gb|EYU40133.1| hypothetical protein MIMGU_mgv1a005618mg [Erythranthe guttata]
Length=477

 Score =   194 bits (494),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 92/119 (77%), Positives = 106/119 (89%), Gaps = 0/119 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            I NGS G+TSGF R+E+PSVDIPLDN+ FAVPKG NAPQQVHITQGDYDGKAVII+WVT 
Sbjct  16   ISNGSGGVTSGFVRNEFPSVDIPLDNEVFAVPKGYNAPQQVHITQGDYDGKAVIITWVTA  75

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            DEPGS++V YGLSEGKY++TAEGT  NYTFYNY SG+IHQCL+ GL++  KYYYEIG+G
Sbjct  76   DEPGSNKVSYGLSEGKYEYTAEGTVHNYTFYNYTSGYIHQCLIDGLQYSTKYYYEIGDG  134



>ref|XP_002870408.1| ATPAP26/PAP26 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46667.1| ATPAP26/PAP26 [Arabidopsis lyrata subsp. lyrata]
Length=475

 Score =   194 bits (494),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 90/119 (76%), Positives = 100/119 (84%), Gaps = 0/119 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            +  G AG+TS F RSEWP+VDIPLD+  F +PKG NAPQQVHITQGDYDGKAVIISWVTP
Sbjct  16   VYRGDAGVTSSFIRSEWPAVDIPLDHHVFKIPKGYNAPQQVHITQGDYDGKAVIISWVTP  75

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            DEPGSS+V YG  +GKY+F AEGTY NYTFY YKSGFIH CLV GLEHD KYYY+I +G
Sbjct  76   DEPGSSKVYYGAVQGKYEFVAEGTYHNYTFYKYKSGFIHHCLVSGLEHDTKYYYKIESG  134



>gb|KDO73457.1| hypothetical protein CISIN_1g011679mg [Citrus sinensis]
Length=466

 Score =   194 bits (493),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 91/119 (76%), Positives = 102/119 (86%), Gaps = 0/119 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            +  GSAG+TS F R+EWPS+DIPLDN+AFAVPKG N+PQQVHITQGDYDGKAVIISWVTP
Sbjct  22   VNGGSAGITSKFIRTEWPSIDIPLDNEAFAVPKGHNSPQQVHITQGDYDGKAVIISWVTP  81

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
             EPG S V YG S  K+DFTAEGT  NYTFY YKSG+IHQCLV GLE+D KYYY+IG+G
Sbjct  82   HEPGPSTVSYGTSADKFDFTAEGTVNNYTFYKYKSGYIHQCLVDGLEYDTKYYYKIGSG  140



>gb|KDO73456.1| hypothetical protein CISIN_1g011679mg [Citrus sinensis]
Length=479

 Score =   194 bits (494),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 91/119 (76%), Positives = 102/119 (86%), Gaps = 0/119 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            +  GSAG+TS F R+EWPS+DIPLDN+AFAVPKG N+PQQVHITQGDYDGKAVIISWVTP
Sbjct  22   VNGGSAGITSKFIRTEWPSIDIPLDNEAFAVPKGHNSPQQVHITQGDYDGKAVIISWVTP  81

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
             EPG S V YG S  K+DFTAEGT  NYTFY YKSG+IHQCLV GLE+D KYYY+IG+G
Sbjct  82   HEPGPSTVSYGTSADKFDFTAEGTVNNYTFYKYKSGYIHQCLVDGLEYDTKYYYKIGSG  140



>ref|XP_008373401.1| PREDICTED: bifunctional purple acid phosphatase 26-like [Malus 
domestica]
Length=463

 Score =   193 bits (491),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 106/120 (88%), Gaps = 1/120 (1%)
 Frame = +2

Query  173  IENG-SAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVT  349
            + NG +AG+TS F RSE+P+VD+PLD+K FAVPKG NAPQQVHITQGDYDGKAVIISWVT
Sbjct  26   LANGKAAGITSTFLRSEYPAVDMPLDHKVFAVPKGYNAPQQVHITQGDYDGKAVIISWVT  85

Query  350  PDEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            PDEPG S+V+YG SE KY+F+A+G  TNYT+Y YKSG+IH CLVGGLE+D KYYYEIGNG
Sbjct  86   PDEPGDSKVQYGTSEKKYEFSAKGVVTNYTYYQYKSGYIHHCLVGGLEYDTKYYYEIGNG  145



>ref|XP_011017864.1| PREDICTED: bifunctional purple acid phosphatase 26-like isoform 
X1 [Populus euphratica]
 ref|XP_011017865.1| PREDICTED: bifunctional purple acid phosphatase 26-like isoform 
X1 [Populus euphratica]
Length=484

 Score =   194 bits (492),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 90/119 (76%), Positives = 105/119 (88%), Gaps = 0/119 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            ++NG+AG TS F RSEWPS DIPLD++ FAVPKG NAPQQVHITQGDY+GKAVIISWVTP
Sbjct  26   VKNGNAGKTSTFIRSEWPSNDIPLDHEVFAVPKGHNAPQQVHITQGDYNGKAVIISWVTP  85

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            DEPG+S+V+YG+S+  YDFTAEG   NYTFYNY SG+IHQCLV GLE+D KYYY+IG+G
Sbjct  86   DEPGTSKVQYGVSKENYDFTAEGAVRNYTFYNYTSGYIHQCLVDGLEYDTKYYYKIGSG  144



>ref|NP_001275256.1| purple acid phosphatase 3 precursor [Solanum tuberosum]
 gb|AAT37528.1| purple acid phosphatase 3 [Solanum tuberosum]
Length=477

 Score =   193 bits (491),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 90/119 (76%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            I+NGSAG+TS F R+++PSVDIPL+N+  +VP G NAPQQVHITQGDYDG+AVIISWVT 
Sbjct  16   IDNGSAGITSAFIRTQFPSVDIPLENEVLSVPNGYNAPQQVHITQGDYDGEAVIISWVTA  75

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            DEPGSS+VRYGLSEGKYD T EGT  NYTFY Y+SG+IHQCLV GL++D KYYYEIG G
Sbjct  76   DEPGSSEVRYGLSEGKYDVTVEGTLNNYTFYKYESGYIHQCLVTGLQYDTKYYYEIGKG  134



>ref|XP_010435390.1| PREDICTED: bifunctional purple acid phosphatase 26 isoform X2 
[Camelina sativa]
Length=451

 Score =   192 bits (489),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 88/116 (76%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = +2

Query  182  GSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDEP  361
            G AG+TS F RSEWP+VDIPLD+  F VPKG NAPQQVHITQGDYDGKAVI+SWVTPDEP
Sbjct  20   GDAGITSSFIRSEWPAVDIPLDHHVFKVPKGYNAPQQVHITQGDYDGKAVIVSWVTPDEP  79

Query  362  GSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            GS +V YG  +GKY+FTAEGTY+NYTFY YKSGF+H CLV GLE+D KYYY+I +G
Sbjct  80   GSGKVHYGTVQGKYEFTAEGTYSNYTFYKYKSGFVHHCLVSGLEYDTKYYYKIESG  135



>ref|XP_004242741.1| PREDICTED: bifunctional purple acid phosphatase 26 [Solanum lycopersicum]
 ref|XP_004242742.1| PREDICTED: bifunctional purple acid phosphatase 26 [Solanum lycopersicum]
Length=477

 Score =   193 bits (490),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/119 (76%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            I+NGSAG+TS F R+++PSVDIPL+N+  +VP G NAPQQVHITQGDYDG+AVIISWVT 
Sbjct  16   IDNGSAGITSAFVRTQFPSVDIPLENEVLSVPNGYNAPQQVHITQGDYDGEAVIISWVTA  75

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            DEPGSS+VRYGLSEGKYD T EGT  NYTFY Y+SG+IHQCLV GL++D KYYYEIG G
Sbjct  76   DEPGSSEVRYGLSEGKYDVTVEGTLNNYTFYKYESGYIHQCLVTGLQYDTKYYYEIGKG  134



>ref|XP_010250242.1| PREDICTED: bifunctional purple acid phosphatase 26-like [Nelumbo 
nucifera]
Length=531

 Score =   194 bits (493),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/119 (76%), Positives = 102/119 (86%), Gaps = 0/119 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            +E GSAG+TS F RSEWPS+DIPLDNK FAVPKG NAPQQVHITQGDYDGKAVIISWVT 
Sbjct  73   LEKGSAGVTSSFVRSEWPSIDIPLDNKVFAVPKGYNAPQQVHITQGDYDGKAVIISWVTT  132

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            DEPG ++V+YG S+ KY F+AEGT TNYTFY YKSG+IH CLV  LE+D KYYY+IG G
Sbjct  133  DEPGPNKVQYGKSKKKYSFSAEGTITNYTFYKYKSGYIHHCLVDDLEYDTKYYYKIGKG  191



>ref|XP_010435389.1| PREDICTED: bifunctional purple acid phosphatase 26 isoform X1 
[Camelina sativa]
Length=475

 Score =   193 bits (490),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/116 (76%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = +2

Query  182  GSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDEP  361
            G AG+TS F RSEWP+VDIPLD+  F VPKG NAPQQVHITQGDYDGKAVI+SWVTPDEP
Sbjct  20   GDAGITSSFIRSEWPAVDIPLDHHVFKVPKGYNAPQQVHITQGDYDGKAVIVSWVTPDEP  79

Query  362  GSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            GS +V YG  +GKY+FTAEGTY+NYTFY YKSGF+H CLV GLE+D KYYY+I +G
Sbjct  80   GSGKVHYGTVQGKYEFTAEGTYSNYTFYKYKSGFVHHCLVSGLEYDTKYYYKIESG  135



>ref|XP_006359491.1| PREDICTED: bifunctional purple acid phosphatase 26 [Solanum tuberosum]
Length=477

 Score =   193 bits (490),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/119 (75%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            I+NGSAG+TS F R+++PSVDIPL+N+  +VP G NAPQQVHITQGDYDG+AVIISWVT 
Sbjct  16   IDNGSAGITSAFIRTQFPSVDIPLENEVLSVPNGYNAPQQVHITQGDYDGEAVIISWVTA  75

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            DEPGSS+VRYGLSEGKYD T EGT  NYTFY Y+SG+IHQCL+ GL++D KYYYEIG G
Sbjct  76   DEPGSSEVRYGLSEGKYDVTVEGTLNNYTFYKYESGYIHQCLITGLQYDTKYYYEIGKG  134



>ref|NP_198334.1| purple acid phosphatase 26 [Arabidopsis thaliana]
 sp|Q949Y3.1|PPA26_ARATH RecName: Full=Bifunctional purple acid phosphatase 26; Includes: 
RecName: Full=Acid phosphatase; Includes: RecName: Full=Peroxidase; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAK92747.1| putative acid phosphatase [Arabidopsis thaliana]
 gb|AAM14354.1| putative acid phosphatase [Arabidopsis thaliana]
 gb|AED93912.1| purple acid phosphatase 26 [Arabidopsis thaliana]
Length=475

 Score =   193 bits (490),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/119 (75%), Positives = 99/119 (83%), Gaps = 0/119 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            +  G +G+TS F RSEWP+VDIPLD+  F VPKG NAPQQVHITQGDYDGKAVIISWVTP
Sbjct  17   LYRGESGITSSFIRSEWPAVDIPLDHHVFKVPKGYNAPQQVHITQGDYDGKAVIISWVTP  76

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            DEPGSSQV YG  +GKY+F A+GTY NYTFY YKSGFIH CLV  LEHD KYYY+I +G
Sbjct  77   DEPGSSQVHYGAVQGKYEFVAQGTYHNYTFYKYKSGFIHHCLVSDLEHDTKYYYKIESG  135



>gb|AAW29950.1| putative purple acid phosphatase [Arabidopsis thaliana]
Length=475

 Score =   192 bits (489),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/119 (75%), Positives = 99/119 (83%), Gaps = 0/119 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            +  G +G+TS F RSEWP+VDIPLD+  F VPKG NAPQQVHITQGDYDGKAVIISWVTP
Sbjct  17   LYRGESGITSSFIRSEWPAVDIPLDHHVFKVPKGYNAPQQVHITQGDYDGKAVIISWVTP  76

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            DEPGSSQV YG  +GKY+F A+GTY NYTFY YKSGFIH CLV  LEHD KYYY+I +G
Sbjct  77   DEPGSSQVHYGAVQGKYEFVAQGTYHNYTFYKYKSGFIHHCLVSDLEHDTKYYYKIESG  135



>ref|XP_010450339.1| PREDICTED: bifunctional purple acid phosphatase 26-like isoform 
X2 [Camelina sativa]
Length=451

 Score =   191 bits (485),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 88/116 (76%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = +2

Query  182  GSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDEP  361
            G AG+TS F RSEWP+VDIPLD+  F VPKG NAPQQVHITQGDYDGKAVI+SWVTPDEP
Sbjct  20   GDAGITSSFIRSEWPAVDIPLDHHVFKVPKGYNAPQQVHITQGDYDGKAVIVSWVTPDEP  79

Query  362  GSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            GS +V YG  +GKY+FTAEGTY+NYTFY YKSGF+H CLV GLE+D KYYY+I +G
Sbjct  80   GSGKVHYGTVQGKYEFTAEGTYSNYTFYKYKSGFVHHCLVYGLEYDTKYYYKIESG  135



>ref|XP_010450337.1| PREDICTED: bifunctional purple acid phosphatase 26-like isoform 
X1 [Camelina sativa]
 ref|XP_010450338.1| PREDICTED: bifunctional purple acid phosphatase 26-like isoform 
X1 [Camelina sativa]
Length=475

 Score =   191 bits (486),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 88/116 (76%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = +2

Query  182  GSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDEP  361
            G AG+TS F RSEWP+VDIPLD+  F VPKG NAPQQVHITQGDYDGKAVI+SWVTPDEP
Sbjct  20   GDAGITSSFIRSEWPAVDIPLDHHVFKVPKGYNAPQQVHITQGDYDGKAVIVSWVTPDEP  79

Query  362  GSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            GS +V YG  +GKY+FTAEGTY+NYTFY YKSGF+H CLV GLE+D KYYY+I +G
Sbjct  80   GSGKVHYGTVQGKYEFTAEGTYSNYTFYKYKSGFVHHCLVYGLEYDTKYYYKIESG  135



>ref|XP_002515485.1| Iron(III)-zinc(II) purple acid phosphatase precursor, putative 
[Ricinus communis]
 gb|EEF46934.1| Iron(III)-zinc(II) purple acid phosphatase precursor, putative 
[Ricinus communis]
Length=469

 Score =   189 bits (480),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 87/119 (73%), Positives = 101/119 (85%), Gaps = 0/119 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            +ENG+AG+TS F RS+WPS DIPLDN+ FA+PKG NAPQQVHITQGDYDGKAVIISW+T 
Sbjct  17   LENGNAGITSSFTRSQWPSTDIPLDNQVFAIPKGHNAPQQVHITQGDYDGKAVIISWITA  76

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            DEPGS  V YG  E KY+F+A+GT TNYTFYNY SG+IH CLV GLE+D KY+Y+IG G
Sbjct  77   DEPGSINVEYGKLEKKYEFSAQGTVTNYTFYNYTSGYIHHCLVDGLEYDTKYFYKIGEG  135



>ref|XP_004287267.1| PREDICTED: bifunctional purple acid phosphatase 26 [Fragaria 
vesca subsp. vesca]
 ref|XP_011457743.1| PREDICTED: bifunctional purple acid phosphatase 26 [Fragaria 
vesca subsp. vesca]
Length=482

 Score =   189 bits (481),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 89/119 (75%), Positives = 103/119 (87%), Gaps = 0/119 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            +  G+AG+TS F RSE+PSVDIPLD++ FAVPKG NAPQQVHITQGDYDGKAVIISWVT 
Sbjct  25   LRYGNAGITSNFVRSEYPSVDIPLDHRVFAVPKGHNAPQQVHITQGDYDGKAVIISWVTA  84

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            DEPG+S+V+YG SE  Y+F+AEGT TNYTFY YKSG+IH C V GLEHD KYYY+IG+G
Sbjct  85   DEPGTSKVQYGTSEKNYEFSAEGTITNYTFYEYKSGYIHHCHVDGLEHDTKYYYKIGSG  143



>ref|XP_010096988.1| Bifunctional purple acid phosphatase 26 [Morus notabilis]
 gb|EXB66615.1| Bifunctional purple acid phosphatase 26 [Morus notabilis]
Length=417

 Score =   188 bits (477),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = +2

Query  179  NGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDE  358
            NG+AG+TS F RSEWPS DIP+DN+AF++PK  NAPQQVHITQ DYDG+AVIISWVTPD 
Sbjct  105  NGNAGITSTFIRSEWPSTDIPIDNEAFSIPKAHNAPQQVHITQADYDGRAVIISWVTPDA  164

Query  359  PGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            PGS++V+YG +E +Y+FTAEGT +NYTFY YKSG+IH CLV GLE+D KYYY++G+G
Sbjct  165  PGSNKVQYGTAEKRYEFTAEGTVSNYTFYQYKSGYIHHCLVDGLEYDTKYYYKLGSG  221



>gb|KDP30232.1| hypothetical protein JCGZ_17014 [Jatropha curcas]
Length=478

 Score =   189 bits (481),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 88/116 (76%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = +2

Query  182  GSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDEP  361
            G+AG+TS F RS WPS DIPLDN+ FAVPKG NAPQQVHITQGDY+GKAVIISWVTPDEP
Sbjct  22   GNAGITSSFIRSAWPSTDIPLDNEVFAVPKGYNAPQQVHITQGDYNGKAVIISWVTPDEP  81

Query  362  GSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            GSS+V+YG S+ KYDFTAEG   NYTFY YKSG+IH CL+ GL++D KYYY+IG+G
Sbjct  82   GSSKVQYGTSKKKYDFTAEGIVRNYTFYQYKSGYIHHCLLDGLKYDTKYYYKIGDG  137



>ref|XP_010440689.1| PREDICTED: bifunctional purple acid phosphatase 26-like isoform 
X2 [Camelina sativa]
Length=451

 Score =   189 bits (479),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 86/116 (74%), Positives = 99/116 (85%), Gaps = 0/116 (0%)
 Frame = +2

Query  182  GSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDEP  361
            G AG+TS F RSEWP++DIPLD+  F VPKG NAPQQVHITQGDYDGKAVI+SWVTPDEP
Sbjct  20   GDAGITSSFIRSEWPAIDIPLDHYVFKVPKGYNAPQQVHITQGDYDGKAVIVSWVTPDEP  79

Query  362  GSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            GS +V YG  +GKY+FTAEGTY+NYTFY YKSGF+H C V GLE+D KYYY+I +G
Sbjct  80   GSGKVHYGTVQGKYEFTAEGTYSNYTFYKYKSGFVHHCHVSGLEYDTKYYYKIESG  135



>ref|XP_007155068.1| hypothetical protein PHAVU_003G170500g [Phaseolus vulgaris]
 gb|ESW27062.1| hypothetical protein PHAVU_003G170500g [Phaseolus vulgaris]
Length=480

 Score =   189 bits (480),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 93/140 (66%), Positives = 111/140 (79%), Gaps = 0/140 (0%)
 Frame = +2

Query  110  DKEADTMllhllfffslllsfIENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQ  289
            ++   TMLL  +    +LL  I +GSAG+TS F RSEWP+VDIPLD++AFAVPKG NAPQ
Sbjct  2    ERRVQTMLLKFVLASFVLLVSIRDGSAGITSSFIRSEWPAVDIPLDHEAFAVPKGYNAPQ  61

Query  290  QVHITQGDYDGKAVIISWVTPDEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIH  469
            QVHITQGDYDGKAVIISWVTPDEPG + V+YG SE K+  + EGT TNYTFY YKSG+IH
Sbjct  62   QVHITQGDYDGKAVIISWVTPDEPGPNHVQYGTSESKFQTSLEGTVTNYTFYEYKSGYIH  121

Query  470  QCLVGGLEHDRKYYYEIGNG  529
             C++ GLE+  KYYY IG+G
Sbjct  122  HCVIEGLEYKTKYYYRIGSG  141



>ref|XP_007155069.1| hypothetical protein PHAVU_003G170500g [Phaseolus vulgaris]
 dbj|BAD05166.1| acid phosphatase [Phaseolus vulgaris]
 dbj|BAD05167.1| acid phosphatase [Phaseolus vulgaris]
 gb|ESW27063.1| hypothetical protein PHAVU_003G170500g [Phaseolus vulgaris]
Length=457

 Score =   189 bits (479),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 93/140 (66%), Positives = 111/140 (79%), Gaps = 0/140 (0%)
 Frame = +2

Query  110  DKEADTMllhllfffslllsfIENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQ  289
            ++   TMLL  +    +LL  I +GSAG+TS F RSEWP+VDIPLD++AFAVPKG NAPQ
Sbjct  2    ERRVQTMLLKFVLASFVLLVSIRDGSAGITSSFIRSEWPAVDIPLDHEAFAVPKGYNAPQ  61

Query  290  QVHITQGDYDGKAVIISWVTPDEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIH  469
            QVHITQGDYDGKAVIISWVTPDEPG + V+YG SE K+  + EGT TNYTFY YKSG+IH
Sbjct  62   QVHITQGDYDGKAVIISWVTPDEPGPNHVQYGTSESKFQTSLEGTVTNYTFYEYKSGYIH  121

Query  470  QCLVGGLEHDRKYYYEIGNG  529
             C++ GLE+  KYYY IG+G
Sbjct  122  HCVIEGLEYKTKYYYRIGSG  141



>ref|XP_006403101.1| hypothetical protein EUTSA_v10003451mg [Eutrema salsugineum]
 ref|XP_006403102.1| hypothetical protein EUTSA_v10003451mg [Eutrema salsugineum]
 gb|ESQ44554.1| hypothetical protein EUTSA_v10003451mg [Eutrema salsugineum]
 gb|ESQ44555.1| hypothetical protein EUTSA_v10003451mg [Eutrema salsugineum]
Length=474

 Score =   189 bits (480),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 86/119 (72%), Positives = 100/119 (84%), Gaps = 0/119 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            + +G  G+TS F RSEWP++DIPLD+  F VPKG NAPQQVHITQGDYDGKAVIISWVTP
Sbjct  16   LLHGDGGITSSFIRSEWPAIDIPLDHHVFKVPKGYNAPQQVHITQGDYDGKAVIISWVTP  75

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            DEPGSS+V YG  +GKYDF A+GTY+NYTFY YKSG+ H CLV GLE+D KYYY+I +G
Sbjct  76   DEPGSSKVLYGAVQGKYDFVAQGTYSNYTFYKYKSGYTHHCLVSGLEYDTKYYYKIESG  134



>ref|XP_010440687.1| PREDICTED: bifunctional purple acid phosphatase 26-like isoform 
X1 [Camelina sativa]
 ref|XP_010440688.1| PREDICTED: bifunctional purple acid phosphatase 26-like isoform 
X1 [Camelina sativa]
Length=475

 Score =   189 bits (479),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 86/116 (74%), Positives = 99/116 (85%), Gaps = 0/116 (0%)
 Frame = +2

Query  182  GSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDEP  361
            G AG+TS F RSEWP++DIPLD+  F VPKG NAPQQVHITQGDYDGKAVI+SWVTPDEP
Sbjct  20   GDAGITSSFIRSEWPAIDIPLDHYVFKVPKGYNAPQQVHITQGDYDGKAVIVSWVTPDEP  79

Query  362  GSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            GS +V YG  +GKY+FTAEGTY+NYTFY YKSGF+H C V GLE+D KYYY+I +G
Sbjct  80   GSGKVHYGTVQGKYEFTAEGTYSNYTFYKYKSGFVHHCHVSGLEYDTKYYYKIESG  135



>ref|XP_009363959.1| PREDICTED: bifunctional purple acid phosphatase 26-like isoform 
X1 [Pyrus x bretschneideri]
Length=463

 Score =   188 bits (477),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 103/120 (86%), Gaps = 1/120 (1%)
 Frame = +2

Query  173  IENGSA-GMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVT  349
            + NG+A G+TS F RSE+PSVDIPL+NK FAVP+G NAPQQVH+TQGDYDGKAVIISWVT
Sbjct  26   LMNGNATGITSTFIRSEYPSVDIPLNNKVFAVPRGYNAPQQVHVTQGDYDGKAVIISWVT  85

Query  350  PDEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
             DEPG  +VRYG SE KY+F+A+G  TNYTFY YKSG+IH CLV GLE+D KYYY+IGNG
Sbjct  86   ADEPGDGKVRYGTSEKKYEFSAKGVMTNYTFYQYKSGYIHHCLVDGLEYDTKYYYKIGNG  145



>gb|AGV54598.1| acid phosphatase [Phaseolus vulgaris]
Length=479

 Score =   188 bits (478),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 92/140 (66%), Positives = 111/140 (79%), Gaps = 0/140 (0%)
 Frame = +2

Query  110  DKEADTMllhllfffslllsfIENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQ  289
            ++   TMLL  +    +LL  I +GSAG+TS F RSEWP+VDIPLD++AFAVPKG NAPQ
Sbjct  2    ERRVQTMLLKFVLASFVLLVSIRDGSAGITSSFIRSEWPAVDIPLDHEAFAVPKGYNAPQ  61

Query  290  QVHITQGDYDGKAVIISWVTPDEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIH  469
            QVHITQGDYDGKAVIISWVTPDEPG + V+YG SE K+  + EGT TNYTFY Y+SG+IH
Sbjct  62   QVHITQGDYDGKAVIISWVTPDEPGPNHVQYGTSESKFQTSLEGTVTNYTFYEYQSGYIH  121

Query  470  QCLVGGLEHDRKYYYEIGNG  529
             C++ GLE+  KYYY IG+G
Sbjct  122  HCVIEGLEYQTKYYYRIGSG  141



>ref|XP_002264680.1| PREDICTED: bifunctional purple acid phosphatase 26-like [Vitis 
vinifera]
 ref|XP_010656512.1| PREDICTED: bifunctional purple acid phosphatase 26-like [Vitis 
vinifera]
Length=487

 Score =   188 bits (478),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/119 (76%), Positives = 102/119 (86%), Gaps = 0/119 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            + NG+A +TS F RSE+PSVDIPLDNK FAVPKG NAPQQVHITQGDYDGKAVI+SWVT 
Sbjct  29   VGNGNARITSAFVRSEFPSVDIPLDNKVFAVPKGYNAPQQVHITQGDYDGKAVIVSWVTT  88

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            DEPG S+V+YG SE  YD+TAEGT TNYTFY Y+SG+IH CLV GLE D KYYY+IG+G
Sbjct  89   DEPGPSKVQYGTSEKTYDYTAEGTTTNYTFYKYQSGYIHHCLVDGLEFDTKYYYKIGSG  147



>emb|CBI25544.3| unnamed protein product [Vitis vinifera]
Length=462

 Score =   187 bits (476),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/119 (76%), Positives = 102/119 (86%), Gaps = 0/119 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            + NG+A +TS F RSE+PSVDIPLDNK FAVPKG NAPQQVHITQGDYDGKAVI+SWVT 
Sbjct  4    VGNGNARITSAFVRSEFPSVDIPLDNKVFAVPKGYNAPQQVHITQGDYDGKAVIVSWVTT  63

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            DEPG S+V+YG SE  YD+TAEGT TNYTFY Y+SG+IH CLV GLE D KYYY+IG+G
Sbjct  64   DEPGPSKVQYGTSEKTYDYTAEGTTTNYTFYKYQSGYIHHCLVDGLEFDTKYYYKIGSG  122



>ref|XP_010241603.1| PREDICTED: bifunctional purple acid phosphatase 26 isoform X1 
[Nelumbo nucifera]
Length=478

 Score =   187 bits (476),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/119 (74%), Positives = 99/119 (83%), Gaps = 0/119 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            +  GSAG+TS F RSEWPS DIPLDN+ F VPKG N PQQVHITQGDYDGKAVIISWVT 
Sbjct  21   VNKGSAGITSTFIRSEWPSTDIPLDNEVFVVPKGYNTPQQVHITQGDYDGKAVIISWVTT  80

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            DEPG S+V+YG SE +Y ++AEG  TNYTFYNYKSG+IH CLV GLE+D KYYY+IG G
Sbjct  81   DEPGPSKVQYGTSEKQYSYSAEGIITNYTFYNYKSGYIHHCLVDGLEYDTKYYYKIGVG  139



>gb|KCW79137.1| hypothetical protein EUGRSUZ_C00583 [Eucalyptus grandis]
Length=407

 Score =   186 bits (472),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/119 (71%), Positives = 102/119 (86%), Gaps = 0/119 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            +EN   G+TS F RS+WPSVDIPLDN+ FAVPKG NAPQQVHITQGDYDGKAVIISWVT 
Sbjct  18   VENTFGGITSTFIRSQWPSVDIPLDNEVFAVPKGHNAPQQVHITQGDYDGKAVIISWVTS  77

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            DEPGSS+V+YG + GKYD +AEG  ++Y+FY YKSG+IH CL+ GLE+D KYYY++G+G
Sbjct  78   DEPGSSEVQYGTTTGKYDHSAEGKSSSYSFYKYKSGYIHHCLLDGLEYDTKYYYKVGSG  136



>ref|XP_009363960.1| PREDICTED: bifunctional purple acid phosphatase 26-like isoform 
X2 [Pyrus x bretschneideri]
Length=478

 Score =   187 bits (476),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 103/120 (86%), Gaps = 1/120 (1%)
 Frame = +2

Query  173  IENGSA-GMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVT  349
            + NG+A G+TS F RSE+PSVDIPL+NK FAVP+G NAPQQVH+TQGDYDGKAVIISWVT
Sbjct  26   LMNGNATGITSTFIRSEYPSVDIPLNNKVFAVPRGYNAPQQVHVTQGDYDGKAVIISWVT  85

Query  350  PDEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
             DEPG  +VRYG SE KY+F+A+G  TNYTFY YKSG+IH CLV GLE+D KYYY+IGNG
Sbjct  86   ADEPGDGKVRYGTSEKKYEFSAKGVMTNYTFYQYKSGYIHHCLVDGLEYDTKYYYKIGNG  145



>ref|XP_004508441.1| PREDICTED: bifunctional purple acid phosphatase 26-like isoform 
X3 [Cicer arietinum]
Length=466

 Score =   187 bits (475),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/119 (73%), Positives = 103/119 (87%), Gaps = 0/119 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            I +G AG+TS F RS+WPSVDIPL+++AFAVPKG NAPQQVHITQGDYDGKAVIISWVTP
Sbjct  19   IRDGCAGITSSFVRSDWPSVDIPLNHEAFAVPKGYNAPQQVHITQGDYDGKAVIISWVTP  78

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            +EPGS+ V++G SE K+  TAEGT +NYTFY YKSG+IH CLV GLE++ KYYY IG+G
Sbjct  79   EEPGSNHVQFGTSENKFKATAEGTVSNYTFYKYKSGYIHHCLVEGLEYNTKYYYRIGSG  137



>emb|CAN71549.1| hypothetical protein VITISV_030234 [Vitis vinifera]
Length=465

 Score =   187 bits (475),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 90/119 (76%), Positives = 101/119 (85%), Gaps = 0/119 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            + NG+A +TS F RSE+PSVDIPLDNK FAVPKG NAPQQVHITQGDYDGKAVI+SWVT 
Sbjct  22   VGNGNARITSAFVRSEFPSVDIPLDNKVFAVPKGYNAPQQVHITQGDYDGKAVIVSWVTT  81

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            DEPG S+V YG SE  YD+TAEGT TNYTFY Y+SG+IH CLV GLE D KYYY+IG+G
Sbjct  82   DEPGPSKVXYGTSEKTYDYTAEGTTTNYTFYKYQSGYIHHCLVDGLEFDTKYYYKIGSG  140



>ref|XP_010241604.1| PREDICTED: bifunctional purple acid phosphatase 26 isoform X2 
[Nelumbo nucifera]
Length=455

 Score =   187 bits (474),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/119 (74%), Positives = 99/119 (83%), Gaps = 0/119 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            +  GSAG+TS F RSEWPS DIPLDN+ F VPKG N PQQVHITQGDYDGKAVIISWVT 
Sbjct  21   VNKGSAGITSTFIRSEWPSTDIPLDNEVFVVPKGYNTPQQVHITQGDYDGKAVIISWVTT  80

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            DEPG S+V+YG SE +Y ++AEG  TNYTFYNYKSG+IH CLV GLE+D KYYY+IG G
Sbjct  81   DEPGPSKVQYGTSEKQYSYSAEGIITNYTFYNYKSGYIHHCLVDGLEYDTKYYYKIGVG  139



>ref|XP_010648745.1| PREDICTED: bifunctional purple acid phosphatase 26 [Vitis vinifera]
 ref|XP_010648746.1| PREDICTED: bifunctional purple acid phosphatase 26 [Vitis vinifera]
 emb|CBI21132.3| unnamed protein product [Vitis vinifera]
Length=484

 Score =   187 bits (476),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 89/119 (75%), Positives = 100/119 (84%), Gaps = 0/119 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            + +GSA +TS F RSEWPS DIPLDN+AFA+PKG NAPQQVHITQGDYDGKAVII+WVT 
Sbjct  25   VRSGSARITSTFTRSEWPSTDIPLDNEAFAIPKGHNAPQQVHITQGDYDGKAVIITWVTT  84

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            DEPGSS+V YG  E KYDF+AEG  TNYTF NY SG+IH CLV GLE D KYYY+IG+G
Sbjct  85   DEPGSSKVLYGTLEKKYDFSAEGNVTNYTFSNYSSGYIHHCLVHGLEPDTKYYYKIGDG  143



>ref|XP_004508439.1| PREDICTED: bifunctional purple acid phosphatase 26-like isoform 
X1 [Cicer arietinum]
 ref|XP_004508440.1| PREDICTED: bifunctional purple acid phosphatase 26-like isoform 
X2 [Cicer arietinum]
Length=476

 Score =   187 bits (475),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 87/119 (73%), Positives = 103/119 (87%), Gaps = 0/119 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            I +G AG+TS F RS+WPSVDIPL+++AFAVPKG NAPQQVHITQGDYDGKAVIISWVTP
Sbjct  19   IRDGCAGITSSFVRSDWPSVDIPLNHEAFAVPKGYNAPQQVHITQGDYDGKAVIISWVTP  78

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            +EPGS+ V++G SE K+  TAEGT +NYTFY YKSG+IH CLV GLE++ KYYY IG+G
Sbjct  79   EEPGSNHVQFGTSENKFKATAEGTVSNYTFYKYKSGYIHHCLVEGLEYNTKYYYRIGSG  137



>gb|KCW79138.1| hypothetical protein EUGRSUZ_C00583 [Eucalyptus grandis]
Length=398

 Score =   185 bits (470),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 85/119 (71%), Positives = 102/119 (86%), Gaps = 0/119 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            +EN   G+TS F RS+WPSVDIPLDN+ FAVPKG NAPQQVHITQGDYDGKAVIISWVT 
Sbjct  18   VENTFGGITSTFIRSQWPSVDIPLDNEVFAVPKGHNAPQQVHITQGDYDGKAVIISWVTS  77

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            DEPGSS+V+YG + GKYD +AEG  ++Y+FY YKSG+IH CL+ GLE+D KYYY++G+G
Sbjct  78   DEPGSSEVQYGTTTGKYDHSAEGKSSSYSFYKYKSGYIHHCLLDGLEYDTKYYYKVGSG  136



>ref|XP_006283714.1| hypothetical protein CARUB_v10004784mg [Capsella rubella]
 gb|EOA16612.1| hypothetical protein CARUB_v10004784mg [Capsella rubella]
Length=453

 Score =   186 bits (471),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 86/117 (74%), Positives = 97/117 (83%), Gaps = 0/117 (0%)
 Frame = +2

Query  179  NGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDE  358
             G AG+TS F RSEWP+VDIPLD+  F VPKG NAPQQV ITQGDYDGKAVIISWVTPDE
Sbjct  21   RGEAGITSSFIRSEWPAVDIPLDHHVFKVPKGYNAPQQVRITQGDYDGKAVIISWVTPDE  80

Query  359  PGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            PG  +V YG  +GKY+FTA GTY+NYTFY YKSGF+H CLV GLE+D KYYY+I +G
Sbjct  81   PGFGKVHYGTVQGKYEFTAHGTYSNYTFYKYKSGFVHHCLVSGLEYDTKYYYKIESG  137



>ref|XP_009358556.1| PREDICTED: bifunctional purple acid phosphatase 26-like [Pyrus 
x bretschneideri]
Length=485

 Score =   186 bits (472),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = +2

Query  182  GSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDEP  361
             +AG+TS F RS++PSVDIPL+NK FAVPKG NAPQQVHITQGDYDGKAVIISWVT +EP
Sbjct  30   NAAGITSTFIRSDYPSVDIPLNNKVFAVPKGYNAPQQVHITQGDYDGKAVIISWVTANEP  89

Query  362  GSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            G S+V+YG SE KY+F+A+G  TNYTFY YKSG+IH CLV GLE+D KYYY+IGNG
Sbjct  90   GDSKVQYGTSEKKYEFSAKGVATNYTFYQYKSGYIHHCLVDGLEYDTKYYYKIGNG  145



>ref|XP_007011812.1| Purple acid phosphatase 26 isoform 2, partial [Theobroma cacao]
 ref|XP_007011813.1| Purple acid phosphatase 26 isoform 2, partial [Theobroma cacao]
 gb|EOY29431.1| Purple acid phosphatase 26 isoform 2, partial [Theobroma cacao]
 gb|EOY29432.1| Purple acid phosphatase 26 isoform 2, partial [Theobroma cacao]
Length=468

 Score =   186 bits (471),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 87/119 (73%), Positives = 101/119 (85%), Gaps = 0/119 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            ++ GSAG+TS F RS+W S DIPLDNK FA+P G NAPQQ+HITQGDYDGKAVIISWVT 
Sbjct  26   VKRGSAGITSTFTRSQWQSFDIPLDNKVFAIPTGYNAPQQLHITQGDYDGKAVIISWVTA  85

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            DEPG S+V+YG SE KYD +A+GT TNYTFYNYKSG+IH CLV GLE++ KYYY+IG G
Sbjct  86   DEPGPSKVQYGTSEKKYDLSADGTVTNYTFYNYKSGYIHHCLVDGLEYETKYYYKIGVG  144



>ref|XP_007011811.1| Purple acid phosphatase 26 isoform 1 [Theobroma cacao]
 gb|EOY29430.1| Purple acid phosphatase 26 isoform 1 [Theobroma cacao]
Length=482

 Score =   186 bits (471),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 87/119 (73%), Positives = 101/119 (85%), Gaps = 0/119 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            ++ GSAG+TS F RS+W S DIPLDNK FA+P G NAPQQ+HITQGDYDGKAVIISWVT 
Sbjct  26   VKRGSAGITSTFTRSQWQSFDIPLDNKVFAIPTGYNAPQQLHITQGDYDGKAVIISWVTA  85

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            DEPG S+V+YG SE KYD +A+GT TNYTFYNYKSG+IH CLV GLE++ KYYY+IG G
Sbjct  86   DEPGPSKVQYGTSEKKYDLSADGTVTNYTFYNYKSGYIHHCLVDGLEYETKYYYKIGVG  144



>ref|XP_010047261.1| PREDICTED: bifunctional purple acid phosphatase 26-like [Eucalyptus 
grandis]
 ref|XP_010047262.1| PREDICTED: bifunctional purple acid phosphatase 26-like [Eucalyptus 
grandis]
 ref|XP_010047263.1| PREDICTED: bifunctional purple acid phosphatase 26-like [Eucalyptus 
grandis]
 ref|XP_010047264.1| PREDICTED: bifunctional purple acid phosphatase 26-like [Eucalyptus 
grandis]
 ref|XP_010047265.1| PREDICTED: bifunctional purple acid phosphatase 26-like [Eucalyptus 
grandis]
 gb|KCW79136.1| hypothetical protein EUGRSUZ_C00583 [Eucalyptus grandis]
Length=466

 Score =   185 bits (470),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/119 (71%), Positives = 102/119 (86%), Gaps = 0/119 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            +EN   G+TS F RS+WPSVDIPLDN+ FAVPKG NAPQQVHITQGDYDGKAVIISWVT 
Sbjct  18   VENTFGGITSTFIRSQWPSVDIPLDNEVFAVPKGHNAPQQVHITQGDYDGKAVIISWVTS  77

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            DEPGSS+V+YG + GKYD +AEG  ++Y+FY YKSG+IH CL+ GLE+D KYYY++G+G
Sbjct  78   DEPGSSEVQYGTTTGKYDHSAEGKSSSYSFYKYKSGYIHHCLLDGLEYDTKYYYKVGSG  136



>ref|XP_008362886.1| PREDICTED: bifunctional purple acid phosphatase 26-like isoform 
X2 [Malus domestica]
Length=461

 Score =   185 bits (469),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 102/120 (85%), Gaps = 1/120 (1%)
 Frame = +2

Query  173  IENG-SAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVT  349
            + NG +AG+TS F RSE+PSVDIPLD+K FAVPKG NAPQQVHITQGDYDGKAVIISWVT
Sbjct  26   LMNGNAAGITSTFIRSEYPSVDIPLDHKVFAVPKGYNAPQQVHITQGDYDGKAVIISWVT  85

Query  350  PDEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
             D+PG  +V+YG SE KY F+A+G  TNYTFY YKSG+IH CLV GLE+D KYYY+IGNG
Sbjct  86   ADKPGDGKVQYGTSEKKYKFSAKGVMTNYTFYQYKSGYIHHCLVDGLEYDTKYYYKIGNG  145



>ref|XP_008362885.1| PREDICTED: bifunctional purple acid phosphatase 26-like isoform 
X1 [Malus domestica]
Length=486

 Score =   185 bits (470),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 102/120 (85%), Gaps = 1/120 (1%)
 Frame = +2

Query  173  IENG-SAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVT  349
            + NG +AG+TS F RSE+PSVDIPLD+K FAVPKG NAPQQVHITQGDYDGKAVIISWVT
Sbjct  26   LMNGNAAGITSTFIRSEYPSVDIPLDHKVFAVPKGYNAPQQVHITQGDYDGKAVIISWVT  85

Query  350  PDEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
             D+PG  +V+YG SE KY F+A+G  TNYTFY YKSG+IH CLV GLE+D KYYY+IGNG
Sbjct  86   ADKPGDGKVQYGTSEKKYKFSAKGVMTNYTFYQYKSGYIHHCLVDGLEYDTKYYYKIGNG  145



>emb|CDY12397.1| BnaC08g08080D [Brassica napus]
Length=475

 Score =   185 bits (469),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 99/117 (85%), Gaps = 0/117 (0%)
 Frame = +2

Query  179  NGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDE  358
            +G  G+TS + RSEWP+VDIPLD+K F VPKG NAPQQVHITQGDYDGKAVIISWVTPDE
Sbjct  19   HGEGGITSSYVRSEWPAVDIPLDHKVFKVPKGYNAPQQVHITQGDYDGKAVIISWVTPDE  78

Query  359  PGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            PGSS V YG  +G+YDF A+GTY+NYTFY YKSG+ H CLV GLE++ KYYY+I +G
Sbjct  79   PGSSTVHYGAVQGEYDFVAKGTYSNYTFYKYKSGYTHHCLVSGLEYNTKYYYKIESG  135



>gb|AGL44396.1| calcineurin-like phosphoesterase [Manihot esculenta]
Length=469

 Score =   184 bits (467),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 85/119 (71%), Positives = 99/119 (83%), Gaps = 0/119 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            +ENGSAG+TS + R+EWPS DIPLDN+ F +PKG NAPQQVHITQGDYDGKAVIISWVT 
Sbjct  17   LENGSAGITSTYIRTEWPSTDIPLDNQVFEIPKGHNAPQQVHITQGDYDGKAVIISWVTA  76

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            DEP  S V+YGL + KY+F+A+G  TNYTF  YKSG+IH CLV GLE+D KYYY+IG G
Sbjct  77   DEPCCSNVKYGLLDNKYEFSAQGIVTNYTFSGYKSGYIHHCLVDGLEYDTKYYYKIGEG  135



>gb|AFY06665.1| purple acid phosphatase [Citrus trifoliata]
Length=476

 Score =   184 bits (467),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 87/117 (74%), Positives = 98/117 (84%), Gaps = 0/117 (0%)
 Frame = +2

Query  179  NGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDE  358
            NG+A +TS F R+EWPSVDIPLDNK F +PKG NAPQQV ITQGDYDGKAVIISWV PDE
Sbjct  26   NGTARITSSFIRTEWPSVDIPLDNKVFDIPKGHNAPQQVRITQGDYDGKAVIISWVAPDE  85

Query  359  PGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
             GSS+V+YG  E KYD +AEGT TNYTFY YKSG+IH CLV  LE+D KYYY+IG+G
Sbjct  86   MGSSRVQYGKLEKKYDSSAEGTVTNYTFYKYKSGYIHHCLVDDLEYDTKYYYKIGDG  142



>ref|NP_001236677.1| purple acid phosphatase-like protein [Glycine max]
 gb|AAN85416.1| purple acid phosphatase-like protein [Glycine max]
 gb|AAN85417.1| purple acid phosphatase-like protein [Glycine max]
 gb|AAN85418.1| purple acid phosphatase-like protein [Glycine max]
 gb|AAN85419.1| purple acid phosphatase-like protein [Glycine max]
 gb|AAN85420.1| purple acid phosphatase-like protein [Glycine max]
 gb|ADM32497.1| phytase [Glycine max]
 gb|KHN15041.1| Bifunctional purple acid phosphatase 26 [Glycine soja]
Length=512

 Score =   184 bits (467),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 85/119 (71%), Positives = 101/119 (85%), Gaps = 0/119 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            I +GSAG+TS F RSEWP+VDIPLD++AFAVPKG NAPQQVHITQGDYDGKAVIISWVT 
Sbjct  55   IRDGSAGITSSFIRSEWPAVDIPLDHEAFAVPKGYNAPQQVHITQGDYDGKAVIISWVTT  114

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            +EPG S ++YG SE K+  + EGT TNYTF+ YKSG+IH CL+ GLE++ KYYY IG+G
Sbjct  115  EEPGHSHIQYGTSENKFQTSEEGTVTNYTFHKYKSGYIHHCLIEGLEYETKYYYRIGSG  173



>ref|XP_009108064.1| PREDICTED: bifunctional purple acid phosphatase 26 isoform X2 
[Brassica rapa]
Length=480

 Score =   183 bits (465),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 83/117 (71%), Positives = 98/117 (84%), Gaps = 0/117 (0%)
 Frame = +2

Query  179  NGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDE  358
             G  G+TS + RSEWP+VDIPLD+K F VPKG NAPQQVHITQGDYDGKAVI+SWVTPDE
Sbjct  24   QGEGGITSSYVRSEWPAVDIPLDHKVFKVPKGYNAPQQVHITQGDYDGKAVIVSWVTPDE  83

Query  359  PGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            PGSS V YG  +GKYDF A+GT++NYTFY YKSG+ H CL+ GLE++ KYYY+I +G
Sbjct  84   PGSSTVHYGAVQGKYDFVAKGTFSNYTFYKYKSGYTHHCLLSGLEYNTKYYYKIESG  140



>ref|XP_008361111.1| PREDICTED: bifunctional purple acid phosphatase 26-like [Malus 
domestica]
Length=485

 Score =   183 bits (465),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 87/115 (76%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = +2

Query  185  SAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDEPG  364
            +AG+TS F RSE PSVDIPL+NK FAVPKG NAPQQVHITQGDYDGKAVIISWVT +EPG
Sbjct  31   AAGITSTFIRSEHPSVDIPLNNKVFAVPKGYNAPQQVHITQGDYDGKAVIISWVTANEPG  90

Query  365  SSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
             S+V+YG SE KY+F+A+G  TNYTFY YKSG+IH CLV GLE+D KYYY+IG G
Sbjct  91   DSKVQYGTSEKKYEFSAKGVVTNYTFYXYKSGYIHHCLVEGLEYDTKYYYKIGXG  145



>ref|XP_008336971.1| PREDICTED: bifunctional purple acid phosphatase 26-like [Malus 
domestica]
Length=485

 Score =   183 bits (465),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 99/116 (85%), Gaps = 0/116 (0%)
 Frame = +2

Query  182  GSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDEP  361
             +AG+TS F RSE PSVDIPL+NK FAVPKG NAPQQVHITQGDYDGKAVIISWVT +EP
Sbjct  30   NAAGITSTFIRSEHPSVDIPLNNKVFAVPKGYNAPQQVHITQGDYDGKAVIISWVTANEP  89

Query  362  GSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            G S+V+YG SE KY+F+A+G  TNYTFY YKSG+IH CLV GLE+D KYYY+IG G
Sbjct  90   GDSKVQYGTSEKKYEFSAKGVVTNYTFYXYKSGYIHHCLVEGLEYDTKYYYKIGXG  145



>ref|XP_009108063.1| PREDICTED: bifunctional purple acid phosphatase 26 isoform X1 
[Brassica rapa]
Length=518

 Score =   183 bits (465),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 83/117 (71%), Positives = 98/117 (84%), Gaps = 0/117 (0%)
 Frame = +2

Query  179  NGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDE  358
             G  G+TS + RSEWP+VDIPLD+K F VPKG NAPQQVHITQGDYDGKAVI+SWVTPDE
Sbjct  62   QGEGGITSSYVRSEWPAVDIPLDHKVFKVPKGYNAPQQVHITQGDYDGKAVIVSWVTPDE  121

Query  359  PGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            PGSS V YG  +GKYDF A+GT++NYTFY YKSG+ H CL+ GLE++ KYYY+I +G
Sbjct  122  PGSSTVHYGAVQGKYDFVAKGTFSNYTFYKYKSGYTHHCLLSGLEYNTKYYYKIESG  178



>ref|NP_001239650.1| uncharacterized protein LOC100818438 precursor [Glycine max]
 gb|ADM32498.1| phytase [Glycine max]
Length=457

 Score =   182 bits (462),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 83/119 (70%), Positives = 99/119 (83%), Gaps = 0/119 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            I +GSAG+TS F R +WP VDIP+D++ FAVPKG NAPQQVHITQGDYDGKAVI+SWVTP
Sbjct  23   IRDGSAGITSSFVRPQWPGVDIPVDHEVFAVPKGYNAPQQVHITQGDYDGKAVIVSWVTP  82

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            DEPG+  V+YG S+ K+  +AEGT  NYTFYNYKSG+IH CL+ GLE+  KYYY IG+G
Sbjct  83   DEPGTRHVQYGTSKDKFKTSAEGTVANYTFYNYKSGYIHHCLIEGLEYKTKYYYRIGSG  141



>gb|KHG06954.1| Bifunctional purple acid phosphatase 26 -like protein [Gossypium 
arboreum]
Length=479

 Score =   182 bits (462),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/119 (71%), Positives = 100/119 (84%), Gaps = 0/119 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            ++ GSAG+TS F R++W S DIPLD+K  A+P G NAPQQVHITQGDYDGKAV+ISWVT 
Sbjct  23   VKKGSAGITSTFTRTKWQSFDIPLDHKVLAIPNGYNAPQQVHITQGDYDGKAVMISWVTA  82

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            D+PGSS+V+YG SE KYDF A+GT  NYTFYNYKSG+IH CLV GLE++ KYYY+IG G
Sbjct  83   DKPGSSRVQYGTSENKYDFKADGTVANYTFYNYKSGYIHHCLVDGLEYETKYYYKIGEG  141



>gb|KHN47108.1| Bifunctional purple acid phosphatase 26 [Glycine soja]
Length=472

 Score =   182 bits (461),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 83/119 (70%), Positives = 99/119 (83%), Gaps = 0/119 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            I +GSAG+TS F R +WP VDIP+D++ FAVPKG NAPQQVHITQGDYDGKAVI+SWVTP
Sbjct  20   IRDGSAGITSSFVRPQWPGVDIPVDHEVFAVPKGYNAPQQVHITQGDYDGKAVIVSWVTP  79

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            DEPG+  V+YG S+ K+  +AEGT  NYTFYNYKSG+IH CL+ GLE+  KYYY IG+G
Sbjct  80   DEPGTRHVQYGTSKDKFKTSAEGTVANYTFYNYKSGYIHHCLIEGLEYKTKYYYRIGSG  138



>ref|XP_006852875.1| hypothetical protein AMTR_s00033p00208170 [Amborella trichopoda]
 gb|ERN14342.1| hypothetical protein AMTR_s00033p00208170 [Amborella trichopoda]
Length=509

 Score =   182 bits (463),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 86/117 (74%), Positives = 97/117 (83%), Gaps = 0/117 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            +  GSAG TS F RSEWPSVDIPLDN+AFA+PKG NAP+QVHITQGDYDGKAVI+SWVTP
Sbjct  49   VRFGSAGTTSSFVRSEWPSVDIPLDNEAFAIPKGYNAPEQVHITQGDYDGKAVIVSWVTP  108

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIG  523
             EPG+S+V Y  SE  YD  AEG  TNYTFYNYKSG+IH CL+ GLE+D KY Y+IG
Sbjct  109  AEPGTSEVFYATSENGYDHHAEGKVTNYTFYNYKSGYIHHCLIDGLEYDTKYNYKIG  165



>ref|XP_006593472.1| PREDICTED: uncharacterized protein LOC100818438 isoform X1 [Glycine 
max]
Length=475

 Score =   182 bits (461),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 83/119 (70%), Positives = 99/119 (83%), Gaps = 0/119 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            I +GSAG+TS F R +WP VDIP+D++ FAVPKG NAPQQVHITQGDYDGKAVI+SWVTP
Sbjct  23   IRDGSAGITSSFVRPQWPGVDIPVDHEVFAVPKGYNAPQQVHITQGDYDGKAVIVSWVTP  82

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            DEPG+  V+YG S+ K+  +AEGT  NYTFYNYKSG+IH CL+ GLE+  KYYY IG+G
Sbjct  83   DEPGTRHVQYGTSKDKFKTSAEGTVANYTFYNYKSGYIHHCLIEGLEYKTKYYYRIGSG  141



>emb|CDY47560.1| BnaA08g07270D [Brassica napus]
Length=480

 Score =   181 bits (460),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 97/117 (83%), Gaps = 0/117 (0%)
 Frame = +2

Query  179  NGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDE  358
             G  G+TS + RSEWP+VDIPLD+K F VPKG NAPQQVHITQGDYDGKAVI+SWVTPDE
Sbjct  24   QGEGGITSSYVRSEWPAVDIPLDHKVFKVPKGYNAPQQVHITQGDYDGKAVIVSWVTPDE  83

Query  359  PGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            PGSS V YG  +G YDF A+GT++NYTFY YKSG+ H CL+ GLE++ KYYY+I +G
Sbjct  84   PGSSTVHYGAVQGNYDFVAKGTFSNYTFYKYKSGYTHHCLLSGLEYNTKYYYKIESG  140



>gb|KHG11290.1| Bifunctional purple acid phosphatase 26 -like protein [Gossypium 
arboreum]
Length=477

 Score =   181 bits (459),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 86/117 (74%), Positives = 97/117 (83%), Gaps = 0/117 (0%)
 Frame = +2

Query  179  NGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDE  358
            N +AG TS F R EWPS DIPLD++ FAVP G NAPQQVHITQGDYDGKAVIISWVTPDE
Sbjct  21   NVNAGHTSVFVRKEWPSEDIPLDHEVFAVPTGHNAPQQVHITQGDYDGKAVIISWVTPDE  80

Query  359  PGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            PGSS+V+YG  +GKY+FTAEG  TNYTFY Y SG+IH  LV GLE+D K+YY+IG G
Sbjct  81   PGSSKVQYGTLKGKYEFTAEGKMTNYTFYKYNSGYIHHVLVDGLEYDTKFYYKIGTG  137



>gb|KJB65857.1| hypothetical protein B456_010G116200 [Gossypium raimondii]
Length=396

 Score =   179 bits (454),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 82/119 (69%), Positives = 100/119 (84%), Gaps = 0/119 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            ++ GSAG+TS F R++W S DIPLD+K  A+P G NAPQQVHITQGDY+GKAV++SWVT 
Sbjct  23   VKKGSAGITSTFTRTKWQSFDIPLDHKVLAIPNGYNAPQQVHITQGDYNGKAVMVSWVTA  82

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            D+PGSS+V+YG SE KYDF A+GT  NYTFYNYKSG+IH CLV GLE++ KYYY+IG G
Sbjct  83   DKPGSSRVQYGTSEKKYDFKADGTVANYTFYNYKSGYIHHCLVDGLEYETKYYYKIGEG  141



>emb|CAD30328.1| acid phosphatase [Lupinus luteus]
Length=477

 Score =   180 bits (457),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 83/119 (70%), Positives = 101/119 (85%), Gaps = 0/119 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            I++GSAG+TS F RSE+PS DIPLD++ FAVPKG NAPQQVHITQGDYDGKAVI+SWVT 
Sbjct  19   IKDGSAGITSSFIRSEFPSTDIPLDHEVFAVPKGYNAPQQVHITQGDYDGKAVIVSWVTT  78

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            DEPG S+V++G SE K+  +AEGT +NYTFY YKSG++H CL+ GLE+  KYYY IG+G
Sbjct  79   DEPGPSKVQFGTSENKFQTSAEGTVSNYTFYKYKSGYVHHCLIEGLEYKTKYYYRIGSG  137



>ref|XP_006450381.1| hypothetical protein CICLE_v10008150mg [Citrus clementina]
 gb|ESR63621.1| hypothetical protein CICLE_v10008150mg [Citrus clementina]
 gb|KDO61797.1| hypothetical protein CISIN_1g011680mg [Citrus sinensis]
Length=374

 Score =   178 bits (451),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 97/117 (83%), Gaps = 0/117 (0%)
 Frame = +2

Query  179  NGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDE  358
            NG+A +TS F R+EWPS DIPL NK F +PKG NAPQQV ITQGDYDGKAVIISWVTP+E
Sbjct  26   NGTARITSRFIRTEWPSADIPLHNKVFDIPKGHNAPQQVRITQGDYDGKAVIISWVTPNE  85

Query  359  PGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
             GS++V+YG  E KYD +AEGT TNYTFY YKSG+IH CLV  LE+D KYYY+IG+G
Sbjct  86   LGSNRVQYGKLEKKYDSSAEGTVTNYTFYKYKSGYIHHCLVDDLEYDTKYYYKIGDG  142



>gb|KGN65112.1| hypothetical protein Csa_1G225410 [Cucumis sativus]
Length=481

 Score =   179 bits (455),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/116 (72%), Positives = 98/116 (84%), Gaps = 0/116 (0%)
 Frame = +2

Query  182  GSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDEP  361
            G AG+TS F RSEWPS+DIPLD++ FAVP+G NAPQQVHITQGDY+GKAVIISWVTPDE 
Sbjct  28   GDAGITSTFIRSEWPSIDIPLDHEVFAVPQGYNAPQQVHITQGDYEGKAVIISWVTPDEL  87

Query  362  GSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
              + V+YG SEG Y+FTAEG  TNYTFY YKSG+IH CL+  L++D KYYY+IG+G
Sbjct  88   EPNSVQYGTSEGGYEFTAEGAVTNYTFYKYKSGYIHHCLIADLKYDTKYYYKIGSG  143



>ref|XP_010913336.1| PREDICTED: phosphoenolpyruvate phosphatase isoform X1 [Elaeis 
guineensis]
Length=491

 Score =   179 bits (455),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 84/119 (71%), Positives = 97/119 (82%), Gaps = 0/119 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            +++   G TS F RSEWPS DIPLDN+ FA+PKG NAPQQVHITQGDYDGKAVIISWVT 
Sbjct  35   VDHVICGRTSTFIRSEWPSTDIPLDNEVFAIPKGYNAPQQVHITQGDYDGKAVIISWVTV  94

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
             EPG+S+V YG  E KY+ +A+G  TNYTFYNYKSG+IH CLV GLE+D KYYY+IG G
Sbjct  95   SEPGTSEVLYGKEEHKYEHSAQGKTTNYTFYNYKSGYIHHCLVDGLEYDTKYYYKIGKG  153



>ref|XP_008443931.1| PREDICTED: bifunctional purple acid phosphatase 26 [Cucumis melo]
Length=481

 Score =   179 bits (454),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 82/116 (71%), Positives = 98/116 (84%), Gaps = 0/116 (0%)
 Frame = +2

Query  182  GSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDEP  361
            G AG+TS F RSEWPS+DIPLD++ FAVP+G NAPQQVHITQGDY+GKAVIISWVT DEP
Sbjct  28   GDAGITSTFIRSEWPSIDIPLDHEVFAVPQGYNAPQQVHITQGDYEGKAVIISWVTHDEP  87

Query  362  GSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
              + V+YG S+G Y+FTAEG  TNYTFY YKSG+IH CL+  L++D KYYY+IG+G
Sbjct  88   EPNSVQYGTSDGSYEFTAEGVVTNYTFYKYKSGYIHHCLIADLKYDTKYYYKIGSG  143



>ref|XP_010913337.1| PREDICTED: phosphoenolpyruvate phosphatase isoform X2 [Elaeis 
guineensis]
Length=487

 Score =   179 bits (455),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 84/119 (71%), Positives = 97/119 (82%), Gaps = 0/119 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            +++   G TS F RSEWPS DIPLDN+ FA+PKG NAPQQVHITQGDYDGKAVIISWVT 
Sbjct  31   VDHVICGRTSTFIRSEWPSTDIPLDNEVFAIPKGYNAPQQVHITQGDYDGKAVIISWVTV  90

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
             EPG+S+V YG  E KY+ +A+G  TNYTFYNYKSG+IH CLV GLE+D KYYY+IG G
Sbjct  91   SEPGTSEVLYGKEEHKYEHSAQGKTTNYTFYNYKSGYIHHCLVDGLEYDTKYYYKIGKG  149



>gb|KJB64666.1| hypothetical protein B456_010G060100 [Gossypium raimondii]
Length=477

 Score =   179 bits (454),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 96/117 (82%), Gaps = 0/117 (0%)
 Frame = +2

Query  179  NGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDE  358
            N +AG TS F R EWPS DIPLD++ FAVP G NAPQQVHITQGDYDGKAVIISWVTPDE
Sbjct  21   NVNAGHTSVFVRKEWPSEDIPLDHEVFAVPTGHNAPQQVHITQGDYDGKAVIISWVTPDE  80

Query  359  PGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            PGSS+V+YG  +GKY+FTAEG  TNYTFY Y SG+IH  LV GLE+D  +YY+IG G
Sbjct  81   PGSSKVQYGTLKGKYEFTAEGKMTNYTFYKYNSGYIHHVLVDGLEYDTNFYYKIGTG  137



>gb|KJB64663.1| hypothetical protein B456_010G060100 [Gossypium raimondii]
 gb|KJB64664.1| hypothetical protein B456_010G060100 [Gossypium raimondii]
 gb|KJB64667.1| hypothetical protein B456_010G060100 [Gossypium raimondii]
 gb|KJB64670.1| hypothetical protein B456_010G060100 [Gossypium raimondii]
 gb|KJB64671.1| hypothetical protein B456_010G060100 [Gossypium raimondii]
Length=477

 Score =   179 bits (453),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 96/117 (82%), Gaps = 0/117 (0%)
 Frame = +2

Query  179  NGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDE  358
            N +AG TS F R EWPS DIPLD++ FAVP G NAPQQVHITQGDYDGKAVIISWVTPDE
Sbjct  21   NVNAGHTSVFVRKEWPSEDIPLDHEVFAVPTGHNAPQQVHITQGDYDGKAVIISWVTPDE  80

Query  359  PGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            PGSS+V+YG  +GKY+FTAEG  TNYTFY Y SG+IH  LV GLE+D  +YY+IG G
Sbjct  81   PGSSKVQYGTLKGKYEFTAEGKMTNYTFYKYNSGYIHHVLVDGLEYDTNFYYKIGTG  137



>gb|KJB65854.1| hypothetical protein B456_010G116200 [Gossypium raimondii]
 gb|KJB65856.1| hypothetical protein B456_010G116200 [Gossypium raimondii]
Length=479

 Score =   179 bits (453),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 82/119 (69%), Positives = 100/119 (84%), Gaps = 0/119 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            ++ GSAG+TS F R++W S DIPLD+K  A+P G NAPQQVHITQGDY+GKAV++SWVT 
Sbjct  23   VKKGSAGITSTFTRTKWQSFDIPLDHKVLAIPNGYNAPQQVHITQGDYNGKAVMVSWVTA  82

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            D+PGSS+V+YG SE KYDF A+GT  NYTFYNYKSG+IH CLV GLE++ KYYY+IG G
Sbjct  83   DKPGSSRVQYGTSEKKYDFKADGTVANYTFYNYKSGYIHHCLVDGLEYETKYYYKIGEG  141



>gb|KJB64662.1| hypothetical protein B456_010G060100 [Gossypium raimondii]
 gb|KJB64665.1| hypothetical protein B456_010G060100 [Gossypium raimondii]
 gb|KJB64669.1| hypothetical protein B456_010G060100 [Gossypium raimondii]
Length=453

 Score =   178 bits (452),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 96/117 (82%), Gaps = 0/117 (0%)
 Frame = +2

Query  179  NGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDE  358
            N +AG TS F R EWPS DIPLD++ FAVP G NAPQQVHITQGDYDGKAVIISWVTPDE
Sbjct  21   NVNAGHTSVFVRKEWPSEDIPLDHEVFAVPTGHNAPQQVHITQGDYDGKAVIISWVTPDE  80

Query  359  PGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            PGSS+V+YG  +GKY+FTAEG  TNYTFY Y SG+IH  LV GLE+D  +YY+IG G
Sbjct  81   PGSSKVQYGTLKGKYEFTAEGKMTNYTFYKYNSGYIHHVLVDGLEYDTNFYYKIGTG  137



>gb|KJB64668.1| hypothetical protein B456_010G060100 [Gossypium raimondii]
Length=484

 Score =   179 bits (453),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 96/117 (82%), Gaps = 0/117 (0%)
 Frame = +2

Query  179  NGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDE  358
            N +AG TS F R EWPS DIPLD++ FAVP G NAPQQVHITQGDYDGKAVIISWVTPDE
Sbjct  21   NVNAGHTSVFVRKEWPSEDIPLDHEVFAVPTGHNAPQQVHITQGDYDGKAVIISWVTPDE  80

Query  359  PGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            PGSS+V+YG  +GKY+FTAEG  TNYTFY Y SG+IH  LV GLE+D  +YY+IG G
Sbjct  81   PGSSKVQYGTLKGKYEFTAEGKMTNYTFYKYNSGYIHHVLVDGLEYDTNFYYKIGTG  137



>ref|XP_006483400.1| PREDICTED: bifunctional purple acid phosphatase 26-like isoform 
X1 [Citrus sinensis]
Length=479

 Score =   178 bits (451),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 97/117 (83%), Gaps = 0/117 (0%)
 Frame = +2

Query  179  NGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDE  358
            NG+A +TS F R+EWPS DIPL NK F +PKG NAPQQV ITQGDYDGKAVIISWVTP+E
Sbjct  26   NGTARITSRFIRTEWPSADIPLHNKVFDIPKGHNAPQQVRITQGDYDGKAVIISWVTPNE  85

Query  359  PGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
             GS++V+YG  E KYD +AEGT TNYTFY YKSG+IH CLV  LE+D KYYY+IG+G
Sbjct  86   LGSNRVQYGKLEKKYDSSAEGTVTNYTFYKYKSGYIHHCLVDDLEYDTKYYYKIGDG  142



>ref|XP_006450380.1| hypothetical protein CICLE_v10008150mg [Citrus clementina]
 gb|ESR63620.1| hypothetical protein CICLE_v10008150mg [Citrus clementina]
 gb|KDO61796.1| hypothetical protein CISIN_1g011680mg [Citrus sinensis]
Length=479

 Score =   178 bits (451),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 97/117 (83%), Gaps = 0/117 (0%)
 Frame = +2

Query  179  NGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDE  358
            NG+A +TS F R+EWPS DIPL NK F +PKG NAPQQV ITQGDYDGKAVIISWVTP+E
Sbjct  26   NGTARITSRFIRTEWPSADIPLHNKVFDIPKGHNAPQQVRITQGDYDGKAVIISWVTPNE  85

Query  359  PGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
             GS++V+YG  E KYD +AEGT TNYTFY YKSG+IH CLV  LE+D KYYY+IG+G
Sbjct  86   LGSNRVQYGKLEKKYDSSAEGTVTNYTFYKYKSGYIHHCLVDDLEYDTKYYYKIGDG  142



>ref|XP_008795838.1| PREDICTED: phosphoenolpyruvate phosphatase [Phoenix dactylifera]
Length=475

 Score =   177 bits (449),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/119 (70%), Positives = 95/119 (80%), Gaps = 0/119 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            ++N   G TS F RSEWPS DIPLDN+ FA+PKG NAPQQVH+TQGDYDGKAVIISWVT 
Sbjct  19   VDNVICGRTSTFIRSEWPSTDIPLDNEVFAIPKGYNAPQQVHVTQGDYDGKAVIISWVTT  78

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
             EPG+S+V YG  E KY+ +A+G  TNYTFYNYKSG+IH CLV GLE+  KYYY IG G
Sbjct  79   SEPGTSEVLYGKEEHKYEHSAQGKTTNYTFYNYKSGYIHHCLVDGLEYGTKYYYTIGKG  137



>ref|XP_007155070.1| hypothetical protein PHAVU_003G170600g [Phaseolus vulgaris]
 gb|ESW27064.1| hypothetical protein PHAVU_003G170600g [Phaseolus vulgaris]
Length=441

 Score =   176 bits (447),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/119 (68%), Positives = 96/119 (81%), Gaps = 0/119 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            I +GSAGMTS F R++WPS D+P+D++ FA+PKG NAPQQVHITQGDYDGKAVIISWVTP
Sbjct  16   IRDGSAGMTSSFVRTKWPSEDMPVDHEVFAIPKGYNAPQQVHITQGDYDGKAVIISWVTP  75

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            DE G S V+YG S+     + EGT  NYTFYNYKSG+IH CL+ GL H+ KYYY IG+G
Sbjct  76   DEAGPSHVQYGTSKSNLQTSKEGTVANYTFYNYKSGYIHHCLIEGLTHNTKYYYRIGSG  134



>ref|XP_007013582.1| Purple acid phosphatase 26 isoform 1 [Theobroma cacao]
 gb|EOY31201.1| Purple acid phosphatase 26 isoform 1 [Theobroma cacao]
Length=477

 Score =   177 bits (449),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/119 (71%), Positives = 95/119 (80%), Gaps = 0/119 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            + N +AG+TS F R EWPSVDIPLDN+ FAVP   NAPQQVHITQGDYDGKAVIISWVT 
Sbjct  19   VNNVNAGITSVFIRDEWPSVDIPLDNEVFAVPNEHNAPQQVHITQGDYDGKAVIISWVTA  78

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            DEPG S+V+YG SE  Y+FTA+G  TNYTFY Y SG+IH   V GLE+D KYYY+IG G
Sbjct  79   DEPGPSKVQYGTSEKNYEFTADGKMTNYTFYKYNSGYIHHVFVDGLEYDTKYYYKIGTG  137



>ref|XP_004150527.1| PREDICTED: bifunctional purple acid phosphatase 26-like [Cucumis 
sativus]
 ref|XP_004165645.1| PREDICTED: bifunctional purple acid phosphatase 26-like [Cucumis 
sativus]
Length=454

 Score =   177 bits (448),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 97/114 (85%), Gaps = 0/114 (0%)
 Frame = +2

Query  188  AGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDEPGS  367
            +G+TS F RSEWPS+DIPLD++ FAVP+G NAPQQVHITQGDY+GKAVIISWVTPDE   
Sbjct  3    SGITSTFIRSEWPSIDIPLDHEVFAVPQGYNAPQQVHITQGDYEGKAVIISWVTPDELEP  62

Query  368  SQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            + V+YG SEG Y+FTAEG  TNYTFY YKSG+IH CL+  L++D KYYY+IG+G
Sbjct  63   NSVQYGTSEGGYEFTAEGAVTNYTFYKYKSGYIHHCLIADLKYDTKYYYKIGSG  116



>ref|XP_007013583.1| Purple acid phosphatase 26 isoform 2 [Theobroma cacao]
 gb|EOY31202.1| Purple acid phosphatase 26 isoform 2 [Theobroma cacao]
Length=483

 Score =   177 bits (449),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/119 (71%), Positives = 95/119 (80%), Gaps = 0/119 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            + N +AG+TS F R EWPSVDIPLDN+ FAVP   NAPQQVHITQGDYDGKAVIISWVT 
Sbjct  25   VNNVNAGITSVFIRDEWPSVDIPLDNEVFAVPNEHNAPQQVHITQGDYDGKAVIISWVTA  84

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            DEPG S+V+YG SE  Y+FTA+G  TNYTFY Y SG+IH   V GLE+D KYYY+IG G
Sbjct  85   DEPGPSKVQYGTSEKNYEFTADGKMTNYTFYKYNSGYIHHVFVDGLEYDTKYYYKIGTG  143



>ref|XP_007013584.1| Purple acid phosphatase 26 isoform 3 [Theobroma cacao]
 gb|EOY31203.1| Purple acid phosphatase 26 isoform 3 [Theobroma cacao]
Length=489

 Score =   177 bits (449),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/119 (71%), Positives = 95/119 (80%), Gaps = 0/119 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            + N +AG+TS F R EWPSVDIPLDN+ FAVP   NAPQQVHITQGDYDGKAVIISWVT 
Sbjct  25   VNNVNAGITSVFIRDEWPSVDIPLDNEVFAVPNEHNAPQQVHITQGDYDGKAVIISWVTA  84

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            DEPG S+V+YG SE  Y+FTA+G  TNYTFY Y SG+IH   V GLE+D KYYY+IG G
Sbjct  85   DEPGPSKVQYGTSEKNYEFTADGKMTNYTFYKYNSGYIHHVFVDGLEYDTKYYYKIGTG  143



>ref|XP_003609435.1| Purple acid phosphatase-like protein [Medicago truncatula]
 gb|AES91632.1| iron(III)-zinc(II) purple acid phosphatase, putative [Medicago 
truncatula]
Length=475

 Score =   175 bits (444),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = +2

Query  188  AGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDEPGS  367
            AG+TS F RSE+PSVDIP ++ AFAVPKG NAPQQVHITQGDYDGKAVIISWVTPDEPGS
Sbjct  23   AGITSSFVRSEFPSVDIPPNHPAFAVPKGHNAPQQVHITQGDYDGKAVIISWVTPDEPGS  82

Query  368  SQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            S V++G SE K+  +A+GT +NYTF  YKSG+IH CLV GLEH  KYYY IG+G
Sbjct  83   SHVQFGTSENKFQSSAQGTVSNYTFGEYKSGYIHHCLVEGLEHSTKYYYRIGSG  136



>gb|AFK47719.1| unknown [Medicago truncatula]
Length=475

 Score =   175 bits (444),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = +2

Query  188  AGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDEPGS  367
            AG+TS F RSE+PSVDIP ++ AFAVPKG NAPQQVHITQGDYDGKAVIISWVTPDEPGS
Sbjct  23   AGITSSFVRSEFPSVDIPPNHPAFAVPKGHNAPQQVHITQGDYDGKAVIISWVTPDEPGS  82

Query  368  SQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            S V++G SE K+  +A+GT +NYTF  YKSG+IH CLV GLEH  KYYY IG+G
Sbjct  83   SHVQFGTSENKFQSSAQGTVSNYTFGEYKSGYIHHCLVEGLEHSTKYYYRIGSG  136



>gb|KJB83221.1| hypothetical protein B456_013G236000 [Gossypium raimondii]
Length=462

 Score =   175 bits (443),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 82/119 (69%), Positives = 98/119 (82%), Gaps = 0/119 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            + N +AG+TS F R EWPSVDIPLD++ FAVPKG NAPQQVHITQG+YDG AVIISW+T 
Sbjct  19   VNNVNAGITSRFVREEWPSVDIPLDHEVFAVPKGYNAPQQVHITQGNYDGNAVIISWITF  78

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            DEPGSS+V+YG S+  Y+F+AEG  TNYTFY Y SG+IH  LV GLE+D KYYY+ G+G
Sbjct  79   DEPGSSKVQYGKSDKNYEFSAEGKMTNYTFYKYNSGYIHHVLVDGLEYDTKYYYKTGDG  137



>gb|AET86956.1| PAP26 [Gossypium hirsutum]
Length=476

 Score =   175 bits (444),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 82/119 (69%), Positives = 98/119 (82%), Gaps = 0/119 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            + N +AG+TS F R EWPSVDIPLD++ FAVPKG NAPQQVHITQG+YDG AVIISW+T 
Sbjct  19   VNNVNAGITSRFIREEWPSVDIPLDHEVFAVPKGYNAPQQVHITQGNYDGNAVIISWITF  78

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            DEPGSS+V+YG S+  Y+F+AEG  TNYTFY Y SG+IH  LV GLE+D KYYY+ G+G
Sbjct  79   DEPGSSKVQYGKSDKNYEFSAEGKMTNYTFYKYNSGYIHHVLVDGLEYDTKYYYKTGDG  137



>gb|EPS64420.1| hypothetical protein M569_10360, partial [Genlisea aurea]
Length=480

 Score =   175 bits (443),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 99/119 (83%), Gaps = 0/119 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            ++ G+AG+TS F R ++PS DIPLD++ FA+PKG NAPQQVH+TQGDYDGKAV+ISW T 
Sbjct  22   VDTGNAGVTSTFIRVQYPSTDIPLDSQVFALPKGYNAPQQVHLTQGDYDGKAVLISWTTA  81

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
             EPGS++VRYGLS+G Y+FTAE T  NYTFY YKSG+IH CLV  L++  KYYYEIG+G
Sbjct  82   GEPGSNKVRYGLSDGNYEFTAEATVQNYTFYKYKSGYIHHCLVDDLQYGSKYYYEIGDG  140



>gb|KJB83219.1| hypothetical protein B456_013G236000 [Gossypium raimondii]
 gb|KJB83220.1| hypothetical protein B456_013G236000 [Gossypium raimondii]
Length=475

 Score =   175 bits (443),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 82/119 (69%), Positives = 98/119 (82%), Gaps = 0/119 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            + N +AG+TS F R EWPSVDIPLD++ FAVPKG NAPQQVHITQG+YDG AVIISW+T 
Sbjct  19   VNNVNAGITSRFVREEWPSVDIPLDHEVFAVPKGYNAPQQVHITQGNYDGNAVIISWITF  78

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            DEPGSS+V+YG S+  Y+F+AEG  TNYTFY Y SG+IH  LV GLE+D KYYY+ G+G
Sbjct  79   DEPGSSKVQYGKSDKNYEFSAEGKMTNYTFYKYNSGYIHHVLVDGLEYDTKYYYKTGDG  137



>ref|XP_010050094.1| PREDICTED: bifunctional purple acid phosphatase 26 [Eucalyptus 
grandis]
 gb|KCW82984.1| hypothetical protein EUGRSUZ_C04373 [Eucalyptus grandis]
Length=485

 Score =   173 bits (439),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 94/113 (83%), Gaps = 0/113 (0%)
 Frame = +2

Query  191  GMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDEPGSS  370
            G+TS F RSEWPSVDIPLDN+ FAVPKG NAPQQVHITQGDYDGKAVI+SWVT D P  S
Sbjct  32   GITSTFVRSEWPSVDIPLDNEVFAVPKGHNAPQQVHITQGDYDGKAVIVSWVTTDTPVLS  91

Query  371  QVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
             V +G S G+Y  +A+GT TNYTF+NYKSG++H CL+ GL++D KYYY+IG G
Sbjct  92   VVHFGTSPGRYTLSAKGTATNYTFHNYKSGYVHHCLLEGLKYDTKYYYKIGEG  144



>ref|XP_009418189.1| PREDICTED: phosphoenolpyruvate phosphatase-like [Musa acuminata 
subsp. malaccensis]
Length=484

 Score =   172 bits (436),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 92/114 (81%), Gaps = 0/114 (0%)
 Frame = +2

Query  188  AGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDEPGS  367
            +G TS F RSEWPS DIPLDN+AF VP G NAPQQVHITQGDYDGKAVIISWVT  EPG+
Sbjct  23   SGRTSSFTRSEWPSTDIPLDNEAFVVPDGYNAPQQVHITQGDYDGKAVIISWVTESEPGT  82

Query  368  SQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            S+V YG  E +++  AEG  TNYTFYNYKSG+IH CLV GLE++ KYYY IG G
Sbjct  83   SEVWYGAVEHEFEHKAEGKNTNYTFYNYKSGYIHHCLVDGLEYNTKYYYRIGTG  136



>ref|XP_007202017.1| hypothetical protein PRUPE_ppa004955mg [Prunus persica]
 gb|EMJ03216.1| hypothetical protein PRUPE_ppa004955mg [Prunus persica]
Length=416

 Score =   169 bits (428),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +2

Query  230  VDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDEPGSSQVRYGLSEGKYDF  409
            +DIPLDNK F+VPKG NAPQQVHITQGDYDGKAVIISWVTPDEPG+S+V+YG SE  Y+ 
Sbjct  1    MDIPLDNKVFSVPKGHNAPQQVHITQGDYDGKAVIISWVTPDEPGTSKVQYGTSENGYEL  60

Query  410  TAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            +AEG  TNYTFY YKSG+IH CLV GLEHD KYYY+IG+G
Sbjct  61   SAEGIVTNYTFYKYKSGYIHHCLVDGLEHDTKYYYKIGSG  100



>gb|AGT17175.1| acid phosphatase precursor [Saccharum hybrid cultivar R570]
Length=476

 Score =   169 bits (428),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 81/115 (70%), Positives = 98/115 (85%), Gaps = 1/115 (1%)
 Frame = +2

Query  185  SAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDEPG  364
            ++G TS + R+E+PS DIPLD++ FA+PKG NAPQQVHITQGDYDGKAVI+SWVTP+EPG
Sbjct  22   ASGRTSSYVRTEFPSTDIPLDSEWFAIPKGYNAPQQVHITQGDYDGKAVIVSWVTPEEPG  81

Query  365  SSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
             S+V YG  E +YD  AEGT TNYTFYNYKSG+IH CLV GLE++ KYYY+IG+G
Sbjct  82   PSEVFYG-KEKQYDQKAEGTTTNYTFYNYKSGYIHHCLVDGLEYNTKYYYKIGSG  135



>ref|XP_009392136.1| PREDICTED: phosphoenolpyruvate phosphatase-like [Musa acuminata 
subsp. malaccensis]
Length=468

 Score =   168 bits (426),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 95/119 (80%), Gaps = 0/119 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            +++  +G TS F RSEWPS DIPLD++AF VP G N PQQVHITQGDYDGKAVIISWVT 
Sbjct  18   VDDVLSGRTSSFRRSEWPSTDIPLDSEAFVVPGGYNTPQQVHITQGDYDGKAVIISWVTE  77

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
             E G+S+V YG  E KY+  A+GT TNYTFYNYKSGFIH CLV GL+++ KY+Y+IG G
Sbjct  78   SETGTSEVLYGTEEHKYEHIAQGTTTNYTFYNYKSGFIHHCLVDGLKYNTKYHYKIGTG  136



>gb|ACR23330.1| mitochondrial acid phosphatase [Triticum aestivum]
Length=477

 Score =   167 bits (424),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 81/120 (68%), Positives = 95/120 (79%), Gaps = 1/120 (1%)
 Frame = +2

Query  173  IENG-SAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVT  349
            + NG S+  TS + RSE+PS D+PLD++ FA PKG NAPQQVHITQGDYDGKAVI+SWVT
Sbjct  17   LANGVSSRRTSSYVRSEFPSTDMPLDSEWFATPKGYNAPQQVHITQGDYDGKAVIVSWVT  76

Query  350  PDEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            P EP  SQV Y   E +YD  AEGT TNYTFY+YKSG+IH CLV GLE++ KYYY+IG G
Sbjct  77   PSEPAPSQVFYSKEENRYDQKAEGTMTNYTFYDYKSGYIHHCLVDGLEYNTKYYYKIGTG  136



>gb|AGT17000.1| acid phosphatase precursor [Saccharum hybrid cultivar R570]
Length=476

 Score =   167 bits (424),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 80/115 (70%), Positives = 98/115 (85%), Gaps = 1/115 (1%)
 Frame = +2

Query  185  SAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDEPG  364
            ++G TS + R+E+PS DIPLD++ FA+PKG NAPQQVHITQGDYDGKAVI+SWVTP+EPG
Sbjct  22   ASGRTSSYVRTEFPSTDIPLDSEWFAIPKGYNAPQQVHITQGDYDGKAVIVSWVTPEEPG  81

Query  365  SSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
             S+V YG  E +YD  AEGT TNYTFY+YKSG+IH CLV GLE++ KYYY+IG+G
Sbjct  82   PSEVFYG-KEKQYDQKAEGTTTNYTFYDYKSGYIHHCLVDGLEYNTKYYYKIGSG  135



>gb|AGT16225.1| purple acid phosphatase precursor [Saccharum hybrid cultivar 
R570]
Length=476

 Score =   166 bits (420),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 80/115 (70%), Positives = 97/115 (84%), Gaps = 1/115 (1%)
 Frame = +2

Query  185  SAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDEPG  364
            + G TS + R+E+PS DIPLD++ FA+PKG NAPQQVHITQGDYDGKAVI+SWVTP+EPG
Sbjct  22   ACGRTSSYVRTEFPSNDIPLDSEWFAIPKGYNAPQQVHITQGDYDGKAVIVSWVTPEEPG  81

Query  365  SSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
             S+V YG  E +YD  AEGT TNYTFY+YKSG+IH CLV GLE++ KYYY+IG+G
Sbjct  82   PSEVFYG-KEKQYDQKAEGTTTNYTFYDYKSGYIHHCLVDGLEYNTKYYYKIGSG  135



>gb|AGT16393.1| purple acid phosphatase precursor [Saccharum hybrid cultivar 
R570]
Length=425

 Score =   164 bits (416),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 79/114 (69%), Positives = 96/114 (84%), Gaps = 1/114 (1%)
 Frame = +2

Query  185  SAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDEPG  364
            ++G TS + R+E+PS DIPLD++ FA+PKG NAPQQVHITQGDYDGKAVI+SWVTP+EPG
Sbjct  22   ASGRTSSYVRTEFPSTDIPLDSEWFAIPKGYNAPQQVHITQGDYDGKAVIVSWVTPEEPG  81

Query  365  SSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGN  526
             S+V YG  E +Y   AEGT TNYTFYNYKSG+IH CLV GLE++ KYYY+IG+
Sbjct  82   PSEVFYG-KEKQYGQKAEGTTTNYTFYNYKSGYIHHCLVDGLEYNTKYYYKIGS  134



>ref|NP_001147979.1| purple acid phosphatase precursor [Zea mays]
 gb|ACG29312.1| purple acid phosphatase precursor [Zea mays]
Length=476

 Score =   164 bits (416),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 79/115 (69%), Positives = 97/115 (84%), Gaps = 1/115 (1%)
 Frame = +2

Query  185  SAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDEPG  364
            ++G TS + R+E+PS DIPL+++ FA+PKG NAPQQVHITQGDYDGKAVI+SWVTP+EPG
Sbjct  22   ASGRTSSYVRTEFPSTDIPLESEWFAIPKGYNAPQQVHITQGDYDGKAVIVSWVTPEEPG  81

Query  365  SSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
             S+V YG  E  YD  AEGT TNYTFY+YKSG+IH CLV GLE++ KYYY+IG+G
Sbjct  82   PSEVFYG-KEKLYDQKAEGTTTNYTFYDYKSGYIHHCLVDGLEYNTKYYYKIGSG  135



>gb|ACF84615.1| unknown [Zea mays]
 gb|AFW87298.1| hypothetical protein ZEAMMB73_796282 [Zea mays]
Length=476

 Score =   164 bits (416),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 79/115 (69%), Positives = 97/115 (84%), Gaps = 1/115 (1%)
 Frame = +2

Query  185  SAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDEPG  364
            ++G TS + R+E+PS DIPL+++ FA+PKG NAPQQVHITQGDYDGKAVI+SWVTP+EPG
Sbjct  22   ASGRTSSYVRTEFPSTDIPLESEWFAIPKGYNAPQQVHITQGDYDGKAVIVSWVTPEEPG  81

Query  365  SSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
             S+V YG  E  YD  AEGT TNYTFY+YKSG+IH CLV GLE++ KYYY+IG+G
Sbjct  82   PSEVFYG-KEKLYDQKAEGTTTNYTFYDYKSGYIHHCLVDGLEYNTKYYYKIGSG  135



>dbj|BAJ92186.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=477

 Score =   164 bits (416),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 79/120 (66%), Positives = 96/120 (80%), Gaps = 1/120 (1%)
 Frame = +2

Query  173  IENGS-AGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVT  349
            + NG+ +G TS + R+E+PS DIP+D++ FA PKG NAPQQVHITQGDYDGKAVIISWVT
Sbjct  17   LVNGAYSGRTSSYVRAEFPSSDIPIDSEWFAAPKGYNAPQQVHITQGDYDGKAVIISWVT  76

Query  350  PDEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            P EP  SQV Y   E +YD  A+GT TNYTFY+YKSG+IH CLV GLE++ KY+Y+IG G
Sbjct  77   PSEPAPSQVFYSKEENRYDQNAQGTMTNYTFYDYKSGYIHHCLVDGLEYNTKYHYKIGTG  136



>gb|EEC81063.1| hypothetical protein OsI_23873 [Oryza sativa Indica Group]
Length=476

 Score =   164 bits (416),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 78/115 (68%), Positives = 96/115 (83%), Gaps = 0/115 (0%)
 Frame = +2

Query  185  SAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDEPG  364
            S G TS + R+E+PS DIPL+++ FAVP G NAPQQVHITQGDY+GKAVI+SWVT  EPG
Sbjct  21   SCGRTSSYVRTEYPSTDIPLESEWFAVPNGYNAPQQVHITQGDYNGKAVIVSWVTVAEPG  80

Query  365  SSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            +S+V YG +E +YD  AEGT TNYTFY+YKSG+IH CLV GLE++ KYYY+IG+G
Sbjct  81   TSEVLYGKNEHQYDQRAEGTVTNYTFYDYKSGYIHHCLVDGLEYNTKYYYKIGSG  135



>gb|AGT15919.1| purple acid phosphatase precursor [Saccharum hybrid cultivar 
R570]
Length=476

 Score =   164 bits (415),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 79/114 (69%), Positives = 96/114 (84%), Gaps = 1/114 (1%)
 Frame = +2

Query  185  SAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDEPG  364
            ++G TS + R+E+PS DIPLD++ FA+PKG NAPQQVHITQGDYDGKAVI+SWVTP+EPG
Sbjct  22   ASGRTSSYVRTEFPSTDIPLDSEWFAIPKGYNAPQQVHITQGDYDGKAVIVSWVTPEEPG  81

Query  365  SSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGN  526
             S+V YG  E +Y   AEGT TNYTFYNYKSG+IH CLV GLE++ KYYY+IG+
Sbjct  82   PSEVFYG-KEKQYGQKAEGTTTNYTFYNYKSGYIHHCLVDGLEYNTKYYYKIGS  134



>ref|NP_001058182.1| Os06g0643900 [Oryza sativa Japonica Group]
 gb|AAM00197.1|AF356352_1 acid phosphatase [Oryza sativa]
 dbj|BAD37373.1| acid phosphatase [Oryza sativa Japonica Group]
 dbj|BAD37429.1| acid phosphatase [Oryza sativa Japonica Group]
 dbj|BAF20096.1| Os06g0643900 [Oryza sativa Japonica Group]
 gb|EAZ37798.1| hypothetical protein OsJ_22134 [Oryza sativa Japonica Group]
Length=476

 Score =   163 bits (412),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 77/115 (67%), Positives = 95/115 (83%), Gaps = 0/115 (0%)
 Frame = +2

Query  185  SAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDEPG  364
            S G TS + R+E+PS DIPL+++ FAVP G NAPQQVHITQGDY+GKAVI+SWVT  EPG
Sbjct  21   SCGRTSSYVRTEYPSTDIPLESEWFAVPNGYNAPQQVHITQGDYNGKAVIVSWVTVAEPG  80

Query  365  SSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            +S+V YG +E +YD   EGT TNYTFY+YKSG+IH CLV GLE++ KYYY+IG+G
Sbjct  81   TSEVLYGKNEHQYDQRVEGTVTNYTFYDYKSGYIHHCLVDGLEYNTKYYYKIGSG  135



>dbj|BAB88215.1| putative secretory acid phosphatase precursor [Oryza sativa Japonica 
Group]
Length=476

 Score =   163 bits (412),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 77/115 (67%), Positives = 95/115 (83%), Gaps = 0/115 (0%)
 Frame = +2

Query  185  SAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDEPG  364
            S G TS + R+E+PS DIPL+++ FAVP G NAPQQVHITQGDY+GKAVI+SWVT  EPG
Sbjct  21   SCGRTSSYVRTEYPSTDIPLESEWFAVPNGYNAPQQVHITQGDYNGKAVIVSWVTVAEPG  80

Query  365  SSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            +S+V YG +E +YD   EGT TNYTFY+YKSG+IH CLV GLE++ KYYY+IG+G
Sbjct  81   TSEVLYGKNEHQYDQRVEGTVTNYTFYDYKSGYIHHCLVDGLEYNTKYYYKIGSG  135



>gb|EMT07067.1| Bifunctional purple acid phosphatase 26 [Aegilops tauschii]
Length=525

 Score =   163 bits (413),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 77/111 (69%), Positives = 90/111 (81%), Gaps = 0/111 (0%)
 Frame = +2

Query  197  TSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDEPGSSQV  376
            TS + RSE+PS D+PLD++ FA PKG NAPQQVHITQGDYDGKAVIISWVTP EP  +QV
Sbjct  26   TSSYVRSEFPSTDMPLDSEWFATPKGYNAPQQVHITQGDYDGKAVIISWVTPSEPAPTQV  85

Query  377  RYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
             Y   E +YD  A+GT TNYTFY+YKSG+IH CLV GLE++ KYYY+IG G
Sbjct  86   FYSKEENRYDQKAQGTMTNYTFYDYKSGYIHHCLVEGLEYNTKYYYKIGTG  136



>ref|XP_004965755.1| PREDICTED: phosphoenolpyruvate phosphatase-like [Setaria italica]
Length=476

 Score =   162 bits (409),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 78/115 (68%), Positives = 95/115 (83%), Gaps = 1/115 (1%)
 Frame = +2

Query  185  SAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDEPG  364
            ++  TS + R+ +PS DIPL+++ FAVPKG NAPQQVHITQGDYDGKAVI+SWVT +EPG
Sbjct  22   TSSRTSSYVRTAFPSTDIPLESEWFAVPKGYNAPQQVHITQGDYDGKAVIVSWVTQEEPG  81

Query  365  SSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
             S+V YG  E +YD  AEGT TNYTFY+YKSG+IH CLV GLE++ KYYY+IGNG
Sbjct  82   PSEVFYG-KEKQYDQKAEGTTTNYTFYDYKSGYIHHCLVSGLEYNTKYYYKIGNG  135



>ref|XP_010696563.1| PREDICTED: bifunctional purple acid phosphatase 26-like [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010696569.1| PREDICTED: bifunctional purple acid phosphatase 26-like [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010696573.1| PREDICTED: bifunctional purple acid phosphatase 26-like [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010696577.1| PREDICTED: bifunctional purple acid phosphatase 26-like [Beta 
vulgaris subsp. vulgaris]
Length=469

 Score =   161 bits (408),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 92/113 (81%), Gaps = 1/113 (1%)
 Frame = +2

Query  182  GSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDEP  361
            G AG+TS + RSE PSVDIPLDN+AFA P+GPN PQQVHITQGDYDGKAVI+SWVTPDEP
Sbjct  28   GHAGLTSAYVRSERPSVDIPLDNEAFAAPEGPNTPQQVHITQGDYDGKAVIVSWVTPDEP  87

Query  362  GSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEI  520
            G  +++YG S+  +  +AE T TNYTF  Y SG+IH CL+ GLE++ KYYY+I
Sbjct  88   GLWKLQYGKSK-DFKLSAESTMTNYTFNKYNSGYIHHCLLDGLEYNTKYYYKI  139



>ref|XP_006656291.1| PREDICTED: phosphoenolpyruvate phosphatase-like isoform X1 [Oryza 
brachyantha]
 ref|XP_006656292.1| PREDICTED: phosphoenolpyruvate phosphatase-like isoform X2 [Oryza 
brachyantha]
Length=477

 Score =   160 bits (405),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 76/115 (66%), Positives = 94/115 (82%), Gaps = 0/115 (0%)
 Frame = +2

Query  185  SAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDEPG  364
            S+G TS + R+E+PS DIPL+++ FA P G NAPQQVHITQGDY+GKAVI+SWVT  EPG
Sbjct  22   SSGRTSSYVRTEYPSTDIPLESEWFAAPNGYNAPQQVHITQGDYNGKAVIVSWVTVAEPG  81

Query  365  SSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
             S+V YG +E +YD  AEGT  NYTFY+YKSG+IH CLV GLE++ KYYY+IG+G
Sbjct  82   PSEVFYGKNEHQYDQRAEGTVKNYTFYDYKSGYIHHCLVDGLEYNTKYYYKIGSG  136



>gb|ABK24726.1| unknown [Picea sitchensis]
Length=517

 Score =   160 bits (404),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 75/117 (64%), Positives = 91/117 (78%), Gaps = 0/117 (0%)
 Frame = +2

Query  176  ENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPD  355
             N +AG+TS F RS   SVD+PLDN+AF++PKG NAP+QVHITQGDY+GKAVI+SWVT  
Sbjct  56   RNSNAGVTSSFMRSLMASVDMPLDNEAFSIPKGYNAPEQVHITQGDYEGKAVIVSWVTSA  115

Query  356  EPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGN  526
            EPGSS+V Y   E  Y + A+G  T YTF+NY SGFIH CL+  LE+D KYYY+IGN
Sbjct  116  EPGSSEVFYDTVEHNYKYRAKGNITTYTFFNYTSGFIHHCLIIDLEYDTKYYYKIGN  172



>ref|XP_003563304.2| PREDICTED: phosphoenolpyruvate phosphatase [Brachypodium distachyon]
Length=563

 Score =   159 bits (401),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 94/120 (78%), Gaps = 1/120 (1%)
 Frame = +2

Query  173  IENGS-AGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVT  349
            I NG  +G TS + R+E+PS D+P+D++ FA P G NAPQQVHITQGDYDGKAVIISWVT
Sbjct  103  IVNGVFSGRTSSYVRTEFPSTDMPIDSEWFATPNGYNAPQQVHITQGDYDGKAVIISWVT  162

Query  350  PDEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
              EPG S+V Y   E +YD  AEGT T+YTFY+YKSG+IH CLV GLE++ KYYY+IG G
Sbjct  163  VSEPGLSEVFYSKEENRYDQKAEGTSTSYTFYDYKSGYIHHCLVDGLEYNTKYYYKIGTG  222



>gb|EMS63219.1| Bifunctional purple acid phosphatase 26 [Triticum urartu]
Length=469

 Score =   150 bits (379),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 71/98 (72%), Positives = 80/98 (82%), Gaps = 0/98 (0%)
 Frame = +2

Query  236  IPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDEPGSSQVRYGLSEGKYDFTA  415
            +PLD++ FA PKG NAPQQVHITQGDYDGKAVIISWVTP EP  SQV Y   E +YD  A
Sbjct  1    MPLDSEWFATPKGYNAPQQVHITQGDYDGKAVIISWVTPSEPAPSQVFYSKEENRYDQKA  60

Query  416  EGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            EGT TNYTFY+YKSG+IH CLV GLE++ KYYY+IG G
Sbjct  61   EGTMTNYTFYDYKSGYIHHCLVDGLEYNTKYYYKIGTG  98



>ref|XP_010933142.1| PREDICTED: purple acid phosphatase-like [Elaeis guineensis]
Length=470

 Score =   145 bits (367),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 69/113 (61%), Positives = 82/113 (73%), Gaps = 0/113 (0%)
 Frame = +2

Query  191  GMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDEPGSS  370
            G+TS F R    +VD+PLD+  F VP G NAPQQVHITQGD DG A+I+SWVT DEPGSS
Sbjct  31   GVTSSFVRKTEKTVDMPLDSDVFRVPPGYNAPQQVHITQGDLDGAAIIVSWVTQDEPGSS  90

Query  371  QVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
             V YG  + K +F AEG YT Y FYNY SG+IH C +G L++D KYYY +G G
Sbjct  91   TVLYGTDKNKLEFYAEGKYTRYKFYNYTSGYIHHCTLGHLKYDTKYYYAVGIG  143



>ref|XP_008793996.1| PREDICTED: purple acid phosphatase 2-like [Phoenix dactylifera]
Length=471

 Score =   145 bits (367),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 69/113 (61%), Positives = 81/113 (72%), Gaps = 0/113 (0%)
 Frame = +2

Query  191  GMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDEPGSS  370
            G+TS F R    +VD+PLD+  F VP G NAPQQVHITQGD DG A+I+SWVT DEPGSS
Sbjct  32   GVTSSFVRKTEKTVDMPLDSDVFRVPPGYNAPQQVHITQGDQDGAAIIVSWVTQDEPGSS  91

Query  371  QVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
             V YG  + K +F AEG YT Y FYNY SG+IH C +  L+HD KYYY +G G
Sbjct  92   AVLYGTDKNKLEFYAEGKYTRYKFYNYTSGYIHHCTIRNLKHDTKYYYAVGIG  144



>ref|XP_010910529.1| PREDICTED: purple acid phosphatase-like [Elaeis guineensis]
Length=470

 Score =   145 bits (367),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 69/113 (61%), Positives = 82/113 (73%), Gaps = 0/113 (0%)
 Frame = +2

Query  191  GMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDEPGSS  370
            G+TS F R    +VD+PLD+  F VP G NAPQQVHITQGD DG A+I+SWVT DEPGSS
Sbjct  31   GVTSSFVRKTEKTVDMPLDSDVFRVPPGYNAPQQVHITQGDLDGAAIIVSWVTQDEPGSS  90

Query  371  QVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
             V YG  + K +F AEG YT Y FYNY SG+IH C +G L++D KYYY +G G
Sbjct  91   TVLYGTDKNKLEFYAEGKYTRYKFYNYTSGYIHHCTLGHLKYDTKYYYAVGIG  143



>ref|XP_008796614.1| PREDICTED: purple acid phosphatase 2-like [Phoenix dactylifera]
Length=469

 Score =   144 bits (364),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/113 (61%), Positives = 81/113 (72%), Gaps = 0/113 (0%)
 Frame = +2

Query  191  GMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDEPGSS  370
            G+TS F R    +VD+PLD+  F VP G NAPQQVHITQGD DG AV +SWVT DEPGSS
Sbjct  30   GVTSSFVRKTGKTVDMPLDSDVFRVPSGDNAPQQVHITQGDRDGTAVTVSWVTCDEPGSS  89

Query  371  QVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
             V YG ++ K +F AEG YT Y FYNY SG+IH C +  L+HD KYYY +G G
Sbjct  90   TVLYGTTKNKIEFFAEGKYTRYKFYNYTSGYIHHCTLRNLKHDTKYYYALGIG  142



>ref|XP_009408475.1| PREDICTED: purple acid phosphatase 2-like [Musa acuminata subsp. 
malaccensis]
Length=459

 Score =   142 bits (359),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 67/113 (59%), Positives = 83/113 (73%), Gaps = 0/113 (0%)
 Frame = +2

Query  191  GMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDEPGSS  370
            G+TS F R     VD+P+D+  F+VP G NAPQQVHITQG++DG A+I+SWVT DEPGSS
Sbjct  29   GVTSSFVRKAEKGVDMPIDSDVFSVPPGYNAPQQVHITQGNHDGSAMILSWVTEDEPGSS  88

Query  371  QVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            +V YG  + + DF AEG YT Y FYNY SG+IH C +  L+HD KYYY +G G
Sbjct  89   KVLYGTDKDQLDFYAEGKYTRYKFYNYTSGYIHHCTLRHLKHDTKYYYAVGIG  141



>ref|XP_009397025.1| PREDICTED: purple acid phosphatase 2 [Musa acuminata subsp. malaccensis]
Length=467

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 84/119 (71%), Gaps = 0/119 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            +     G+TSGF R    ++D+PLD+  F VP G NAPQQVHITQG+ DG A+IISWVT 
Sbjct  24   VNRSDGGVTSGFVRKVEKTIDMPLDSDIFRVPPGYNAPQQVHITQGNLDGTAMIISWVTE  83

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            DEPGSS+V YG  E K + +AEG YT Y FYNY SG+IH C +  L++D +YYY +G G
Sbjct  84   DEPGSSEVLYGTDEDKLELSAEGKYTRYKFYNYTSGYIHHCTIRHLKYDTEYYYAVGIG  142



>ref|XP_010687873.1| PREDICTED: bifunctional purple acid phosphatase 26-like [Beta 
vulgaris subsp. vulgaris]
Length=462

 Score =   139 bits (351),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 70/117 (60%), Positives = 83/117 (71%), Gaps = 0/117 (0%)
 Frame = +2

Query  179  NGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDE  358
            NG   +TS + R    S DIPLD+   A PK  NAPQQVHITQGDYDGKAVIISWVTP  
Sbjct  25   NGDTSVTSKYVRKNPASFDIPLDSDIIAAPKAHNAPQQVHITQGDYDGKAVIISWVTPQL  84

Query  359  PGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
             GS  V YG ++G+Y   A+ T T+Y+F NYKSG I+ CLV GLE++ KYYY IG+G
Sbjct  85   HGSDTVYYGTTKGRYTSKAKATKTSYSFNNYKSGQIYHCLVDGLEYNTKYYYRIGSG  141



>ref|XP_009398390.1| PREDICTED: purple acid phosphatase 2-like [Musa acuminata subsp. 
malaccensis]
Length=466

 Score =   138 bits (348),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 82/113 (73%), Gaps = 0/113 (0%)
 Frame = +2

Query  191  GMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDEPGSS  370
            G+TS F R+   ++D+P+D+  F VP G NAPQQVHITQG++DG A+I+SWVT  EPGSS
Sbjct  29   GVTSSFVRNAKKAIDMPIDSDVFRVPPGYNAPQQVHITQGNHDGSAMIVSWVTEAEPGSS  88

Query  371  QVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            +V YG    K  F+AEG +T Y FYNY SG+IH C +  L+HD KYYY +G G
Sbjct  89   KVLYGTDSNKLIFSAEGKHTRYEFYNYTSGYIHHCTIRKLKHDTKYYYAVGIG  141



>ref|XP_011088457.1| PREDICTED: purple acid phosphatase 2 [Sesamum indicum]
Length=467

 Score =   138 bits (347),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 80/115 (70%), Gaps = 0/115 (0%)
 Frame = +2

Query  185  SAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDEPG  364
            S G TS F R    +VD+PLD+  F VP G NAPQQVHITQGD+ GKAVI+SWVT DEPG
Sbjct  25   SGGFTSSFVRKVEKTVDMPLDSDVFEVPPGYNAPQQVHITQGDHIGKAVIVSWVTVDEPG  84

Query  365  SSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            S+ V Y  +  K    A+GT T Y FYNY SG+IH C +  LE+D KYYYE+G G
Sbjct  85   SNTVLYWAANSKLKNKAKGTLTKYKFYNYTSGYIHHCTIKNLEYDTKYYYEVGIG  139



>dbj|BAA92365.1| purple acid phosphatase [Spirodela punctata]
Length=455

 Score =   137 bits (346),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 64/115 (56%), Positives = 84/115 (73%), Gaps = 0/115 (0%)
 Frame = +2

Query  185  SAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDEPG  364
            S G+TS F R +  +VD+PL    F +P G NAPQQVHITQGD++G+++I+SW+TP E G
Sbjct  19   SGGITSEFVRLQESAVDMPLHADVFRMPPGYNAPQQVHITQGDHEGRSIIVSWITPSEKG  78

Query  365  SSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            SS V YG SE K D  AEGT T Y FY Y SG+IH C++  L++DRKY+Y++G G
Sbjct  79   SSTVFYGTSENKLDQHAEGTVTMYKFYTYTSGYIHHCVLTDLKYDRKYFYKVGEG  133



>ref|XP_006646385.1| PREDICTED: purple acid phosphatase 2-like [Oryza brachyantha]
Length=659

 Score =   139 bits (350),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 80/114 (70%), Gaps = 0/114 (0%)
 Frame = +2

Query  188  AGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDEPGS  367
            AG TS + R    +VD+PLD   F  P G NAPQQVHITQG++DG A+IISWVT  EPGS
Sbjct  27   AGQTSEYRRRLGSAVDMPLDADVFRAPPGHNAPQQVHITQGNHDGTAMIISWVTTSEPGS  86

Query  368  SQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            S V YG ++   +F+A G +T YTFYNY SG+IH C V  LE DRKYYY +G G
Sbjct  87   STVLYGTAKDNLNFSANGKHTQYTFYNYTSGYIHHCTVKNLEFDRKYYYAVGIG  140



>gb|EPS60425.1| hypothetical protein M569_14376, partial [Genlisea aurea]
Length=454

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/109 (61%), Positives = 80/109 (73%), Gaps = 0/109 (0%)
 Frame = +2

Query  197  TSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDEPGSSQV  376
            TS F RS+ PSVD+P+D+  FAVP+G NAPQQVHITQGD+DG+AVI+SW T DEPGS  V
Sbjct  22   TSSFTRSQEPSVDMPIDSDVFAVPRGYNAPQQVHITQGDHDGRAVIVSWTTVDEPGSVVV  81

Query  377  RYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIG  523
             Y  +  +    AEG  T Y +YNY SGFIH   + GLE+D KYYY+IG
Sbjct  82   EYWAATSEVKKHAEGLITKYKYYNYTSGFIHHATIKGLEYDTKYYYKIG  130



>sp|Q93WP4.1|PEPP_ALLCE RecName: Full=Phosphoenolpyruvate phosphatase; Short=PEP phosphatase; 
Flags: Precursor [Allium cepa]
 dbj|BAB60719.1| PEP phosphatase [Allium cepa]
Length=481

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 90/119 (76%), Gaps = 0/119 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            ++      TS F RSE+P+VDIP+D+K FAVPK   +PQQVHITQGDYDGKAVI+SWVT 
Sbjct  23   VDKTLCRQTSSFVRSEFPAVDIPIDSKEFAVPKNQFSPQQVHITQGDYDGKAVIVSWVTF  82

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
             +PG S+V YG S   YD +A+G  TNYT+Y+Y SG+IH CL+  LE+D KYYY+IG G
Sbjct  83   IDPGKSEVVYGTSPNSYDHSAQGKTTNYTYYDYTSGYIHHCLLDKLEYDTKYYYKIGKG  141



>gb|EYU37832.1| hypothetical protein MIMGU_mgv1a005923mg [Erythranthe guttata]
Length=464

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 80/113 (71%), Gaps = 0/113 (0%)
 Frame = +2

Query  191  GMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDEPGSS  370
            G+TS F R    +VD+PLD+  F VP G NAPQQVHITQGD+ GKAVI+SWVT +EPGS+
Sbjct  27   GVTSSFVRKVEKTVDMPLDSDVFKVPPGYNAPQQVHITQGDHVGKAVIVSWVTVEEPGSN  86

Query  371  QVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
             V Y   +  +   A+G+ T Y FYNY SGFIH C +  LEH+ KYYYE+G G
Sbjct  87   TVLYWAEKSAHKNKAKGSLTRYKFYNYTSGFIHHCTIRNLEHETKYYYEVGIG  139



>ref|NP_001044416.1| Os01g0776600 [Oryza sativa Japonica Group]
 dbj|BAC07354.1| putative purple acid phosphatase [Oryza sativa Japonica Group]
 dbj|BAF06330.1| Os01g0776600 [Oryza sativa Japonica Group]
 gb|EAY76021.1| hypothetical protein OsI_03945 [Oryza sativa Indica Group]
 gb|EAZ13731.1| hypothetical protein OsJ_03653 [Oryza sativa Japonica Group]
 dbj|BAG92599.1| unnamed protein product [Oryza sativa Japonica Group]
Length=465

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 80/114 (70%), Gaps = 0/114 (0%)
 Frame = +2

Query  188  AGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDEPGS  367
            AG TS + R    +VD+PLD   F  P G NAPQQVHITQG++DG A+IISWVT  EPGS
Sbjct  25   AGETSEYRRQLGSAVDMPLDADVFRAPPGRNAPQQVHITQGNHDGTAMIISWVTTIEPGS  84

Query  368  SQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            S V YG SE   +F+A+G +T YTFYNY SG+IH C +  LE D KYYY +G G
Sbjct  85   STVLYGTSEDNLNFSADGKHTQYTFYNYTSGYIHHCTIKKLEFDTKYYYAVGIG  138



>gb|KFK32700.1| hypothetical protein AALP_AA6G277500 [Arabis alpina]
Length=464

 Score =   135 bits (341),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 64/119 (54%), Positives = 82/119 (69%), Gaps = 0/119 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            ++  + G+TSG+ R+     D+PLD+  F VP GPN PQQVH+TQG+Y+G  VIISWVTP
Sbjct  18   VQLCNGGITSGYLRAADLPDDMPLDSDVFTVPSGPNTPQQVHVTQGNYEGNGVIISWVTP  77

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
             +PGS+ VRY    GK    AE T   Y F+NY SG+IH C++  LE D KYYYEIG+G
Sbjct  78   VKPGSNTVRYWKENGKPKSQAEATINTYKFFNYTSGYIHHCIIDDLEFDMKYYYEIGSG  136



>ref|XP_010271524.1| PREDICTED: purple acid phosphatase [Nelumbo nucifera]
Length=471

 Score =   135 bits (341),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 78/113 (69%), Gaps = 0/113 (0%)
 Frame = +2

Query  191  GMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDEPGSS  370
            G+TS F R    +VD+PLD+  F VP G NAPQQVHITQGD++GK VIISWVT DEPGSS
Sbjct  32   GITSTFVRKAEKTVDMPLDSDVFRVPPGYNAPQQVHITQGDHEGKGVIISWVTQDEPGSS  91

Query  371  QVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
             V Y     K+ + A+G    Y FYNY SG+IH C +  L+ D KYYYEIG G
Sbjct  92   AVLYWSENSKHKYLAKGEVVTYKFYNYTSGYIHHCTIKNLKFDTKYYYEIGIG  144



>tpg|DAA57388.1| TPA: hypothetical protein ZEAMMB73_877733, partial [Zea mays]
Length=268

 Score =   132 bits (332),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 65/116 (56%), Positives = 79/116 (68%), Gaps = 0/116 (0%)
 Frame = +2

Query  182  GSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDEP  361
              AG TS + R    ++D+PLD   F  P G NAP+QVHITQG++DG A+IISWVT  EP
Sbjct  33   AQAGHTSEYRRQLGSAIDMPLDADVFRPPPGYNAPEQVHITQGNHDGTAMIISWVTTSEP  92

Query  362  GSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            GSS V YG SE   ++TA G +T YTFYNY SG+IH C +  LE D KYYY +G G
Sbjct  93   GSSTVIYGTSEDNLNYTANGKHTQYTFYNYTSGYIHHCTIKKLEFDTKYYYAVGIG  148



>ref|XP_010030674.1| PREDICTED: purple acid phosphatase 2-like [Eucalyptus grandis]
Length=472

 Score =   135 bits (340),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 79/113 (70%), Gaps = 0/113 (0%)
 Frame = +2

Query  191  GMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDEPGSS  370
            G TS F R E  +VD+P+D+  F VP G NAPQQVHITQGD++GK VI+SWVTPDEPGSS
Sbjct  34   GKTSTFVRKEEKAVDMPIDSDVFRVPPGYNAPQQVHITQGDHEGKGVIVSWVTPDEPGSS  93

Query  371  QVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
             VRY     ++  T +G    Y +YNY SG+IH C +  L +D KYYYE+G G
Sbjct  94   VVRYWSENSEHKKTKKGKVNRYKYYNYTSGYIHHCTLNNLMYDTKYYYEVGIG  146



>ref|XP_002512962.1| Purple acid phosphatase precursor, putative [Ricinus communis]
 gb|EEF49465.1| Purple acid phosphatase precursor, putative [Ricinus communis]
Length=467

 Score =   135 bits (339),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 78/113 (69%), Gaps = 0/113 (0%)
 Frame = +2

Query  191  GMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDEPGSS  370
            G TS F R    +VD+PLD+  F VP G NAPQQVHITQGD+DGKAVI+SWVT DEPGSS
Sbjct  27   GKTSSFVRPVEKTVDMPLDSDVFQVPPGYNAPQQVHITQGDHDGKAVIVSWVTEDEPGSS  86

Query  371  QVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
             V Y      +   A+G YT Y FYNY SG+IH C +  LE++ KYYY +G G
Sbjct  87   NVLYWSKSSPHKKQAKGKYTTYKFYNYTSGYIHHCTIRNLEYNTKYYYAVGIG  139



>ref|XP_006838700.1| hypothetical protein AMTR_s00002p00249280 [Amborella trichopoda]
 gb|ERN01269.1| hypothetical protein AMTR_s00002p00249280 [Amborella trichopoda]
Length=461

 Score =   134 bits (337),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 78/111 (70%), Gaps = 0/111 (0%)
 Frame = +2

Query  191  GMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDEPGSS  370
            G+TS F R   P+ D+PLD+  F VP G NAPQQVHITQGD+DGK VI+SWVTP EPGS+
Sbjct  22   GVTSLFVRKVEPTKDMPLDSDVFRVPPGYNAPQQVHITQGDHDGKGVIVSWVTPSEPGSN  81

Query  371  QVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIG  523
             V Y  +  K+ + AEG    Y FYNY SGFIH C +  L+ D +YYYE+G
Sbjct  82   TVLYWTANDKHKYHAEGHVRKYKFYNYTSGFIHHCTLRNLKIDTQYYYEVG  132



>ref|XP_004230906.1| PREDICTED: purple acid phosphatase 2 [Solanum lycopersicum]
 gb|AJK28063.1| purple acid phosphatase [Solanum lycopersicum]
Length=470

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 81/113 (72%), Gaps = 0/113 (0%)
 Frame = +2

Query  191  GMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDEPGSS  370
            G+TS F R    ++D+PLD+  F+VP G NAPQQVHITQGD+ GKAVI+SWVT DEPGSS
Sbjct  30   GVTSSFVRKVEKTIDMPLDSDVFSVPPGYNAPQQVHITQGDHVGKAVIVSWVTMDEPGSS  89

Query  371  QVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
             V Y   + K+   A G  T+YT+YNY SG+IH C +  L+ D KYYY+IG G
Sbjct  90   TVVYWSEKSKHKCKASGKVTSYTYYNYTSGYIHHCNIKNLKFDTKYYYKIGIG  142



>gb|AFK42558.1| unknown [Lotus japonicus]
Length=173

 Score =   128 bits (321),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 76/113 (67%), Gaps = 0/113 (0%)
 Frame = +2

Query  191  GMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDEPGSS  370
            G TS F R    +VD+P D+  FAVP G NAPQQVHITQGD +GKA+I+SWVT DEPGSS
Sbjct  32   GKTSTFVRKVEKTVDMPFDSDVFAVPPGYNAPQQVHITQGDLEGKALIVSWVTVDEPGSS  91

Query  371  QVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            +V Y     K    A+G    Y F+NY SGFIH   +  L+H+ KY+YEIG G
Sbjct  92   EVHYWSEHSKEKKKADGKVVTYRFFNYTSGFIHHTTIRQLKHNTKYHYEIGIG  144



>ref|XP_011017866.1| PREDICTED: bifunctional purple acid phosphatase 26-like isoform 
X2 [Populus euphratica]
Length=434

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = +2

Query  290  QVHITQGDYDGKAVIISWVTPDEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIH  469
            +VHITQGDY+GKAVIISWVTPDEPG+S+V+YG+S+  YDFTAEG   NYTFYNY SG+IH
Sbjct  15   KVHITQGDYNGKAVIISWVTPDEPGTSKVQYGVSKENYDFTAEGAVRNYTFYNYTSGYIH  74

Query  470  QCLVGGLEHDRKYYYEIGNG  529
            QCLV GLE+D KYYY+IG+G
Sbjct  75   QCLVDGLEYDTKYYYKIGSG  94



>ref|XP_002458586.1| hypothetical protein SORBIDRAFT_03g036210 [Sorghum bicolor]
 gb|EES03706.1| hypothetical protein SORBIDRAFT_03g036210 [Sorghum bicolor]
Length=476

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/116 (56%), Positives = 79/116 (68%), Gaps = 0/116 (0%)
 Frame = +2

Query  182  GSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDEP  361
              AG TS + R    ++D+PLD   F  P G NAP+QVHITQG++DG A+IISWVT  EP
Sbjct  34   AQAGQTSEYRRQLGSAIDMPLDADVFRPPPGHNAPEQVHITQGNHDGTAMIISWVTTSEP  93

Query  362  GSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            GSS V YG SE   ++TA G +T YTFYNY SG+IH C +  LE D KYYY +G G
Sbjct  94   GSSTVIYGTSEDNLNYTANGKHTQYTFYNYTSGYIHHCTIKKLEFDTKYYYAVGIG  149



>gb|KJB58168.1| hypothetical protein B456_009G197600 [Gossypium raimondii]
 gb|KJB58172.1| hypothetical protein B456_009G197600 [Gossypium raimondii]
Length=261

 Score =   129 bits (325),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 78/118 (66%), Gaps = 0/118 (0%)
 Frame = +2

Query  176  ENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPD  355
            E  + G TS F R+   S D+PLD+  F VP G NAPQQVHITQGD+ G AVI+SWVTPD
Sbjct  25   EVCNGGRTSSFVRNSDLSRDMPLDSDVFRVPPGYNAPQQVHITQGDHLGNAVIVSWVTPD  84

Query  356  EPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            EPGS+ V Y     +   +A+G    Y ++NY SGFIH C V  LE D KYYYE+G G
Sbjct  85   EPGSNSVFYWAENSELKNSAQGIVLTYKYFNYTSGFIHHCTVRDLEFDTKYYYEVGIG  142



>emb|CAA06921.1| purple acid phosphatase [Ipomoea batatas]
Length=465

 Score =   133 bits (334),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 81/114 (71%), Gaps = 0/114 (0%)
 Frame = +2

Query  188  AGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDEPGS  367
            AG+TS F R    +VD+PLD+  F VP G NAPQQVHITQGD+ GKA+I+SWVT DEPGS
Sbjct  24   AGITSSFIRKVEKTVDMPLDSDVFRVPPGYNAPQQVHITQGDHVGKAMIVSWVTVDEPGS  83

Query  368  SQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            S+V Y     ++   A+G    YT++NY SG+IH C +  LE++ KYYYE+G G
Sbjct  84   SKVVYWSENSQHKKVAKGNIRTYTYFNYTSGYIHHCTIRNLEYNTKYYYEVGIG  137



>ref|XP_002274392.1| PREDICTED: purple acid phosphatase [Vitis vinifera]
 emb|CBI38023.3| unnamed protein product [Vitis vinifera]
Length=471

 Score =   133 bits (334),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 77/113 (68%), Gaps = 0/113 (0%)
 Frame = +2

Query  191  GMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDEPGSS  370
            G+TS F R    SVD+PLD+  FA P G NAPQQVHITQGD+ GKAVI+SWVT  EPGS+
Sbjct  33   GITSSFVRQAEKSVDMPLDSDVFAEPPGYNAPQQVHITQGDHSGKAVIVSWVTMAEPGSN  92

Query  371  QVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
             V Y   + K    AE +   Y +YNY SG+IH C +  LE D KYYYE+G+G
Sbjct  93   TVLYWSEKSKVKMQAEASVVTYKYYNYASGYIHHCTIRNLEFDTKYYYEVGSG  145



>ref|XP_008448074.1| PREDICTED: purple acid phosphatase 2 [Cucumis melo]
Length=471

 Score =   132 bits (333),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 64/119 (54%), Positives = 82/119 (69%), Gaps = 0/119 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            +E    G TS F R    +VD+PLD+  FAVP G NAPQQVHITQGD++GKAVI+SW+TP
Sbjct  25   VEVCYGGKTSQFLRKVEKTVDMPLDSDVFAVPPGFNAPQQVHITQGDHEGKAVIVSWITP  84

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            D+PGS++V Y   + K    A G    Y FYNY SG+IH C +  L+++ KYYYE+G G
Sbjct  85   DKPGSNEVLYWTEKSKQKKLAFGKVYTYKFYNYTSGYIHHCTIKNLKYNTKYYYEVGIG  143



>ref|XP_010061253.1| PREDICTED: purple acid phosphatase-like isoform X1 [Eucalyptus 
grandis]
 ref|XP_010061254.1| PREDICTED: purple acid phosphatase-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW68181.1| hypothetical protein EUGRSUZ_F01849 [Eucalyptus grandis]
Length=476

 Score =   132 bits (333),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 78/113 (69%), Gaps = 0/113 (0%)
 Frame = +2

Query  191  GMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDEPGSS  370
            G+TS + RS   S D+PLD+  F VP G NAPQQVHITQGDY GK VI+SWVTPDEPGS+
Sbjct  30   GITSSYVRSANLSADMPLDSDVFRVPPGYNAPQQVHITQGDYVGKGVIVSWVTPDEPGSN  89

Query  371  QVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
             V Y       +  AEG  T Y ++NY SG+IH C +  LE+D KYYYE+G G
Sbjct  90   TVVYWAEGSTTESRAEGIVTTYKYFNYTSGYIHHCAIEDLEYDTKYYYEVGIG  142



>sp|Q9SDZ9.1|PPAF2_IPOBA RecName: Full=Purple acid phosphatase 2; AltName: Full=Manganese(II) 
purple acid phosphatase 2; Flags: Precursor [Ipomoea 
batatas]
 gb|AAF19822.1|AF200826_1 purple acid phosphatase precursor [Ipomoea batatas]
Length=465

 Score =   132 bits (333),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 80/114 (70%), Gaps = 0/114 (0%)
 Frame = +2

Query  188  AGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDEPGS  367
            AG+TS F R    +VD+PLD+  F VP G NAPQQVHITQGD+ GKA+I+SWVT DEPGS
Sbjct  24   AGITSSFIRKVEKTVDMPLDSDVFRVPPGYNAPQQVHITQGDHVGKAMIVSWVTVDEPGS  83

Query  368  SQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            S+V Y     ++   A G    YT++NY SG+IH C +  LE++ KYYYE+G G
Sbjct  84   SKVVYWSENSQHKKVARGNIRTYTYFNYTSGYIHHCTIRNLEYNTKYYYEVGIG  137



>ref|NP_001141970.1| hypothetical protein precursor [Zea mays]
 gb|ACF78809.1| unknown [Zea mays]
 gb|ACF87398.1| unknown [Zea mays]
 tpg|DAA57387.1| TPA: hypothetical protein ZEAMMB73_877733 [Zea mays]
Length=475

 Score =   132 bits (333),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 65/116 (56%), Positives = 79/116 (68%), Gaps = 0/116 (0%)
 Frame = +2

Query  182  GSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDEP  361
              AG TS + R    ++D+PLD   F  P G NAP+QVHITQG++DG A+IISWVT  EP
Sbjct  33   AQAGHTSEYRRQLGSAIDMPLDADVFRPPPGYNAPEQVHITQGNHDGTAMIISWVTTSEP  92

Query  362  GSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            GSS V YG SE   ++TA G +T YTFYNY SG+IH C +  LE D KYYY +G G
Sbjct  93   GSSTVIYGTSEDNLNYTANGKHTQYTFYNYTSGYIHHCTIKKLEFDTKYYYAVGIG  148



>gb|KJB63548.1| hypothetical protein B456_010G007100 [Gossypium raimondii]
 gb|KJB63550.1| hypothetical protein B456_010G007100 [Gossypium raimondii]
Length=379

 Score =   131 bits (330),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 65/119 (55%), Positives = 80/119 (67%), Gaps = 3/119 (3%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            I NG  G+T  F R ++ S D+PLD+  F VP G NAPQQVHITQGD DG  VIISW+TP
Sbjct  24   ICNG--GITGNFVRKKY-SPDMPLDSDVFQVPSGYNAPQQVHITQGDMDGSGVIISWITP  80

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            DEPGS+ V Y      + + AEG +  Y F+NY SG+IH C +  LE++ KY YEIG G
Sbjct  81   DEPGSNMVYYWSENSNHKYKAEGIFVRYKFFNYTSGYIHHCTINNLEYNTKYMYEIGRG  139



>ref|XP_007017662.1| Purple acid phosphatase 10 isoform 1 [Theobroma cacao]
 gb|EOY14887.1| Purple acid phosphatase 10 isoform 1 [Theobroma cacao]
Length=467

 Score =   132 bits (333),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 80/113 (71%), Gaps = 1/113 (1%)
 Frame = +2

Query  191  GMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDEPGSS  370
            G+TS F R E+ S D+PLD+  F VP G N PQQVHITQGD DG+ VIISW+TPDEPGS+
Sbjct  28   GITSSFVRKEY-SPDMPLDSDVFQVPPGYNEPQQVHITQGDADGRGVIISWITPDEPGSN  86

Query  371  QVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
             V Y     K+   A+GT+  Y F+NY SG+IH C +  LE++ KY+YE+G G
Sbjct  87   TVLYWSENSKHKNRADGTFVRYKFFNYTSGYIHHCTINKLEYNTKYFYEVGIG  139



>gb|KHN22217.1| Purple acid phosphatase 2 [Glycine soja]
Length=345

 Score =   130 bits (328),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 79/113 (70%), Gaps = 0/113 (0%)
 Frame = +2

Query  191  GMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDEPGSS  370
            G TS F R+++ S+D+P+D+  F VP G NAPQQVHITQGD+ GK VIISW++P EPGSS
Sbjct  33   GKTSDFLRNDYLSLDMPIDSDTFRVPPGYNAPQQVHITQGDHVGKGVIISWISPHEPGSS  92

Query  371  QVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
             V Y     ++ + A G +  Y ++NY SG+IH C V  LE D KYYYE+G G
Sbjct  93   TVIYWAENSEFKWQAHGFFLTYKYFNYTSGYIHHCTVHNLEFDTKYYYEVGIG  145



>ref|XP_007017665.1| Purple acid phosphatase 10 isoform 2 [Theobroma cacao]
 gb|EOY14890.1| Purple acid phosphatase 10 isoform 2 [Theobroma cacao]
Length=342

 Score =   130 bits (327),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 78/118 (66%), Gaps = 0/118 (0%)
 Frame = +2

Query  176  ENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPD  355
            E  + G TS F R++  S D+PLD+  F +P G NAPQQVHITQGD+ GK VI+SWVTPD
Sbjct  24   EVCNGGKTSSFVRNDQLSHDMPLDSDVFRIPPGYNAPQQVHITQGDHLGKGVIVSWVTPD  83

Query  356  EPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            EPGS+ V Y     +    AEG    Y ++NY SG+IH C +  LE D KYYYE+G G
Sbjct  84   EPGSNLVLYWAENSELKHQAEGIVLTYKYFNYTSGYIHHCTITNLESDTKYYYEVGIG  141



>gb|KJB63549.1| hypothetical protein B456_010G007100 [Gossypium raimondii]
Length=402

 Score =   131 bits (329),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 65/119 (55%), Positives = 80/119 (67%), Gaps = 3/119 (3%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            I NG  G+T  F R ++ S D+PLD+  F VP G NAPQQVHITQGD DG  VIISW+TP
Sbjct  24   ICNG--GITGNFVRKKY-SPDMPLDSDVFQVPSGYNAPQQVHITQGDMDGSGVIISWITP  80

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            DEPGS+ V Y      + + AEG +  Y F+NY SG+IH C +  LE++ KY YEIG G
Sbjct  81   DEPGSNMVYYWSENSNHKYKAEGIFVRYKFFNYTSGYIHHCTINNLEYNTKYMYEIGRG  139



>ref|XP_006581009.1| PREDICTED: uncharacterized protein LOC100794124 isoform X1 [Glycine 
max]
Length=416

 Score =   131 bits (329),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 79/113 (70%), Gaps = 0/113 (0%)
 Frame = +2

Query  191  GMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDEPGSS  370
            G TS F R+++ S+D+P+D+  F VP G NAPQQVHITQGD+ GK VIISW++P EPGSS
Sbjct  33   GKTSDFLRNDYLSLDMPIDSDTFRVPPGYNAPQQVHITQGDHVGKGVIISWISPHEPGSS  92

Query  371  QVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
             V Y     ++ + A G +  Y ++NY SG+IH C V  LE D KYYYE+G G
Sbjct  93   TVIYWAENSEFKWQAHGFFLTYKYFNYTSGYIHHCTVHNLEFDTKYYYEVGIG  145



>gb|EYU37834.1| hypothetical protein MIMGU_mgv1a005856mg [Erythranthe guttata]
Length=467

 Score =   131 bits (330),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 65/115 (57%), Positives = 78/115 (68%), Gaps = 0/115 (0%)
 Frame = +2

Query  185  SAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDEPG  364
            S G TS F R +  S D+PLD+  F VP G NAPQQVHITQGD+ GKAVI+SWVT +EPG
Sbjct  25   SGGSTSSFVRKDEKSGDMPLDSDVFNVPPGHNAPQQVHITQGDHIGKAVIVSWVTVEEPG  84

Query  365  SSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            S+ V Y      +   A+G  T Y FYNY SG+IH C +  LE+D KYYYE+G G
Sbjct  85   SNTVLYWAENSGHKHKAKGKVTKYKFYNYTSGYIHHCTIRNLEYDTKYYYEVGIG  139



>ref|XP_009762746.1| PREDICTED: purple acid phosphatase 2-like [Nicotiana sylvestris]
Length=490

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 80/111 (72%), Gaps = 0/111 (0%)
 Frame = +2

Query  191  GMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDEPGSS  370
            G+TS F R    ++D+P+D+  F+VP G NAPQQVHITQGD+ GKA+I+SWVT DEPGSS
Sbjct  50   GITSSFVRKVEKTIDMPMDSDVFSVPPGYNAPQQVHITQGDHVGKAMIVSWVTMDEPGSS  109

Query  371  QVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIG  523
             V Y  +  K    A+GT T Y FYNY SG+IH C++  L+ + KYYYE+G
Sbjct  110  TVLYWSNNSKQKNKAKGTVTTYRFYNYTSGYIHHCIIKHLKFNTKYYYEVG  160



>ref|NP_001239689.1| uncharacterized protein LOC100794124 [Glycine max]
 gb|ADM32495.1| phytase [Glycine max]
Length=444

 Score =   131 bits (329),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 79/113 (70%), Gaps = 0/113 (0%)
 Frame = +2

Query  191  GMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDEPGSS  370
            G TS F R+++ S+D+P+D+  F VP G NAPQQVHITQGD+ GK VIISW++P EPGSS
Sbjct  3    GKTSDFLRNDYLSLDMPIDSDTFRVPPGYNAPQQVHITQGDHVGKGVIISWISPHEPGSS  62

Query  371  QVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
             V Y     ++ + A G +  Y ++NY SG+IH C V  LE D KYYYE+G G
Sbjct  63   TVIYWAENSEFKWQAHGFFLTYKYFNYTSGYIHHCTVHNLEFDTKYYYEVGIG  115



>ref|XP_010315506.1| PREDICTED: LOW QUALITY PROTEIN: purple acid phosphatase 2-like 
[Solanum lycopersicum]
Length=465

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 81/119 (68%), Gaps = 2/119 (2%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            + NG  G+TS F R    ++D+PLD+  F +P G NAPQQVHITQGD++GKAVI+SWVT 
Sbjct  21   LRNG--GVTSSFVRKVENTIDMPLDSDVFRIPPGYNAPQQVHITQGDHEGKAVIVSWVTM  78

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            DE GSS V Y   + K    A G  TNY FYNY SG+IH C +  L+ D KYYY+IG G
Sbjct  79   DETGSSTVVYWSEKSKLKNKANGKVTNYKFYNYTSGYIHHCTIKHLKFDTKYYYKIGIG  137



>gb|ABV89758.1| purple acid phosphatase 12 protein family isoform 7 premature 
[Brassica napus]
 gb|ABV89760.1| purple acid phosphatase 12 protein family isoform 7 premature 
[Brassica napus]
Length=366

 Score =   130 bits (327),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/119 (54%), Positives = 77/119 (65%), Gaps = 0/119 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            +E    G+TS + R      D+PLD+  F VP GPN PQQVHITQG+++G  VIISWVTP
Sbjct  23   VELCDGGITSEYVRGSDLPDDMPLDSDVFKVPPGPNTPQQVHITQGNHEGNGVIISWVTP  82

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
              P S+ VRY    GK    AE T   Y F+NY SG+IH CL+  LE D KYYYEIG+G
Sbjct  83   SAPCSNTVRYWSENGKSKKQAEATMNTYRFFNYTSGYIHHCLIDDLEFDMKYYYEIGSG  141



>ref|XP_003527865.2| PREDICTED: purple acid phosphatase 2-like [Glycine max]
Length=474

 Score =   131 bits (329),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/111 (55%), Positives = 77/111 (69%), Gaps = 0/111 (0%)
 Frame = +2

Query  197  TSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDEPGSSQV  376
            T+ F R +  SVD+P+D+  F VP G NAPQQVHITQGD+ GK VIISW+TP EPGSS V
Sbjct  35   TTTFVRDDSLSVDMPIDSDVFRVPPGYNAPQQVHITQGDHVGKGVIISWITPHEPGSSTV  94

Query  377  RYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            +Y     +++  A G Y  Y ++NY SG+IH C +  LE D KYYYE+G G
Sbjct  95   KYWAENSEFELKAHGFYLAYKYFNYTSGYIHHCTIHNLEFDTKYYYEVGIG  145



>gb|ACU17971.1| unknown [Glycine max]
Length=307

 Score =   129 bits (324),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/115 (55%), Positives = 76/115 (66%), Gaps = 0/115 (0%)
 Frame = +2

Query  185  SAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDEPG  364
            + G +S F R    +VD+PLD+  FA+P G NAPQQVHITQGD  GKAVI+SWVT DEPG
Sbjct  21   NGGTSSPFVRKVEKAVDMPLDSDVFAIPPGYNAPQQVHITQGDLVGKAVIVSWVTVDEPG  80

Query  365  SSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            SS+VRY           EG    Y F+NY SGFIH   +  LE++ KYYYE+G G
Sbjct  81   SSEVRYWSENSDQKKIVEGKLVTYRFFNYTSGFIHHTTIRNLEYNTKYYYEVGLG  135



>gb|AET86954.1| PAP12 [Gossypium hirsutum]
Length=467

 Score =   131 bits (329),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/119 (55%), Positives = 80/119 (67%), Gaps = 3/119 (3%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            I NG  G+T  F R ++ S D+PLD+  F VP G NAPQQVHITQGD DG  VIISW+TP
Sbjct  24   ICNG--GITGNFVRKKY-SPDMPLDSDVFQVPSGYNAPQQVHITQGDMDGSGVIISWITP  80

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            DEPGS+ V Y      + + AEG +  Y F+NY SG+IH C +  LE++ KY YEIG G
Sbjct  81   DEPGSNMVYYWSENSNHKYKAEGIFVRYKFFNYTSGYIHHCTINNLEYNTKYMYEIGRG  139



>gb|KGN43158.1| hypothetical protein Csa_7G004110 [Cucumis sativus]
Length=508

 Score =   131 bits (329),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/119 (55%), Positives = 81/119 (68%), Gaps = 0/119 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            +E    G T  F R    +VD+PLD+  FAVP G NAPQQVHITQGD++GKAVI+SWVTP
Sbjct  48   VEVCYGGKTGQFMRKVEKTVDMPLDSDVFAVPPGFNAPQQVHITQGDHEGKAVIVSWVTP  107

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            ++PGS++V Y   + K    A G    Y FYNY SG+IH C +  L++D KYYYEIG G
Sbjct  108  NKPGSNEVLYWSEKSKEKKQAFGKVYTYKFYNYTSGYIHHCTIKNLKYDTKYYYEIGIG  166



>ref|XP_010690819.1| PREDICTED: purple acid phosphatase 2-like isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=472

 Score =   131 bits (329),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 79/116 (68%), Gaps = 0/116 (0%)
 Frame = +2

Query  182  GSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDEP  361
             +AG +S F R    SVD+PLD+  F  P G NAPQQVHITQGD++GK VI+SWVTP  P
Sbjct  28   SNAGKSSSFVRKVEKSVDMPLDSDVFRPPPGHNAPQQVHITQGDHEGKGVIVSWVTPISP  87

Query  362  GSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            GSS V Y     K+ + A+G  T Y +YNY SG+IH C +  LE++ KYYY++G G
Sbjct  88   GSSSVVYWSGSSKHKYKAKGIVTKYKYYNYTSGYIHHCTIRNLEYNTKYYYKVGTG  143



>gb|KJB63547.1| hypothetical protein B456_010G007100 [Gossypium raimondii]
Length=467

 Score =   131 bits (329),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/119 (55%), Positives = 80/119 (67%), Gaps = 3/119 (3%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            I NG  G+T  F R ++ S D+PLD+  F VP G NAPQQVHITQGD DG  VIISW+TP
Sbjct  24   ICNG--GITGNFVRKKY-SPDMPLDSDVFQVPSGYNAPQQVHITQGDMDGSGVIISWITP  80

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            DEPGS+ V Y      + + AEG +  Y F+NY SG+IH C +  LE++ KY YEIG G
Sbjct  81   DEPGSNMVYYWSENSNHKYKAEGIFVRYKFFNYTSGYIHHCTINNLEYNTKYMYEIGRG  139



>ref|XP_004148530.1| PREDICTED: purple acid phosphatase 2-like [Cucumis sativus]
 ref|XP_004165228.1| PREDICTED: purple acid phosphatase 2-like [Cucumis sativus]
Length=477

 Score =   131 bits (329),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/119 (55%), Positives = 81/119 (68%), Gaps = 0/119 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            +E    G T  F R    +VD+PLD+  FAVP G NAPQQVHITQGD++GKAVI+SWVTP
Sbjct  31   VEVCYGGKTGQFMRKVEKTVDMPLDSDVFAVPPGFNAPQQVHITQGDHEGKAVIVSWVTP  90

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            ++PGS++V Y   + K    A G    Y FYNY SG+IH C +  L++D KYYYEIG G
Sbjct  91   NKPGSNEVLYWSEKSKEKKQAFGKVYTYKFYNYTSGYIHHCTIKNLKYDTKYYYEIGIG  149



>ref|XP_010690820.1| PREDICTED: purple acid phosphatase 2-like isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=469

 Score =   131 bits (329),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 79/116 (68%), Gaps = 0/116 (0%)
 Frame = +2

Query  182  GSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDEP  361
             +AG +S F R    SVD+PLD+  F  P G NAPQQVHITQGD++GK VI+SWVTP  P
Sbjct  28   SNAGKSSSFVRKVEKSVDMPLDSDVFRPPPGHNAPQQVHITQGDHEGKGVIVSWVTPISP  87

Query  362  GSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            GSS V Y     K+ + A+G  T Y +YNY SG+IH C +  LE++ KYYY++G G
Sbjct  88   GSSSVVYWSGSSKHKYKAKGIVTKYKYYNYTSGYIHHCTIRNLEYNTKYYYKVGTG  143



>ref|XP_010510800.1| PREDICTED: fe(3+)-Zn(2+) purple acid phosphatase 12-like [Camelina 
sativa]
Length=470

 Score =   130 bits (328),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/119 (54%), Positives = 77/119 (65%), Gaps = 0/119 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            +E    G TS + R      D+PLD+  F VP GPN PQQVHITQG+++G  VI+SWVTP
Sbjct  24   VELCHGGFTSEYVRGTDLPDDMPLDSDVFTVPPGPNTPQQVHITQGNHEGNGVIVSWVTP  83

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
             +PGS+ VRY     K    AE T   Y F+NY SGFIH CL+  LE D KYYYEIG+G
Sbjct  84   IKPGSNTVRYWCENEKTKKEAEATVNTYRFFNYTSGFIHHCLIDDLEFDTKYYYEIGSG  142



>gb|ABV89741.1| purple acid phosphatase 12 protein family isoform 2 [Brassica 
napus]
 gb|ABV89742.1| purple acid phosphatase 12 protein family isoform 2 [Brassica 
napus]
Length=469

 Score =   130 bits (328),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/119 (54%), Positives = 77/119 (65%), Gaps = 0/119 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            +E    G+TS + R      D+PLD+  F VP GPN PQQVHITQG+++G  VIISWVTP
Sbjct  23   VELCDGGITSEYVRGSDLPDDMPLDSDVFKVPPGPNTPQQVHITQGNHEGNGVIISWVTP  82

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
              P S+ VRY    GK    AE T   Y F+NY SG+IH CL+  LE D KYYYEIG+G
Sbjct  83   SAPCSNTVRYWSENGKSKKLAEATMNTYRFFNYTSGYIHHCLIDDLEFDMKYYYEIGSG  141



>ref|XP_004152670.1| PREDICTED: purple acid phosphatase 2-like [Cucumis sativus]
 gb|KGN62641.1| hypothetical protein Csa_2G363020 [Cucumis sativus]
Length=477

 Score =   130 bits (328),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 81/113 (72%), Gaps = 0/113 (0%)
 Frame = +2

Query  191  GMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDEPGSS  370
            G+TSGF R +  S+D+PLD+  F  P G NAPQQVHITQGD +GK+VIISWVTPD+PGS+
Sbjct  29   GITSGFVRDDDASLDMPLDSDVFRPPPGKNAPQQVHITQGDSEGKSVIISWVTPDKPGSN  88

Query  371  QVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            +V Y          AEG +T+Y ++NY SG+IH C +  LE+D KY+Y IG G
Sbjct  89   RVVYWAENSGIRNHAEGYFTSYKYFNYTSGYIHHCTIENLEYDTKYFYVIGFG  141



>gb|ABV89739.1| purple acid phosphatase 12 protein family isoform 1 [Brassica 
napus]
 gb|ABV89740.1| purple acid phosphatase 12 protein family isoform 1 [Brassica 
napus]
Length=469

 Score =   130 bits (328),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/119 (54%), Positives = 77/119 (65%), Gaps = 0/119 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            +E    G+TS + R      D+PLD+  F VP GPN PQQVHITQG+++G  VIISWVTP
Sbjct  23   VELCDGGITSEYVRGSDLPDDMPLDSDVFKVPPGPNTPQQVHITQGNHEGNGVIISWVTP  82

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
              P S+ VRY    GK    AE T   Y F+NY SG+IH CL+  LE D KYYYEIG+G
Sbjct  83   SAPCSNTVRYWSENGKSKKQAEATMNTYRFFNYTSGYIHHCLIDDLEFDMKYYYEIGSG  141



>gb|ABV89757.1| purple acid phosphatase 12 protein family isoform 7 [Brassica 
napus]
 gb|ABV89759.1| purple acid phosphatase 12 protein family isoform 7 [Brassica 
napus]
Length=469

 Score =   130 bits (328),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/119 (54%), Positives = 77/119 (65%), Gaps = 0/119 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            +E    G+TS + R      D+PLD+  F VP GPN PQQVHITQG+++G  VIISWVTP
Sbjct  23   VELCDGGITSEYVRGSDLPDDMPLDSDVFKVPPGPNTPQQVHITQGNHEGNGVIISWVTP  82

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
              P S+ VRY    GK    AE T   Y F+NY SG+IH CL+  LE D KYYYEIG+G
Sbjct  83   SAPCSNTVRYWSENGKSKKQAEATMNTYRFFNYTSGYIHHCLIDDLEFDMKYYYEIGSG  141



>gb|ABV89751.1| purple acid phosphatase 12 protein family isoform 5 premature 
2 [Brassica napus]
 gb|ABV89754.1| purple acid phosphatase 12 protein family isoform 5 premature 
2 [Brassica napus]
Length=246

 Score =   127 bits (319),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 76/119 (64%), Gaps = 0/119 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            +E    G+TS + R      D+PLD+  F VP G N PQQVHITQG+++G  VIISWVTP
Sbjct  23   VELCDGGITSEYVRGSDLPDDMPLDSDVFKVPPGRNTPQQVHITQGNHEGNGVIISWVTP  82

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
              P S+ VRY    GK    AE T   Y F+NY SG+IH CL+  LE D KYYYEIG+G
Sbjct  83   SAPCSNTVRYWSENGKSKKLAEATMNTYRFFNYTSGYIHHCLIDDLEFDMKYYYEIGSG  141



>ref|XP_011048850.1| PREDICTED: purple acid phosphatase 2-like isoform X2 [Populus 
euphratica]
Length=372

 Score =   129 bits (325),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/119 (54%), Positives = 82/119 (69%), Gaps = 2/119 (2%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            I NG  G+TS + R++  S+D+PLD+  F VP G NAPQQVHITQGD++GK VI+SWVTP
Sbjct  23   IVNG--GITSSYVRNDDLSLDMPLDSDVFRVPPGYNAPQQVHITQGDHEGKGVIVSWVTP  80

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            DEPGS  V Y     +   +A+G    Y ++NY SG+IH C +  LE D KYYYE+G G
Sbjct  81   DEPGSKTVLYWAENSELKNSADGFILKYRYFNYTSGYIHHCTIKDLEFDTKYYYEVGIG  139



>gb|KHG20719.1| Purple acid phosphatase 2 [Gossypium arboreum]
Length=467

 Score =   130 bits (327),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 78/118 (66%), Gaps = 1/118 (1%)
 Frame = +2

Query  176  ENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPD  355
            E  + G+T  F R E+ S D+PLD+  F VP G NAPQQVHITQGD DG+ VIISW+TPD
Sbjct  23   ELCNGGITGNFLRKEY-SPDMPLDSDVFQVPPGYNAPQQVHITQGDTDGRGVIISWITPD  81

Query  356  EPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            EPGS  V Y     K    AEG +  Y F+NY SG+IH C +  LE++ KY YEIG G
Sbjct  82   EPGSDTVLYWSENSKNKNRAEGIFVRYKFFNYTSGYIHHCTIKNLEYNTKYMYEIGIG  139



>gb|KJB58169.1| hypothetical protein B456_009G197600 [Gossypium raimondii]
Length=371

 Score =   129 bits (325),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 78/118 (66%), Gaps = 0/118 (0%)
 Frame = +2

Query  176  ENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPD  355
            E  + G TS F R+   S D+PLD+  F VP G NAPQQVHITQGD+ G AVI+SWVTPD
Sbjct  25   EVCNGGRTSSFVRNSDLSRDMPLDSDVFRVPPGYNAPQQVHITQGDHLGNAVIVSWVTPD  84

Query  356  EPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            EPGS+ V Y     +   +A+G    Y ++NY SGFIH C V  LE D KYYYE+G G
Sbjct  85   EPGSNSVFYWAENSELKNSAQGIVLTYKYFNYTSGFIHHCTVRDLEFDTKYYYEVGIG  142



>ref|XP_002307690.1| Iron(III)-zinc(II) purple acid phosphatase precursor family protein 
[Populus trichocarpa]
 gb|EEE94686.1| Iron(III)-zinc(II) purple acid phosphatase precursor family protein 
[Populus trichocarpa]
Length=467

 Score =   130 bits (327),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 81/118 (69%), Gaps = 0/118 (0%)
 Frame = +2

Query  176  ENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPD  355
            E  + G+TS + R++  S+D+PLD+  F VP G NAPQQVHITQGD++GK VI+SWVTPD
Sbjct  22   EIANGGITSSYVRNDDLSLDMPLDSDVFRVPPGYNAPQQVHITQGDHEGKGVIVSWVTPD  81

Query  356  EPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            EPGS  V Y     +   +A+G    Y ++NY SG+IH C +  LE D KYYYE+G G
Sbjct  82   EPGSKTVLYWAENSELKNSADGFILKYRYFNYTSGYIHHCTIKDLEFDTKYYYEVGIG  139



>ref|XP_002280883.1| PREDICTED: purple acid phosphatase 2 isoform X1 [Vitis vinifera]
 ref|XP_010664743.1| PREDICTED: purple acid phosphatase 2 isoform X1 [Vitis vinifera]
 ref|XP_010664744.1| PREDICTED: purple acid phosphatase 2 isoform X1 [Vitis vinifera]
 ref|XP_010664745.1| PREDICTED: purple acid phosphatase 2 isoform X1 [Vitis vinifera]
 ref|XP_010664746.1| PREDICTED: purple acid phosphatase 2 isoform X1 [Vitis vinifera]
 ref|XP_010664747.1| PREDICTED: purple acid phosphatase 2 isoform X1 [Vitis vinifera]
 ref|XP_010664748.1| PREDICTED: purple acid phosphatase 2 isoform X1 [Vitis vinifera]
 ref|XP_010664749.1| PREDICTED: purple acid phosphatase 2 isoform X1 [Vitis vinifera]
 ref|XP_010664751.1| PREDICTED: purple acid phosphatase 2 isoform X1 [Vitis vinifera]
 ref|XP_010664752.1| PREDICTED: purple acid phosphatase 2 isoform X1 [Vitis vinifera]
 emb|CBI19778.3| unnamed protein product [Vitis vinifera]
Length=468

 Score =   130 bits (327),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 76/113 (67%), Gaps = 0/113 (0%)
 Frame = +2

Query  191  GMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDEPGSS  370
            G+TS F R+   S D+PLD+  F VP G NAPQQVHITQGDY+G AVIISW+TPDEPGS+
Sbjct  27   GVTSSFARTNNISADMPLDSDVFRVPPGYNAPQQVHITQGDYEGNAVIISWITPDEPGSN  86

Query  371  QVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
             V Y    GK+   A G    Y ++ Y SG+IH C +  L  D KYYYE+G G
Sbjct  87   TVLYWAENGKHKSHANGIVLTYKYFKYTSGYIHHCTIRNLVFDTKYYYEVGIG  139



>ref|XP_007017664.1| Purple acid phosphatase 12 isoform 1 [Theobroma cacao]
 gb|EOY14889.1| Purple acid phosphatase 12 isoform 1 [Theobroma cacao]
Length=465

 Score =   130 bits (327),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 78/118 (66%), Gaps = 0/118 (0%)
 Frame = +2

Query  176  ENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPD  355
            E  + G TS F R++  S D+PLD+  F +P G NAPQQVHITQGD+ GK VI+SWVTPD
Sbjct  24   EVCNGGKTSSFVRNDQLSHDMPLDSDVFRIPPGYNAPQQVHITQGDHLGKGVIVSWVTPD  83

Query  356  EPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            EPGS+ V Y     +    AEG    Y ++NY SG+IH C +  LE D KYYYE+G G
Sbjct  84   EPGSNLVLYWAENSELKHQAEGIVLTYKYFNYTSGYIHHCTITNLESDTKYYYEVGIG  141



>gb|ABV89743.1| purple acid phosphatase 12 protein family isoform 3 [Brassica 
napus]
 gb|ABV89744.1| purple acid phosphatase 12 protein family isoform 3 [Brassica 
napus]
 emb|CDX77047.1| BnaC04g38420D [Brassica napus]
Length=469

 Score =   130 bits (326),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 64/119 (54%), Positives = 77/119 (65%), Gaps = 0/119 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            +E    G+TS + R      D+PLD+  F V  GPN PQQVHITQG+++G  VIISWVTP
Sbjct  23   VELCDGGITSEYVRGSDLPDDMPLDSDVFKVSPGPNTPQQVHITQGNHEGNGVIISWVTP  82

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
              PGS+ VRY    GK    AE T   Y F+NY SG+IH CL+  LE D KYYYEIG+G
Sbjct  83   SAPGSNTVRYWSENGKSKKLAEATMNTYRFFNYTSGYIHHCLIDDLEFDMKYYYEIGSG  141



>ref|XP_002280873.1| PREDICTED: purple acid phosphatase 2 [Vitis vinifera]
 emb|CAN60822.1| hypothetical protein VITISV_037054 [Vitis vinifera]
 emb|CBI19779.3| unnamed protein product [Vitis vinifera]
Length=467

 Score =   130 bits (326),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 76/113 (67%), Gaps = 0/113 (0%)
 Frame = +2

Query  191  GMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDEPGSS  370
            G+TS F R++  S D+PLD+  F VP G NAPQQVHITQGDY+G AV++SW TPDEPGSS
Sbjct  27   GVTSSFVRTKNISADMPLDSDVFQVPPGYNAPQQVHITQGDYEGNAVLVSWTTPDEPGSS  86

Query  371  QVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
             V Y     K    A+G    Y ++NY SG+IH C +  L  D KYYYE+G G
Sbjct  87   TVLYWAENSKTKSHAKGIVLTYKYFNYTSGYIHHCTIKNLTFDTKYYYEVGIG  139



>gb|KJB58170.1| hypothetical protein B456_009G197600 [Gossypium raimondii]
Length=410

 Score =   129 bits (325),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 78/118 (66%), Gaps = 0/118 (0%)
 Frame = +2

Query  176  ENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPD  355
            E  + G TS F R+   S D+PLD+  F VP G NAPQQVHITQGD+ G AVI+SWVTPD
Sbjct  25   EVCNGGRTSSFVRNSDLSRDMPLDSDVFRVPPGYNAPQQVHITQGDHLGNAVIVSWVTPD  84

Query  356  EPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            EPGS+ V Y     +   +A+G    Y ++NY SGFIH C V  LE D KYYYE+G G
Sbjct  85   EPGSNSVFYWAENSELKNSAQGIVLTYKYFNYTSGFIHHCTVRDLEFDTKYYYEVGIG  142



>ref|XP_009777042.1| PREDICTED: purple acid phosphatase 2 isoform X2 [Nicotiana sylvestris]
Length=470

 Score =   130 bits (326),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 78/113 (69%), Gaps = 0/113 (0%)
 Frame = +2

Query  191  GMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDEPGSS  370
            G+TS F R    +VD+PLD+  F  P G NAPQQVHITQGD++GKAVI+SWVT DEPGSS
Sbjct  30   GVTSSFIRKVEKTVDMPLDSDVFRAPPGYNAPQQVHITQGDHEGKAVIVSWVTMDEPGSS  89

Query  371  QVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
             V Y   + K   TA+G  T Y FYNY SG+IH   +  LE + KYYY+IG G
Sbjct  90   TVLYWSEKSKQKNTAKGKVTTYKFYNYTSGYIHHSTIRHLEFNTKYYYKIGVG  142



>ref|XP_010417871.1| PREDICTED: fe(3+)-Zn(2+) purple acid phosphatase 12 [Camelina 
sativa]
Length=470

 Score =   130 bits (326),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 64/119 (54%), Positives = 77/119 (65%), Gaps = 0/119 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            +E    G TS + R      D+PLD+  F VP GPN PQQVHITQG+++G  VIISWVTP
Sbjct  24   VELCHGGFTSEYVRGTDLPDDMPLDSDVFTVPPGPNTPQQVHITQGNHEGNGVIISWVTP  83

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
             +PGS+ VRY     K    AE T   Y F+NY SG+IH CL+  LE D KYYYEIG+G
Sbjct  84   VKPGSNTVRYWCENEKTKKEAEATVNTYRFFNYTSGYIHHCLIDDLEFDTKYYYEIGSG  142



>ref|XP_009777041.1| PREDICTED: purple acid phosphatase 2 isoform X1 [Nicotiana sylvestris]
Length=471

 Score =   130 bits (326),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 78/113 (69%), Gaps = 0/113 (0%)
 Frame = +2

Query  191  GMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDEPGSS  370
            G+TS F R    +VD+PLD+  F  P G NAPQQVHITQGD++GKAVI+SWVT DEPGSS
Sbjct  30   GVTSSFIRKVEKTVDMPLDSDVFRAPPGYNAPQQVHITQGDHEGKAVIVSWVTMDEPGSS  89

Query  371  QVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
             V Y   + K   TA+G  T Y FYNY SG+IH   +  LE + KYYY+IG G
Sbjct  90   TVLYWSEKSKQKNTAKGKVTTYKFYNYTSGYIHHSTIRHLEFNTKYYYKIGVG  142



>ref|XP_004172093.1| PREDICTED: purple acid phosphatase 2-like [Cucumis sativus]
Length=477

 Score =   130 bits (326),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 81/113 (72%), Gaps = 0/113 (0%)
 Frame = +2

Query  191  GMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDEPGSS  370
            G+TSGF R +  S+D+PLD+  F  P G NAPQQVHITQGD +GK+VIISWVTPD+PGS+
Sbjct  29   GITSGFVRDDDASLDMPLDSDVFRPPPGKNAPQQVHITQGDSEGKSVIISWVTPDKPGSN  88

Query  371  QVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            +V Y          AEG +T+Y ++NY SG+IH C +  LE+D KY+Y IG G
Sbjct  89   RVVYWDENSGIRNHAEGYFTSYKYFNYTSGYIHHCTIENLEYDSKYFYVIGFG  141



>ref|XP_011083627.1| PREDICTED: purple acid phosphatase 2-like [Sesamum indicum]
Length=469

 Score =   129 bits (325),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 61/114 (54%), Positives = 79/114 (69%), Gaps = 0/114 (0%)
 Frame = +2

Query  188  AGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDEPGS  367
            AG+TS + R+   S D+PLD+  F  P G NAPQQ HITQGD++GK VI+SW+TPDEPGS
Sbjct  28   AGLTSSYVRNNGLSQDMPLDSDVFKEPPGYNAPQQGHITQGDHEGKGVIVSWITPDEPGS  87

Query  368  SQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            + V Y  +  +   TA G    YT+YNY SG+IH C +  L++D KYYYE+G G
Sbjct  88   NSVLYWPANSRIKKTAHGVVVKYTYYNYTSGYIHHCTIKNLDYDTKYYYELGAG  141



>ref|XP_002874764.1| secreted purple acid phosphatase precursor [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH51023.1| secreted purple acid phosphatase precursor [Arabidopsis lyrata 
subsp. lyrata]
Length=469

 Score =   129 bits (325),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 80/119 (67%), Gaps = 0/119 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            +E    G+TS + R+     D+PLD+  FA+P GPN+PQQVH+TQG+++G  VIISWVTP
Sbjct  23   VELCHGGITSEYVRASDLPDDMPLDSDVFALPPGPNSPQQVHVTQGNHEGNGVIISWVTP  82

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
             +PGS+ V Y     K     EGT   Y F+NY SG+IH CL+  LE D KYYYEIG+G
Sbjct  83   VKPGSNTVHYWFENEKSKKQEEGTVNTYRFFNYTSGYIHHCLIDDLEFDTKYYYEIGSG  141



>gb|KJB58167.1| hypothetical protein B456_009G197600 [Gossypium raimondii]
Length=474

 Score =   129 bits (325),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 78/118 (66%), Gaps = 0/118 (0%)
 Frame = +2

Query  176  ENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPD  355
            E  + G TS F R+   S D+PLD+  F VP G NAPQQVHITQGD+ G AVI+SWVTPD
Sbjct  25   EVCNGGRTSSFVRNSDLSRDMPLDSDVFRVPPGYNAPQQVHITQGDHLGNAVIVSWVTPD  84

Query  356  EPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            EPGS+ V Y     +   +A+G    Y ++NY SGFIH C V  LE D KYYYE+G G
Sbjct  85   EPGSNSVFYWAENSELKNSAQGIVLTYKYFNYTSGFIHHCTVRDLEFDTKYYYEVGIG  142



>ref|XP_009335656.1| PREDICTED: purple acid phosphatase 2 [Pyrus x bretschneideri]
Length=531

 Score =   130 bits (326),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 63/120 (53%), Positives = 82/120 (68%), Gaps = 1/120 (1%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            +E    G+TS + R++  S+D+PLD+  F VP G NAPQQVHITQGD++GK VI+SWVTP
Sbjct  83   LEVCDGGITSSYVRNDDLSLDMPLDSDVFRVPPGYNAPQQVHITQGDHEGKGVIVSWVTP  142

Query  353  DEPGSSQVRY-GLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            DEPGSS V Y   +      +A+ T   Y ++NY SG+IH C +  LE D KYYYE+G G
Sbjct  143  DEPGSSTVIYWAENNTSLKKSAQATVLTYKYFNYTSGYIHHCTIDNLEFDTKYYYEVGTG  202



>ref|XP_011048849.1| PREDICTED: purple acid phosphatase 2-like isoform X1 [Populus 
euphratica]
Length=467

 Score =   129 bits (325),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 64/119 (54%), Positives = 82/119 (69%), Gaps = 2/119 (2%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            I NG  G+TS + R++  S+D+PLD+  F VP G NAPQQVHITQGD++GK VI+SWVTP
Sbjct  23   IVNG--GITSSYVRNDDLSLDMPLDSDVFRVPPGYNAPQQVHITQGDHEGKGVIVSWVTP  80

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            DEPGS  V Y     +   +A+G    Y ++NY SG+IH C +  LE D KYYYE+G G
Sbjct  81   DEPGSKTVLYWAENSELKNSADGFILKYRYFNYTSGYIHHCTIKDLEFDTKYYYEVGIG  139



>gb|KHG11060.1| Purple acid phosphatase 2 [Gossypium arboreum]
Length=467

 Score =   129 bits (325),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 65/119 (55%), Positives = 79/119 (66%), Gaps = 3/119 (3%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            I NG  G+T  F R ++ S D+PLD+  F VP G NAPQQVHITQGD DG  VIISW+TP
Sbjct  24   ISNG--GITGNFVRKKY-SPDMPLDSDVFQVPSGYNAPQQVHITQGDMDGSGVIISWITP  80

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            DEPGS+ V Y      +   AEG +  Y F+NY SG+IH C +  LE++ KY YEIG G
Sbjct  81   DEPGSNMVYYWPENSNHKNKAEGIFVRYKFFNYTSGYIHHCTINNLEYNTKYIYEIGRG  139



>gb|AET86953.1| PAP1 [Gossypium hirsutum]
Length=481

 Score =   129 bits (325),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 78/118 (66%), Gaps = 0/118 (0%)
 Frame = +2

Query  176  ENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPD  355
            E  + G TS F R+   S D+PLD+  F VP G NAPQQVHITQGD+ G AVI+SWVTPD
Sbjct  25   EVCNGGRTSSFVRNSDLSRDMPLDSDVFRVPPGYNAPQQVHITQGDHLGNAVIVSWVTPD  84

Query  356  EPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            EPGS+ V Y     +   +A+G    Y ++NY SGFIH C +  LE D KYYYE+G G
Sbjct  85   EPGSNSVFYWAENSELKNSAQGIVLTYKYFNYTSGFIHHCTIRDLEFDTKYYYEVGIG  142



>emb|CDY48179.1| BnaA04g15430D [Brassica napus]
Length=469

 Score =   129 bits (324),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 76/119 (64%), Gaps = 0/119 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            +E    G+TS + R      D+PLD+  F VP GPN PQQVHITQG+++G  VIISWVTP
Sbjct  23   VELCDGGITSEYVRGSDLPDDMPLDSDVFKVPPGPNTPQQVHITQGNHEGNGVIISWVTP  82

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
              P S+ VRY    GK    AE T   Y F+NY SG+IH C +  LE D KYYYEIG+G
Sbjct  83   SAPCSNTVRYWSENGKSKKLAEATMNTYRFFNYTSGYIHHCFIDDLEFDMKYYYEIGSG  141



>gb|KHG20720.1| Purple acid phosphatase 2 [Gossypium arboreum]
Length=474

 Score =   129 bits (324),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 78/118 (66%), Gaps = 0/118 (0%)
 Frame = +2

Query  176  ENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPD  355
            E  + G TS F R+   S D+PLD+  F VP G NAPQQVHITQGD+ G AVI+SWVTPD
Sbjct  25   EVCNGGRTSSFVRNSDLSRDMPLDSDVFRVPPGYNAPQQVHITQGDHLGNAVIVSWVTPD  84

Query  356  EPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            EPGS+ V Y     +   +A+G    Y ++NY SGFIH C +  LE D KYYYE+G G
Sbjct  85   EPGSNSVFYWAENSELKNSAQGIVLTYKYFNYTSGFIHHCTIRDLEFDTKYYYEVGIG  142



>gb|AAA91803.1| secreted purple acid phosphatase precursor [Arabidopsis thaliana]
Length=469

 Score =   129 bits (323),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 77/119 (65%), Gaps = 0/119 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            +E    G TS + R      D+PLD+  F VP GPN+PQQVH+TQG+++G  VIISWVTP
Sbjct  23   VEFCYGGFTSEYVRGSDLPDDMPLDSDVFEVPPGPNSPQQVHVTQGNHEGNGVIISWVTP  82

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
             +PGS  VRY     K    AE T   Y F+NY SG+IH CL+  LE D KYYYEIG+G
Sbjct  83   VKPGSKTVRYWCENKKSRKQAEATVNTYRFFNYTSGYIHHCLIDDLEFDTKYYYEIGSG  141



>emb|CDY48178.1| BnaA04g15420D [Brassica napus]
Length=481

 Score =   129 bits (324),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 79/124 (64%), Gaps = 6/124 (5%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSE------WPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVI  334
            +E    G+TSG+ RS       +   D+PLD+  F VP GPN PQQVHITQG+++G  VI
Sbjct  23   VELCDGGITSGYVRSRRGRSDVFVPDDMPLDSDVFKVPPGPNTPQQVHITQGNHEGNGVI  82

Query  335  ISWVTPDEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYY  514
            ISWVTP  P S+ VRY    GK    AE T   Y F+NY SG+IH CL+  LE D KYYY
Sbjct  83   ISWVTPSAPCSNTVRYWSENGKSKKLAEATINTYRFFNYTSGYIHHCLIDDLEFDMKYYY  142

Query  515  EIGN  526
            EIG+
Sbjct  143  EIGS  146



>gb|AAT37527.1| purple acid phosphatase 2 [Solanum tuberosum]
Length=447

 Score =   129 bits (323),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 65/115 (57%), Positives = 77/115 (67%), Gaps = 0/115 (0%)
 Frame = +2

Query  185  SAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDEPG  364
            S  +TS F R    ++D+PLD+  F VP G NAPQQVHITQGD+ GKAVI+SWVT DEPG
Sbjct  5    SGEVTSSFVRKIEKTIDMPLDSDVFRVPPGYNAPQQVHITQGDHVGKAVIVSWVTMDEPG  64

Query  365  SSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            SS V Y   + K    A G  T Y FYNY SG+IH C +  L+ D KYYY+IG G
Sbjct  65   SSTVVYWSEKSKLKNKANGKVTTYKFYNYTSGYIHHCNIKNLKFDTKYYYKIGIG  119



>dbj|BAC55157.1| purple acid phosphatase [Nicotiana tabacum]
Length=470

 Score =   129 bits (323),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 78/113 (69%), Gaps = 0/113 (0%)
 Frame = +2

Query  191  GMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDEPGSS  370
            G TS F R    ++D+P+D+  F+VP G NAPQQVHITQGD+ GKA+I+SWVT DEPGSS
Sbjct  30   GTTSSFVRKVEKTIDMPMDSDVFSVPPGYNAPQQVHITQGDHVGKAMIVSWVTMDEPGSS  89

Query  371  QVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
             V Y  +  K    A G  T Y FYNY SG+IH C++  L+ + KYYYE+G G
Sbjct  90   TVLYWSNNSKQKNKATGAVTTYRFYNYTSGYIHHCIIKHLKFNTKYYYEVGIG  142



>gb|ABQ50886.1| purple acid phosphatase [Lolium multiflorum]
Length=396

 Score =   128 bits (321),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 78/114 (68%), Gaps = 0/114 (0%)
 Frame = +2

Query  188  AGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDEPGS  367
            AG TS + R    ++D+P+D   F  P G NAPQQVHITQGD+DG A+IISWVT  EPGS
Sbjct  25   AGQTSEYRRQLGQAMDMPIDADVFRPPPGRNAPQQVHITQGDHDGTAMIISWVTTIEPGS  84

Query  368  SQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            S V YG SE   + +A+G +T YTFYNY SG+IH   +  LE D KYYY +G G
Sbjct  85   STVLYGASEDSLNCSAKGKHTQYTFYNYTSGYIHHSTIKKLEFDTKYYYAVGTG  138



>ref|XP_009610724.1| PREDICTED: purple acid phosphatase 2-like [Nicotiana tomentosiformis]
Length=470

 Score =   129 bits (323),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 78/113 (69%), Gaps = 0/113 (0%)
 Frame = +2

Query  191  GMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDEPGSS  370
            G TS F R    ++D+P+D+  F+VP G NAPQQVHITQGD+ GKA+I+SWVT DEPGSS
Sbjct  30   GTTSSFVRKVEKTIDMPMDSDVFSVPPGYNAPQQVHITQGDHVGKAMIVSWVTMDEPGSS  89

Query  371  QVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
             V Y  +  K    A G  T Y FYNY SG+IH C++  L+ + KYYYE+G G
Sbjct  90   TVLYWSNNSKQKNKATGAVTTYRFYNYTSGYIHHCIIKHLKFNTKYYYEVGIG  142



>ref|XP_009140744.1| PREDICTED: fe(3+)-Zn(2+) purple acid phosphatase 12 [Brassica 
rapa]
Length=469

 Score =   128 bits (322),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 76/118 (64%), Gaps = 0/118 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            +E    G+TS + R      D+PLD+  F VP GPN PQQVHITQG+++G  VIISWVTP
Sbjct  23   VELCDGGITSEYVRGSDLPDDMPLDSDVFKVPPGPNTPQQVHITQGNHEGNGVIISWVTP  82

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGN  526
              P S+ VRY    GK    AE T   Y F+NY SG+IH CL+  LE D KYYYEIG+
Sbjct  83   SAPCSNTVRYWSENGKSKKLAEATMNTYRFFNYTSGYIHHCLIDDLEFDMKYYYEIGS  140



>ref|XP_007222938.1| hypothetical protein PRUPE_ppa005293mg [Prunus persica]
 gb|EMJ24137.1| hypothetical protein PRUPE_ppa005293mg [Prunus persica]
Length=468

 Score =   128 bits (322),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 64/121 (53%), Positives = 84/121 (69%), Gaps = 3/121 (2%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            +E    G+TS + R++  S+D+PLD+  F VP G NAPQQVHITQGD++G+ VI+SWVTP
Sbjct  21   LEVCEGGITSSYVRNDDLSLDMPLDSDVFQVPPGYNAPQQVHITQGDHEGRGVIVSWVTP  80

Query  353  DEPGSSQVRYGLSEGKYDFT--AEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGN  526
            DEPGSS V Y  +E   +    A+GT   Y ++NY SG+IH C +  LE D KYYYE+G 
Sbjct  81   DEPGSSTVLY-WAENNTNLKNQAQGTLLTYHYFNYISGYIHHCTIHNLEFDTKYYYEVGI  139

Query  527  G  529
            G
Sbjct  140  G  140



>ref|XP_004970155.1| PREDICTED: purple acid phosphatase 2-like [Setaria italica]
Length=475

 Score =   128 bits (322),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 63/111 (57%), Positives = 76/111 (68%), Gaps = 0/111 (0%)
 Frame = +2

Query  197  TSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDEPGSSQV  376
            TS + R    ++D+PLD   F  P G NAP+QVHITQG++DG A+IISWVT  EPGSS V
Sbjct  38   TSEYRRHLGSAIDMPLDADVFRPPPGQNAPEQVHITQGNHDGTAMIISWVTTSEPGSSTV  97

Query  377  RYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
             YG SE   ++TA G  T YTFYNY SG+IH C +  LE D KYYY +G G
Sbjct  98   VYGTSEDNLNYTANGKNTQYTFYNYTSGYIHHCTIKKLEFDTKYYYAVGIG  148



>gb|KDP41744.1| hypothetical protein JCGZ_26762 [Jatropha curcas]
Length=466

 Score =   128 bits (322),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 75/111 (68%), Gaps = 1/111 (1%)
 Frame = +2

Query  191  GMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDEPGSS  370
            G TS F R    +VD+PLD+  F VP G NAPQQVHITQGD+DGKAVI+SWVT DEPGSS
Sbjct  27   GKTSSFVRPVEKTVDMPLDSDVFRVPSGDNAPQQVHITQGDHDGKAVIVSWVT-DEPGSS  85

Query  371  QVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIG  523
             V Y          A+G Y  Y FYNY SG+IH C +  LE++ KYYY +G
Sbjct  86   NVLYWRENSTNKKIAKGKYNTYRFYNYNSGYIHHCTIRNLEYNTKYYYLVG  136



>gb|AAX20028.1| purple acid phosphatase [Medicago truncatula]
 gb|KEH29467.1| purple acid phosphatase superfamily protein [Medicago truncatula]
Length=465

 Score =   128 bits (321),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 76/113 (67%), Gaps = 0/113 (0%)
 Frame = +2

Query  191  GMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDEPGSS  370
            G TS F R    ++D+PLD+  F VP G NAPQQVHITQGD+ GKAVI+SWVT DEPGS+
Sbjct  24   GRTSTFVRKVEKTIDMPLDSDVFDVPSGYNAPQQVHITQGDHVGKAVIVSWVTEDEPGSN  83

Query  371  QVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
             VRY     K    A+G    Y F+NY SGFIH   +  LE++ KYYYE+G G
Sbjct  84   AVRYWSKNSKQKRLAKGKIVTYRFFNYTSGFIHHTTIRNLEYNTKYYYEVGLG  136



>dbj|BAC55155.1| purple acid phosphatase [Nicotiana tabacum]
Length=470

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 77/113 (68%), Gaps = 0/113 (0%)
 Frame = +2

Query  191  GMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDEPGSS  370
            G+TS F R    +VD+PLD+  F  P G NAPQQVHITQGD++GK VI+SWVT DEPGSS
Sbjct  30   GVTSSFIRKVEKTVDMPLDSDVFRAPPGYNAPQQVHITQGDHEGKTVIVSWVTMDEPGSS  89

Query  371  QVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
             V Y   + K   TA+G  T Y FYNY SG+IH   +  LE + KYYY+IG G
Sbjct  90   TVLYWSEKSKQKNTAKGKVTTYKFYNYTSGYIHHSTIRHLEFNTKYYYKIGVG  142



>gb|AGL44395.1| calcineurin-like phosphoesterase [Manihot esculenta]
Length=533

 Score =   128 bits (322),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 78/118 (66%), Gaps = 0/118 (0%)
 Frame = +2

Query  176  ENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPD  355
            E  S G+TS + R++  S D+PLD+  FAVP G NAPQQVHITQGDY+G +VIISWVTPD
Sbjct  81   EISSGGLTSSYVRNDEASEDMPLDSDVFAVPPGYNAPQQVHITQGDYEGNSVIISWVTPD  140

Query  356  EPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            EPGS +V Y          A+  +  Y +YNY SG+IH C +  LE D KY Y +G G
Sbjct  141  EPGSDEVLYWPDNSGLRIIAKSFHVRYKYYNYTSGYIHHCPIKNLEFDTKYNYVVGIG  198



>dbj|BAJ53173.1| JHL18I08.7 [Jatropha curcas]
 gb|KDP38574.1| hypothetical protein JCGZ_04499 [Jatropha curcas]
Length=471

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 76/111 (68%), Gaps = 0/111 (0%)
 Frame = +2

Query  197  TSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDEPGSSQV  376
            TS F R++  S+D+PLD+  F VP G NAPQQVHITQGDY+  +VI+SWVTPDEPGSS V
Sbjct  33   TSSFVRTDNLSLDMPLDSDVFRVPPGYNAPQQVHITQGDYEANSVIVSWVTPDEPGSSSV  92

Query  377  RYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            +Y     +   + EG    Y ++NY SG+IH C +  LE D KY Y++G G
Sbjct  93   QYWAENSEIKNSVEGLVVRYKYFNYTSGYIHHCTIKDLEFDTKYQYQVGTG  143



>ref|XP_002880886.1| secreted purple acid phosphatase precursor [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH57145.1| secreted purple acid phosphatase precursor [Arabidopsis lyrata 
subsp. lyrata]
Length=469

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 80/119 (67%), Gaps = 0/119 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            +E    G+TS + R+     D+PLD+  FA P GPN+PQQVH+TQG+++G  VIISWVTP
Sbjct  23   VELCHGGITSEYVRASDLPDDMPLDSDVFAFPPGPNSPQQVHLTQGNHEGNGVIISWVTP  82

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
             +PGS+ V Y     K    AEGT   Y F+NY SG+IH CL+  L+ D KYYYEIG+G
Sbjct  83   VKPGSNTVHYWSENEKSKKQAEGTVNTYRFFNYTSGYIHHCLINDLKFDTKYYYEIGSG  141



>ref|XP_010028627.1| PREDICTED: purple acid phosphatase 2-like [Eucalyptus grandis]
 gb|KCW55389.1| hypothetical protein EUGRSUZ_I01298 [Eucalyptus grandis]
Length=475

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 76/113 (67%), Gaps = 0/113 (0%)
 Frame = +2

Query  191  GMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDEPGSS  370
            G TS F R    +VD+PLD+  F VP G NAPQQVHITQGD+ GK VI+SWVTPDEPGSS
Sbjct  37   GKTSTFVRKVEKTVDMPLDSDVFRVPPGYNAPQQVHITQGDHVGKGVIVSWVTPDEPGSS  96

Query  371  QVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
             V Y     ++   A+G    Y FYNY SG+IH C +  L ++ KYYYE+G G
Sbjct  97   VVLYWSKNSEHKKKAKGKVNRYEFYNYTSGYIHHCTLNDLMYNTKYYYEVGIG  149



>ref|XP_008387992.1| PREDICTED: purple acid phosphatase 2-like [Malus domestica]
Length=531

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/120 (52%), Positives = 81/120 (68%), Gaps = 1/120 (1%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            +E    G+TS + R++  S+D+PLD+  F VP G N PQQVHITQGD++GK VI+SWVTP
Sbjct  83   LEVCDGGITSSYVRNDDLSLDMPLDSDVFQVPPGYNVPQQVHITQGDHEGKGVIVSWVTP  142

Query  353  DEPGSSQVRY-GLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            DEPGSS V Y   +      +A+ T   Y ++NY SG+IH C +  LE D KYYYE+G G
Sbjct  143  DEPGSSTVIYWAENNTSLKKSAQATVLTYKYFNYTSGYIHHCTIDNLEFDTKYYYEVGTG  202



>ref|XP_002264113.1| PREDICTED: purple acid phosphatase [Vitis vinifera]
Length=472

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 76/113 (67%), Gaps = 0/113 (0%)
 Frame = +2

Query  191  GMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDEPGSS  370
            G+TS F R    ++D+PLD+  F VP G NAPQQVHITQGD++G+ VI+SWVT DEPGS+
Sbjct  32   GITSSFVRKVEKTIDMPLDSDVFRVPLGYNAPQQVHITQGDHEGRGVIVSWVTVDEPGSN  91

Query  371  QVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
             V Y   + K    AEG    Y FYNY SG+IH C +  LE + KYYY +G G
Sbjct  92   TVLYWSEKSKRKNRAEGIMVTYKFYNYTSGYIHHCTIKNLEFNTKYYYVVGIG  144



>gb|EPS60513.1| hypothetical protein M569_14289, partial [Genlisea aurea]
Length=350

 Score =   127 bits (318),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 77/119 (65%), Gaps = 0/119 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            I+   AG TS + R +  S D+P ++ AF VP G NAPQQVHITQGD++G+AVI+SW+TP
Sbjct  11   IDESEAGFTSNYSRIDSVSGDLPFESDAFKVPPGYNAPQQVHITQGDHEGRAVIVSWITP  70

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
             EPGS+ V Y   +     TA G    Y FY Y SGFIH C +  L  D KYYYE+G G
Sbjct  71   SEPGSNSVLYWEEKNLIKKTASGIIRRYKFYTYTSGFIHHCNISDLNFDTKYYYELGTG  129



>ref|NP_001240926.1| uncharacterized protein LOC100807555 precursor [Glycine max]
 gb|ADM32496.1| phytase [Glycine max]
 gb|KHN32421.1| Purple acid phosphatase [Glycine soja]
Length=464

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 75/113 (66%), Gaps = 0/113 (0%)
 Frame = +2

Query  191  GMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDEPGSS  370
            G +S F R    +VD+PLD+  FA+P G NAPQQVHITQGD  GKAVI+SWVT DEPGSS
Sbjct  23   GTSSPFVRKVEKAVDMPLDSDVFAIPPGYNAPQQVHITQGDLVGKAVIVSWVTVDEPGSS  82

Query  371  QVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            +VRY           EG    Y F+NY SGFIH   +  LE++ KYYYE+G G
Sbjct  83   EVRYWSENSDQKKIVEGKLVTYRFFNYTSGFIHHTTIRNLEYNTKYYYEVGLG  135



>ref|XP_003564342.1| PREDICTED: purple acid phosphatase 2 [Brachypodium distachyon]
 ref|XP_010232421.1| PREDICTED: purple acid phosphatase 2 [Brachypodium distachyon]
Length=468

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 78/114 (68%), Gaps = 0/114 (0%)
 Frame = +2

Query  182  GSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDEP  361
            G AG TS + R    ++D+PLD   F  P G NAPQQVHITQG++DG A+IISWVT  EP
Sbjct  26   GHAGQTSEYQRQLGHAIDMPLDADVFRPPAGHNAPQQVHITQGNHDGTAMIISWVTTIEP  85

Query  362  GSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIG  523
            GSS V YG S+   + +A+G +T YTFYNY SG+IH   V  LE D KYYY +G
Sbjct  86   GSSTVLYGTSQDNLNCSAKGKHTQYTFYNYTSGYIHHSTVKNLEFDTKYYYAVG  139



>gb|ABV89753.1| purple acid phosphatase 12 protein family isoform 5 premature 
1 [Brassica napus]
Length=397

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 79/120 (66%), Gaps = 2/120 (2%)
 Frame = +2

Query  173  IENGSAGMTSGFFR-SEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVT  349
            +E    G+TS + R S+ P  D+PLD+  F VP G N PQQVHITQG+++G  VIISWVT
Sbjct  23   VELCDGGITSEYVRGSDLPD-DMPLDSDVFKVPPGRNTPQQVHITQGNHEGNGVIISWVT  81

Query  350  PDEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            P  P S+ VRY    GK    AE T   Y F+NY SG+IH CL+  LE D KYYYEIG+G
Sbjct  82   PSAPCSNTVRYWSENGKSKKLAEATMNTYRFFNYTSGYIHHCLIDDLEFDMKYYYEIGSG  141



>gb|ABV89750.1| purple acid phosphatase 12 protein family isoform 5 premature 
1 [Brassica napus]
Length=397

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 76/119 (64%), Gaps = 0/119 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            +E    G+TS + R      D+PLD+  F VP G N PQQVHITQG+++G  VIISWVTP
Sbjct  23   VELCDGGITSEYVRGSDLPDDMPLDSDVFKVPPGRNTPQQVHITQGNHEGNGVIISWVTP  82

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
              P S+ VRY    GK    AE T   Y F+NY SG+IH CL+  LE D KYYYEIG+G
Sbjct  83   SAPCSNTVRYWSENGKSKKLAEATMNTYRFFNYTSGYIHHCLIDDLEFDMKYYYEIGSG  141



>gb|EMT02488.1| Purple acid phosphatase 2 [Aegilops tauschii]
Length=463

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 79/119 (66%), Gaps = 0/119 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            ++  + G+TS + R    + D+PLD   FAVP G NAPQQVH+T GD  G A+ +SWVT 
Sbjct  22   VQAEARGVTSAYRRRLEAAEDMPLDADVFAVPPGHNAPQQVHVTLGDQAGTAMTVSWVTV  81

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            DE G+S V YG + G+ D  AEGT+T Y ++NY SGFIH C +  LEH  KYYY +G G
Sbjct  82   DEVGNSTVMYGRAMGRLDMAAEGTHTRYKYHNYTSGFIHHCTLTSLEHGTKYYYAMGFG  140



>ref|XP_002263937.1| PREDICTED: purple acid phosphatase [Vitis vinifera]
 emb|CBI38022.3| unnamed protein product [Vitis vinifera]
Length=472

 Score =   127 bits (320),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 75/113 (66%), Gaps = 0/113 (0%)
 Frame = +2

Query  191  GMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDEPGSS  370
            G+TS F R    ++D+PLD+  F VP G NAPQQVHITQGD++G+ VI+SWVT DEPGS+
Sbjct  32   GITSSFVRKVEKTIDMPLDSDVFRVPLGYNAPQQVHITQGDHEGRGVIVSWVTVDEPGSN  91

Query  371  QVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
             V Y     K    AEG    Y FYNY SG+IH C +  LE + KYYY +G G
Sbjct  92   TVLYWSENSKRKNRAEGIMVTYKFYNYTSGYIHHCTIKNLEFNTKYYYVVGIG  144



>gb|AAK51700.1|AF317218_1 secreted acid phosphatase [Lupinus albus]
 gb|AAK58416.1|AF309552_1 orthophosphoric monoester phosphohydrolase precursor [Lupinus 
albus]
Length=460

 Score =   127 bits (319),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 80/115 (70%), Gaps = 3/115 (3%)
 Frame = +2

Query  191  GMTSGFFRS--EWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDEPG  364
            G TS + R+  E P VD+PLD+ AFA+P G NAPQQVHITQGD  G+A+IISWVT DEPG
Sbjct  22   GKTSTYVRNLIEKP-VDMPLDSDAFAIPPGYNAPQQVHITQGDLVGQAMIISWVTVDEPG  80

Query  365  SSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            S+QV Y       +FTAEG    YT+YNY SGFIH   +  LE D  YYYE+G G
Sbjct  81   SNQVIYWSDSSLQNFTAEGEVFTYTYYNYTSGFIHHTTITNLEFDTTYYYEVGIG  135



>ref|XP_010028626.1| PREDICTED: purple acid phosphatase-like [Eucalyptus grandis]
 gb|KCW55388.1| hypothetical protein EUGRSUZ_I01297 [Eucalyptus grandis]
Length=466

 Score =   127 bits (319),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 61/114 (54%), Positives = 76/114 (67%), Gaps = 1/114 (1%)
 Frame = +2

Query  191  GMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDEPGSS  370
            G TS F R  WPSVD+P D+  FA P G NAPQQVHITQGD+ GK VI+SWVTP EPGS+
Sbjct  29   GTTSPFVRKIWPSVDMPFDSDVFAAPTGHNAPQQVHITQGDHVGKGVIVSWVTPHEPGSN  88

Query  371  QVRYGLSE-GKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            +V Y   + G+   +       Y +YNY SG+IH C +  LE D KY+Y +G+G
Sbjct  89   KVHYWSEKTGRKKHSENTVVKTYKYYNYTSGYIHHCTIKDLEPDTKYHYVVGSG  142



>ref|XP_007042078.1| Purple acid phosphatase 10 [Theobroma cacao]
 gb|EOX97909.1| Purple acid phosphatase 10 [Theobroma cacao]
Length=470

 Score =   127 bits (319),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 76/113 (67%), Gaps = 0/113 (0%)
 Frame = +2

Query  191  GMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDEPGSS  370
            G TS + R+   +VD+PLD+  F +P G NAPQQVHITQGD+ GKAVI+SWVT DEPGSS
Sbjct  31   GKTSVYVRNVEKTVDMPLDSDVFGLPSGYNAPQQVHITQGDHVGKAVIVSWVTDDEPGSS  90

Query  371  QVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
             V Y     K    AEG    Y FYNY SG+IH C +  LE++ KYYY +G G
Sbjct  91   TVLYWSENSKQKKMAEGKVKTYKFYNYTSGYIHHCTIRNLEYNTKYYYMVGVG  143



>dbj|BAA97745.1| secretory acid phosphatase precursor [Lupinus albus]
Length=462

 Score =   127 bits (319),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 80/115 (70%), Gaps = 3/115 (3%)
 Frame = +2

Query  191  GMTSGFFRS--EWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDEPG  364
            G TS + R+  E P VD+PLD+ AFA+P G NAPQQVHITQGD  G+A+IISWVT DEPG
Sbjct  24   GKTSTYVRNLIEKP-VDMPLDSDAFAIPPGYNAPQQVHITQGDLVGQAMIISWVTVDEPG  82

Query  365  SSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            S+QV Y       +FTAEG    YT+YNY SGFIH   +  LE D  YYYE+G G
Sbjct  83   SNQVIYWSDSSLQNFTAEGEVFTYTYYNYTSGFIHHTTITNLEFDTTYYYEVGIG  137



>gb|ABV89749.1| purple acid phosphatase 12 protein family isoform 5 [Brassica 
napus]
 gb|ABV89752.1| purple acid phosphatase 12 protein family isoform 5 [Brassica 
napus]
Length=475

 Score =   127 bits (319),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 76/119 (64%), Gaps = 0/119 (0%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            +E    G+TS + R      D+PLD+  F VP G N PQQVHITQG+++G  VIISWVTP
Sbjct  23   VELCDGGITSEYVRGSDLPDDMPLDSDVFKVPPGRNTPQQVHITQGNHEGNGVIISWVTP  82

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
              P S+ VRY    GK    AE T   Y F+NY SG+IH CL+  LE D KYYYEIG+G
Sbjct  83   SAPCSNTVRYWSENGKSKKLAEATMNTYRFFNYTSGYIHHCLIDDLEFDMKYYYEIGSG  141



>ref|XP_002300736.2| hypothetical protein POPTR_0002s03080g [Populus trichocarpa]
 gb|EEE80009.2| hypothetical protein POPTR_0002s03080g [Populus trichocarpa]
Length=488

 Score =   127 bits (319),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 77/119 (65%), Gaps = 2/119 (2%)
 Frame = +2

Query  173  IENGSAGMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTP  352
            I NG  G+TS + R    S+D+PLD+  F VP G NAPQQVHITQGD++GK VI+SWVT 
Sbjct  44   IVNG--GITSSYVRDADFSLDMPLDSDVFRVPPGYNAPQQVHITQGDHEGKGVIVSWVTQ  101

Query  353  DEPGSSQVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            DEPGS  V Y          AEG    Y FYNY SG+IH C +  LE D KYYYE+G G
Sbjct  102  DEPGSKTVLYWAENSGLKKIAEGFIVTYKFYNYTSGYIHHCTIEDLEFDTKYYYEVGIG  160



>ref|NP_001242830.1| uncharacterized protein LOC100815854 precursor [Glycine max]
 gb|ACU18684.1| unknown [Glycine max]
Length=460

 Score =   127 bits (319),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 74/113 (65%), Gaps = 0/113 (0%)
 Frame = +2

Query  191  GMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDEPGSS  370
            G +S F R    +VD+PLD+  FAVP G NAPQQVHITQGD  GKAVI+SWVT DEPGSS
Sbjct  23   GSSSPFIRKVEKTVDMPLDSDVFAVPPGYNAPQQVHITQGDLVGKAVIVSWVTADEPGSS  82

Query  371  QVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
            +V Y          AEG    Y F+NY SGFIH   +  LE+  KYYYE+G G
Sbjct  83   EVHYWSENSDKKKIAEGKLVTYRFFNYSSGFIHHTTIRNLEYKTKYYYEVGLG  135



>ref|XP_009614460.1| PREDICTED: purple acid phosphatase 2-like [Nicotiana tomentosiformis]
Length=466

 Score =   127 bits (319),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 77/113 (68%), Gaps = 0/113 (0%)
 Frame = +2

Query  191  GMTSGFFRSEWPSVDIPLDNKAFAVPKGPNAPQQVHITQGDYDGKAVIISWVTPDEPGSS  370
            G+TS F R    ++D+PLD+  F  P G NAPQQVHITQGD++GKAVI+SWVT DEPGSS
Sbjct  25   GVTSSFVRKVEKTIDMPLDSDVFRAPPGYNAPQQVHITQGDHEGKAVIVSWVTMDEPGSS  84

Query  371  QVRYGLSEGKYDFTAEGTYTNYTFYNYKSGFIHQCLVGGLEHDRKYYYEIGNG  529
             V Y   + K    A+G  T Y FYNY SG+IH   +  LE + KYYY+IG G
Sbjct  85   TVLYWSEKSKQKNNAKGKVTTYKFYNYTSGYIHHSTIRHLEFNTKYYYKIGIG  137



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 556507818200