BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001P16

Length=523
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009774388.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     132   2e-33   Nicotiana sylvestris
ref|XP_010327054.1|  PREDICTED: GDSL esterase/lipase At2g27360-li...    132   2e-33   Solanum lycopersicum
ref|XP_004248464.1|  PREDICTED: GDSL esterase/lipase At1g28610-li...    131   4e-33   Solanum lycopersicum
ref|XP_009607101.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     131   5e-33   Nicotiana tomentosiformis
emb|CDO96750.1|  unnamed protein product                                107   3e-24   Coffea canephora [robusta coffee]
ref|XP_011027711.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     102   1e-22   Populus euphratica
ref|XP_004291631.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     102   1e-22   Fragaria vesca subsp. vesca
ref|XP_002305753.2|  hypothetical protein POPTR_0004s05350g             102   2e-22   
emb|CDO96748.1|  unnamed protein product                              97.8    1e-21   Coffea canephora [robusta coffee]
emb|CDO96752.1|  unnamed protein product                              99.4    2e-21   Coffea canephora [robusta coffee]
ref|XP_007212730.1|  hypothetical protein PRUPE_ppa019092mg           99.0    2e-21   
ref|XP_010277743.1|  PREDICTED: GDSL esterase/lipase At1g28570-like   98.6    3e-21   Nelumbo nucifera [Indian lotus]
emb|CDP22023.1|  unnamed protein product                              94.7    7e-21   Coffea canephora [robusta coffee]
emb|CDO96749.1|  unnamed protein product                              97.4    9e-21   Coffea canephora [robusta coffee]
ref|XP_010316802.1|  PREDICTED: GDSL esterase/lipase At1g28580-li...  95.9    2e-20   Solanum lycopersicum
ref|XP_010316801.1|  PREDICTED: GDSL esterase/lipase At1g28580-li...  95.9    2e-20   Solanum lycopersicum
gb|KJB62810.1|  hypothetical protein B456_009G437600                  95.5    4e-20   Gossypium raimondii
ref|XP_004233850.1|  PREDICTED: GDSL esterase/lipase At1g28580-li...  95.1    5e-20   Solanum lycopersicum
ref|XP_007212863.1|  hypothetical protein PRUPE_ppa021567mg           95.1    6e-20   
emb|CDO96754.1|  unnamed protein product                              94.7    8e-20   Coffea canephora [robusta coffee]
ref|XP_009601721.1|  PREDICTED: GDSL esterase/lipase At1g28600-like   94.4    9e-20   Nicotiana tomentosiformis
ref|XP_009765841.1|  PREDICTED: GDSL esterase/lipase At1g28610-like   94.4    1e-19   Nicotiana sylvestris
ref|XP_008225208.1|  PREDICTED: GDSL esterase/lipase At1g28590-like   94.4    1e-19   Prunus mume [ume]
ref|NP_001031103.1|  GDSL esterase/lipase                             93.6    1e-19   
ref|XP_010478903.1|  PREDICTED: GDSL esterase/lipase At1g31550        94.0    1e-19   Camelina sativa [gold-of-pleasure]
emb|CDP21061.1|  unnamed protein product                              94.0    2e-19   Coffea canephora [robusta coffee]
ref|NP_174182.1|  GDSL esterase/lipase                                93.6    2e-19   Arabidopsis thaliana [mouse-ear cress]
gb|AAM65183.1|  lipase, putative                                      93.2    2e-19   Arabidopsis thaliana [mouse-ear cress]
gb|AFW86785.1|  hypothetical protein ZEAMMB73_041304                  92.8    3e-19   
gb|AAG60153.1|AC074360_18  lipase, putative                           92.8    3e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009352954.1|  PREDICTED: uncharacterized protein LOC103944252  95.5    3e-19   
ref|NP_174440.2|  GDSL esterase/lipase                                92.8    4e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008225217.1|  PREDICTED: uncharacterized protein LOC103324878  95.1    4e-19   
gb|ACF85857.1|  unknown                                               92.8    4e-19   Zea mays [maize]
ref|NP_001031122.1|  GDSL esterase/lipase                             92.8    4e-19   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001150078.1|  esterase                                         92.8    4e-19   Zea mays [maize]
gb|KJB63192.1|  hypothetical protein B456_009G437100                  91.7    4e-19   Gossypium raimondii
ref|XP_007213171.1|  hypothetical protein PRUPE_ppa026981mg           92.0    4e-19   
dbj|BAD95190.1|  hypothetical protein                                 92.4    5e-19   Arabidopsis thaliana [mouse-ear cress]
emb|CDO99485.1|  unnamed protein product                              92.4    5e-19   Coffea canephora [robusta coffee]
ref|XP_002893538.1|  predicted protein                                94.7    5e-19   
ref|XP_006377555.1|  hypothetical protein POPTR_0011s07620g           88.2    7e-19   
emb|CDO96753.1|  unnamed protein product                              92.0    7e-19   Coffea canephora [robusta coffee]
ref|XP_010462954.1|  PREDICTED: uncharacterized protein LOC104743592  94.4    7e-19   
ref|XP_010460979.1|  PREDICTED: GDSL esterase/lipase At1g31550-like   92.0    8e-19   Camelina sativa [gold-of-pleasure]
ref|XP_002893537.1|  hypothetical protein ARALYDRAFT_473078           92.0    8e-19   
ref|XP_004485879.1|  PREDICTED: GDSL esterase/lipase At2g27360-like   91.7    9e-19   Cicer arietinum [garbanzo]
ref|XP_008647410.1|  PREDICTED: uncharacterized protein LOC100193...  90.9    9e-19   
ref|XP_009629822.1|  PREDICTED: GDSL esterase/lipase At1g28600-like   91.7    1e-18   Nicotiana tomentosiformis
ref|XP_008371712.1|  PREDICTED: GDSL esterase/lipase At1g28600-like   92.0    1e-18   
ref|XP_010499708.1|  PREDICTED: GDSL esterase/lipase At1g31550-li...  91.3    1e-18   
ref|XP_009393075.1|  PREDICTED: GDSL esterase/lipase At1g28580-like   91.7    1e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010499707.1|  PREDICTED: GDSL esterase/lipase At1g31550-li...  91.3    1e-18   Camelina sativa [gold-of-pleasure]
gb|AAF24548.2|AC007508_11  F1K23.17                                   93.2    1e-18   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001132231.1|  uncharacterized protein LOC100193666 precursor   90.9    2e-18   Zea mays [maize]
gb|KJB63193.1|  hypothetical protein B456_009G437100                  90.9    2e-18   Gossypium raimondii
ref|XP_006362447.1|  PREDICTED: GDSL esterase/lipase At1g28600-like   90.9    2e-18   Solanum tuberosum [potatoes]
gb|EEE65824.1|  hypothetical protein OsJ_21563                        90.9    2e-18   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009421256.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   90.5    2e-18   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFW76565.1|  hypothetical protein ZEAMMB73_187768                  90.9    2e-18   
ref|XP_002267261.1|  PREDICTED: GDSL esterase/lipase At1g28580        90.5    2e-18   Vitis vinifera
emb|CDY15655.1|  BnaA07g08260D                                        90.5    2e-18   Brassica napus [oilseed rape]
ref|XP_010501634.1|  PREDICTED: uncharacterized protein LOC104778924  92.8    2e-18   
ref|XP_004983111.1|  PREDICTED: GDSL esterase/lipase At1g28600-like   90.5    3e-18   Setaria italica
ref|XP_004965533.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   90.5    3e-18   Setaria italica
gb|EEC80750.1|  hypothetical protein OsI_23233                        90.1    3e-18   Oryza sativa Indica Group [Indian rice]
ref|NP_001057785.1|  Os06g0531600                                     90.1    3e-18   
ref|NP_174180.1|  GDSL esterase/lipase                                90.1    3e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009347996.1|  PREDICTED: GDSL esterase/lipase At1g28580-like   90.1    3e-18   Pyrus x bretschneideri [bai li]
ref|XP_009792971.1|  PREDICTED: GDSL esterase/lipase At1g28600-like   90.1    3e-18   Nicotiana sylvestris
ref|XP_002439449.1|  hypothetical protein SORBIDRAFT_09g006580        89.4    4e-18   
gb|EPS71267.1|  hypothetical protein M569_03493                       90.1    4e-18   Genlisea aurea
ref|XP_010478237.1|  PREDICTED: GDSL esterase/lipase At1g28580-like   90.1    4e-18   
ref|XP_002438501.1|  hypothetical protein SORBIDRAFT_10g020950        90.1    4e-18   Sorghum bicolor [broomcorn]
gb|KEH36573.1|  GDSL-like lipase/acylhydrolase                        89.4    4e-18   Medicago truncatula
ref|XP_008785390.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   89.4    4e-18   Phoenix dactylifera
ref|XP_006828268.1|  hypothetical protein AMTR_s00023p00212280        89.7    4e-18   Amborella trichopoda
ref|XP_006645634.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   89.7    4e-18   Oryza brachyantha
ref|NP_180304.1|  GDSL esterase/lipase                                89.7    5e-18   Arabidopsis thaliana [mouse-ear cress]
emb|CDX94632.1|  BnaC07g10260D                                        89.4    5e-18   
dbj|BAD44668.1|  putative lipase                                      89.7    5e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009352806.1|  PREDICTED: GDSL esterase/lipase At1g28600-like   89.4    5e-18   
gb|ACU19966.1|  unknown                                               87.8    7e-18   Glycine max [soybeans]
ref|XP_008812182.1|  PREDICTED: GDSL esterase/lipase At1g28570-like   88.6    7e-18   
ref|XP_010478238.1|  PREDICTED: GDSL esterase/lipase At1g28600-like   89.7    7e-18   Camelina sativa [gold-of-pleasure]
gb|AFK42362.1|  unknown                                               89.0    7e-18   Medicago truncatula
ref|XP_010460658.1|  PREDICTED: GDSL esterase/lipase At1g28580-li...  89.4    7e-18   Camelina sativa [gold-of-pleasure]
ref|XP_003546023.2|  PREDICTED: GDSL esterase/lipase At1g31550-like   89.4    7e-18   Glycine max [soybeans]
ref|XP_003593737.1|  GDSL esterase/lipase                             89.0    8e-18   Medicago truncatula
ref|XP_010460657.1|  PREDICTED: GDSL esterase/lipase At1g28580-li...  89.4    8e-18   Camelina sativa [gold-of-pleasure]
ref|XP_009102892.1|  PREDICTED: GDSL esterase/lipase At1g28570-like   89.0    8e-18   Brassica rapa
ref|XP_009102895.1|  PREDICTED: GDSL esterase/lipase At1g28570-like   89.0    9e-18   Brassica rapa
ref|XP_010540487.1|  PREDICTED: GDSL esterase/lipase At1g28570-like   89.0    9e-18   Tarenaya hassleriana [spider flower]
emb|CDY15658.1|  BnaA07g08290D                                        89.0    9e-18   Brassica napus [oilseed rape]
gb|AAX59709.1|  lipase 1                                              88.6    1e-17   Brassica napus [oilseed rape]
ref|XP_002456059.1|  hypothetical protein SORBIDRAFT_03g029650        89.0    1e-17   Sorghum bicolor [broomcorn]
ref|NP_001151904.1|  alpha-L-fucosidase 2 precursor                   88.6    1e-17   Zea mays [maize]
ref|XP_009113643.1|  PREDICTED: GDSL esterase/lipase At2g27360-li...  88.6    1e-17   
ref|XP_009113642.1|  PREDICTED: GDSL esterase/lipase At2g27360-li...  88.6    1e-17   Brassica rapa
ref|XP_010925698.1|  PREDICTED: GDSL esterase/lipase At1g28570-li...  87.8    1e-17   Elaeis guineensis
emb|CBI30663.3|  unnamed protein product                              90.9    1e-17   Vitis vinifera
ref|XP_010925697.1|  PREDICTED: GDSL esterase/lipase At1g28570-li...  87.8    1e-17   Elaeis guineensis
ref|XP_003593736.1|  GDSL esterase/lipase                             88.6    1e-17   Medicago truncatula
emb|CDX94633.1|  BnaC07g10250D                                        88.6    1e-17   
ref|XP_006415636.1|  hypothetical protein EUTSA_v10006895mg           90.5    1e-17   
ref|XP_003560692.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   87.8    1e-17   
ref|XP_008364168.1|  PREDICTED: GDSL esterase/lipase At1g28570-like   87.4    2e-17   
ref|XP_010499396.1|  PREDICTED: GDSL esterase/lipase At1g28580-like   88.2    2e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010501635.1|  PREDICTED: uncharacterized protein LOC104778925  90.5    2e-17   
ref|XP_007148067.1|  hypothetical protein PHAVU_006G177800g           87.4    2e-17   Phaseolus vulgaris [French bean]
emb|CDX94634.1|  BnaC07g10240D                                        88.2    2e-17   
ref|XP_011096449.1|  PREDICTED: uncharacterized protein LOC105175645  90.1    2e-17   
ref|XP_002891138.1|  carboxylic ester hydrolase/ lipase               88.2    2e-17   Arabidopsis lyrata subsp. lyrata
ref|XP_006656143.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   88.2    2e-17   Oryza brachyantha
ref|XP_002879083.1|  predicted protein                                87.8    2e-17   
dbj|BAJ86670.1|  predicted protein                                    87.8    2e-17   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002438500.1|  hypothetical protein SORBIDRAFT_10g020940        87.4    2e-17   Sorghum bicolor [broomcorn]
ref|XP_010277742.1|  PREDICTED: GDSL esterase/lipase At1g28610-like   87.8    2e-17   Nelumbo nucifera [Indian lotus]
ref|XP_008785157.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   87.0    3e-17   Phoenix dactylifera
ref|XP_010925696.1|  PREDICTED: GDSL esterase/lipase At5g45910-li...  87.4    3e-17   Elaeis guineensis
ref|XP_006655466.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   87.0    3e-17   
ref|XP_003542989.1|  PREDICTED: GDSL esterase/lipase At1g28600        87.4    4e-17   Glycine max [soybeans]
ref|XP_006828273.1|  hypothetical protein AMTR_s00023p00217880        87.0    4e-17   
ref|XP_010460655.1|  PREDICTED: GDSL esterase/lipase At1g28610-like   87.4    4e-17   Camelina sativa [gold-of-pleasure]
ref|NP_564313.1|  GDSL esterase/lipase                                85.9    4e-17   Arabidopsis thaliana [mouse-ear cress]
gb|EAZ01210.1|  hypothetical protein OsI_23235                        86.7    5e-17   Oryza sativa Indica Group [Indian rice]
ref|XP_008777732.1|  PREDICTED: GDSL esterase/lipase At1g28570-like   85.5    5e-17   Phoenix dactylifera
gb|EAZ37226.1|  hypothetical protein OsJ_21564                        86.7    5e-17   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001057786.1|  Os06g0531900                                     86.7    5e-17   
ref|XP_009415143.1|  PREDICTED: GDSL esterase/lipase At1g28590-li...  86.7    6e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006367776.1|  PREDICTED: GDSL esterase/lipase At1g28590-like   86.7    6e-17   Solanum tuberosum [potatoes]
ref|XP_010915609.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   86.3    7e-17   
ref|XP_006654152.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   86.3    7e-17   Oryza brachyantha
gb|EYU28061.1|  hypothetical protein MIMGU_mgv11b014990mg             87.0    7e-17   Erythranthe guttata [common monkey flower]
gb|KFK44741.1|  hypothetical protein AALP_AA1G296900                  86.7    7e-17   Arabis alpina [alpine rockcress]
gb|EYU28060.1|  hypothetical protein MIMGU_mgv1a008085mg              86.3    8e-17   Erythranthe guttata [common monkey flower]
gb|AFK33964.1|  unknown                                               85.1    8e-17   Lotus japonicus
emb|CAN64953.1|  hypothetical protein VITISV_042282                   88.2    8e-17   Vitis vinifera
ref|XP_006844517.1|  hypothetical protein AMTR_s00016p00148320        86.3    8e-17   Amborella trichopoda
gb|KFK44742.1|  hypothetical protein AALP_AA1G297000                  88.6    8e-17   Arabis alpina [alpine rockcress]
ref|XP_009353234.1|  PREDICTED: GDSL esterase/lipase At1g28570-like   85.9    8e-17   
ref|XP_010435654.1|  PREDICTED: GDSL esterase/lipase At1g31550-like   86.3    8e-17   Camelina sativa [gold-of-pleasure]
gb|EEE62721.1|  hypothetical protein OsJ_17524                        85.1    9e-17   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006415637.1|  hypothetical protein EUTSA_v10009438mg           86.3    9e-17   
ref|XP_010540488.1|  PREDICTED: GDSL esterase/lipase At1g28610-li...  86.3    9e-17   Tarenaya hassleriana [spider flower]
ref|XP_010499588.1|  PREDICTED: GDSL esterase/lipase At1g28580-like   86.3    1e-16   Camelina sativa [gold-of-pleasure]
ref|XP_009102894.1|  PREDICTED: GDSL esterase/lipase At1g28580-like   86.3    1e-16   Brassica rapa
emb|CDY15657.1|  BnaA07g08280D                                        86.3    1e-16   Brassica napus [oilseed rape]
ref|XP_010478618.1|  PREDICTED: GDSL esterase/lipase At1g31550-like   85.9    1e-16   Camelina sativa [gold-of-pleasure]
ref|XP_009113646.1|  PREDICTED: GDSL esterase/lipase At1g28580-like   85.9    1e-16   Brassica rapa
ref|XP_003542992.1|  PREDICTED: GDSL esterase/lipase At1g28580-like   85.5    1e-16   
ref|XP_010054331.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   85.1    1e-16   
ref|XP_002438722.1|  hypothetical protein SORBIDRAFT_10g025030        85.1    1e-16   
ref|NP_174181.1|  GDSL esterase/lipase                                85.9    1e-16   Arabidopsis thaliana [mouse-ear cress]
emb|CDY30822.1|  BnaC05g21980D                                        85.9    1e-16   Brassica napus [oilseed rape]
gb|KJB62806.1|  hypothetical protein B456_009G437200                  85.9    1e-16   Gossypium raimondii
dbj|BAC41872.1|  unknown protein                                      84.3    1e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008655072.1|  PREDICTED: LOC100284848 isoform X1               85.5    1e-16   
ref|XP_003563800.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   85.5    1e-16   Brachypodium distachyon [annual false brome]
ref|XP_010455497.1|  PREDICTED: GDSL esterase/lipase At1g31550-li...  85.5    1e-16   Camelina sativa [gold-of-pleasure]
ref|XP_010445802.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   85.5    1e-16   Camelina sativa [gold-of-pleasure]
gb|EAY96951.1|  hypothetical protein OsI_18870                        85.1    1e-16   Oryza sativa Indica Group [Indian rice]
gb|AAS91011.1|  putative lipase                                       85.1    1e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010912621.1|  PREDICTED: GDSL esterase/lipase At1g28570-like   83.2    1e-16   
gb|ACF83155.1|  unknown                                               85.1    1e-16   Zea mays [maize]
ref|XP_010480704.1|  PREDICTED: GDSL esterase/lipase At1g28590-like   85.1    1e-16   
ref|XP_004969330.1|  PREDICTED: GDSL esterase/lipase At1g28600-li...  85.5    2e-16   Setaria italica
ref|XP_004969329.1|  PREDICTED: GDSL esterase/lipase At1g28600-li...  85.5    2e-16   Setaria italica
ref|NP_001064520.1|  Os10g0393800                                     85.9    2e-16   
ref|XP_011086014.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   85.1    2e-16   Sesamum indicum [beniseed]
ref|NP_001151215.1|  LOC100284848 precursor                           85.1    2e-16   Zea mays [maize]
ref|NP_001054912.2|  Os05g0209600                                     85.1    2e-16   
ref|XP_004952371.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   85.1    2e-16   Setaria italica
ref|XP_008783974.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   81.6    2e-16   
gb|KDO77811.1|  hypothetical protein CISIN_1g018031mg                 84.0    2e-16   Citrus sinensis [apfelsine]
gb|KHG23842.1|  hypothetical protein F383_29871                       85.1    2e-16   Gossypium arboreum [tree cotton]
ref|XP_010455496.1|  PREDICTED: GDSL esterase/lipase At1g31550-li...  85.5    2e-16   Camelina sativa [gold-of-pleasure]
ref|XP_010422035.1|  PREDICTED: GDSL esterase/lipase At1g31550-li...  85.1    2e-16   Camelina sativa [gold-of-pleasure]
ref|XP_010915608.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   84.7    2e-16   Elaeis guineensis
ref|XP_010422034.1|  PREDICTED: GDSL esterase/lipase At1g31550-li...  85.1    2e-16   Camelina sativa [gold-of-pleasure]
ref|XP_002863442.1|  GDSL-motif lipase/hydrolase family protein       84.7    2e-16   
ref|XP_003565527.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   84.7    2e-16   Brachypodium distachyon [annual false brome]
ref|NP_001147763.1|  esterase precursor                               85.5    2e-16   Zea mays [maize]
ref|XP_010478236.1|  PREDICTED: GDSL esterase/lipase At1g28610-like   85.1    2e-16   Camelina sativa [gold-of-pleasure]
gb|KJB62808.1|  hypothetical protein B456_009G437400                  84.3    2e-16   Gossypium raimondii
ref|XP_010041184.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   84.7    3e-16   Eucalyptus grandis [rose gum]
gb|KCW44566.1|  hypothetical protein EUGRSUZ_L01923                   84.3    3e-16   Eucalyptus grandis [rose gum]
ref|NP_001141565.1|  uncharacterized protein LOC100273681             84.7    3e-16   Zea mays [maize]
ref|XP_007025434.1|  GDSL-like Lipase/Acylhydrolase superfamily p...  84.3    3e-16   
ref|XP_008643602.1|  PREDICTED: esterase isoform X1                   85.1    3e-16   Zea mays [maize]
ref|XP_008439763.1|  PREDICTED: GDSL esterase/lipase At1g28570-like   84.7    3e-16   Cucumis melo [Oriental melon]
ref|XP_006844514.1|  hypothetical protein AMTR_s00016p00146420        81.6    3e-16   
ref|NP_001242505.1|  uncharacterized protein LOC100815771 precursor   84.3    3e-16   Glycine max [soybeans]
ref|XP_008777734.1|  PREDICTED: GDSL esterase/lipase At1g28570-like   84.7    3e-16   Phoenix dactylifera
ref|XP_002267222.2|  PREDICTED: GDSL esterase/lipase At5g45910        84.3    3e-16   Vitis vinifera
gb|KDO77810.1|  hypothetical protein CISIN_1g018031mg                 83.6    4e-16   Citrus sinensis [apfelsine]
ref|XP_010052216.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   84.3    4e-16   Eucalyptus grandis [rose gum]
ref|XP_003593742.1|  GDSL esterase/lipase                             84.3    4e-16   Medicago truncatula
ref|NP_973932.1|  GDSL esterase/lipase                                84.3    4e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004134933.1|  PREDICTED: GDSL esterase/lipase At1g28570-like   84.3    4e-16   Cucumis sativus [cucumbers]
ref|XP_008812183.1|  PREDICTED: GDSL esterase/lipase At1g31550-like   84.3    4e-16   Phoenix dactylifera
ref|XP_008785278.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   84.0    4e-16   Phoenix dactylifera
gb|ACG38031.1|  alpha-L-fucosidase 2 precursor                        84.0    5e-16   Zea mays [maize]
emb|CDY30819.1|  BnaC05g21950D                                        84.3    5e-16   Brassica napus [oilseed rape]
ref|XP_010478242.1|  PREDICTED: GDSL esterase/lipase At1g28670-like   84.0    5e-16   Camelina sativa [gold-of-pleasure]
dbj|BAJ94075.1|  predicted protein                                    84.0    5e-16   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010912577.1|  PREDICTED: GDSL esterase/lipase At1g28580-like   84.0    6e-16   
ref|XP_010460659.1|  PREDICTED: GDSL esterase/lipase At1g28670-like   84.0    6e-16   Camelina sativa [gold-of-pleasure]
dbj|BAJ95195.1|  predicted protein                                    84.0    6e-16   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006643905.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   83.2    6e-16   
ref|NP_564314.1|  GDSL esterase/lipase                                83.6    6e-16   Arabidopsis thaliana [mouse-ear cress]
ref|NP_849723.1|  GDSL esterase/lipase                                83.6    6e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008783908.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   84.0    7e-16   Phoenix dactylifera
ref|XP_009109701.1|  PREDICTED: GDSL esterase/lipase At1g28670-li...  84.0    7e-16   
ref|XP_009109700.1|  PREDICTED: GDSL esterase/lipase At1g28670-li...  84.0    7e-16   Brassica rapa
ref|XP_009109702.1|  PREDICTED: GDSL esterase/lipase At1g28670-li...  83.6    7e-16   
gb|KJB66735.1|  hypothetical protein B456_010G156100                  82.8    7e-16   Gossypium raimondii
emb|CDX90162.1|  BnaA08g18220D                                        83.6    8e-16   
dbj|BAD44794.1|  lipase-like                                          81.3    8e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010912671.1|  PREDICTED: GDSL esterase/lipase At1g31550-like   84.0    8e-16   
ref|NP_001241470.1|  uncharacterized protein LOC100816865             83.6    8e-16   Glycine max [soybeans]
ref|XP_009102890.1|  PREDICTED: GDSL esterase/lipase At1g28670-like   83.6    8e-16   Brassica rapa
emb|CDY63998.1|  BnaA07g36520D                                        83.6    8e-16   Brassica napus [oilseed rape]
gb|EEE54111.1|  hypothetical protein OsJ_00875                        83.2    8e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008673536.1|  PREDICTED: GDSL esterase/lipase At5g45910 is...  84.0    8e-16   
gb|AAX62802.1|  lipase 2                                              83.6    9e-16   Brassica napus [oilseed rape]
ref|XP_008439761.1|  PREDICTED: GDSL esterase/lipase At1g28570-like   83.2    9e-16   Cucumis melo [Oriental melon]
tpg|DAA52848.1|  TPA: hypothetical protein ZEAMMB73_895572            83.6    9e-16   
ref|NP_174179.3|  GDSL esterase/lipase                                83.6    9e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004964803.1|  PREDICTED: GDSL esterase/lipase At5g45910-li...  82.8    1e-15   Setaria italica
ref|XP_007020866.1|  GDSL-like Lipase/Acylhydrolase superfamily p...  85.1    1e-15   
dbj|BAJ85333.1|  predicted protein                                    83.2    1e-15   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB62807.1|  hypothetical protein B456_009G437300                  83.6    1e-15   Gossypium raimondii
sp|Q3ZFI4.1|SCE3_BRANA  RecName: Full=Sinapine esterase; Short=Bn...  83.2    1e-15   Brassica napus [oilseed rape]
ref|NP_001043722.1|  Os01g0650000                                     80.9    1e-15   
ref|XP_004965532.1|  PREDICTED: GDSL esterase/lipase At5g45910-li...  82.8    1e-15   Setaria italica
ref|XP_010495736.1|  PREDICTED: GDSL esterase/lipase At5g45910        83.2    1e-15   Camelina sativa [gold-of-pleasure]
ref|XP_007214461.1|  hypothetical protein PRUPE_ppa023988mg           84.0    1e-15   
ref|XP_008783975.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   82.8    1e-15   Phoenix dactylifera
dbj|BAJ99647.1|  predicted protein                                    82.8    1e-15   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB57433.1|  hypothetical protein B456_009G164000                  82.8    1e-15   Gossypium raimondii
gb|KDO77809.1|  hypothetical protein CISIN_1g018031mg                 82.8    1e-15   Citrus sinensis [apfelsine]
ref|XP_002457136.1|  hypothetical protein SORBIDRAFT_03g001840        83.2    1e-15   
gb|EMT08653.1|  GDSL esterase/lipase                                  83.2    1e-15   
ref|XP_002457140.1|  hypothetical protein SORBIDRAFT_03g001880        82.8    1e-15   Sorghum bicolor [broomcorn]
ref|XP_008812189.1|  PREDICTED: GDSL esterase/lipase At1g28570-like   82.8    1e-15   Phoenix dactylifera
ref|XP_010480702.1|  PREDICTED: uncharacterized protein LOC104759479  84.7    1e-15   
dbj|BAJ86481.1|  predicted protein                                    82.8    1e-15   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002467296.1|  hypothetical protein SORBIDRAFT_01g023210        83.6    1e-15   
ref|XP_006646155.1|  PREDICTED: GDSL esterase/lipase At1g28600-like   82.8    1e-15   Oryza brachyantha
ref|XP_009401628.1|  PREDICTED: GDSL esterase/lipase At1g28570-like   82.8    1e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002453668.1|  hypothetical protein SORBIDRAFT_04g010100        82.8    1e-15   Sorghum bicolor [broomcorn]
ref|XP_009140758.1|  PREDICTED: GDSL esterase/lipase At5g45910        82.8    1e-15   Brassica rapa
ref|XP_004964802.1|  PREDICTED: GDSL esterase/lipase At5g45910-li...  82.8    1e-15   
ref|XP_003546024.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   82.8    1e-15   Glycine max [soybeans]
emb|CDY48195.1|  BnaA04g15590D                                        82.8    1e-15   Brassica napus [oilseed rape]
gb|EMT00792.1|  GDSL esterase/lipase                                  82.0    1e-15   
ref|XP_003565495.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   82.4    2e-15   
ref|XP_004971765.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   82.4    2e-15   Setaria italica
ref|XP_007148064.1|  hypothetical protein PHAVU_006G177500g           82.8    2e-15   Phaseolus vulgaris [French bean]
gb|EEE64296.1|  hypothetical protein OsJ_19133                        82.0    2e-15   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001042390.1|  Os01g0214600                                     82.0    2e-15   
ref|XP_006467672.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   82.4    2e-15   Citrus sinensis [apfelsine]
ref|XP_010925694.1|  PREDICTED: GDSL esterase/lipase At5g45910-li...  82.0    2e-15   
dbj|BAD73006.1|  putative esterase                                    82.0    2e-15   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008225209.1|  PREDICTED: GDSL esterase/lipase At5g45910        82.4    2e-15   Prunus mume [ume]
ref|XP_004960619.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   82.4    2e-15   Setaria italica
gb|EAY98626.1|  hypothetical protein OsI_20551                        82.4    2e-15   Oryza sativa Indica Group [Indian rice]
ref|XP_009407319.1|  PREDICTED: GDSL esterase/lipase At1g28650-like   82.8    2e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003565548.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   82.4    2e-15   Brachypodium distachyon [annual false brome]
ref|XP_006449476.1|  hypothetical protein CICLE_v10015707mg           82.0    2e-15   Citrus clementina [clementine]
ref|XP_010925693.1|  PREDICTED: GDSL esterase/lipase At5g45910-li...  82.4    2e-15   Elaeis guineensis
ref|XP_008383651.1|  PREDICTED: GDSL esterase/lipase At1g31550-like   80.5    2e-15   
ref|XP_006654615.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   82.0    2e-15   Oryza brachyantha
emb|CDY64716.1|  BnaCnng44670D                                        82.4    2e-15   Brassica napus [oilseed rape]
ref|XP_010232089.1|  PREDICTED: GDSL esterase/lipase At1g28600-li...  82.0    2e-15   Brachypodium distachyon [annual false brome]
ref|XP_003569463.1|  PREDICTED: GDSL esterase/lipase At1g28600-li...  82.0    2e-15   Brachypodium distachyon [annual false brome]
ref|XP_011096420.1|  PREDICTED: LOW QUALITY PROTEIN: GDSL esteras...  82.4    2e-15   Sesamum indicum [beniseed]
ref|XP_010499397.1|  PREDICTED: GDSL esterase/lipase At1g28670        82.4    2e-15   Camelina sativa [gold-of-pleasure]
gb|AAM62801.1|  GDSL-motif lipase/hydrolase-like protein              82.0    3e-15   
ref|XP_006844513.1|  hypothetical protein AMTR_s00016p00145970        82.0    3e-15   
ref|XP_006643906.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   82.0    3e-15   
ref|NP_199403.1|  GDSL esterase/lipase                                82.0    3e-15   
gb|EYU28066.1|  hypothetical protein MIMGU_mgv1a009376mg              81.3    3e-15   
gb|EMT16610.1|  GDSL esterase/lipase                                  81.6    3e-15   
ref|NP_001042391.1|  Os01g0214800                                     81.6    3e-15   
gb|EAZ11025.1|  hypothetical protein OsJ_00869                        81.6    3e-15   
ref|XP_003560003.2|  PREDICTED: GDSL esterase/lipase At1g28600-like   81.6    3e-15   
dbj|BAK05007.1|  predicted protein                                    81.6    3e-15   
ref|XP_010912598.1|  PREDICTED: GDSL esterase/lipase At1g28650-li...  82.0    3e-15   
gb|KJB66738.1|  hypothetical protein B456_010G156100                  81.6    3e-15   
gb|KJB66739.1|  hypothetical protein B456_010G156100                  81.6    3e-15   
ref|XP_004515399.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   81.6    3e-15   
ref|XP_010912608.1|  PREDICTED: GDSL esterase/lipase At1g28570-li...  82.0    3e-15   
dbj|BAF02148.1|  putative lipase                                      81.3    3e-15   
ref|XP_004967475.1|  PREDICTED: GDSL esterase/lipase At1g31550-li...  80.9    3e-15   
gb|AAF24544.2|AC007508_7  F1K23.13                                    84.0    3e-15   
ref|XP_011038247.1|  PREDICTED: GDSL esterase/lipase 1-like           81.3    3e-15   
ref|NP_174186.1|  GDSL esterase/lipase                                81.6    4e-15   
gb|KCW76155.1|  hypothetical protein EUGRSUZ_D00534                   81.3    4e-15   
ref|XP_003542991.1|  PREDICTED: GDSL esterase/lipase At1g28600-li...  81.6    4e-15   
ref|NP_001042396.1|  Os01g0215700                                     81.6    4e-15   
ref|XP_004234096.1|  PREDICTED: GDSL esterase/lipase At1g28590-like   81.6    4e-15   
dbj|BAA94228.1|  putative esterase                                    81.3    4e-15   
ref|NP_001055985.1|  Os05g0506500                                     80.1    4e-15   
emb|CDY43309.1|  BnaC03g58810D                                        81.6    4e-15   
ref|XP_003564303.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   81.3    5e-15   
gb|EEE64294.1|  hypothetical protein OsJ_19131                        80.5    5e-15   
gb|EAY99508.1|  hypothetical protein OsI_21478                        81.3    6e-15   
gb|KDP21068.1|  hypothetical protein JCGZ_21539                       80.9    6e-15   
ref|XP_004967474.1|  PREDICTED: GDSL esterase/lipase At1g31550-li...  81.3    6e-15   
ref|XP_010912585.1|  PREDICTED: GDSL esterase/lipase At1g31550-like   81.3    6e-15   
ref|XP_010052214.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   80.9    6e-15   
dbj|BAJ90380.1|  predicted protein                                    80.9    6e-15   
dbj|BAK05815.1|  predicted protein                                    80.9    6e-15   
ref|XP_010912648.1|  PREDICTED: sinapine esterase-like isoform X3     80.9    6e-15   
emb|CDX77066.1|  BnaC04g38610D                                        81.3    6e-15   
ref|XP_003559896.2|  PREDICTED: GDSL esterase/lipase At1g28600-like   80.9    6e-15   
gb|AFW80388.1|  hypothetical protein ZEAMMB73_198775                  80.5    7e-15   
gb|AFW71084.1|  esterase                                              80.5    7e-15   
gb|AAT11017.1|  lipase 1                                              80.9    7e-15   
gb|ABL11233.1|  UCW116, putative lipase                               80.5    7e-15   
ref|XP_004968624.1|  PREDICTED: GDSL esterase/lipase At1g31550-like   80.9    7e-15   
gb|EEC75319.1|  hypothetical protein OsI_11692                        79.3    7e-15   
ref|XP_002305752.2|  GDSL-motif lipase/hydrolase family protein       80.9    7e-15   
ref|XP_010461021.1|  PREDICTED: GDSL esterase/lipase At1g31550-like   80.9    8e-15   
ref|XP_010912640.1|  PREDICTED: GDSL esterase/lipase At1g28650-li...  80.9    8e-15   
ref|XP_007148066.1|  hypothetical protein PHAVU_006G177700g           80.5    8e-15   
ref|XP_010912632.1|  PREDICTED: GDSL esterase/lipase At1g28650-li...  80.9    8e-15   
ref|XP_004485880.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   80.5    9e-15   
gb|EAZ12915.1|  hypothetical protein OsJ_02838                        79.7    9e-15   
ref|XP_002451875.1|  hypothetical protein SORBIDRAFT_04g009090        80.5    9e-15   
ref|NP_001056856.1|  Os06g0156700                                     80.9    9e-15   
ref|XP_004155631.1|  PREDICTED: LOW QUALITY PROTEIN: GDSL esteras...  80.5    9e-15   
ref|XP_010915607.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   80.5    9e-15   
ref|XP_004134931.1|  PREDICTED: GDSL esterase/lipase At1g28570-like   80.5    9e-15   
ref|XP_008777731.1|  PREDICTED: GDSL esterase/lipase At1g31550-like   80.5    9e-15   
gb|EAY90132.1|  hypothetical protein OsI_11698                        80.5    9e-15   
dbj|BAJ92568.1|  predicted protein                                    80.5    9e-15   
ref|NP_001132319.1|  uncharacterized protein LOC100193761 precursor   80.5    1e-14   
gb|EAZ12911.1|  hypothetical protein OsJ_02834                        80.5    1e-14   
gb|EEC80045.1|  hypothetical protein OsI_21742                        80.5    1e-14   
ref|XP_008655074.1|  PREDICTED: LOC100284971 isoform X1               80.5    1e-14   
gb|EMT16273.1|  GDSL esterase/lipase                                  80.9    1e-14   
ref|XP_011027710.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   80.1    1e-14   
gb|EAY98625.1|  hypothetical protein OsI_20550                        80.1    1e-14   
ref|XP_006651412.1|  PREDICTED: GDSL esterase/lipase At1g31550-like   80.1    1e-14   
ref|XP_006643907.1|  PREDICTED: GDSL esterase/lipase At1g28590-like   80.1    1e-14   
gb|EAZ27028.1|  hypothetical protein OsJ_10957                        80.5    1e-14   
ref|XP_011096421.1|  PREDICTED: GDSL esterase/lipase At5g45910        80.5    1e-14   
ref|XP_004964800.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   80.1    1e-14   
gb|EEE55085.1|  hypothetical protein OsJ_02827                        80.5    1e-14   
ref|NP_001151338.1|  LOC100284971 precursor                           80.1    1e-14   
gb|EAY75193.1|  hypothetical protein OsI_03085                        80.1    1e-14   
gb|KCW76148.1|  hypothetical protein EUGRSUZ_D00525                   80.1    1e-14   
ref|XP_010052212.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   80.1    1e-14   
gb|EAY99756.1|  hypothetical protein OsI_21741                        78.6    1e-14   
ref|XP_009109699.1|  PREDICTED: GDSL esterase/lipase At1g28670-like   80.1    1e-14   
emb|CBI21953.3|  unnamed protein product                              79.0    1e-14   
dbj|BAB89203.1|  lipase-like                                          80.1    1e-14   
ref|XP_003565533.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   79.7    1e-14   
gb|ABK24921.1|  unknown                                               80.1    1e-14   
tpg|DAA58958.1|  TPA: hypothetical protein ZEAMMB73_908344            78.2    1e-14   
ref|XP_004968625.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   79.7    2e-14   
ref|XP_003633253.2|  PREDICTED: GDSL esterase/lipase At5g45910-like   79.0    2e-14   
gb|KCW63207.1|  hypothetical protein EUGRSUZ_G00824                   79.3    2e-14   
gb|EMT01150.1|  GDSL esterase/lipase                                  79.3    2e-14   
gb|KHN08454.1|  GDSL esterase/lipase                                  81.3    2e-14   
gb|KCW44565.1|  hypothetical protein EUGRSUZ_L01922                   79.3    2e-14   
ref|XP_010915615.1|  PREDICTED: GDSL esterase/lipase At5g45910-li...  78.2    2e-14   
ref|XP_003593740.1|  GDSL esterase/lipase                             79.7    2e-14   
ref|XP_002304246.1|  50 kDa family protein                            79.7    2e-14   
ref|XP_010068245.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   79.3    2e-14   
gb|EEE65121.1|  hypothetical protein OsJ_20187                        79.3    2e-14   
emb|CDY25680.1|  BnaC03g69950D                                        77.4    2e-14   
emb|CDX90163.1|  BnaA08g18210D                                        79.7    2e-14   
ref|XP_010041182.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   79.3    2e-14   
emb|CDM83832.1|  unnamed protein product                              79.7    2e-14   
ref|XP_008658948.1|  PREDICTED: uncharacterized protein LOC100501...  79.3    2e-14   
gb|EMT03967.1|  GDSL esterase/lipase                                  79.7    2e-14   
dbj|BAJ97605.1|  predicted protein                                    79.3    2e-14   
ref|XP_010518794.1|  PREDICTED: GDSL esterase/lipase At5g45910        79.0    2e-14   
gb|KFK35686.1|  hypothetical protein AALP_AA4G024100                  79.3    2e-14   
ref|XP_002439448.1|  hypothetical protein SORBIDRAFT_09g006570        79.3    2e-14   
ref|XP_004971762.1|  PREDICTED: GDSL esterase/lipase At1g28600-like   79.3    2e-14   
ref|XP_010478243.1|  PREDICTED: GDSL esterase/lipase At1g28650        79.3    2e-14   
emb|CDY02491.1|  BnaA08g00980D                                        77.0    2e-14   
ref|XP_008777735.1|  PREDICTED: GDSL esterase/lipase At1g28580-like   79.7    2e-14   
ref|NP_001064519.1|  Os10g0393500                                     78.2    2e-14   
dbj|BAD61220.1|  lanatoside 15'-O-acetylesterase-like                 79.3    2e-14   
gb|EEC75320.1|  hypothetical protein OsI_11693                        79.0    2e-14   
ref|XP_006415633.1|  hypothetical protein EUTSA_v10007853mg           79.3    2e-14   
ref|XP_007148063.1|  hypothetical protein PHAVU_006G177400g           79.3    2e-14   
gb|EAZ11087.1|  hypothetical protein OsJ_00934                        77.8    2e-14   
gb|EMT16275.1|  GDSL esterase/lipase                                  79.3    2e-14   
gb|EAY85214.1|  hypothetical protein OsI_06576                        79.3    3e-14   
ref|XP_006662321.1|  PREDICTED: GDSL esterase/lipase At1g28600-like   79.7    3e-14   
gb|EEC70207.1|  hypothetical protein OsI_00954                        77.8    3e-14   
gb|EAY98628.1|  hypothetical protein OsI_20553                        79.3    3e-14   
dbj|BAH01022.1|  unnamed protein product                              79.3    3e-14   
ref|XP_003568743.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   79.0    3e-14   
ref|XP_004509605.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   79.0    3e-14   
gb|AFW85778.1|  hypothetical protein ZEAMMB73_678347                  79.3    3e-14   
gb|EAZ12674.1|  hypothetical protein OsJ_02589                        79.3    3e-14   
dbj|BAD81454.1|  putative esterase                                    77.8    3e-14   
dbj|BAD19158.1|  lipase-like                                          79.0    3e-14   
ref|XP_011036528.1|  PREDICTED: GDSL esterase/lipase 1                79.0    3e-14   
gb|EMT23217.1|  GDSL esterase/lipase                                  79.0    3e-14   
ref|XP_002893540.1|  predicted protein                                80.9    3e-14   
ref|NP_001050175.1|  Os03g0365800                                     79.0    3e-14   
emb|CDP03455.1|  unnamed protein product                              77.4    3e-14   
ref|NP_174188.1|  lipase ARAB-1                                       79.0    3e-14   
ref|XP_002461107.1|  hypothetical protein SORBIDRAFT_02g040890        79.0    3e-14   
ref|XP_004485878.1|  PREDICTED: GDSL esterase/lipase At1g28590-like   79.0    4e-14   
ref|XP_004961580.1|  PREDICTED: GDSL esterase/lipase At5g45910-li...  79.0    4e-14   
ref|XP_003572041.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   79.0    4e-14   
gb|EEE59101.1|  hypothetical protein OsJ_10956                        78.6    4e-14   
ref|XP_009775228.1|  PREDICTED: acetylajmalan esterase-like           76.3    4e-14   
emb|CDY43308.1|  BnaC03g58800D                                        79.0    4e-14   
gb|EAY90131.1|  hypothetical protein OsI_11697                        79.0    4e-14   
ref|XP_006646152.1|  PREDICTED: GDSL esterase/lipase At1g28600-like   78.6    4e-14   
gb|ABF96122.1|  GDSL-like Lipase/Acylhydrolase family protein         78.2    4e-14   
gb|EMT23758.1|  GDSL esterase/lipase                                  78.6    4e-14   
ref|XP_009411652.1|  PREDICTED: GDSL esterase/lipase At1g28570-like   79.0    4e-14   
dbj|BAK07356.1|  predicted protein                                    78.6    4e-14   
gb|KHG30334.1|  hypothetical protein F383_10781                       78.6    4e-14   
ref|XP_004968644.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   78.6    4e-14   
ref|XP_006662320.1|  PREDICTED: GDSL esterase/lipase At1g28590-like   77.0    5e-14   
ref|XP_007020870.1|  GDSL esterase/lipase                             77.4    5e-14   
ref|XP_004971763.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   78.2    5e-14   
ref|XP_010915614.1|  PREDICTED: GDSL esterase/lipase At5g45910-li...  77.8    5e-14   
ref|XP_004984286.1|  PREDICTED: GDSL esterase/lipase At1g28600-like   78.6    5e-14   
ref|XP_006656658.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   78.2    5e-14   
gb|EMT23218.1|  GDSL esterase/lipase                                  77.8    5e-14   
gb|KCW45468.1|  hypothetical protein EUGRSUZ_L00817                   78.6    6e-14   
ref|XP_010912659.1|  PREDICTED: GDSL esterase/lipase At1g28650-like   78.2    6e-14   
ref|XP_002457137.1|  hypothetical protein SORBIDRAFT_03g001850        78.2    6e-14   
ref|NP_001142390.1|  Zea nodulation homolog1 precursor                77.8    7e-14   
ref|NP_001152399.1|  alpha-L-fucosidase 2 precursor                   77.8    7e-14   
ref|XP_004961581.1|  PREDICTED: GDSL esterase/lipase At5g45910-li...  78.2    7e-14   
gb|ACN30561.1|  unknown                                               77.8    7e-14   
gb|AFW83240.1|  hypothetical protein ZEAMMB73_837402                  77.8    7e-14   
dbj|BAJ98970.1|  predicted protein                                    78.2    7e-14   
ref|XP_004961579.1|  PREDICTED: GDSL esterase/lipase At5g45910-li...  77.8    7e-14   
ref|XP_010054333.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   78.2    8e-14   
gb|KFK31510.1|  hypothetical protein AALP_AA6G122100                  77.8    8e-14   
gb|EAY78349.1|  hypothetical protein OsI_33438                        78.2    8e-14   
gb|EMT15204.1|  GDSL esterase/lipase                                  77.0    8e-14   
ref|NP_001056855.1|  Os06g0156600                                     77.8    8e-14   
gb|KDP40644.1|  hypothetical protein JCGZ_24643                       77.8    8e-14   
gb|AAM22734.1|AC092388_18  putative lipase                            77.8    8e-14   
ref|XP_006387157.1|  hypothetical protein POPTR_1677s00210g           74.3    8e-14   
gb|EMT09180.1|  GDSL esterase/lipase                                  77.0    8e-14   
dbj|BAK01569.1|  predicted protein                                    77.8    8e-14   
ref|XP_007020873.1|  GDSL esterase/lipase                             75.9    9e-14   
gb|EMT00808.1|  GDSL esterase/lipase                                  77.8    9e-14   
gb|KCW63215.1|  hypothetical protein EUGRSUZ_G00835                   77.4    9e-14   
ref|NP_001055986.1|  Os05g0506600                                     77.4    9e-14   
ref|XP_006286037.1|  hypothetical protein CARUB_v10007566mg           77.8    9e-14   
ref|XP_010068248.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   77.4    1e-13   
ref|XP_002463272.1|  hypothetical protein SORBIDRAFT_02g040950        77.8    1e-13   
ref|XP_008673524.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   77.4    1e-13   
ref|XP_006643908.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   77.4    1e-13   
emb|CDM85791.1|  unnamed protein product                              77.4    1e-13   
ref|XP_002454933.1|  hypothetical protein SORBIDRAFT_03g001670        77.4    1e-13   
ref|XP_004968623.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   77.4    1e-13   
ref|NP_001043721.1|  Os01g0649900                                     77.8    1e-13   
ref|XP_004305778.1|  PREDICTED: GDSL esterase/lipase 2-like           77.4    1e-13   
ref|XP_009352808.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   77.4    1e-13   
ref|XP_006656659.1|  PREDICTED: GDSL esterase/lipase At1g28590-like   77.8    1e-13   
ref|XP_004248142.1|  PREDICTED: GDSL esterase/lipase At1g28610        77.4    1e-13   
ref|NP_001149136.1|  alpha-L-fucosidase 2 precursor                   77.4    1e-13   
ref|XP_002457134.1|  hypothetical protein SORBIDRAFT_03g001820        77.0    1e-13   
gb|EAY75181.1|  hypothetical protein OsI_03071                        77.4    1e-13   
gb|AAF02864.1|AC009324_13  Similar to anther-specific proline-ric...  77.0    1e-13   
ref|XP_002455947.1|  hypothetical protein SORBIDRAFT_03g027770        77.8    1e-13   
ref|NP_175795.2|  GDSL esterase/lipase 5                              77.0    1e-13   
ref|NP_001168047.1|  uncharacterized protein LOC100381776 precursor   77.0    1e-13   
ref|XP_006651411.1|  PREDICTED: GDSL esterase/lipase At1g28600-like   77.0    1e-13   
ref|NP_001132224.1|  alpha-L-fucosidase 2 precursor                   77.0    2e-13   
gb|ACL53525.1|  unknown                                               77.4    2e-13   
gb|EMT29920.1|  GDSL esterase/lipase                                  73.2    2e-13   
ref|NP_001149156.1|  esterase precursor                               77.0    2e-13   
ref|XP_006644440.1|  PREDICTED: GDSL esterase/lipase At1g28600-like   77.4    2e-13   
ref|XP_006644439.1|  PREDICTED: GDSL esterase/lipase At1g28600-like   77.4    2e-13   
ref|XP_010040115.1|  PREDICTED: uncharacterized protein LOC104428890  78.6    2e-13   
gb|KJB57075.1|  hypothetical protein B456_009G146900                  76.6    2e-13   
ref|XP_002437861.1|  hypothetical protein SORBIDRAFT_10g003930        77.0    2e-13   
emb|CDM83767.1|  unnamed protein product                              76.6    2e-13   
emb|CDO96755.1|  unnamed protein product                              77.0    2e-13   
ref|NP_001168581.1|  hypothetical protein precursor                   77.0    2e-13   
ref|XP_002891781.1|  hypothetical protein ARALYDRAFT_314703           77.0    2e-13   
dbj|BAD73008.1|  putative esterase                                    75.9    2e-13   
ref|XP_006372529.1|  hypothetical protein POPTR_0017s02500g           76.6    2e-13   
ref|XP_009106953.1|  PREDICTED: GDSL esterase/lipase 5                77.0    2e-13   
gb|KEH33577.1|  GDSL-like lipase/acylhydrolase                        76.6    2e-13   
ref|XP_004296391.1|  PREDICTED: GDSL esterase/lipase At5g45910        76.6    2e-13   
ref|XP_009411653.1|  PREDICTED: GDSL esterase/lipase At1g28570-like   76.6    2e-13   
ref|XP_004969326.1|  PREDICTED: GDSL esterase/lipase At1g28600-like   77.0    2e-13   
ref|XP_008383648.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   76.6    2e-13   



>ref|XP_009774388.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Nicotiana sylvestris]
Length=385

 Score =   132 bits (333),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 78/93 (84%), Gaps = 3/93 (3%)
 Frame = +3

Query  99   STAACYTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILDL  278
            +T+ CY +IFGFGDSLTDAGNL+HL   G  PHMY+PPYG+T+F  PTGRCSDGR+++DL
Sbjct  26   ATSNCYKSIFGFGDSLTDAGNLVHLYPPGRKPHMYFPPYGKTYFNRPTGRCSDGRLLIDL  85

Query  279  IAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            IA+YYGL +PPP  SR+A+ GG+ +Q G+NFAV
Sbjct  86   IAQYYGLPLPPP--SREAKDGGN-MQSGINFAV  115



>ref|XP_010327054.1| PREDICTED: GDSL esterase/lipase At2g27360-like isoform X2 [Solanum 
lycopersicum]
Length=356

 Score =   132 bits (331),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 74/96 (77%), Gaps = 6/96 (6%)
 Frame = +3

Query  90   IIGSTAACYTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVI  269
            ++    +CYT+IFGFGDSLTD GNL+H   +G+ PHMY+PPYGET+F HPTGRCSDGR++
Sbjct  19   LLACATSCYTSIFGFGDSLTDTGNLVHFYPNGNKPHMYFPPYGETYFHHPTGRCSDGRLL  78

Query  270  LDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            +DLIA++YGL +PPPSL R+        Q G NFAV
Sbjct  79   IDLIAQHYGLPLPPPSLDRRNA------QNGTNFAV  108



>ref|XP_004248464.1| PREDICTED: GDSL esterase/lipase At1g28610-like isoform X1 [Solanum 
lycopersicum]
Length=378

 Score =   131 bits (330),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 74/96 (77%), Gaps = 6/96 (6%)
 Frame = +3

Query  90   IIGSTAACYTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVI  269
            ++    +CYT+IFGFGDSLTD GNL+H   +G+ PHMY+PPYGET+F HPTGRCSDGR++
Sbjct  19   LLACATSCYTSIFGFGDSLTDTGNLVHFYPNGNKPHMYFPPYGETYFHHPTGRCSDGRLL  78

Query  270  LDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            +DLIA++YGL +PPPSL R+        Q G NFAV
Sbjct  79   IDLIAQHYGLPLPPPSLDRRNA------QNGTNFAV  108



>ref|XP_009607101.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Nicotiana tomentosiformis]
Length=398

 Score =   131 bits (330),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 78/93 (84%), Gaps = 3/93 (3%)
 Frame = +3

Query  99   STAACYTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILDL  278
            +T+ CY +IFGFGDSLTDAGNL+HL   G  PHMY+PPYG+T+F  PTGRCSDGR+++DL
Sbjct  29   ATSNCYKSIFGFGDSLTDAGNLVHLYPPGRKPHMYFPPYGKTYFNRPTGRCSDGRLLIDL  88

Query  279  IAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            IA+YYGL +PPP  S++A+ GG+ +Q G+NFAV
Sbjct  89   IAQYYGLPLPPP--SKEARDGGN-MQSGINFAV  118



>emb|CDO96750.1| unnamed protein product [Coffea canephora]
Length=386

 Score =   107 bits (267),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 62/94 (66%), Gaps = 3/94 (3%)
 Frame = +3

Query  96   GSTAACYTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILD  275
             S  +CY +I GFGDSLTD GNL+ L    +  H Y PPYGETFF HPTGRC DGR+I+D
Sbjct  30   ASAGSCYKSIIGFGDSLTDTGNLVQLFPPDNPTHCYRPPYGETFFKHPTGRCCDGRLIID  89

Query  276  LIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
             IAE +GL + P  L R   T     +QGVNFAV
Sbjct  90   FIAESFGLPLVPAYLWRDESTD---FRQGVNFAV  120



>ref|XP_011027711.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Populus euphratica]
Length=380

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 50/95 (53%), Positives = 62/95 (65%), Gaps = 3/95 (3%)
 Frame = +3

Query  93   IGSTAACYTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVIL  272
            I  T  CYT+IF FGDSL D GN  +L    ++PH  + PYGETFF HPTGRCSDGR+++
Sbjct  23   ISCTIGCYTSIFSFGDSLADTGNSRNLSPPDNLPHFSFLPYGETFFHHPTGRCSDGRLVI  82

Query  273  DLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            D IAEY GL   PP      ++   + + GVNFAV
Sbjct  83   DFIAEYLGLPFVPPYFGGSMES---FKEAGVNFAV  114



>ref|XP_004291631.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Fragaria vesca 
subsp. vesca]
Length=389

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/89 (54%), Positives = 62/89 (70%), Gaps = 1/89 (1%)
 Frame = +3

Query  111  CYTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILDLIAEY  290
            CY++IF FGDS+TD GNL ++ +  S  H ++PPYGET+F HPTGRCSDGR+I+D IAE+
Sbjct  33   CYSSIFSFGDSITDTGNL-YISSKNSSFHFFFPPYGETYFHHPTGRCSDGRLIIDFIAEF  91

Query  291  YGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
             GL    P    K+      I+ GVNFAV
Sbjct  92   LGLPYVRPYTEVKSNASPQNIEGGVNFAV  120



>ref|XP_002305753.2| hypothetical protein POPTR_0004s05350g [Populus trichocarpa]
 gb|EEE86264.2| hypothetical protein POPTR_0004s05350g [Populus trichocarpa]
Length=424

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/95 (52%), Positives = 62/95 (65%), Gaps = 3/95 (3%)
 Frame = +3

Query  93   IGSTAACYTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVIL  272
            +  T  CYT+IF FGDSL D GN  +L    ++PH  + PYGETFF HPTGRCSDGR+++
Sbjct  67   VSCTTGCYTSIFSFGDSLADTGNSRNLSPPDNLPHYSFLPYGETFFHHPTGRCSDGRLVI  126

Query  273  DLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            D IAEY GL   PP      ++   + + GVNFAV
Sbjct  127  DFIAEYLGLPFVPPYFGGSMES---FKEAGVNFAV  158



>emb|CDO96748.1| unnamed protein product [Coffea canephora]
Length=215

 Score = 97.8 bits (242),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 58/93 (62%), Gaps = 4/93 (4%)
 Frame = +3

Query  111  CYTAIFGFGDSLTDAGNLI----HLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILDL  278
            CYT+IF FGDSLTDAGN +    HL      PH ++PP GET+F +PTGRC DGR+++D 
Sbjct  74   CYTSIFAFGDSLTDAGNYLELYPHLVPHHKPPHFFFPPNGETYFHYPTGRCCDGRLMIDF  133

Query  279  IAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
             AEY+GL + P     K          GVNFAV
Sbjct  134  FAEYFGLPLLPTYFGGKNNESNRNFDSGVNFAV  166



>emb|CDO96752.1| unnamed protein product [Coffea canephora]
Length=385

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 68/94 (72%), Gaps = 3/94 (3%)
 Frame = +3

Query  99   STAACYTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILDL  278
            S + CYT++F FGDSL+D GNL+   +  ++ H   PP GET+FG PTGRC DGR+I+D+
Sbjct  19   SASECYTSMFSFGDSLSDNGNLLGFSSPKTI-HQGRPPNGETYFGQPTGRCCDGRLIVDM  77

Query  279  IAEYYGLAIPPPSLS-RKAQTGGDYIQQGVNFAV  377
            IA+ +GL IPPP +S R A++  D+   GVNFAV
Sbjct  78   IAQNFGLPIPPPYVSIRNAKSSRDF-YAGVNFAV  110



>ref|XP_007212730.1| hypothetical protein PRUPE_ppa019092mg [Prunus persica]
 gb|EMJ13929.1| hypothetical protein PRUPE_ppa019092mg [Prunus persica]
Length=377

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 65/90 (72%), Gaps = 2/90 (2%)
 Frame = +3

Query  111  CYTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILDLIAEY  290
            CY +I GFGDS+TD GNL + + + S+ + ++PPYGET+F HPTGRCSDGR+++D IAE+
Sbjct  26   CYNSIIGFGDSITDTGNLYNSDPNRSL-NFFHPPYGETYFHHPTGRCSDGRLVIDFIAEF  84

Query  291  YGLAIPPPSL-SRKAQTGGDYIQQGVNFAV  377
             GL + PP L S+ +       + GVNFAV
Sbjct  85   LGLPLVPPYLESQSSNQSVQNFEAGVNFAV  114



>ref|XP_010277743.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Nelumbo nucifera]
Length=390

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 64/93 (69%), Gaps = 3/93 (3%)
 Frame = +3

Query  99   STAACYTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILDL  278
            S +  YT+IF FGDSL D GNL+ L+ + +    ++P YG T+F HPTGRCSDGR+I+D 
Sbjct  27   SCSCHYTSIFSFGDSLIDTGNLLRLQHNNASFECWFP-YGITYFHHPTGRCSDGRLIIDF  85

Query  279  IAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            IAEY GL   PP LSR   +GG   + GVNFAV
Sbjct  86   IAEYLGLPFVPPYLSRG--SGGQDFRHGVNFAV  116



>emb|CDP22023.1| unnamed protein product [Coffea canephora]
Length=168

 Score = 94.7 bits (234),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 61/96 (64%), Gaps = 2/96 (2%)
 Frame = +3

Query  90   IIGSTAACYTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVI  269
            I  S   CYT+IF FGDSLTD GNL+ L     + H    P GET+F HPTGRC DGR+I
Sbjct  16   IAQSAEGCYTSIFAFGDSLTDNGNLLALSAP-RIIHQGRLPNGETYFHHPTGRCCDGRLI  74

Query  270  LDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            +D +A+ +GL IPPP      +   D I+ GVNFAV
Sbjct  75   VDFLAQQFGLPIPPPYTEVSKEMTMD-IRAGVNFAV  109



>emb|CDO96749.1| unnamed protein product [Coffea canephora]
Length=397

 Score = 97.4 bits (241),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 64/96 (67%), Gaps = 6/96 (6%)
 Frame = +3

Query  105  AACYTAIFGFGDSLTDAGNLIHLETDG-----SVPHMYYPPYGETFFGHPTGRCSDGRVI  269
            +ACYT+I+ FGDSL+DAGN IH+          +P    PPYGET+F HPTGR SDGR I
Sbjct  26   SACYTSIYAFGDSLSDAGNYIHIYQQMFPGTHKLPRYASPPYGETYFHHPTGRTSDGRTI  85

Query  270  LDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            +D +AEYYGL + PP +    Q+  ++   G+NFAV
Sbjct  86   IDFMAEYYGLPLIPPYIRGVNQSSSNF-GAGINFAV  120



>ref|XP_010316802.1| PREDICTED: GDSL esterase/lipase At1g28580-like isoform X3 [Solanum 
lycopersicum]
Length=313

 Score = 95.9 bits (237),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 58/90 (64%), Gaps = 1/90 (1%)
 Frame = +3

Query  111  CYTAIFGFGDSLTDAGNLIHLETDGSVP-HMYYPPYGETFFGHPTGRCSDGRVILDLIAE  287
            C+ +I  FGDSL D GN +H+  + + P H   PPYGETFF HPTGR SDGR+++D IAE
Sbjct  28   CFDSIISFGDSLADTGNKLHISLNKTPPSHFSLPPYGETFFHHPTGRFSDGRLVIDFIAE  87

Query  288  YYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
              GL + P  L  K +      +QGVNFAV
Sbjct  88   SLGLPLVPAYLEGKDERNNVKFRQGVNFAV  117



>ref|XP_010316801.1| PREDICTED: GDSL esterase/lipase At1g28580-like isoform X2 [Solanum 
lycopersicum]
Length=328

 Score = 95.9 bits (237),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 58/90 (64%), Gaps = 1/90 (1%)
 Frame = +3

Query  111  CYTAIFGFGDSLTDAGNLIHLETDGSVP-HMYYPPYGETFFGHPTGRCSDGRVILDLIAE  287
            C+ +I  FGDSL D GN +H+  + + P H   PPYGETFF HPTGR SDGR+++D IAE
Sbjct  28   CFDSIISFGDSLADTGNKLHISLNKTPPSHFSLPPYGETFFHHPTGRFSDGRLVIDFIAE  87

Query  288  YYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
              GL + P  L  K +      +QGVNFAV
Sbjct  88   SLGLPLVPAYLEGKDERNNVKFRQGVNFAV  117



>gb|KJB62810.1| hypothetical protein B456_009G437600 [Gossypium raimondii]
Length=391

 Score = 95.5 bits (236),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 46/91 (51%), Positives = 61/91 (67%), Gaps = 3/91 (3%)
 Frame = +3

Query  111  CYTAIFGFGDSLTDAGNL--IHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILDLIA  284
            C+T+IF FGDSLTD GNL  + L     + H  +PPYG TFFG+PTGRCSDGR+++D IA
Sbjct  33   CFTSIFSFGDSLTDTGNLHQLSLSESKKLSHFDFPPYGRTFFGYPTGRCSDGRLVIDFIA  92

Query  285  EYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            E +GL   PP    +     + ++ GVNFA+
Sbjct  93   EDFGLPFLPPYFEGENGKPRN-LENGVNFAI  122



>ref|XP_004233850.1| PREDICTED: GDSL esterase/lipase At1g28580-like isoform X1 [Solanum 
lycopersicum]
Length=385

 Score = 95.1 bits (235),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 58/90 (64%), Gaps = 1/90 (1%)
 Frame = +3

Query  111  CYTAIFGFGDSLTDAGNLIHLETDGSVP-HMYYPPYGETFFGHPTGRCSDGRVILDLIAE  287
            C+ +I  FGDSL D GN +H+  + + P H   PPYGETFF HPTGR SDGR+++D IAE
Sbjct  28   CFDSIISFGDSLADTGNKLHISLNKTPPSHFSLPPYGETFFHHPTGRFSDGRLVIDFIAE  87

Query  288  YYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
              GL + P  L  K +      +QGVNFAV
Sbjct  88   SLGLPLVPAYLEGKDERNNVKFRQGVNFAV  117



>ref|XP_007212863.1| hypothetical protein PRUPE_ppa021567mg [Prunus persica]
 gb|EMJ14062.1| hypothetical protein PRUPE_ppa021567mg [Prunus persica]
Length=393

 Score = 95.1 bits (235),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 62/97 (64%), Gaps = 2/97 (2%)
 Frame = +3

Query  90   IIGSTAACYTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVI  269
            II     C+ ++  FGDSLTD GNL +   + S+ H + PPYGET+F HPTGRCSDGR+I
Sbjct  22   IIPHVLGCFNSVISFGDSLTDTGNLYNSSPNRSL-HYFQPPYGETYFHHPTGRCSDGRLI  80

Query  270  LDLIAEYYGLAIPPPSLSR-KAQTGGDYIQQGVNFAV  377
            +D IA++ GL + PP L    +       + GVNFAV
Sbjct  81   IDFIAQFLGLPLVPPFLQNLNSNQSVQNFEAGVNFAV  117



>emb|CDO96754.1| unnamed protein product [Coffea canephora]
Length=398

 Score = 94.7 bits (234),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 65/99 (66%), Gaps = 3/99 (3%)
 Frame = +3

Query  90   IIGSTAACYTAIFGFGDSLTDAGNLIHLETDG---SVPHMYYPPYGETFFGHPTGRCSDG  260
            +  S   CY ++  FGDSL D GNL HL++       PH + PPYGET+F HPTGRCSDG
Sbjct  27   VSASAGICYKSLISFGDSLADTGNLFHLDSPSSSSDAPHFFLPPYGETYFHHPTGRCSDG  86

Query  261  RVILDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            R+++D IAE  GL + PP L+RK  +G     +GVNFAV
Sbjct  87   RLVVDFIAESLGLPLLPPYLARKDTSGSLDFLEGVNFAV  125



>ref|XP_009601721.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Nicotiana tomentosiformis]
Length=389

 Score = 94.4 bits (233),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 64/105 (61%), Gaps = 11/105 (10%)
 Frame = +3

Query  84   ACII------GSTAACYTAIFGFGDSLTDAGNLIHLETDGSV-PHMYYPPYGETFFGHPT  242
            ACII       +T  C+ +I  FGDSL D GN +HL  + ++ PH    PYGETFF  PT
Sbjct  18   ACIILVLNFFQATEGCFNSIISFGDSLADTGNRLHLSQNKTLLPHFAVRPYGETFFHRPT  77

Query  243  GRCSDGRVILDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            GR SDGR+++D IAE  GL + PP L  K +      +QGVNFAV
Sbjct  78   GRFSDGRIVIDFIAESLGLPLVPPYLGGKDER----FKQGVNFAV  118



>ref|XP_009765841.1| PREDICTED: GDSL esterase/lipase At1g28610-like [Nicotiana sylvestris]
Length=388

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 60/94 (64%), Gaps = 5/94 (5%)
 Frame = +3

Query  99   STAACYTAIFGFGDSLTDAGNLIHL-ETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILD  275
            +T  C+ +I  FGDSL D GN +HL +    +PH    PYGETFF HPTGR SDGR+++D
Sbjct  29   ATKGCFNSIISFGDSLADTGNKLHLSQYKTHLPHFAVRPYGETFFHHPTGRFSDGRLVID  88

Query  276  LIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
             IAE  GL + PP L  K +      +QGVNFAV
Sbjct  89   FIAESLGLPLVPPYLGGKDEN----FKQGVNFAV  118



>ref|XP_008225208.1| PREDICTED: GDSL esterase/lipase At1g28590-like [Prunus mume]
Length=380

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 62/97 (64%), Gaps = 2/97 (2%)
 Frame = +3

Query  90   IIGSTAACYTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVI  269
            II     C+ ++  FGDSLTD GNL +   + S+ H + PPYGET+F HPTGRCSDGR+I
Sbjct  22   IIPHVLGCFNSVISFGDSLTDTGNLYNSSPNRSL-HYFQPPYGETYFHHPTGRCSDGRLI  80

Query  270  LDLIAEYYGLAIPPPSLSRKAQTG-GDYIQQGVNFAV  377
            +D IA++ GL + PP L     T      + GVNFAV
Sbjct  81   IDFIAQFLGLPLVPPFLQSLNSTQPVQNFEAGVNFAV  117



>ref|NP_001031103.1| GDSL esterase/lipase [Arabidopsis thaliana]
 gb|AEE31000.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=298

 Score = 93.6 bits (231),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 54/123 (44%), Positives = 67/123 (54%), Gaps = 12/123 (10%)
 Frame = +3

Query  90   IIGSTAAC--YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGR  263
            I+ S   C  + +I  FGDS+ D GNL+ L     +P   +PPYGETFF HPTGR  DGR
Sbjct  19   IVSSETPCPNFKSIISFGDSIADTGNLVGLSDRNQLPVTAFPPYGETFFHHPTGRSCDGR  78

Query  264  VILDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAVELHGFASSTPTPSVRFSIDRSI  443
            +I+D IAE+ GL   PP    K +       +GVNFAV     A +T   S  F   R I
Sbjct  79   IIMDFIAEFVGLPYVPPYFGSKNRN----FDKGVNFAV-----AGATALKS-SFLKKRGI  128

Query  444  SPH  452
             PH
Sbjct  129  QPH  131



>ref|XP_010478903.1| PREDICTED: GDSL esterase/lipase At1g31550 [Camelina sativa]
Length=395

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 62/98 (63%), Gaps = 6/98 (6%)
 Frame = +3

Query  90   IIGSTAAC--YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGR  263
            I+ S + C  + +I  FGDS+ D GNL+ L    ++P   +PPYGETFF HPTGR SDGR
Sbjct  25   IVSSESQCRSFESIISFGDSIADTGNLLGLSDQNNLPMSAFPPYGETFFHHPTGRYSDGR  84

Query  264  VILDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            +I+D IAE+ GL   PP    K +      ++GVNFAV
Sbjct  85   LIIDFIAEFLGLPYVPPYFGSKNEN----FEKGVNFAV  118



>emb|CDP21061.1| unnamed protein product [Coffea canephora]
Length=394

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 1/94 (1%)
 Frame = +3

Query  96   GSTAACYTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILD  275
             S   CY +I  FGDS+ D GNL+ L      PH   PPYGE+FF  PTGR S+GR+++D
Sbjct  30   ASAGICYKSIISFGDSIADTGNLLRLCPSNYPPHFSLPPYGESFFHRPTGRFSNGRLVID  89

Query  276  LIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
              AE +GL + PP L+ +   G D+ +QGVNFAV
Sbjct  90   FFAESFGLPLIPPYLAGEDARGRDF-RQGVNFAV  122



>ref|NP_174182.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q94F40.1|GDL9_ARATH RecName: Full=GDSL esterase/lipase At1g28600; AltName: Full=Extracellular 
lipase At1g28600; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAK60329.1|AF385739_1 At1g28600/F1K23_6 [Arabidopsis thaliana]
 gb|AAM91505.1| At1g28600/F1K23_6 [Arabidopsis thaliana]
 gb|AEE30999.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=393

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 54/123 (44%), Positives = 67/123 (54%), Gaps = 12/123 (10%)
 Frame = +3

Query  90   IIGSTAAC--YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGR  263
            I+ S   C  + +I  FGDS+ D GNL+ L     +P   +PPYGETFF HPTGR  DGR
Sbjct  19   IVSSETPCPNFKSIISFGDSIADTGNLVGLSDRNQLPVTAFPPYGETFFHHPTGRSCDGR  78

Query  264  VILDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAVELHGFASSTPTPSVRFSIDRSI  443
            +I+D IAE+ GL   PP    K +       +GVNFAV     A +T   S  F   R I
Sbjct  79   IIMDFIAEFVGLPYVPPYFGSKNRN----FDKGVNFAV-----AGATALKS-SFLKKRGI  128

Query  444  SPH  452
             PH
Sbjct  129  QPH  131



>gb|AAM65183.1| lipase, putative [Arabidopsis thaliana]
Length=393

 Score = 93.2 bits (230),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 54/123 (44%), Positives = 67/123 (54%), Gaps = 12/123 (10%)
 Frame = +3

Query  90   IIGSTAAC--YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGR  263
            I+ S   C  + +I  FGDS+ D GNL+ L     +P   +PPYGETFF HPTGR  DGR
Sbjct  19   IVSSETPCRNFKSIISFGDSIADTGNLVGLSDRNQLPVTAFPPYGETFFHHPTGRSCDGR  78

Query  264  VILDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAVELHGFASSTPTPSVRFSIDRSI  443
            +I+D IAE+ GL   PP    K +       +GVNFAV     A +T   S  F   R I
Sbjct  79   IIMDFIAEFVGLPYVPPYFGSKNRN----FDKGVNFAV-----AGATALKS-SFLKKRGI  128

Query  444  SPH  452
             PH
Sbjct  129  QPH  131



>gb|AFW86785.1| hypothetical protein ZEAMMB73_041304 [Zea mays]
Length=356

 Score = 92.8 bits (229),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 62/92 (67%), Gaps = 6/92 (7%)
 Frame = +3

Query  102  TAACYTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILDLI  281
            +   YTAIF FGDSL+DAGNLI   T  ++     PPYG TFF  PTGRCS+GR+++D +
Sbjct  52   SKKSYTAIFSFGDSLSDAGNLIVNGTPKALTTAR-PPYGMTFFRKPTGRCSNGRLVVDFL  110

Query  282  AEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            AE++GL +PPPS     Q  G   ++G NFA+
Sbjct  111  AEHFGLPLPPPS-----QAKGKDFKKGANFAI  137



>gb|AAG60153.1|AC074360_18 lipase, putative [Arabidopsis thaliana]
Length=391

 Score = 92.8 bits (229),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 48/98 (49%), Positives = 64/98 (65%), Gaps = 6/98 (6%)
 Frame = +3

Query  90   IIGSTAAC--YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGR  263
            I+ S + C  + +I  FGDS+ D GNL+ L    ++P   +PPYGETFF HPTGR SDGR
Sbjct  24   IVSSESQCRNFESIISFGDSIADTGNLLGLSDHNNLPMSAFPPYGETFFHHPTGRFSDGR  83

Query  264  VILDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            +I+D IAE+ GL   PP       T G++ ++GVNFAV
Sbjct  84   LIIDFIAEFLGLPYVPPYF---GSTNGNF-EKGVNFAV  117



>ref|XP_009352954.1| PREDICTED: uncharacterized protein LOC103944252 [Pyrus x bretschneideri]
Length=1005

 Score = 95.5 bits (236),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 62/89 (70%), Gaps = 2/89 (2%)
 Frame = +3

Query  111  CYTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILDLIAEY  290
            CY++I  FGDS++D GNL +   + S  + ++PPYGET+F HPTGRCSDGR+++D IAE 
Sbjct  481  CYSSIISFGDSVSDTGNLYNSSPNKSF-NFFFPPYGETYFHHPTGRCSDGRLVIDFIAES  539

Query  291  YGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
             GL +  P L    QT  D I+ GVNFAV
Sbjct  540  MGLPLVQPYLESHNQT-ADNIEGGVNFAV  567


 Score = 91.7 bits (226),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 46/89 (52%), Positives = 60/89 (67%), Gaps = 2/89 (2%)
 Frame = +3

Query  111  CYTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILDLIAEY  290
            CY++I  FGDS+ D GNL +   + S+   ++PPYGET+F  P GRCSDGR+I+D IAEY
Sbjct  21   CYSSIISFGDSIADTGNLYNSSPNKSL-DFFFPPYGETYFHRPVGRCSDGRLIIDFIAEY  79

Query  291  YGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
             GL +  P L    QT  + I+ GVNFAV
Sbjct  80   MGLPLVQPYLESHNQTVHN-IEGGVNFAV  107



>ref|NP_174440.2| GDSL esterase/lipase [Arabidopsis thaliana]
 gb|AAT99799.1| At1g31550 [Arabidopsis thaliana]
 gb|AAU45217.1| At1g31550 [Arabidopsis thaliana]
 gb|AEE31371.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=391

 Score = 92.8 bits (229),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 48/98 (49%), Positives = 64/98 (65%), Gaps = 6/98 (6%)
 Frame = +3

Query  90   IIGSTAAC--YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGR  263
            I+ S + C  + +I  FGDS+ D GNL+ L    ++P   +PPYGETFF HPTGR SDGR
Sbjct  24   IVSSESQCRNFESIISFGDSIADTGNLLGLSDHNNLPMSAFPPYGETFFHHPTGRFSDGR  83

Query  264  VILDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            +I+D IAE+ GL   PP       T G++ ++GVNFAV
Sbjct  84   LIIDFIAEFLGLPYVPPYF---GSTNGNF-EKGVNFAV  117



>ref|XP_008225217.1| PREDICTED: uncharacterized protein LOC103324878 [Prunus mume]
Length=885

 Score = 95.1 bits (235),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 63/90 (70%), Gaps = 2/90 (2%)
 Frame = +3

Query  111  CYTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILDLIAEY  290
            CY +I  FGDSLTD GNL +   + S+ + ++PPYG+T+F HPTGRCSDGR+++D IAE+
Sbjct  534  CYNSIIAFGDSLTDTGNLYNSYPNKSL-NFFHPPYGQTYFHHPTGRCSDGRLVIDFIAEF  592

Query  291  YGLAIPPPSL-SRKAQTGGDYIQQGVNFAV  377
             GL + PP L S+ +       + GVNFAV
Sbjct  593  LGLPLVPPYLESQDSNQSVQNFEAGVNFAV  622


 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 61/89 (69%), Gaps = 2/89 (2%)
 Frame = +3

Query  114  YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILDLIAEYY  293
            Y +I  FGDSLTD GN  +   + S+ + ++PPYG+T+F HPTGRCSDGR+++D IAE+ 
Sbjct  34   YNSIISFGDSLTDTGNFYNSYPNKSL-NFFHPPYGQTYFHHPTGRCSDGRLVIDFIAEFL  92

Query  294  GLAIPPPSL-SRKAQTGGDYIQQGVNFAV  377
            GL + PP L S+ +       + GVNFAV
Sbjct  93   GLPLVPPYLESQNSNQSVQNFEAGVNFAV  121



>gb|ACF85857.1| unknown [Zea mays]
 gb|AFW86784.1| esterase [Zea mays]
Length=397

 Score = 92.8 bits (229),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 61/88 (69%), Gaps = 6/88 (7%)
 Frame = +3

Query  114  YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILDLIAEYY  293
            YTAIF FGDSL+DAGNLI   T  ++     PPYG TFF  PTGRCS+GR+++D +AE++
Sbjct  56   YTAIFSFGDSLSDAGNLIVNGTPKALTTAR-PPYGMTFFRKPTGRCSNGRLVVDFLAEHF  114

Query  294  GLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            GL +PPPS     Q  G   ++G NFA+
Sbjct  115  GLPLPPPS-----QAKGKDFKKGANFAI  137



>ref|NP_001031122.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q9C857.1|GDL16_ARATH RecName: Full=GDSL esterase/lipase At1g31550; AltName: Full=Extracellular 
lipase At1g31550; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAG51269.1|AC027135_10 unknown protein [Arabidopsis thaliana]
 gb|AEE31372.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=394

 Score = 92.8 bits (229),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 48/98 (49%), Positives = 64/98 (65%), Gaps = 6/98 (6%)
 Frame = +3

Query  90   IIGSTAAC--YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGR  263
            I+ S + C  + +I  FGDS+ D GNL+ L    ++P   +PPYGETFF HPTGR SDGR
Sbjct  24   IVSSESQCRNFESIISFGDSIADTGNLLGLSDHNNLPMSAFPPYGETFFHHPTGRFSDGR  83

Query  264  VILDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            +I+D IAE+ GL   PP       T G++ ++GVNFAV
Sbjct  84   LIIDFIAEFLGLPYVPPYF---GSTNGNF-EKGVNFAV  117



>ref|NP_001150078.1| esterase [Zea mays]
 gb|ACG37721.1| esterase precursor [Zea mays]
Length=397

 Score = 92.8 bits (229),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 61/88 (69%), Gaps = 6/88 (7%)
 Frame = +3

Query  114  YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILDLIAEYY  293
            YTAIF FGDSL+DAGNLI   T  ++     PPYG TFF  PTGRCS+GR+++D +AE++
Sbjct  56   YTAIFSFGDSLSDAGNLIVNGTPKALTTAR-PPYGMTFFRKPTGRCSNGRLVVDFLAEHF  114

Query  294  GLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            GL +PPPS     Q  G   ++G NFA+
Sbjct  115  GLPLPPPS-----QAKGKDFKKGANFAI  137



>gb|KJB63192.1| hypothetical protein B456_009G437100 [Gossypium raimondii]
Length=264

 Score = 91.7 bits (226),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 57/91 (63%), Gaps = 3/91 (3%)
 Frame = +3

Query  111  CYTAIFGFGDSLTDAGNLIHLETDGSV--PHMYYPPYGETFFGHPTGRCSDGRVILDLIA  284
            C+T+IF FGDSLTD GNL+ +    S   PH  + PYG TFF HPTGR  DGR+++D IA
Sbjct  33   CFTSIFSFGDSLTDTGNLLEISLSDSTNPPHSAFLPYGRTFFHHPTGRFCDGRLVIDFIA  92

Query  285  EYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            E  G +  PP    K+     + Q+G NFAV
Sbjct  93   EALGFSFLPPFYGSKSGKWEKF-QKGANFAV  122



>ref|XP_007213171.1| hypothetical protein PRUPE_ppa026981mg, partial [Prunus persica]
 gb|EMJ14370.1| hypothetical protein PRUPE_ppa026981mg, partial [Prunus persica]
Length=310

 Score = 92.0 bits (227),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 45/90 (50%), Positives = 58/90 (64%), Gaps = 2/90 (2%)
 Frame = +3

Query  111  CYTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILDLIAEY  290
            C+ ++  FGDSLTD GNL     + S+ H + PPYGET+F HPTGRCSDGR+I+D IA++
Sbjct  37   CFNSVISFGDSLTDTGNLYDSSPNRSL-HYFQPPYGETYFHHPTGRCSDGRLIIDFIAQF  95

Query  291  YGLAIPPPSLSR-KAQTGGDYIQQGVNFAV  377
             GL   PP L    +       + GVNFAV
Sbjct  96   LGLPFVPPFLQNLNSNQSVQNFEAGVNFAV  125



>dbj|BAD95190.1| hypothetical protein [Arabidopsis thaliana]
Length=394

 Score = 92.4 bits (228),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 48/98 (49%), Positives = 64/98 (65%), Gaps = 6/98 (6%)
 Frame = +3

Query  90   IIGSTAAC--YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGR  263
            I+ S + C  + +I  FGDS+ D GNL+ L    ++P   +PPYGETFF HPTGR SDGR
Sbjct  24   IVSSESQCRNFESIISFGDSIADTGNLLGLSDHNNLPMSAFPPYGETFFHHPTGRFSDGR  83

Query  264  VILDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            +I+D IAE+ GL   PP       T G++ ++GVNFAV
Sbjct  84   LIIDFIAEFLGLPYVPPYF---GSTNGNF-ERGVNFAV  117



>emb|CDO99485.1| unnamed protein product [Coffea canephora]
Length=399

 Score = 92.4 bits (228),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 63/102 (62%), Gaps = 9/102 (9%)
 Frame = +3

Query  93   IGSTAACYTAIFGFGDSLTDAGN-------LIHLETDGSVPHMYYPPYGETFFGHPTGRC  251
            + + + C+T+IF  GDSL D GN       + HL + G++ +   PPYGET+F HPTGRC
Sbjct  25   LKTASGCFTSIFALGDSLADTGNYATIYPPIFHL-SKGTL-YCGLPPYGETYFHHPTGRC  82

Query  252  SDGRVILDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            SDGR+I+D IAEYYGL   PP L           Q G+NFAV
Sbjct  83   SDGRLIIDFIAEYYGLPPVPPYLRGANHRSNSRFQAGLNFAV  124



>ref|XP_002893538.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69797.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=808

 Score = 94.7 bits (234),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 55/123 (45%), Positives = 71/123 (58%), Gaps = 12/123 (10%)
 Frame = +3

Query  90   IIGSTAAC--YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGR  263
            I+ S   C  + +I  FGDS+ D GNL+ L    ++P   +PPYGETFF HPTGR  DGR
Sbjct  19   IVSSETPCQNFKSIISFGDSIADTGNLVGLSNRNNLPVTAFPPYGETFFHHPTGRSCDGR  78

Query  264  VILDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAVELHGFASSTPTPSVRFSIDRSI  443
            +I+D IAE+ GL   PP    K    G++  +GVNFAV     A +T   S  F + R I
Sbjct  79   IIMDFIAEFVGLPYVPPYFGSK---NGNF-DKGVNFAV-----AGATALES-SFLMKRGI  128

Query  444  SPH  452
             PH
Sbjct  129  HPH  131


 Score = 82.4 bits (202),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 55/88 (63%), Gaps = 4/88 (5%)
 Frame = +3

Query  114  YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILDLIAEYY  293
            + +I  FGDS+ D GNL+ L    ++P   +PPYGETFF HPTGR SDGR+I+D IAE+ 
Sbjct  453  FKSIISFGDSIADTGNLLGLSDPNNLPASAFPPYGETFFHHPTGRYSDGRLIIDFIAEFL  512

Query  294  GLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            G  +  P    +        ++GVNFAV
Sbjct  513  GFPLVHPFYGCQNAN----FEKGVNFAV  536



>ref|XP_006377555.1| hypothetical protein POPTR_0011s07620g, partial [Populus trichocarpa]
 gb|ERP55352.1| hypothetical protein POPTR_0011s07620g, partial [Populus trichocarpa]
Length=125

 Score = 88.2 bits (217),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 55/82 (67%), Gaps = 4/82 (5%)
 Frame = +3

Query  132  FGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILDLIAEYYGLAIPP  311
            FGDSL D GNL+H+   G +P   +PPYG+TFF H TGRCS+GR+++D IAEY GL    
Sbjct  1    FGDSLADTGNLVHMPQPGKLPPFVFPPYGKTFFNHATGRCSNGRLVIDFIAEYLGL----  56

Query  312  PSLSRKAQTGGDYIQQGVNFAV  377
            PS+     +   + + GVNF+V
Sbjct  57   PSVPYFGGSMKSFKEAGVNFSV  78



>emb|CDO96753.1| unnamed protein product [Coffea canephora]
Length=404

 Score = 92.0 bits (227),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 59/104 (57%), Gaps = 11/104 (11%)
 Frame = +3

Query  99   STAACYTAIFGFGDSLTDAGNLIHLE-----------TDGSVPHMYYPPYGETFFGHPTG  245
            S   CY +I  FGDSL D GNL+ L+           +  + PH + PPYGETFF HPTG
Sbjct  31   SAGTCYNSIISFGDSLADTGNLLRLDRLSSSSSSSSSSSNTPPHFFLPPYGETFFHHPTG  90

Query  246  RCSDGRVILDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            RCSDGR+++D IAE  G  +  P  + K   G     +G NFAV
Sbjct  91   RCSDGRLVIDFIAESLGFPLIRPYFAGKDIRGRSDFIKGSNFAV  134



>ref|XP_010462954.1| PREDICTED: uncharacterized protein LOC104743592 [Camelina sativa]
Length=799

 Score = 94.4 bits (233),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 64/98 (65%), Gaps = 8/98 (8%)
 Frame = +3

Query  93   IGSTAAC--YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRV  266
            + S   C  + +I  FGDSL D GNL+ L     +PH+ +PPYGETFF HPTGR S+GR+
Sbjct  433  VSSETQCREFKSIISFGDSLADTGNLLGLSDPNELPHVAFPPYGETFFHHPTGRFSNGRL  492

Query  267  ILDLIAEYYGLAIPPPSL-SRKAQTGGDYIQQGVNFAV  377
            I+D IAE+ GL + PP   S+KA       ++GVNFAV
Sbjct  493  IIDFIAEFLGLPLVPPFYGSQKAN-----FEKGVNFAV  525


 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 57/97 (59%), Gaps = 6/97 (6%)
 Frame = +3

Query  93   IGSTAAC--YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRV  266
            + S   C  + +I  FGDS+ D  NL+ L     +P   +PPYGE+F  HPTGR SDGR+
Sbjct  25   LNSQTQCKNFRSIISFGDSIADTENLLSLSDPNDLPGSAFPPYGESFLNHPTGRFSDGRL  84

Query  267  ILDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            I+D IAE+  L + PP    +  +     ++GVNFAV
Sbjct  85   IIDFIAEFLDLPLVPPFYGSQHAS----FEKGVNFAV  117



>ref|XP_010460979.1| PREDICTED: GDSL esterase/lipase At1g31550-like [Camelina sativa]
Length=387

 Score = 92.0 bits (227),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 62/98 (63%), Gaps = 6/98 (6%)
 Frame = +3

Query  90   IIGSTAAC--YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGR  263
            I+ S + C  + +I  FGDS+ D GNL+ L    ++P   +PPYGETFF HPTGR SDGR
Sbjct  17   IVCSESQCRNFESIISFGDSIADTGNLLGLSDRNNLPMSAFPPYGETFFHHPTGRYSDGR  76

Query  264  VILDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            +I+D IAE+ GL   PP    K +      ++GVNFAV
Sbjct  77   LIIDFIAEFLGLPYVPPYFGFKNRN----FEKGVNFAV  110



>ref|XP_002893537.1| hypothetical protein ARALYDRAFT_473078 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69796.1| hypothetical protein ARALYDRAFT_473078 [Arabidopsis lyrata subsp. 
lyrata]
Length=390

 Score = 92.0 bits (227),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 60/97 (62%), Gaps = 6/97 (6%)
 Frame = +3

Query  93   IGSTAAC--YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRV  266
            + S   C  + +I  FGDS+ D GNL+ L     +PHM +PPYGETFF HPTGR S+GR+
Sbjct  26   VSSETKCREFRSIISFGDSIADTGNLLGLSDPNDLPHMAFPPYGETFFHHPTGRFSNGRL  85

Query  267  ILDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            I+D IAE+ GL + PP    +         +GVNFAV
Sbjct  86   IIDFIAEFLGLPLVPPFYGSQNAN----FDKGVNFAV  118



>ref|XP_004485879.1| PREDICTED: GDSL esterase/lipase At2g27360-like [Cicer arietinum]
Length=383

 Score = 91.7 bits (226),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 57/125 (46%), Positives = 69/125 (55%), Gaps = 13/125 (10%)
 Frame = +3

Query  96   GSTAACYTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILD  275
            G+  A YT+IF FGDSLTD GNL  +    S P    PP+G+T F HP GRCSDGR+I+D
Sbjct  15   GTCRAYYTSIFSFGDSLTDTGNLNFISPPLS-PDCMLPPFGQTHFHHPNGRCSDGRLIID  73

Query  276  LIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV-----------ELHGF-ASSTPTPSV  419
             IAE  GL+   P L  K       I+ GVNFA+           E  GF   +T   S+
Sbjct  74   FIAESLGLSYVKPYLGFKNGEVTGNIENGVNFAIAGATALDLSFFEEKGFVVDATTNYSL  133

Query  420  RFSID  434
            RF ID
Sbjct  134  RFQID  138



>ref|XP_008647410.1| PREDICTED: uncharacterized protein LOC100193666 isoform X1 [Zea 
mays]
Length=322

 Score = 90.9 bits (224),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 62/90 (69%), Gaps = 10/90 (11%)
 Frame = +3

Query  114  YTAIFGFGDSLTDAGNLIHLETDGSVPHMY--YPPYGETFFGHPTGRCSDGRVILDLIAE  287
            Y A+F FGDSL DAGNL+   T+G   ++    PPYG+T+FG+PTGRCSDGR+++D IA+
Sbjct  46   YRAVFSFGDSLVDAGNLV---TEGIPDYLATARPPYGQTYFGYPTGRCSDGRLVVDFIAQ  102

Query  288  YYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
              GL +PPPS ++ A        QG NFA+
Sbjct  103  ELGLPLPPPSKAKNAS-----FAQGANFAI  127



>ref|XP_009629822.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Nicotiana tomentosiformis]
Length=385

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 50/95 (53%), Positives = 56/95 (59%), Gaps = 1/95 (1%)
 Frame = +3

Query  96   GSTAACYTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILD  275
            G    CY +I  FGDSLTD GNLI L    S      PPYGETFF HPTGR SDGR+++D
Sbjct  21   GLVLGCYESIISFGDSLTDTGNLIRLSKSNSHVASSVPPYGETFFHHPTGRFSDGRLVID  80

Query  276  LIAEYYGL-AIPPPSLSRKAQTGGDYIQQGVNFAV  377
             IAE  G   IPP +   K  T      +GVNFAV
Sbjct  81   FIAESMGFPLIPPYAGVMKNMTSNRNSIRGVNFAV  115



>ref|XP_008371712.1| PREDICTED: GDSL esterase/lipase At1g28600-like, partial [Malus 
domestica]
Length=434

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 62/96 (65%), Gaps = 3/96 (3%)
 Frame = +3

Query  90   IIGSTAACYTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVI  269
            +I   + C+++IF FGDSL D GNL  + +     H ++PPYG T+F  PTGRCSDGR++
Sbjct  8    LIPHASCCFSSIFSFGDSLADTGNL-KISSPNETVHFFFPPYGMTYFHRPTGRCSDGRLV  66

Query  270  LDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            +D IAEY GL +  P L  ++Q      + GVNFAV
Sbjct  67   IDFIAEYLGLPLVRPYL--ESQKSIQNFEGGVNFAV  100



>ref|XP_010499708.1| PREDICTED: GDSL esterase/lipase At1g31550-like isoform X2 [Camelina 
sativa]
Length=379

 Score = 91.3 bits (225),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 61/98 (62%), Gaps = 6/98 (6%)
 Frame = +3

Query  90   IIGSTAAC--YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGR  263
            I+ S + C  + +I  FGDS+ D GNL+ L    ++P   +PPYGETFF HPTGR SDG 
Sbjct  26   IVSSESQCRNFESIISFGDSIADTGNLLGLSDRNNLPMSAFPPYGETFFHHPTGRFSDGH  85

Query  264  VILDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            +I+D IAE+ GL   PP    K +      ++GVNFAV
Sbjct  86   LIIDFIAEFLGLPYVPPYFGSKNEN----FEKGVNFAV  119



>ref|XP_009393075.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Musa acuminata 
subsp. malaccensis]
Length=410

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 66/94 (70%), Gaps = 6/94 (6%)
 Frame = +3

Query  99   STAACYTAIFGFGDSLTDAGNLIH-LETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILD  275
            +T  CY++IF FGDSL D GNL+H L  DG+   +  PPYG T+F  PTGR SDGR+I+D
Sbjct  47   ATTGCYSSIFSFGDSLADTGNLLHTLGRDGT--RIGRPPYGMTYFHRPTGRFSDGRLIVD  104

Query  276  LIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
             IA+  GL + PP L  +  TGGD +++GVNFAV
Sbjct  105  FIAQAMGLPLLPPYL--EETTGGD-MRKGVNFAV  135



>ref|XP_010499707.1| PREDICTED: GDSL esterase/lipase At1g31550-like isoform X1 [Camelina 
sativa]
Length=396

 Score = 91.3 bits (225),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 61/98 (62%), Gaps = 6/98 (6%)
 Frame = +3

Query  90   IIGSTAAC--YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGR  263
            I+ S + C  + +I  FGDS+ D GNL+ L    ++P   +PPYGETFF HPTGR SDG 
Sbjct  26   IVSSESQCRNFESIISFGDSIADTGNLLGLSDRNNLPMSAFPPYGETFFHHPTGRFSDGH  85

Query  264  VILDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            +I+D IAE+ GL   PP    K +      ++GVNFAV
Sbjct  86   LIIDFIAEFLGLPYVPPYFGSKNEN----FEKGVNFAV  119



>gb|AAF24548.2|AC007508_11 F1K23.17 [Arabidopsis thaliana]
Length=823

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 54/123 (44%), Positives = 67/123 (54%), Gaps = 12/123 (10%)
 Frame = +3

Query  90   IIGSTAAC--YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGR  263
            I+ S   C  + +I  FGDS+ D GNL+ L     +P   +PPYGETFF HPTGR  DGR
Sbjct  19   IVSSETPCPNFKSIISFGDSIADTGNLVGLSDRNQLPVTAFPPYGETFFHHPTGRSCDGR  78

Query  264  VILDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAVELHGFASSTPTPSVRFSIDRSI  443
            +I+D IAE+ GL   PP    K +       +GVNFAV     A +T   S  F   R I
Sbjct  79   IIMDFIAEFVGLPYVPPYFGSKNRN----FDKGVNFAV-----AGATALKS-SFLKKRGI  128

Query  444  SPH  452
             PH
Sbjct  129  QPH  131


 Score = 86.3 bits (212),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 58/97 (60%), Gaps = 6/97 (6%)
 Frame = +3

Query  93   IGSTAAC--YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRV  266
            + S   C  + +I  FGDS+ D GNL+ L     +P   +PPYGETFF HPTGR SDGR+
Sbjct  445  VNSQTQCRNFKSIISFGDSIADTGNLLGLSDPNDLPASAFPPYGETFFHHPTGRYSDGRL  504

Query  267  ILDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            I+D IAE+ G  + PP    +        ++GVNFAV
Sbjct  505  IIDFIAEFLGFPLVPPFYGCQNAN----FKKGVNFAV  537



>ref|NP_001132231.1| uncharacterized protein LOC100193666 precursor [Zea mays]
 gb|ACF80999.1| unknown [Zea mays]
Length=376

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 62/90 (69%), Gaps = 10/90 (11%)
 Frame = +3

Query  114  YTAIFGFGDSLTDAGNLIHLETDGSVPHMY--YPPYGETFFGHPTGRCSDGRVILDLIAE  287
            Y A+F FGDSL DAGNL+   T+G   ++    PPYG+T+FG+PTGRCSDGR+++D IA+
Sbjct  32   YRAVFSFGDSLVDAGNLV---TEGIPDYLATARPPYGQTYFGYPTGRCSDGRLVVDFIAQ  88

Query  288  YYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
              GL +PPPS ++ A        QG NFA+
Sbjct  89   ELGLPLPPPSKAKNAS-----FAQGANFAI  113



>gb|KJB63193.1| hypothetical protein B456_009G437100 [Gossypium raimondii]
Length=399

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 60/99 (61%), Gaps = 4/99 (4%)
 Frame = +3

Query  90   IIGSTA-ACYTAIFGFGDSLTDAGNLIHLETDGSV--PHMYYPPYGETFFGHPTGRCSDG  260
            II S    C+T+IF FGDSLTD GNL+ +    S   PH  + PYG TFF HPTGR  DG
Sbjct  25   IINSQVNGCFTSIFSFGDSLTDTGNLLEISLSDSTNPPHSAFLPYGRTFFHHPTGRFCDG  84

Query  261  RVILDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            R+++D IAE  G +  PP    K+     + Q+G NFAV
Sbjct  85   RLVIDFIAEALGFSFLPPFYGSKSGKWEKF-QKGANFAV  122



>ref|XP_006362447.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Solanum tuberosum]
Length=400

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 61/93 (66%), Gaps = 6/93 (6%)
 Frame = +3

Query  111  CYTAIFGFGDSLTDAGNLIHLETDGSVP-HMYYPPYGETFFGHPTGRCSDGRVILDLIAE  287
            C+ +I  FGDSL D GN +H+  +   P H   PPYGETFF HPTGR SDGR+++D IAE
Sbjct  28   CFDSIISFGDSLADTGNKLHITLNKIPPSHFSLPPYGETFFHHPTGRFSDGRLVIDFIAE  87

Query  288  YYGLAIPPPSLSRKAQTGGDYI---QQGVNFAV  377
             +GL + P  L  K +   +YI   +QGVNFAV
Sbjct  88   SFGLPLVPAYLEGKDER--NYIVKFRQGVNFAV  118



>gb|EEE65824.1| hypothetical protein OsJ_21563 [Oryza sativa Japonica Group]
Length=411

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 64/95 (67%), Gaps = 10/95 (11%)
 Frame = +3

Query  99   STAACYTAIFGFGDSLTDAGNLIHLETDGSVPHMY--YPPYGETFFGHPTGRCSDGRVIL  272
            S A  Y A+F FGDSL DAGNL+   TDG   ++    PPYG+T+FG+PTGRCSDGR+++
Sbjct  28   SAAGKYRAVFNFGDSLVDAGNLV---TDGIPDYLATARPPYGQTYFGYPTGRCSDGRLVV  84

Query  273  DLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            D IA+ +GL + PPS ++ A        +G NFA+
Sbjct  85   DFIAQEFGLPLLPPSKAKNAS-----FARGANFAI  114



>ref|XP_009421256.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Musa acuminata 
subsp. malaccensis]
Length=370

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 60/96 (63%), Gaps = 6/96 (6%)
 Frame = +3

Query  93   IGSTAACYTAIFGFGDSLTDAGNLIHLETDG-SVPHMYYPPYGETFFGHPTGRCSDGRVI  269
            + S+   + AIF FGDSL+D GN +    +    P++   PYG TFFGHPTGRCSDGR+I
Sbjct  17   LSSSTRTFDAIFNFGDSLSDTGNFLIANANAFPAPNIGNTPYGMTFFGHPTGRCSDGRLI  76

Query  270  LDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            +D  AE +GL + PP LSR          +GVNFAV
Sbjct  77   IDFFAEAFGLPLLPPFLSRNQS-----FARGVNFAV  107



>gb|AFW76565.1| hypothetical protein ZEAMMB73_187768 [Zea mays]
Length=390

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 62/90 (69%), Gaps = 10/90 (11%)
 Frame = +3

Query  114  YTAIFGFGDSLTDAGNLIHLETDGSVPHMY--YPPYGETFFGHPTGRCSDGRVILDLIAE  287
            Y A+F FGDSL DAGNL+   T+G   ++    PPYG+T+FG+PTGRCSDGR+++D IA+
Sbjct  46   YRAVFSFGDSLVDAGNLV---TEGIPDYLATARPPYGQTYFGYPTGRCSDGRLVVDFIAQ  102

Query  288  YYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
              GL +PPPS ++ A        QG NFA+
Sbjct  103  ELGLPLPPPSKAKNAS-----FAQGANFAI  127



>ref|XP_002267261.1| PREDICTED: GDSL esterase/lipase At1g28580 [Vitis vinifera]
Length=375

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/89 (52%), Positives = 56/89 (63%), Gaps = 6/89 (7%)
 Frame = +3

Query  111  CYTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILDLIAEY  290
            CY +IF FGDSLTD GNL+      ++PH   PPYGETFF  PTGRCSDGR+I+D IA +
Sbjct  20   CYESIFSFGDSLTDTGNLLLASPAHNLPHFAKPPYGETFFHRPTGRCSDGRLIIDFIAGF  79

Query  291  YGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
             GL +  P L           +Q VNFA+
Sbjct  80   LGLPLIHPYLETTDP------RQSVNFAI  102



>emb|CDY15655.1| BnaA07g08260D [Brassica napus]
Length=393

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 60/95 (63%), Gaps = 4/95 (4%)
 Frame = +3

Query  93   IGSTAACYTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVIL  272
            I ++ + + +I  FGDS+ D GNL+ L     +PH+ +PPYGETFF H TGR S+GR+I+
Sbjct  23   IANSESRFKSIISFGDSIADTGNLLGLSDPNDLPHVAFPPYGETFFNHSTGRFSNGRLII  82

Query  273  DLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            D IAEY GL + PP    +         +GVNFAV
Sbjct  83   DFIAEYLGLPLVPPFYGSQNAN----FDKGVNFAV  113



>ref|XP_010501634.1| PREDICTED: uncharacterized protein LOC104778924 [Camelina sativa]
Length=818

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 61/97 (63%), Gaps = 6/97 (6%)
 Frame = +3

Query  93   IGSTAAC--YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRV  266
            + S   C  + +I  FGDS+ D GNL+ L    ++PH  +PPYGETFF HPTGR S+GRV
Sbjct  23   VSSETQCREFKSIISFGDSIADTGNLLGLSDPNNLPHFAFPPYGETFFHHPTGRFSNGRV  82

Query  267  ILDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            I+D IAE+  L + PP    +      Y ++GVNFAV
Sbjct  83   IIDFIAEFLDLPLVPPFYGSQ----NAYFEKGVNFAV  115


 Score = 85.1 bits (209),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 58/97 (60%), Gaps = 6/97 (6%)
 Frame = +3

Query  93   IGSTAAC--YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRV  266
            + S   C  + +I  FGDS+ D GN + L    ++PH  +PPYGETFF H TGR S+GR+
Sbjct  447  VSSETKCREFKSIISFGDSVADTGNFLGLSDRNNLPHFAFPPYGETFFHHATGRFSNGRL  506

Query  267  ILDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            I+D IAE+  L + PP    +        ++GVNFAV
Sbjct  507  IIDFIAEFLSLPLVPPFYGSQNAN----FEKGVNFAV  539



>ref|XP_004983111.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Setaria italica]
Length=395

 Score = 90.5 bits (223),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 68/117 (58%), Gaps = 10/117 (9%)
 Frame = +3

Query  114  YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILDLIAEYY  293
            Y  +F FGDSLTD GN +HL   G  P    PPYGETFF  PTGR SDGR+++D I E  
Sbjct  37   YDRVFSFGDSLTDTGNALHLSPSGGGP-ASRPPYGETFFRRPTGRASDGRLVVDFIVEAL  95

Query  294  GLAIPPPSLSRKAQTGGDYIQQGVNFAV------ELHGFASSTPTPSVRFSIDRSIS  446
            GL  P P L+ KA    D+ ++GVNFAV      ++H F S    P V  S++   S
Sbjct  96   GLPHPTPYLAGKA--AADF-RRGVNFAVGGATALDVHFFESRGLAPFVPVSLNNQTS  149



>ref|XP_004965533.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Setaria italica]
Length=400

 Score = 90.5 bits (223),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 60/88 (68%), Gaps = 6/88 (7%)
 Frame = +3

Query  114  YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILDLIAEYY  293
            Y AIF FGDSL+DAGNLI   T  ++     PPYG TFF  PTGRCS+GR+++D +AE++
Sbjct  59   YRAIFSFGDSLSDAGNLIVNGTPKALTTAR-PPYGMTFFRKPTGRCSNGRLVVDFLAEHF  117

Query  294  GLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            GL +PPPS     Q  G   ++G NFA+
Sbjct  118  GLPLPPPS-----QAQGKDFRKGANFAI  140



>gb|EEC80750.1| hypothetical protein OsI_23233 [Oryza sativa Indica Group]
Length=375

 Score = 90.1 bits (222),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 64/95 (67%), Gaps = 10/95 (11%)
 Frame = +3

Query  99   STAACYTAIFGFGDSLTDAGNLIHLETDGSVPHMY--YPPYGETFFGHPTGRCSDGRVIL  272
            S A  Y A+F FGDSL DAGNL+   TDG   ++    PPYG+T+FG+PTGRCSDGR+++
Sbjct  28   SAAGKYRAVFNFGDSLVDAGNLV---TDGIPDYLATARPPYGQTYFGYPTGRCSDGRLVV  84

Query  273  DLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            D IA+ +GL + PPS ++ A        +G NFA+
Sbjct  85   DFIAQEFGLPLLPPSKAKNAS-----FARGANFAI  114



>ref|NP_001057785.1| Os06g0531600 [Oryza sativa Japonica Group]
 dbj|BAD54227.1| putative lipase [Oryza sativa Japonica Group]
 dbj|BAF19699.1| Os06g0531600 [Oryza sativa Japonica Group]
 dbj|BAG87200.1| unnamed protein product [Oryza sativa Japonica Group]
Length=375

 Score = 90.1 bits (222),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 64/95 (67%), Gaps = 10/95 (11%)
 Frame = +3

Query  99   STAACYTAIFGFGDSLTDAGNLIHLETDGSVPHMY--YPPYGETFFGHPTGRCSDGRVIL  272
            S A  Y A+F FGDSL DAGNL+   TDG   ++    PPYG+T+FG+PTGRCSDGR+++
Sbjct  28   SAAGKYRAVFNFGDSLVDAGNLV---TDGIPDYLATARPPYGQTYFGYPTGRCSDGRLVV  84

Query  273  DLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            D IA+ +GL + PPS ++ A        +G NFA+
Sbjct  85   DFIAQEFGLPLLPPSKAKNAS-----FARGANFAI  114



>ref|NP_174180.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q9FXJ2.1|GDL7_ARATH RecName: Full=GDSL esterase/lipase At1g28580; AltName: Full=Extracellular 
lipase At1g28580; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAG22836.1|AC007508_13 F1K23.18 [Arabidopsis thaliana]
 gb|AAK32776.1|AF361608_1 At1g28580/F1K23_7 [Arabidopsis thaliana]
 gb|AAK76488.1| putative lipase [Arabidopsis thaliana]
 gb|AAL69539.1| At1g28580/F1K23_7 [Arabidopsis thaliana]
 gb|AAL85126.1| putative lipase [Arabidopsis thaliana]
 gb|AEE30996.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=390

 Score = 90.1 bits (222),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 59/97 (61%), Gaps = 6/97 (6%)
 Frame = +3

Query  93   IGSTAAC--YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRV  266
            + S   C  + +I  FGDS+ D GNL+ L     +PHM +PPYGE FF HPTGR S+GR+
Sbjct  26   VSSETKCREFKSIISFGDSIADTGNLLGLSDPKDLPHMAFPPYGENFFHHPTGRFSNGRL  85

Query  267  ILDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            I+D IAE+ GL + PP             ++GVNFAV
Sbjct  86   IIDFIAEFLGLPLVPPFYGSHNAN----FEKGVNFAV  118



>ref|XP_009347996.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Pyrus x bretschneideri]
Length=376

 Score = 90.1 bits (222),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 60/91 (66%), Gaps = 3/91 (3%)
 Frame = +3

Query  105  AACYTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILDLIA  284
            + C+++IF FGDSL D GNL  + +     H ++PPYG T+F  PTGRCSDGR+++D IA
Sbjct  26   SCCFSSIFSFGDSLADTGNL-KISSPNETIHFFFPPYGMTYFHLPTGRCSDGRLVIDFIA  84

Query  285  EYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            EY GL +  P L  ++Q      + GVNFAV
Sbjct  85   EYLGLPLVRPYL--ESQKSIQNFEGGVNFAV  113



>ref|XP_009792971.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Nicotiana sylvestris]
Length=384

 Score = 90.1 bits (222),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 49/95 (52%), Positives = 55/95 (58%), Gaps = 1/95 (1%)
 Frame = +3

Query  96   GSTAACYTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILD  275
            G    CY +I  FGDSLTD GNLI L           PPYGETFF HPTGR SDGR+I+D
Sbjct  20   GLVLGCYESIISFGDSLTDTGNLIRLSKSNKHVASSVPPYGETFFHHPTGRFSDGRLIID  79

Query  276  LIAEYYGL-AIPPPSLSRKAQTGGDYIQQGVNFAV  377
             IAE  G   IPP +   K  T      +G+NFAV
Sbjct  80   FIAESMGFPLIPPYAGVMKNMTSSRNSIRGINFAV  114



>ref|XP_002439449.1| hypothetical protein SORBIDRAFT_09g006580 [Sorghum bicolor]
 gb|EES17879.1| hypothetical protein SORBIDRAFT_09g006580 [Sorghum bicolor]
Length=317

 Score = 89.4 bits (220),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 58/121 (48%), Positives = 74/121 (61%), Gaps = 18/121 (15%)
 Frame = +3

Query  105  AACYTAIFGFGDSLTDAGNLIHLETDGSVPH---MYYPPYGETFFGHPTGRCSDGRVILD  275
            A  Y AI+ FGDS++D GNL      G  P    M  PPYGETFF  PTGRCSDGRVI+D
Sbjct  24   AQQYNAIWSFGDSISDTGNLC----VGGCPAWLTMGQPPYGETFFHRPTGRCSDGRVIVD  79

Query  276  LIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV---ELHGFASSTPTPS-VRF-SIDRS  440
             +AE++GL +PP S     + GGD+ ++G N A+         SSTP  S +RF ++ RS
Sbjct  80   FLAEHFGLPLPPAS-----KAGGDF-KKGANMAIISATTMNSTSSTPLASEIRFGTMGRS  133

Query  441  I  443
            I
Sbjct  134  I  134



>gb|EPS71267.1| hypothetical protein M569_03493 [Genlisea aurea]
Length=402

 Score = 90.1 bits (222),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 64/118 (54%), Gaps = 8/118 (7%)
 Frame = +3

Query  90   IIGSTAACYTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVI  269
            +  + AA Y +IF FGDSL D GN I   +    P +   PYG TFF  PTGRCSDGR++
Sbjct  46   VTAAGAASYDSIFSFGDSLADTGNFIVSGSAVKFPVIAKLPYGMTFFHRPTGRCSDGRLV  105

Query  270  LDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAVELHGFASSTPTPSVRFSIDRSI  443
            LD IAE YGL   PP L+ K   G    + G NFAV      +       +F +DR +
Sbjct  106  LDFIAEAYGLPYVPPYLAGKNDVGN--FRHGANFAV------AGATAMDAKFFVDRKL  155



>ref|XP_010478237.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Camelina sativa]
Length=415

 Score = 90.1 bits (222),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 61/97 (63%), Gaps = 6/97 (6%)
 Frame = +3

Query  93   IGSTAAC--YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRV  266
            + S   C  + +I  FGDS+ D GNL+ L     +PH+ +PPYGETFF HPTGR S+GR+
Sbjct  44   VSSETQCRQFKSIISFGDSIADTGNLLGLSDPNELPHVAFPPYGETFFHHPTGRFSNGRL  103

Query  267  ILDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            I+D IA++ GL + PP    +        ++GVNFAV
Sbjct  104  IIDFIADFLGLPLVPPFYGSQNAN----FEKGVNFAV  136



>ref|XP_002438501.1| hypothetical protein SORBIDRAFT_10g020950 [Sorghum bicolor]
 gb|EER89868.1| hypothetical protein SORBIDRAFT_10g020950 [Sorghum bicolor]
Length=399

 Score = 90.1 bits (222),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 60/88 (68%), Gaps = 6/88 (7%)
 Frame = +3

Query  114  YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILDLIAEYY  293
            YTAIF FGDSL+DAGNLI   T  ++     PPYG TFF  PTGRCS+GR+++D +AE++
Sbjct  58   YTAIFSFGDSLSDAGNLIVNGTPKALTTAR-PPYGMTFFRKPTGRCSNGRLVVDFLAEHF  116

Query  294  GLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            GL +P PS     Q  G   ++G NFA+
Sbjct  117  GLPLPQPS-----QAKGKDFKKGANFAI  139



>gb|KEH36573.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=342

 Score = 89.4 bits (220),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 62/98 (63%), Gaps = 6/98 (6%)
 Frame = +3

Query  90   IIGSTAA--CYTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGR  263
            ++ +TAA  CY++IF FGDSLTD GNL  +    S P    PPYG+T F HP GRCSDGR
Sbjct  19   LVFTTAATSCYSSIFSFGDSLTDTGNLYFISQPQS-PDCLLPPYGKTHFHHPNGRCSDGR  77

Query  264  VILDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            +I+D IAE++ L    P L       G  I+ GVNFAV
Sbjct  78   LIVDFIAEFFRLPYLKPYLGF---INGGNIEHGVNFAV  112



>ref|XP_008785390.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Phoenix dactylifera]
Length=364

 Score = 89.4 bits (220),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 59/93 (63%), Gaps = 6/93 (6%)
 Frame = +3

Query  99   STAACYTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILDL  278
            ST   YT+IF FGDSL D GN + + +  S P     PYG TFF HPTGRC DGR+I+D 
Sbjct  20   STLLNYTSIFSFGDSLADTGNAL-IYSKSSSPAFGRLPYGMTFFRHPTGRCCDGRLIVDF  78

Query  279  IAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            IA  +GL + PP L+      G  IQQGVNFAV
Sbjct  79   IATAFGLPLLPPYLAH-----GQNIQQGVNFAV  106



>ref|XP_006828268.1| hypothetical protein AMTR_s00023p00212280 [Amborella trichopoda]
 gb|ERM95684.1| hypothetical protein AMTR_s00023p00212280 [Amborella trichopoda]
Length=377

 Score = 89.7 bits (221),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 48/98 (49%), Positives = 65/98 (66%), Gaps = 3/98 (3%)
 Frame = +3

Query  84   ACIIGSTAACYTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGR  263
            A  + S    Y+A+F FGDSL D GNL+ L        + +PP+GETFF  PTGRCSDGR
Sbjct  24   ASKVHSKKGNYSALFSFGDSLADTGNLL-LSGHSPFIRIAHPPFGETFFHKPTGRCSDGR  82

Query  264  VILDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            +++D +AE +GL + PP LS K +   D+ ++GVNFAV
Sbjct  83   LVVDFVAEAFGLPLLPPYLS-KLKGPADF-RKGVNFAV  118



>ref|XP_006645634.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Oryza brachyantha]
Length=379

 Score = 89.7 bits (221),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 59/92 (64%), Gaps = 12/92 (13%)
 Frame = +3

Query  114  YTAIFGFGDSLTDAGNLI----HLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILDLI  281
            YT+IF FGDS +DAGN++    H + D +   M  PPYG TFFGHPTGR SDGR+I+D I
Sbjct  27   YTSIFSFGDSFSDAGNIVFIYGHRKPDLT---MVKPPYGMTFFGHPTGRLSDGRLIVDFI  83

Query  282  AEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            AE  GL +PPPS +          +QG NFA 
Sbjct  84   AEALGLPLPPPSFAANRS-----FEQGANFAT  110



>ref|NP_180304.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q9ZQI3.1|GDL40_ARATH RecName: Full=GDSL esterase/lipase At2g27360; AltName: Full=Extracellular 
lipase At2g27360; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAD41994.1| putative lipase [Arabidopsis thaliana]
 gb|AAM15186.1| putative lipase [Arabidopsis thaliana]
 gb|AEC07985.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=394

 Score = 89.7 bits (221),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 64/98 (65%), Gaps = 6/98 (6%)
 Frame = +3

Query  90   IIGSTAAC--YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGR  263
            ++ S   C  + +I  FGDS+TD GNL+ L +   +P   +PPYGETFF HP+GR SDGR
Sbjct  21   VVTSQTRCRNFKSIISFGDSITDTGNLLGLSSPNDLPESAFPPYGETFFHHPSGRFSDGR  80

Query  264  VILDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            +I+D IAE+ G+   PP    K    G++ ++GVNFAV
Sbjct  81   LIIDFIAEFLGIPHVPPFYGSK---NGNF-EKGVNFAV  114



>emb|CDX94632.1| BnaC07g10260D [Brassica napus]
Length=382

 Score = 89.4 bits (220),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 44/98 (45%), Positives = 60/98 (61%), Gaps = 6/98 (6%)
 Frame = +3

Query  90   IIGSTAAC--YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGR  263
            ++ S   C  + +I  FGDS+ D GNL+ L     +P + +PPYGETFF HPTGR S+GR
Sbjct  26   VVNSETNCRNFKSIISFGDSIADTGNLLGLSDPNDLPKVAFPPYGETFFHHPTGRFSNGR  85

Query  264  VILDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            +I+D IAE+ G  + PP    +        +QGVNFAV
Sbjct  86   LIIDFIAEFLGFPLVPPFYGSQNAN----FEQGVNFAV  119



>dbj|BAD44668.1| putative lipase [Arabidopsis thaliana]
Length=390

 Score = 89.7 bits (221),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 64/98 (65%), Gaps = 6/98 (6%)
 Frame = +3

Query  90   IIGSTAAC--YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGR  263
            ++ S   C  + +I  FGDS+TD GNL+ L +   +P   +PPYGETFF HP+GR SDGR
Sbjct  17   VVTSQTRCRNFKSIISFGDSITDTGNLLGLSSPNDLPESAFPPYGETFFHHPSGRFSDGR  76

Query  264  VILDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            +I+D IAE+ G+   PP    K    G++ ++GVNFAV
Sbjct  77   LIIDFIAEFLGIPHVPPFYGSK---NGNF-EKGVNFAV  110



>ref|XP_009352806.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Pyrus x bretschneideri]
Length=373

 Score = 89.4 bits (220),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 60/99 (61%), Gaps = 3/99 (3%)
 Frame = +3

Query  90   IIGSTAACYTAIFGFGDSLTDAGNLI--HLETDGSVPHMYYPPYGETFFGHPTGRCSDGR  263
            II     CYT+I GFGDSL D GN+    L+      H ++PPYGET+F HPTGRC DGR
Sbjct  12   IIPHANCCYTSIIGFGDSLADTGNIYVDALDHHKGPYHFFFPPYGETYFHHPTGRCCDGR  71

Query  264  VILDLIAEYYGLAIPPPSLS-RKAQTGGDYIQQGVNFAV  377
            +I+DLIAE   L +  P L           +++GVNFAV
Sbjct  72   LIIDLIAESMRLPLIRPYLEVLNVNETMRNLEEGVNFAV  110



>gb|ACU19966.1| unknown [Glycine max]
Length=224

 Score = 87.8 bits (216),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 50/91 (55%), Positives = 58/91 (64%), Gaps = 4/91 (4%)
 Frame = +3

Query  111  CYTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILDLIAEY  290
            CYT++F FGDSLTD GNL  +    S P    PPYG+T F  P GRCSDGR+ILD +AE 
Sbjct  34   CYTSLFSFGDSLTDTGNLYFISPRQS-PDCLLPPYGQTHFHRPNGRCSDGRLILDFLAES  92

Query  291  YGLAIPPPSLSRK--AQTGGDYIQQGVNFAV  377
             GL    P L  K  A   G+ I+QGVNFAV
Sbjct  93   LGLPYVKPYLGFKNGAVKRGN-IEQGVNFAV  122



>ref|XP_008812182.1| PREDICTED: GDSL esterase/lipase At1g28570-like, partial [Phoenix 
dactylifera]
Length=319

 Score = 88.6 bits (218),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 59/93 (63%), Gaps = 6/93 (6%)
 Frame = +3

Query  99   STAACYTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILDL  278
            +T +CYT+IF FGDSL D GN +H    G    +   PYGET+F HPTGR SDGR+I+D 
Sbjct  27   ATTSCYTSIFSFGDSLADTGNFLHYANQGPEARL---PYGETYFQHPTGRFSDGRLIIDF  83

Query  279  IAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            IA+  GL + PP L+     G    ++G NFAV
Sbjct  84   IAQAIGLPLVPPYLAGPGDHG---FRRGANFAV  113



>ref|XP_010478238.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Camelina sativa]
Length=415

 Score = 89.7 bits (221),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 61/98 (62%), Gaps = 6/98 (6%)
 Frame = +3

Query  90   IIGSTAAC--YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGR  263
            I+ S   C  + +I  FGDS+ D GNL+ L     +P   +PPYGETFF HPTGR  DGR
Sbjct  33   IVSSETLCRNFESIISFGDSIADTGNLVALSDHNHLPGPAFPPYGETFFHHPTGRSCDGR  92

Query  264  VILDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            +I+D IAE+ GL   PP    K    G++ ++GVNFA+
Sbjct  93   IIIDFIAEFLGLPYVPPYFGSK---NGNF-EKGVNFAI  126



>gb|AFK42362.1| unknown [Medicago truncatula]
Length=375

 Score = 89.0 bits (219),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 62/98 (63%), Gaps = 6/98 (6%)
 Frame = +3

Query  90   IIGSTAA--CYTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGR  263
            ++ +TAA  CY++IF FGDSLTD GNL  +    S P    PPYG+T F HP GRCSDGR
Sbjct  19   LVFTTAATSCYSSIFSFGDSLTDTGNLYFISQPQS-PDCLLPPYGKTHFHHPNGRCSDGR  77

Query  264  VILDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            +I+D IAE++ L    P L       G  I+ GVNFAV
Sbjct  78   LIVDFIAEFFRLPYLKPYLGF---INGGNIEHGVNFAV  112



>ref|XP_010460658.1| PREDICTED: GDSL esterase/lipase At1g28580-like isoform X2 [Camelina 
sativa]
Length=394

 Score = 89.4 bits (220),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 59/97 (61%), Gaps = 6/97 (6%)
 Frame = +3

Query  93   IGSTAAC--YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRV  266
            + S   C  + +I  FGDS+ D GN + L    ++PH  +PPYGETFF HPTGR S+GRV
Sbjct  26   VSSKTQCREFKSIISFGDSIADTGNFLGLSDPNNLPHFAFPPYGETFFHHPTGRFSNGRV  85

Query  267  ILDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            I+D IAE+  L + PP    +        ++GVNFAV
Sbjct  86   IIDFIAEFLSLPLVPPFYGSQNAN----FEKGVNFAV  118



>ref|XP_003546023.2| PREDICTED: GDSL esterase/lipase At1g31550-like [Glycine max]
Length=391

 Score = 89.4 bits (220),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 61/92 (66%), Gaps = 3/92 (3%)
 Frame = +3

Query  105  AAC-YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILDLI  281
            AAC YT+IF FGDS  D GNL +L +     H ++PPYGET+F   TGRCSDGR+I+D I
Sbjct  36   AACPYTSIFSFGDSFADTGNL-YLSSHPPTHHCFFPPYGETYFHRVTGRCSDGRLIIDFI  94

Query  282  AEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            AE  GL +  P    K + GG  +++G NFAV
Sbjct  95   AESLGLPLVKPYFGIK-KFGGWSVEEGANFAV  125



>ref|XP_003593737.1| GDSL esterase/lipase [Medicago truncatula]
 gb|AES63988.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=375

 Score = 89.0 bits (219),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 62/98 (63%), Gaps = 6/98 (6%)
 Frame = +3

Query  90   IIGSTAA--CYTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGR  263
            ++ +TAA  CY++IF FGDSLTD GNL  +    S P    PPYG+T F HP GRCSDGR
Sbjct  19   LVFTTAATSCYSSIFSFGDSLTDTGNLYFISQPQS-PDCLLPPYGKTHFHHPNGRCSDGR  77

Query  264  VILDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            +I+D IAE++ L    P L       G  I+ GVNFAV
Sbjct  78   LIVDFIAEFFRLPYLKPYLGF---INGGNIEHGVNFAV  112



>ref|XP_010460657.1| PREDICTED: GDSL esterase/lipase At1g28580-like isoform X1 [Camelina 
sativa]
Length=397

 Score = 89.4 bits (220),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 59/97 (61%), Gaps = 6/97 (6%)
 Frame = +3

Query  93   IGSTAAC--YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRV  266
            + S   C  + +I  FGDS+ D GN + L    ++PH  +PPYGETFF HPTGR S+GRV
Sbjct  26   VSSKTQCREFKSIISFGDSIADTGNFLGLSDPNNLPHFAFPPYGETFFHHPTGRFSNGRV  85

Query  267  ILDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            I+D IAE+  L + PP    +        ++GVNFAV
Sbjct  86   IIDFIAEFLSLPLVPPFYGSQNAN----FEKGVNFAV  118



>ref|XP_009102892.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Brassica rapa]
Length=395

 Score = 89.0 bits (219),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 43/88 (49%), Positives = 56/88 (64%), Gaps = 4/88 (5%)
 Frame = +3

Query  114  YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILDLIAEYY  293
            + +I  FGDS+ D GNL+ L     +PH+ +PPYGETFF H TGR S+GR+I+D IAEY 
Sbjct  30   FKSIISFGDSIADTGNLLGLSDPNDLPHVAFPPYGETFFNHSTGRFSNGRLIIDFIAEYL  89

Query  294  GLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            GL + PP    +         +GVNFAV
Sbjct  90   GLPLVPPFYGSQNAN----FDKGVNFAV  113



>ref|XP_009102895.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Brassica rapa]
Length=382

 Score = 89.0 bits (219),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 43/98 (44%), Positives = 61/98 (62%), Gaps = 6/98 (6%)
 Frame = +3

Query  90   IIGSTAAC--YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGR  263
            ++ S   C  + +I  FGDS+ D GNL+ L    ++P + +PPYGETFF HPTGR S+GR
Sbjct  26   VVNSETTCRNFKSIISFGDSIADTGNLLGLSDPNNLPKVAFPPYGETFFHHPTGRFSNGR  85

Query  264  VILDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            +I+D IAE+ G  + PP    +        ++GVNFAV
Sbjct  86   LIIDFIAEFLGFPLVPPFYGSQNAN----FEKGVNFAV  119



>ref|XP_010540487.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Tarenaya hassleriana]
Length=402

 Score = 89.0 bits (219),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 58/93 (62%), Gaps = 2/93 (2%)
 Frame = +3

Query  99   STAACYTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILDL  278
            S   CY +I  FGDS+ D GNL+ L     VP + +PPYGETFF  PTGR SDGR+++D 
Sbjct  36   SRRRCYDSIISFGDSIADTGNLLSLSEPSHVPQVAFPPYGETFFHRPTGRFSDGRLVIDF  95

Query  279  IAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            IA+  GL +  P     ++ G    ++GVNFAV
Sbjct  96   IADSMGLPLVRPYFG--SRNGNGSFERGVNFAV  126



>emb|CDY15658.1| BnaA07g08290D [Brassica napus]
Length=386

 Score = 89.0 bits (219),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 43/98 (44%), Positives = 61/98 (62%), Gaps = 6/98 (6%)
 Frame = +3

Query  90   IIGSTAAC--YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGR  263
            ++ S   C  + +I  FGDS+ D GNL+ L    ++P + +PPYGETFF HPTGR S+GR
Sbjct  26   VVNSETTCRNFKSIISFGDSIADTGNLLGLSDPNNLPKVAFPPYGETFFHHPTGRFSNGR  85

Query  264  VILDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            +I+D IAE+ G  + PP    +        ++GVNFAV
Sbjct  86   LIIDFIAEFLGFPLVPPFYGSQNAN----FEKGVNFAV  119



>gb|AAX59709.1| lipase 1 [Brassica napus]
Length=373

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/98 (44%), Positives = 61/98 (62%), Gaps = 6/98 (6%)
 Frame = +3

Query  90   IIGSTAAC--YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGR  263
            ++ S   C  + +I  FGDS+ D GNL+ L    ++P + +PPYGETFF HPTGR S+GR
Sbjct  17   VVNSETTCRNFKSIISFGDSIADTGNLLGLSDPNNLPKVAFPPYGETFFHHPTGRFSNGR  76

Query  264  VILDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            +I+D IAE+ G  + PP    +        ++GVNFAV
Sbjct  77   LIIDFIAEFLGFPLVPPFYGSQNAN----FEKGVNFAV  110



>ref|XP_002456059.1| hypothetical protein SORBIDRAFT_03g029650 [Sorghum bicolor]
 gb|EES01179.1| hypothetical protein SORBIDRAFT_03g029650 [Sorghum bicolor]
Length=391

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 51/101 (50%), Positives = 61/101 (60%), Gaps = 9/101 (9%)
 Frame = +3

Query  90   IIGST-----AACYTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCS  254
            +IGS+     A CYT IF FGDSLTD GN +HL      P+   PPYG TFFG PTGR S
Sbjct  32   VIGSSGSPVLAGCYTRIFSFGDSLTDTGNYVHLTATSHSPYGA-PPYGRTFFGKPTGRAS  90

Query  255  DGRVILDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            DGR+++D IAE  GLA      + +A T     Q G NFA+
Sbjct  91   DGRLVIDFIAEELGLA---KVTAIQAGTAPGDFQSGANFAI  128



>ref|NP_001151904.1| alpha-L-fucosidase 2 precursor [Zea mays]
 ref|XP_008673014.1| PREDICTED: alpha-L-fucosidase 2 isoform X1 [Zea mays]
 gb|ACF88251.1| unknown [Zea mays]
 gb|ACG44875.1| alpha-L-fucosidase 2 precursor [Zea mays]
 gb|ACR36958.1| unknown [Zea mays]
 tpg|DAA58327.1| TPA: alpha-L-fucosidase 2 [Zea mays]
Length=377

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 56/89 (63%), Gaps = 4/89 (4%)
 Frame = +3

Query  111  CYTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILDLIAEY  290
            CYT IF FGDSLTD GN +HL      P+   PPYG TFFG PTGR SDGR+++D IAE 
Sbjct  33   CYTRIFSFGDSLTDTGNYVHLTASSHSPYGA-PPYGRTFFGKPTGRASDGRLVIDFIAEE  91

Query  291  YGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            +GLA      + +A T     Q G NFA+
Sbjct  92   FGLA---KVTAIQAGTAPGDFQNGANFAI  117



>ref|XP_009113643.1| PREDICTED: GDSL esterase/lipase At2g27360-like isoform X2 [Brassica 
rapa]
Length=386

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 61/97 (63%), Gaps = 6/97 (6%)
 Frame = +3

Query  93   IGSTAAC--YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRV  266
            + S   C  + +I  FGDS+TD GNLI L T   +P   + PYGETFF HPTGR SDGR+
Sbjct  25   VSSETKCLNFQSIISFGDSITDTGNLIALSTPNELPESAFLPYGETFFHHPTGRYSDGRL  84

Query  267  ILDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            I+D IAE  GL   PP    K    G++ ++GVNFAV
Sbjct  85   IIDFIAEVLGLPHVPPFYGSK---NGNF-EKGVNFAV  117



>ref|XP_009113642.1| PREDICTED: GDSL esterase/lipase At2g27360-like isoform X1 [Brassica 
rapa]
 emb|CDY34089.1| BnaA09g27150D [Brassica napus]
Length=389

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 61/97 (63%), Gaps = 6/97 (6%)
 Frame = +3

Query  93   IGSTAAC--YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRV  266
            + S   C  + +I  FGDS+TD GNLI L T   +P   + PYGETFF HPTGR SDGR+
Sbjct  25   VSSETKCLNFQSIISFGDSITDTGNLIALSTPNELPESAFLPYGETFFHHPTGRYSDGRL  84

Query  267  ILDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            I+D IAE  GL   PP    K    G++ ++GVNFAV
Sbjct  85   IIDFIAEVLGLPHVPPFYGSK---NGNF-EKGVNFAV  117



>ref|XP_010925698.1| PREDICTED: GDSL esterase/lipase At1g28570-like isoform X3 [Elaeis 
guineensis]
Length=313

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 61/94 (65%), Gaps = 9/94 (10%)
 Frame = +3

Query  99   STAACYTAIFGFGDSLTDAGN-LIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILD  275
            ST   YT+IF FGDSL D GN LIH +++   P     PYG T+F HPTGRCSDGR+I+D
Sbjct  30   STQLNYTSIFSFGDSLADTGNALIHSKSN---PVFGRLPYGMTYFMHPTGRCSDGRLIVD  86

Query  276  LIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
             +A  +GL   PP L+      G  I+QGVNFAV
Sbjct  87   FLASAFGLPFLPPYLAH-----GQNIRQGVNFAV  115



>emb|CBI30663.3| unnamed protein product [Vitis vinifera]
Length=1124

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/89 (52%), Positives = 56/89 (63%), Gaps = 6/89 (7%)
 Frame = +3

Query  111  CYTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILDLIAEY  290
            CY +IF FGDSLTD GNL+      ++PH   PPYGETFF  PTGRCSDGR+I+D IA +
Sbjct  20   CYESIFSFGDSLTDTGNLLLASPAHNLPHFAKPPYGETFFHRPTGRCSDGRLIIDFIAGF  79

Query  291  YGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
             GL +  P L           +Q VNFA+
Sbjct  80   LGLPLIHPYLETTDP------RQSVNFAI  102


 Score = 83.6 bits (205),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 57/93 (61%), Gaps = 4/93 (4%)
 Frame = +3

Query  99   STAACYTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILDL  278
            S+   Y +IF FGDSL D GN + L    + P +   PYGETFF H TGRCSDGR+I+D 
Sbjct  367  SSVRRYESIFSFGDSLADTGNFL-LSGALAFPVIRELPYGETFFRHATGRCSDGRLIVDF  425

Query  279  IAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            IAE +G+   PP LS      G   + GVNFAV
Sbjct  426  IAEAFGIPYLPPYLSLGK---GKSFRHGVNFAV  455



>ref|XP_010925697.1| PREDICTED: GDSL esterase/lipase At1g28570-like isoform X2 [Elaeis 
guineensis]
Length=329

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 61/94 (65%), Gaps = 9/94 (10%)
 Frame = +3

Query  99   STAACYTAIFGFGDSLTDAGN-LIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILD  275
            ST   YT+IF FGDSL D GN LIH +++   P     PYG T+F HPTGRCSDGR+I+D
Sbjct  30   STQLNYTSIFSFGDSLADTGNALIHSKSN---PVFGRLPYGMTYFMHPTGRCSDGRLIVD  86

Query  276  LIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
             +A  +GL   PP L+      G  I+QGVNFAV
Sbjct  87   FLASAFGLPFLPPYLAH-----GQNIRQGVNFAV  115



>ref|XP_003593736.1| GDSL esterase/lipase [Medicago truncatula]
 gb|AES63987.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=399

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 63/95 (66%), Gaps = 4/95 (4%)
 Frame = +3

Query  102  TAAC--YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILD  275
            TAAC  Y++IF FGDS+ D GNL +L +     H ++PPYG+T+F HP+GRCSDGR+I+D
Sbjct  39   TAACSSYSSIFSFGDSIADTGNL-YLSSQPPSDHCFFPPYGQTYFHHPSGRCSDGRLIID  97

Query  276  LIAEYYGLAIPPPSLSRKAQTGGDY-IQQGVNFAV  377
             IAE  G+ +  P L  K     D   ++G NFAV
Sbjct  98   FIAESLGIPMVKPYLGIKNGVLEDNSAKEGANFAV  132



>emb|CDX94633.1| BnaC07g10250D [Brassica napus]
Length=396

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 59/98 (60%), Gaps = 6/98 (6%)
 Frame = +3

Query  90   IIGSTAAC--YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGR  263
            I+ S A C  + +I  FGDS  D GNLI L     +P   +PPYGETFF HPTGR S+GR
Sbjct  25   IVNSEAHCRNFKSIISFGDSTADTGNLIGLSDPDDLPAAAFPPYGETFFHHPTGRFSNGR  84

Query  264  VILDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            +I+D IAE+ GL   PP    +        ++GVNFAV
Sbjct  85   LIIDFIAEFLGLPFVPPFYGSQNAN----FEKGVNFAV  118



>ref|XP_006415636.1| hypothetical protein EUTSA_v10006895mg [Eutrema salsugineum]
 gb|ESQ33989.1| hypothetical protein EUTSA_v10006895mg [Eutrema salsugineum]
Length=753

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/88 (48%), Positives = 58/88 (66%), Gaps = 4/88 (5%)
 Frame = +3

Query  114  YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILDLIAEYY  293
            + +I  FGDS+ D GNL+ L     +PH+ +PPYGETFF HPTGR S+GR+++D IAE+ 
Sbjct  396  FKSIISFGDSIADTGNLVGLSDPNDLPHVAFPPYGETFFHHPTGRFSNGRLVIDFIAEFL  455

Query  294  GLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            GL + PP    +        ++GVNFAV
Sbjct  456  GLPLVPPFYGSQNAN----FEKGVNFAV  479


 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 61/97 (63%), Gaps = 6/97 (6%)
 Frame = +3

Query  93   IGSTAAC--YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRV  266
            + S   C  + +I  FGDS+ D GNLI L +   +P   +PPYGETFF HPTGR SDGR+
Sbjct  28   VRSETKCRSFESIISFGDSIADTGNLIGLSSPNQLPESAFPPYGETFFHHPTGRFSDGRL  87

Query  267  ILDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            ++D IAE+ G    PP    K    G++ ++GVNFAV
Sbjct  88   VIDFIAEFLGFPHVPPFYGSK---NGNF-EKGVNFAV  120



>ref|XP_003560692.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Brachypodium 
distachyon]
Length=352

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 60/91 (66%), Gaps = 12/91 (13%)
 Frame = +3

Query  114  YTAIFGFGDSLTDAGNLIHLETDGSVPHMY---YPPYGETFFGHPTGRCSDGRVILDLIA  284
            Y A+F FGDSL+DAGNLI    DG +P        PYG TFFG PTGRCS+GRV++D +A
Sbjct  37   YQAVFSFGDSLSDAGNLI---VDG-IPKSLTTARKPYGMTFFGRPTGRCSNGRVVVDFLA  92

Query  285  EYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            E++GL +PP S     Q  G   ++G NFA+
Sbjct  93   EHFGLPLPPAS-----QAHGTDFKKGANFAI  118



>ref|XP_008364168.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Malus domestica]
Length=311

 Score = 87.4 bits (215),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 61/100 (61%), Gaps = 5/100 (5%)
 Frame = +3

Query  90   IIGSTAACYTAIFGFGDSLTDAGN--LIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGR  263
            II     CYT+I GFGDSL D GN  L  L+      H ++PPYGE FF HPTGRC DGR
Sbjct  22   IIPHALGCYTSIIGFGDSLADTGNSYLNALDHHDKPFHFFFPPYGEDFFHHPTGRCCDGR  81

Query  264  VILDLIAEYYGLAIPPP--SLSRKAQTGGDYIQQGVNFAV  377
            +I+D IAE  GL +  P   +    +T  ++ ++G NFAV
Sbjct  82   LIIDFIAESLGLPLVRPYFEILNVNETXRNF-EEGANFAV  120



>ref|XP_010499396.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Camelina sativa]
Length=397

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 60/97 (62%), Gaps = 6/97 (6%)
 Frame = +3

Query  93   IGSTAAC--YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRV  266
            + S   C  + +I  FGDS+ D GNL+ L     +PH+ +PPYGETFF  PTGR S+GR+
Sbjct  26   VSSETQCREFKSIISFGDSIADTGNLLGLSGPNELPHVAFPPYGETFFHRPTGRFSNGRL  85

Query  267  ILDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            I+D IAE+ GL + PP    +        ++GVNFAV
Sbjct  86   IIDFIAEFLGLPLVPPFYGSQNAN----FEKGVNFAV  118



>ref|XP_010501635.1| PREDICTED: uncharacterized protein LOC104778925 [Camelina sativa]
Length=815

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 61/97 (63%), Gaps = 6/97 (6%)
 Frame = +3

Query  93   IGSTAAC--YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRV  266
            + S   C  + +I  FGDS+ D GNL+ L     +PH+ +PPYGETFF HPTGR S+GR+
Sbjct  435  VSSETQCREFKSIISFGDSIADTGNLLGLSDPNELPHVAFPPYGETFFHHPTGRFSNGRL  494

Query  267  ILDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            I+D +AE+ GL + PP    +        ++GVNFAV
Sbjct  495  IIDFLAEFLGLPLVPPFYGSQHAN----FEKGVNFAV  527


 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 59/97 (61%), Gaps = 6/97 (6%)
 Frame = +3

Query  93   IGSTAAC--YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRV  266
            + S   C  + +I  FGDS+ D GNL+ L     +P   +PPYG++F  HPTGR SDGR+
Sbjct  25   LNSQTQCKNFRSIISFGDSIADTGNLLSLADPSDLPGSAFPPYGKSFLNHPTGRFSDGRL  84

Query  267  ILDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            I+D IAE+ GL + PP    +  +     ++GVNFAV
Sbjct  85   IIDFIAEFLGLPLVPPFYRSQHAS----FEKGVNFAV  117



>ref|XP_007148067.1| hypothetical protein PHAVU_006G177800g [Phaseolus vulgaris]
 gb|ESW20061.1| hypothetical protein PHAVU_006G177800g [Phaseolus vulgaris]
Length=317

 Score = 87.4 bits (215),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/88 (51%), Positives = 57/88 (65%), Gaps = 8/88 (9%)
 Frame = +3

Query  114  YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILDLIAEYY  293
            +T+IF FGDSLTD GN        S  H ++PPYG+TFF H TGRCSDGR+I+D IAE  
Sbjct  44   FTSIFSFGDSLTDTGN--RYLASHSPNHCFFPPYGQTFFHHVTGRCSDGRLIIDFIAESL  101

Query  294  GLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            GL +  P L +K+       ++G NFAV
Sbjct  102  GLPLVKPYLEKKSG------KEGTNFAV  123



>emb|CDX94634.1| BnaC07g10240D [Brassica napus]
Length=398

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/88 (48%), Positives = 57/88 (65%), Gaps = 4/88 (5%)
 Frame = +3

Query  114  YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILDLIAEYY  293
            + +I  FG+S+ D GNL+ L     +PH+ +PPYGETFF H TGR S+GR+I+D IAEY 
Sbjct  36   FKSIISFGNSIADTGNLLGLSDPNDLPHVAFPPYGETFFNHSTGRFSNGRLIIDFIAEYL  95

Query  294  GLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            GL + PP    +        ++GVNFAV
Sbjct  96   GLPLVPPFYGSQNAN----FEKGVNFAV  119



>ref|XP_011096449.1| PREDICTED: uncharacterized protein LOC105175645 [Sesamum indicum]
Length=1007

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 58/96 (60%), Gaps = 3/96 (3%)
 Frame = +3

Query  99   STAACYTAIFGFGDSLTDAGNLIHLETDGSVPHMY-YPPYGETFFGHPTGRCSDGRVILD  275
            ++A+C+T+I  FGDS+ D GN  +L  +   P  Y  PPYGETFF HPTGRCSDGR+I+D
Sbjct  417  ASASCFTSIISFGDSIADTGNAPYLSPESGRPPFYTLPPYGETFFNHPTGRCSDGRLIID  476

Query  276  LIAEYYGLAIPPPSLS--RKAQTGGDYIQQGVNFAV  377
             IAE + L    P L   R         + G NFAV
Sbjct  477  FIAEEFELPFVAPFLQGGRNGNVNSTSFRDGANFAV  512


 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 47/100 (47%), Positives = 59/100 (59%), Gaps = 3/100 (3%)
 Frame = +3

Query  84   ACIIGSTAACYTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGR  263
            A I    + CY +I  FGDSL D GNL+ L    + P    PPYG TFF   TGR SDGR
Sbjct  15   ASISRLASGCYDSIISFGDSLADTGNLLLLSPPNNPPLCGRPPYGRTFFHRTTGRYSDGR  74

Query  264  VILDLIAEYYGLAIPPPSLSRK--AQTGGDYIQQGVNFAV  377
            +++D IAE  GL +  P  + K  A+ GG +  +GVNFAV
Sbjct  75   LVIDFIAESLGLPLVEPYAAWKIAAEKGGSF-SKGVNFAV  113



>ref|XP_002891138.1| carboxylic ester hydrolase/ lipase [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67397.1| carboxylic ester hydrolase/ lipase [Arabidopsis lyrata subsp. 
lyrata]
Length=394

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 59/93 (63%), Gaps = 4/93 (4%)
 Frame = +3

Query  99   STAACYTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILDL  278
            S    + +I  FGDS+ D GNL+ L    ++P   +PPYGETFF HPTGR SDGR+I+D 
Sbjct  29   SQCQNFESIISFGDSIADTGNLLSLSDRYNLPMSAFPPYGETFFHHPTGRFSDGRLIIDF  88

Query  279  IAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            IAE+ GL   PP         G++ ++GVNFAV
Sbjct  89   IAEFLGLPYVPPYF---GSINGNF-EKGVNFAV  117



>ref|XP_006656143.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Oryza brachyantha]
Length=403

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/91 (53%), Positives = 60/91 (66%), Gaps = 12/91 (13%)
 Frame = +3

Query  114  YTAIFGFGDSLTDAGNLIHLETDGSVPHMY---YPPYGETFFGHPTGRCSDGRVILDLIA  284
            Y AIF FGDSL+DAGNLI    DG VP       PPYG TFFG PTGRCS+GR+++D +A
Sbjct  63   YEAIFSFGDSLSDAGNLI---ADG-VPKALTTARPPYGMTFFGRPTGRCSNGRLVVDFLA  118

Query  285  EYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            E++GL +PP S     +  G    +G NFA+
Sbjct  119  EHFGLPLPPAS-----KAHGKDFSKGANFAI  144



>ref|XP_002879083.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55342.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=392

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 64/98 (65%), Gaps = 6/98 (6%)
 Frame = +3

Query  90   IIGSTAAC--YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGR  263
            I+ S   C  + +I  FGDS+TD GNL+ L +   +P   +PPYGETFF +P+GR SDGR
Sbjct  21   IVTSQTGCRNFKSIISFGDSITDTGNLLGLSSPNDLPESAFPPYGETFFHYPSGRFSDGR  80

Query  264  VILDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            +I+D IAE+ G+   PP    K    G++ ++GVNFAV
Sbjct  81   LIIDFIAEFLGIPHVPPFYGSK---NGNF-EKGVNFAV  114



>dbj|BAJ86670.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=379

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/90 (49%), Positives = 62/90 (69%), Gaps = 10/90 (11%)
 Frame = +3

Query  114  YTAIFGFGDSLTDAGNLIHLETDGSVPHMY--YPPYGETFFGHPTGRCSDGRVILDLIAE  287
            Y A+F FGDSL DAGNL+   T+G   ++    PPYG+++FG+PTGRCSDGR+++D IA+
Sbjct  37   YNAVFNFGDSLVDAGNLV---TEGIPDYLATARPPYGQSYFGYPTGRCSDGRLVIDFIAQ  93

Query  288  YYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
             +GL + PPS ++ A        QG NFA+
Sbjct  94   EFGLPLLPPSKAKNAS-----FAQGANFAI  118



>ref|XP_002438500.1| hypothetical protein SORBIDRAFT_10g020940 [Sorghum bicolor]
 gb|EER89867.1| hypothetical protein SORBIDRAFT_10g020940 [Sorghum bicolor]
Length=374

 Score = 87.4 bits (215),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/90 (50%), Positives = 62/90 (69%), Gaps = 10/90 (11%)
 Frame = +3

Query  114  YTAIFGFGDSLTDAGNLIHLETDGSVPHMY--YPPYGETFFGHPTGRCSDGRVILDLIAE  287
            Y A+F FGDSL DAGNL+   T+G   ++    PPYG+T+FG+PTGRCSDGR+++D IA+
Sbjct  32   YHAVFNFGDSLVDAGNLV---TEGIPDYLATARPPYGQTYFGYPTGRCSDGRLVVDFIAQ  88

Query  288  YYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
             +GL + PPS ++ A        QG NFA+
Sbjct  89   EFGLPLLPPSKAKNAS-----FAQGANFAI  113



>ref|XP_010277742.1| PREDICTED: GDSL esterase/lipase At1g28610-like [Nelumbo nucifera]
Length=391

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 59/92 (64%), Gaps = 5/92 (5%)
 Frame = +3

Query  108  ACYTAIFGFGDSLTDAGNLIHLETDGSVPH--MYYPPYGETFFGHPTGRCSDGRVILDLI  281
            +CYT+IF FGDSL D GNL+ L+     P+  +   PYGET+F  PTGR S+GR+++D I
Sbjct  29   SCYTSIFSFGDSLADTGNLLILQAQEHKPYSRISRVPYGETYFHRPTGRSSNGRLVIDFI  88

Query  282  AEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            A+  GL   PP L R        +QQG+NFAV
Sbjct  89   AQSLGLPFIPPFLQRN---NSQPVQQGLNFAV  117



>ref|XP_008785157.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Phoenix dactylifera]
Length=360

 Score = 87.0 bits (214),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 51/91 (56%), Positives = 60/91 (66%), Gaps = 7/91 (8%)
 Frame = +3

Query  105  AACYTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILDLIA  284
            A  Y AIF FGDSL+DAGNLI    + SV      PYG TFF  PTGRCSDGR+ +D IA
Sbjct  20   AQRYDAIFSFGDSLSDAGNLI--VKNPSVYLTSKWPYGMTFFHKPTGRCSDGRLFIDFIA  77

Query  285  EYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            E  GL +PPPSL    ++G D+ Q+G NFA 
Sbjct  78   EAVGLPLPPPSL----KSGEDF-QKGANFAT  103



>ref|XP_010925696.1| PREDICTED: GDSL esterase/lipase At5g45910-like isoform X1 [Elaeis 
guineensis]
Length=377

 Score = 87.4 bits (215),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 61/94 (65%), Gaps = 9/94 (10%)
 Frame = +3

Query  99   STAACYTAIFGFGDSLTDAGN-LIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILD  275
            ST   YT+IF FGDSL D GN LIH +++   P     PYG T+F HPTGRCSDGR+I+D
Sbjct  30   STQLNYTSIFSFGDSLADTGNALIHSKSN---PVFGRLPYGMTYFMHPTGRCSDGRLIVD  86

Query  276  LIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
             +A  +GL   PP L+      G  I+QGVNFAV
Sbjct  87   FLASAFGLPFLPPYLAH-----GQNIRQGVNFAV  115



>ref|XP_006655466.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Oryza brachyantha]
Length=371

 Score = 87.0 bits (214),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 58/89 (65%), Gaps = 7/89 (8%)
 Frame = +3

Query  114  YTAIFGFGDSLTDAGNLIHLETDGSVPHMY-YPPYGETFFGHPTGRCSDGRVILDLIAEY  290
            +T+I+ FGDS  DAGN + + +  +VP  Y  PPYG TFFGH TGR SDGRVI+D IAE 
Sbjct  25   FTSIYSFGDSYVDAGNFVIMASS-TVPVWYDKPPYGMTFFGHSTGRMSDGRVIVDFIAEE  83

Query  291  YGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            +GL   PPS     Q     + QG+NFAV
Sbjct  84   FGLPFLPPS-----QANSSTLSQGLNFAV  107



>ref|XP_003542989.1| PREDICTED: GDSL esterase/lipase At1g28600 [Glycine max]
Length=400

 Score = 87.4 bits (215),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 50/91 (55%), Positives = 58/91 (64%), Gaps = 4/91 (4%)
 Frame = +3

Query  111  CYTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILDLIAEY  290
            CYT++F FGDSLTD GNL  +    S P    PPYG+T F  P GRCSDGR+ILD +AE 
Sbjct  34   CYTSLFSFGDSLTDTGNLYFISPRQS-PDCLLPPYGQTHFHRPNGRCSDGRLILDFLAES  92

Query  291  YGLAIPPPSLSRK--AQTGGDYIQQGVNFAV  377
             GL    P L  K  A   G+ I+QGVNFAV
Sbjct  93   LGLPYVKPYLGFKNGAVKRGN-IEQGVNFAV  122



>ref|XP_006828273.1| hypothetical protein AMTR_s00023p00217880 [Amborella trichopoda]
 gb|ERM95689.1| hypothetical protein AMTR_s00023p00217880 [Amborella trichopoda]
Length=374

 Score = 87.0 bits (214),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 63/95 (66%), Gaps = 3/95 (3%)
 Frame = +3

Query  93   IGSTAACYTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVIL  272
              S    Y+++F FGDS++D GNL+ L  D     +  PPYG+TFF  PTGRCSDGR+I+
Sbjct  21   FASKTGRYSSLFSFGDSISDTGNLL-LSGDNPFIGIANPPYGQTFFKKPTGRCSDGRLIV  79

Query  273  DLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            D  AE  GL   PP LS K+++  D+ ++G+NFAV
Sbjct  80   DFFAEALGLPFLPPYLS-KSKSKKDF-RKGMNFAV  112



>ref|XP_010460655.1| PREDICTED: GDSL esterase/lipase At1g28610-like [Camelina sativa]
Length=414

 Score = 87.4 bits (215),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 43/88 (49%), Positives = 58/88 (66%), Gaps = 4/88 (5%)
 Frame = +3

Query  114  YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILDLIAEYY  293
            + +I  FGDS+TD GNL+ L    ++PH  +PPYGETFF  PTGR S+GR+I+D IAE+ 
Sbjct  36   FKSIISFGDSITDTGNLLGLSDADNLPHSAFPPYGETFFHFPTGRFSNGRLIIDFIAEFL  95

Query  294  GLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            GL   PP    +  +     ++GVNFAV
Sbjct  96   GLPYLPPFYGSQNAS----FEKGVNFAV  119



>ref|NP_564313.1| GDSL esterase/lipase [Arabidopsis thaliana]
 gb|AAK50088.1|AF372948_1 At1g28610/F1K23_5 [Arabidopsis thaliana]
 gb|AAM91420.1| At1g28610/F1K23_5 [Arabidopsis thaliana]
 gb|AEE31001.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=250

 Score = 85.9 bits (211),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 60/98 (61%), Gaps = 6/98 (6%)
 Frame = +3

Query  90   IIGSTAAC--YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGR  263
            I+ S   C    +I  FGDS+TD GNL+ L     +P   + PYGETFF HPTGR  +GR
Sbjct  19   IVSSQTQCRNLESIISFGDSITDTGNLVGLSDRNHLPVTAFLPYGETFFHHPTGRSCNGR  78

Query  264  VILDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            +I+D IAE+ GL   PP    K    G++ ++GVNFAV
Sbjct  79   IIIDFIAEFLGLPHVPPFYGSK---NGNF-EKGVNFAV  112



>gb|EAZ01210.1| hypothetical protein OsI_23235 [Oryza sativa Indica Group]
Length=379

 Score = 86.7 bits (213),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 63/100 (63%), Gaps = 12/100 (12%)
 Frame = +3

Query  87   CIIGSTAACYTAIFGFGDSLTDAGNLIHLETDGSVPHMY---YPPYGETFFGHPTGRCSD  257
            C    +   Y AIF FGDSL+DAGNLI    DG +P        PYG TFFG PTGRCS+
Sbjct  30   CSAARSKKSYEAIFSFGDSLSDAGNLI---ADG-IPKSLTTARAPYGMTFFGRPTGRCSN  85

Query  258  GRVILDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            GR+++D +AE++GL +PP S +     G D+  +G NFA+
Sbjct  86   GRLVVDFLAEHFGLPLPPASKAH----GADF-SKGANFAI  120



>ref|XP_008777732.1| PREDICTED: GDSL esterase/lipase At1g28570-like, partial [Phoenix 
dactylifera]
Length=251

 Score = 85.5 bits (210),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 58/93 (62%), Gaps = 6/93 (6%)
 Frame = +3

Query  99   STAACYTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILDL  278
            +  +CYT+IF FGDSL D GN +H    G    +   PYGET+F HPTGR SDGR+I+D 
Sbjct  75   AATSCYTSIFSFGDSLADTGNFLHYANQGPEARL---PYGETYFQHPTGRFSDGRLIIDF  131

Query  279  IAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            IA+  G+ + PP L+     G    ++G NFAV
Sbjct  132  IAQAIGVPLVPPYLAGPGDHG---FRRGANFAV  161



>gb|EAZ37226.1| hypothetical protein OsJ_21564 [Oryza sativa Japonica Group]
Length=379

 Score = 86.7 bits (213),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 63/100 (63%), Gaps = 12/100 (12%)
 Frame = +3

Query  87   CIIGSTAACYTAIFGFGDSLTDAGNLIHLETDGSVPHMY---YPPYGETFFGHPTGRCSD  257
            C    +   Y AIF FGDSL+DAGNLI    DG +P        PYG TFFG PTGRCS+
Sbjct  30   CSAARSKKSYEAIFSFGDSLSDAGNLI---ADG-IPKSLTTARAPYGMTFFGRPTGRCSN  85

Query  258  GRVILDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            GR+++D +AE++GL +PP S +     G D+  +G NFA+
Sbjct  86   GRLVVDFLAEHFGLPLPPASKAH----GADF-SKGANFAI  120



>ref|NP_001057786.1| Os06g0531900 [Oryza sativa Japonica Group]
 dbj|BAD54230.1| putative lipase [Oryza sativa Japonica Group]
 dbj|BAF19700.1| Os06g0531900 [Oryza sativa Japonica Group]
 dbj|BAG87915.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG90659.1| unnamed protein product [Oryza sativa Japonica Group]
Length=395

 Score = 86.7 bits (213),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 63/100 (63%), Gaps = 12/100 (12%)
 Frame = +3

Query  87   CIIGSTAACYTAIFGFGDSLTDAGNLIHLETDGSVPHMY---YPPYGETFFGHPTGRCSD  257
            C    +   Y AIF FGDSL+DAGNLI    DG +P        PYG TFFG PTGRCS+
Sbjct  46   CSAARSKKSYEAIFSFGDSLSDAGNLI---ADG-IPKSLTTARAPYGMTFFGRPTGRCSN  101

Query  258  GRVILDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            GR+++D +AE++GL +PP S +     G D+  +G NFA+
Sbjct  102  GRLVVDFLAEHFGLPLPPASKAH----GADF-SKGANFAI  136



>ref|XP_009415143.1| PREDICTED: GDSL esterase/lipase At1g28590-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=384

 Score = 86.7 bits (213),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 55/122 (45%), Positives = 69/122 (57%), Gaps = 15/122 (12%)
 Frame = +3

Query  99   STAACYTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILDL  278
            ST ACY+ IF FGDSL D GNLI +           PPYG T+F  PTGR SDGR+I+D 
Sbjct  20   STTACYSTIFSFGDSLADTGNLIRVPGHADC-QAGRPPYGMTYFHSPTGRFSDGRLIVDY  78

Query  279  IAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV-----------ELHGFASSTPTPSVRF  425
            IAE  GL + PP L  +A  GG  +++GVNFAV           +  G  + +   S+RF
Sbjct  79   IAEAMGLPLLPPYL--EAWRGGR-LRKGVNFAVAGATAMDNEFFQEKGITTGSTNCSLRF  135

Query  426  SI  431
             I
Sbjct  136  QI  137



>ref|XP_006367776.1| PREDICTED: GDSL esterase/lipase At1g28590-like [Solanum tuberosum]
Length=383

 Score = 86.7 bits (213),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 54/95 (57%), Gaps = 1/95 (1%)
 Frame = +3

Query  96   GSTAACYTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILD  275
            G    CY +I  FGDSL D GNLI L     +      PYGETFF HPTGR SDGR+++D
Sbjct  23   GHVHGCYESIISFGDSLADTGNLIRLSKSNKIVASSVLPYGETFFHHPTGRFSDGRLVID  82

Query  276  LIAEYYGLAIPPPSLS-RKAQTGGDYIQQGVNFAV  377
             IAE  G  + PP +   K  +      +GVNFAV
Sbjct  83   FIAEGMGFPLVPPYVGVMKNMSSSKNSMRGVNFAV  117



>ref|XP_010915609.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Elaeis guineensis]
Length=366

 Score = 86.3 bits (212),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 57/88 (65%), Gaps = 8/88 (9%)
 Frame = +3

Query  114  YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILDLIAEYY  293
            YT+IF FGDSL+D GNL+ L     +  +   PYG TFFG PTGR SDGR+I+D IAE +
Sbjct  25   YTSIFNFGDSLSDTGNLLILNASAPIGRL---PYGMTFFGRPTGRFSDGRLIIDFIAEAF  81

Query  294  GLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            GL   PPSL+R     G   + G +FAV
Sbjct  82   GLPFLPPSLAR-----GQDFRHGADFAV  104



>ref|XP_006654152.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Oryza brachyantha]
Length=362

 Score = 86.3 bits (212),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 60/91 (66%), Gaps = 13/91 (14%)
 Frame = +3

Query  114  YTAIFGFGDSLTDAGNLIHLETDGSVPHMY---YPPYGETFFGHPTGRCSDGRVILDLIA  284
            Y AI+ FGDS++D GNL      G  P       PPYG+TFFG PTGRCSDGRV++D +A
Sbjct  26   YNAIYSFGDSISDTGNLCV----GGCPSWLTTGQPPYGKTFFGRPTGRCSDGRVVVDFLA  81

Query  285  EYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            E++GL +PP S     + GGD+ ++G N A+
Sbjct  82   EHFGLPLPPAS-----KAGGDF-KKGANMAI  106



>gb|EYU28061.1| hypothetical protein MIMGU_mgv11b014990mg [Erythranthe guttata]
Length=451

 Score = 87.0 bits (214),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 59/101 (58%), Gaps = 5/101 (5%)
 Frame = +3

Query  84   ACIIGSTAACYTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGR  263
            A I  S   CY +I  FGDSL D GN++ L      PH   PPYG TFF  PTGR SDGR
Sbjct  22   AAIRESEFGCYESIISFGDSLADTGNVLLLSPSDKKPHGGLPPYGRTFFHRPTGRFSDGR  81

Query  264  VILDLIAEYYGLAIPPPSL---SRKAQTGGDYIQQGVNFAV  377
            +++D IA+ +GL   PP +   S +   GG    +GVNFAV
Sbjct  82   LVIDFIAQRFGLPFVPPYIGGESGELHDGG--FSKGVNFAV  120



>gb|KFK44741.1| hypothetical protein AALP_AA1G296900 [Arabis alpina]
Length=390

 Score = 86.7 bits (213),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 62/98 (63%), Gaps = 6/98 (6%)
 Frame = +3

Query  90   IIGSTAAC--YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGR  263
            ++ S   C  +  I  FGDSL D GNLI L T   +P   +PPYGETFF +P+GR SDGR
Sbjct  21   LVSSEPPCRNFEWIISFGDSLADTGNLIGLSTPNDLPESAFPPYGETFFHYPSGRFSDGR  80

Query  264  VILDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            +++D IAE+ GL   PP     +Q+G    ++GVNFAV
Sbjct  81   LVIDFIAEFLGLPHVPPFYG--SQSGN--FEKGVNFAV  114



>gb|EYU28060.1| hypothetical protein MIMGU_mgv1a008085mg [Erythranthe guttata]
Length=385

 Score = 86.3 bits (212),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 44/94 (47%), Positives = 57/94 (61%), Gaps = 1/94 (1%)
 Frame = +3

Query  99   STAACYTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILDL  278
            S   CY +I  FGDSL D GNL+ L    + P    PPYG TFF  PTGR SDGR+++D 
Sbjct  26   SEFGCYESIISFGDSLADTGNLLLLSPADNKPAAARPPYGRTFFHRPTGRFSDGRLVIDF  85

Query  279  IAEYYGLAIPPPSL-SRKAQTGGDYIQQGVNFAV  377
            IA+ +GL   PP +  +  +  G  + +GVNFAV
Sbjct  86   IAQRFGLPFVPPYIGGQNGELRGGGVSKGVNFAV  119



>gb|AFK33964.1| unknown [Lotus japonicus]
Length=234

 Score = 85.1 bits (209),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 60/97 (62%), Gaps = 4/97 (4%)
 Frame = +3

Query  96   GSTAAC-YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVIL  272
            GS  AC +++IF FGDSL D GNL +L +     + + PPYG TFF  P+ RCSDGR+IL
Sbjct  18   GSATACPFSSIFSFGDSLADTGNL-YLSSALPSHNCFSPPYGRTFFHRPSARCSDGRIIL  76

Query  273  DLIAEYYGLAIPPPSLSRKAQTGGD--YIQQGVNFAV  377
            D IAE  GL    P L  K   G +   +++G NFAV
Sbjct  77   DFIAESLGLPFVKPYLEIKKYGGLENWNVEEGANFAV  113



>emb|CAN64953.1| hypothetical protein VITISV_042282 [Vitis vinifera]
Length=772

 Score = 88.2 bits (217),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 48/100 (48%), Positives = 59/100 (59%), Gaps = 7/100 (7%)
 Frame = +3

Query  87   CIIGSTAAC---YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSD  257
            C   + + C   Y +IF FGDSL D GN + L    + P +   PYGETFF H TGRCSD
Sbjct  14   CRFSTVSTCDKRYESIFSFGDSLADTGNFL-LSGALAFPVIRELPYGETFFRHATGRCSD  72

Query  258  GRVILDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            GR+I+D IAE +G+   PP LS      G   + GVNFAV
Sbjct  73   GRLIVDFIAEAFGIPYLPPYLSLGK---GKSFRHGVNFAV  109



>ref|XP_006844517.1| hypothetical protein AMTR_s00016p00148320 [Amborella trichopoda]
 gb|ERN06192.1| hypothetical protein AMTR_s00016p00148320 [Amborella trichopoda]
Length=378

 Score = 86.3 bits (212),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 59/89 (66%), Gaps = 3/89 (3%)
 Frame = +3

Query  111  CYTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILDLIAEY  290
            C+TA+F FGDSLTD GNL +LE D     ++  PYGETFF  PTGRCSDGR+I+D +A+ 
Sbjct  29   CHTALFSFGDSLTDTGNLKYLEHDQFF-DIWSLPYGETFFHRPTGRCSDGRLIVDFLAQG  87

Query  291  YGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
             GL +  P LS     G    ++G NFAV
Sbjct  88   LGLPMLQPYLS--GFHGAVEFRKGANFAV  114



>gb|KFK44742.1| hypothetical protein AALP_AA1G297000 [Arabis alpina]
Length=1372

 Score = 88.6 bits (218),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 60/95 (63%), Gaps = 6/95 (6%)
 Frame = +3

Query  99   STAAC--YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVIL  272
            S + C  + +I  FGDS+ D GNL+ L     +PH+ +PPYGETFF HPTGR S+GR+++
Sbjct  24   SESQCRNFKSIISFGDSIADTGNLVGLSDPNDLPHVAFPPYGETFFHHPTGRFSNGRLVI  83

Query  273  DLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            D +AE+ GL + PP             ++GVNFAV
Sbjct  84   DFMAEFLGLPLVPPFYGSHNAN----FEKGVNFAV  114


 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 43/64 (67%), Gaps = 4/64 (6%)
 Frame = +3

Query  186  SVPHMYYPPYGETFFGHPTGRCSDGRVILDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGV  365
             +P   +PPYGETFF +PTGR S+GR+I+D IAE+ GL   PP     +Q G    ++GV
Sbjct  384  ELPPAAFPPYGETFFHNPTGRFSNGRLIIDFIAEFLGLPYVPPCFG--SQNGS--FEKGV  439

Query  366  NFAV  377
            NFAV
Sbjct  440  NFAV  443



>ref|XP_009353234.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Pyrus x bretschneideri]
Length=368

 Score = 85.9 bits (211),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 60/100 (60%), Gaps = 5/100 (5%)
 Frame = +3

Query  90   IIGSTAACYTAIFGFGDSLTDAGN--LIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGR  263
            II     CYT+I GFGDS  D GN  L  L       H ++PPYGE FF HPTGRC DGR
Sbjct  22   IIPHALGCYTSIIGFGDSTADTGNSYLNALYHHDEPFHFFFPPYGEDFFHHPTGRCCDGR  81

Query  264  VILDLIAEYYGLAIPPP--SLSRKAQTGGDYIQQGVNFAV  377
            +I+D IAE  GL +  P   +    +T  ++ +QGVNFAV
Sbjct  82   LIIDFIAESLGLPLVRPYFEILNVNETVHNF-EQGVNFAV  120



>ref|XP_010435654.1| PREDICTED: GDSL esterase/lipase At1g31550-like [Camelina sativa]
Length=396

 Score = 86.3 bits (212),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 62/98 (63%), Gaps = 6/98 (6%)
 Frame = +3

Query  90   IIGSTAAC--YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGR  263
            ++ S + C  + +I  FGDS+ D GNL+ L    ++    +PPYGETFF HPTGR SDGR
Sbjct  26   MVKSESQCQNFQSIISFGDSIADTGNLLGLSDRNNLSLNGFPPYGETFFHHPTGRSSDGR  85

Query  264  VILDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            +I+D IAE+ GL    P    K    G++ Q+GVNFAV
Sbjct  86   LIIDFIAEFLGLPYVTPYFGSK---NGNF-QKGVNFAV  119



>gb|EEE62721.1| hypothetical protein OsJ_17524 [Oryza sativa Japonica Group]
Length=299

 Score = 85.1 bits (209),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 60/91 (66%), Gaps = 13/91 (14%)
 Frame = +3

Query  114  YTAIFGFGDSLTDAGNLIHLETDGSVPHMY---YPPYGETFFGHPTGRCSDGRVILDLIA  284
            Y AI+ FGDS++D GNL      G  P       PPYG+TFFG PTGRCSDGRV++D +A
Sbjct  25   YNAIYSFGDSISDTGNLCV----GGCPSWLTTGQPPYGKTFFGRPTGRCSDGRVVVDFLA  80

Query  285  EYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            E++GL +PP S     + GGD+ ++G N A+
Sbjct  81   EHFGLPLPPAS-----KGGGDF-KKGANMAI  105



>ref|XP_006415637.1| hypothetical protein EUTSA_v10009438mg, partial [Eutrema salsugineum]
 gb|ESQ33990.1| hypothetical protein EUTSA_v10009438mg, partial [Eutrema salsugineum]
Length=387

 Score = 86.3 bits (212),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 60/97 (62%), Gaps = 6/97 (6%)
 Frame = +3

Query  93   IGSTAAC--YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRV  266
            + S   C  + +I  FGDS+TD GNL+ L     +P   +PPYGETFF  PTGR S+GR+
Sbjct  26   VSSEQQCRKFKSIISFGDSITDTGNLLGLSDANDLPQAAFPPYGETFFHVPTGRFSNGRL  85

Query  267  ILDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            I+D IAE+ GL   PP     +Q G    ++GVNFAV
Sbjct  86   IIDFIAEFLGLPYVPPYFG--SQNGS--FEKGVNFAV  118



>ref|XP_010540488.1| PREDICTED: GDSL esterase/lipase At1g28610-like isoform X1 [Tarenaya 
hassleriana]
Length=393

 Score = 86.3 bits (212),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 54/89 (61%), Gaps = 4/89 (4%)
 Frame = +3

Query  111  CYTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILDLIAEY  290
            CY +I  FGDS+ D GNL+ L     +PH   PPYGETFF  PTGR SDGR+I+D IAE 
Sbjct  33   CYESIISFGDSIADTGNLLILSDPNHLPHFALPPYGETFFHFPTGRHSDGRLIIDFIAES  92

Query  291  YGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
              L   PP    + ++      +G+NFAV
Sbjct  93   LDLPFVPPYFGSRNRS----FLKGINFAV  117



>ref|XP_010499588.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Camelina sativa]
Length=395

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/88 (48%), Positives = 56/88 (64%), Gaps = 4/88 (5%)
 Frame = +3

Query  114  YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILDLIAEYY  293
            + +I  FGDS  D GNL+ L    ++PH  +PPYGETFF HPTGR S+GRVI+D +AE+ 
Sbjct  37   FKSIISFGDSHADTGNLLGLSDPNNLPHFAFPPYGETFFHHPTGRFSNGRVIIDFMAEFL  96

Query  294  GLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
             L + PP    +        ++GVNFAV
Sbjct  97   DLPLVPPFYGSQNAN----FKKGVNFAV  120



>ref|XP_009102894.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Brassica rapa]
Length=397

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 58/98 (59%), Gaps = 6/98 (6%)
 Frame = +3

Query  90   IIGSTAAC--YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGR  263
            ++ S   C  + +I  FGDS  D GNLI L     +P   +PPYGETFF HPTGR S+GR
Sbjct  26   VVNSETHCRNFKSIISFGDSTADTGNLIGLSDPDDLPAAAFPPYGETFFHHPTGRFSNGR  85

Query  264  VILDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            +I+D IAE+ GL   PP    +        ++GVNFAV
Sbjct  86   LIIDFIAEFLGLPFVPPFYGSQNAN----FEKGVNFAV  119



>emb|CDY15657.1| BnaA07g08280D [Brassica napus]
Length=397

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 58/98 (59%), Gaps = 6/98 (6%)
 Frame = +3

Query  90   IIGSTAAC--YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGR  263
            ++ S   C  + +I  FGDS  D GNLI L     +P   +PPYGETFF HPTGR S+GR
Sbjct  26   VVNSETHCRNFKSIISFGDSTADTGNLIGLSDPDDLPAAAFPPYGETFFHHPTGRFSNGR  85

Query  264  VILDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            +I+D IAE+ GL   PP    +        ++GVNFAV
Sbjct  86   LIIDFIAEFLGLPFVPPFYGSQNAN----FEKGVNFAV  119



>ref|XP_010478618.1| PREDICTED: GDSL esterase/lipase At1g31550-like [Camelina sativa]
Length=396

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 64/99 (65%), Gaps = 7/99 (7%)
 Frame = +3

Query  90   IIGSTAAC--YTAIFGFGDSLTDAGNLIHLETD-GSVPHMYYPPYGETFFGHPTGRCSDG  260
            ++GS + C  + +I  FGDS+ D GNL+ L  D  ++    YPPYGETFF  PTGR SDG
Sbjct  25   MVGSESQCRNFESIISFGDSIGDTGNLLGLSDDPNNLALSGYPPYGETFFHQPTGRFSDG  84

Query  261  RVILDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            R+I+D IAE+ GL   PP    K    G++ ++GVNFAV
Sbjct  85   RLIIDFIAEFLGLPYVPPYFGSK---NGNF-EKGVNFAV  119



>ref|XP_009113646.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Brassica rapa]
 emb|CDY34093.1| BnaA09g27190D [Brassica napus]
Length=397

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/88 (49%), Positives = 57/88 (65%), Gaps = 4/88 (5%)
 Frame = +3

Query  114  YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILDLIAEYY  293
            + +I  FGDS+TD GNL+HL    ++P   +PPYGETFF  PTGR S+GR+I+D IAE+ 
Sbjct  35   FKSIIIFGDSITDTGNLLHLSDLNNLPQSAFPPYGETFFHVPTGRFSNGRLIIDFIAEFL  94

Query  294  GLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
             L   PP      ++     Q+GVNFAV
Sbjct  95   RLPYVPPYFGSPNES----FQKGVNFAV  118



>ref|XP_003542992.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Glycine max]
Length=376

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 59/92 (64%), Gaps = 8/92 (9%)
 Frame = +3

Query  105  AAC-YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILDLI  281
             AC Y ++F FGDSL D GNL +L +     H ++PPYG+TFF H +GRCSDGR+I+D I
Sbjct  26   VACPYRSMFSFGDSLADTGNL-YLSSHPPTDHCFFPPYGQTFFHHVSGRCSDGRLIIDFI  84

Query  282  AEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            AE  GL +  P        GG  +++G NFAV
Sbjct  85   AESLGLPLVKPYF------GGWNVEEGANFAV  110



>ref|XP_010054331.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Eucalyptus grandis]
Length=309

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 61/95 (64%), Gaps = 4/95 (4%)
 Frame = +3

Query  93   IGSTAACYTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVIL  272
            + S+   Y AIF FG+SL+D GN + L    + P +   PYGETFF HPTGRCS+GR+++
Sbjct  20   VLSSPGRYEAIFNFGNSLSDTGNFL-LSGALAFPGIKNLPYGETFFHHPTGRCSNGRLMI  78

Query  273  DLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            D IAE +GL   PP L   A   G  ++ GVNFAV
Sbjct  79   DFIAEVFGLPFLPPYL---AVAKGPPVRTGVNFAV  110



>ref|XP_002438722.1| hypothetical protein SORBIDRAFT_10g025030 [Sorghum bicolor]
 gb|EER90089.1| hypothetical protein SORBIDRAFT_10g025030 [Sorghum bicolor]
Length=339

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 56/89 (63%), Gaps = 2/89 (2%)
 Frame = +3

Query  111  CYTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILDLIAEY  290
            CYT +F FGDSL D GN     T+GS P +  P YGETFF   TGR +DGR++LD IA+ 
Sbjct  36   CYTRVFSFGDSLADTGNYRFFYTNGSDPVLRLP-YGETFFHRATGRFTDGRIVLDFIADA  94

Query  291  YGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
             GL   PP LS + +   D++  G NFAV
Sbjct  95   LGLPFVPPYLSGRRRRAEDFL-HGANFAV  122



>ref|NP_174181.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q8RXT9.2|GDL8_ARATH RecName: Full=GDSL esterase/lipase At1g28590; AltName: Full=Extracellular 
lipase At1g28590; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AEE30998.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=403

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 58/97 (60%), Gaps = 6/97 (6%)
 Frame = +3

Query  93   IGSTAAC--YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRV  266
            + S   C  + +I  FGDS+ D GNL+ L     +P   +PPYGETFF HPTGR SDGR+
Sbjct  25   VNSQTQCRNFKSIISFGDSIADTGNLLGLSDPNDLPASAFPPYGETFFHHPTGRYSDGRL  84

Query  267  ILDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            I+D IAE+ G  + PP    +        ++GVNFAV
Sbjct  85   IIDFIAEFLGFPLVPPFYGCQNAN----FKKGVNFAV  117



>emb|CDY30822.1| BnaC05g21980D [Brassica napus]
Length=401

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/102 (44%), Positives = 62/102 (61%), Gaps = 10/102 (10%)
 Frame = +3

Query  90   IIGSTAAC--YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGR  263
            I+ S   C  + +I  FGDS+ D GNL+ L     +PH+ +PPYGETFF HPTGR S+GR
Sbjct  26   IVNSETQCRRFKSIISFGDSIADTGNLLGLSDPNHLPHVAFPPYGETFFQHPTGRFSNGR  85

Query  264  VILDLI----AEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            +I+D I    AE+ G  + PP    +      + ++GVNFAV
Sbjct  86   LIIDFIVRFTAEFLGFPLVPPFYGSQ----NAHFEKGVNFAV  123



>gb|KJB62806.1| hypothetical protein B456_009G437200 [Gossypium raimondii]
Length=399

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 56/91 (62%), Gaps = 3/91 (3%)
 Frame = +3

Query  111  CYTAIFGFGDSLTDAGNLIHLETDGSV--PHMYYPPYGETFFGHPTGRCSDGRVILDLIA  284
            C+T+IF FGDSLTD GNL+ L    S   PH  + PYG TFF  PTGR  DGR+++D +A
Sbjct  33   CFTSIFSFGDSLTDTGNLLELSISESTKPPHSAFLPYGCTFFHRPTGRFCDGRLVIDFLA  92

Query  285  EYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            E  G +  PP    K+     + +QG NFAV
Sbjct  93   EALGFSFLPPFYGSKSGKWEKF-RQGANFAV  122



>dbj|BAC41872.1| unknown protein [Arabidopsis thaliana]
Length=245

 Score = 84.3 bits (207),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/98 (43%), Positives = 60/98 (61%), Gaps = 6/98 (6%)
 Frame = +3

Query  90   IIGSTAAC--YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGR  263
            +  S + C  +T+I  FGDS+ D GN++HL     +P   + PYGE+FF  P+GR SDGR
Sbjct  23   VASSESRCRRFTSIISFGDSIADTGNILHLSDVNHLPQTAFFPYGESFFHPPSGRASDGR  82

Query  264  VILDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            +I+D IAE+ GL   PP    +  +     +QG+NFAV
Sbjct  83   LIIDFIAEFLGLPYVPPYFGSQNVS----FEQGINFAV  116



>ref|XP_008655072.1| PREDICTED: LOC100284848 isoform X1 [Zea mays]
 gb|AFW82123.1| hypothetical protein ZEAMMB73_197874 [Zea mays]
Length=369

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/91 (51%), Positives = 59/91 (65%), Gaps = 12/91 (13%)
 Frame = +3

Query  114  YTAIFGFGDSLTDAGNLIHLETDGSVPHMY---YPPYGETFFGHPTGRCSDGRVILDLIA  284
            Y AI+ FGDS++D GNL      G  P       PPYGETFFG PTGRCSDGRVI+D +A
Sbjct  31   YNAIWSFGDSISDTGNLC---VGGGCPSWLTTGQPPYGETFFGRPTGRCSDGRVIVDFLA  87

Query  285  EYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            E++GL + P S     + GGD +++G N A+
Sbjct  88   EHFGLPLLPAS-----KAGGD-LKKGANMAI  112



>ref|XP_003563800.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Brachypodium 
distachyon]
Length=375

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 63/95 (66%), Gaps = 10/95 (11%)
 Frame = +3

Query  99   STAACYTAIFGFGDSLTDAGNLIHLETDGSVPHMYYP--PYGETFFGHPTGRCSDGRVIL  272
            + A  Y A+F FGDSL DAGNL+   T+G   ++     PYG+++FG+PTGRCSDGR+++
Sbjct  28   AEAGKYNAVFNFGDSLVDAGNLV---TEGIPDYLATARLPYGQSYFGYPTGRCSDGRLVI  84

Query  273  DLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            D IA+ +GL + PPS ++ A        QG NFA+
Sbjct  85   DFIAQEFGLPLLPPSKAKNAS-----FAQGANFAI  114



>ref|XP_010455497.1| PREDICTED: GDSL esterase/lipase At1g31550-like isoform X2 [Camelina 
sativa]
Length=383

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 61/98 (62%), Gaps = 6/98 (6%)
 Frame = +3

Query  90   IIGSTAAC--YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGR  263
            ++ S + C  +  I  FGDS+ D GNL+ L    ++    +PPYGETFF HPTGR SDGR
Sbjct  26   MVNSESQCQNFEYIISFGDSIADTGNLLCLSDRNNLSLNGFPPYGETFFHHPTGRSSDGR  85

Query  264  VILDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            +I+D IAE+ GL    P    K    G++ Q+GVNFAV
Sbjct  86   LIIDFIAEFLGLPYVTPYFGSK---NGNF-QKGVNFAV  119



>ref|XP_010445802.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Camelina sativa]
Length=378

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/88 (48%), Positives = 55/88 (63%), Gaps = 1/88 (1%)
 Frame = +3

Query  114  YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILDLIAEYY  293
            Y +IF FGDSL+D GN + +   G +P++  PPYG+TFF   TGRCS+GR+I+D IAE  
Sbjct  28   YESIFNFGDSLSDTGNFL-ISLGGYIPNIGRPPYGQTFFNRSTGRCSNGRLIIDFIAEAS  86

Query  294  GLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            GL   PP L           ++G NFAV
Sbjct  87   GLPYLPPYLQSARTNNSVDFKRGANFAV  114



>gb|EAY96951.1| hypothetical protein OsI_18870 [Oryza sativa Indica Group]
Length=361

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 60/91 (66%), Gaps = 13/91 (14%)
 Frame = +3

Query  114  YTAIFGFGDSLTDAGNLIHLETDGSVPHMY---YPPYGETFFGHPTGRCSDGRVILDLIA  284
            Y AI+ FGDS++D GNL      G  P       PPYG+TFFG PTGRCSDGRV++D +A
Sbjct  25   YNAIYSFGDSISDTGNLCV----GGCPSWLTTGQPPYGKTFFGRPTGRCSDGRVVVDFLA  80

Query  285  EYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            E++GL +PP S     + GGD+ ++G N A+
Sbjct  81   EHFGLPLPPAS-----KGGGDF-KKGANMAI  105



>gb|AAS91011.1| putative lipase [Oryza sativa Japonica Group]
 gb|AAT01386.1| unknown protein, contains GDSL-like lipase/acylhydrolase domain 
[Oryza sativa Japonica Group]
 gb|AAT44169.1| unknown protein, contains GDSL-like lipase/acylhydrolase domain 
[Oryza sativa Japonica Group]
 dbj|BAG94533.1| unnamed protein product [Oryza sativa Japonica Group]
Length=361

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 60/91 (66%), Gaps = 13/91 (14%)
 Frame = +3

Query  114  YTAIFGFGDSLTDAGNLIHLETDGSVPHMY---YPPYGETFFGHPTGRCSDGRVILDLIA  284
            Y AI+ FGDS++D GNL      G  P       PPYG+TFFG PTGRCSDGRV++D +A
Sbjct  25   YNAIYSFGDSISDTGNLCV----GGCPSWLTTGQPPYGKTFFGRPTGRCSDGRVVVDFLA  80

Query  285  EYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            E++GL +PP S     + GGD+ ++G N A+
Sbjct  81   EHFGLPLPPAS-----KGGGDF-KKGANMAI  105



>ref|XP_010912621.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Elaeis guineensis]
Length=175

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/92 (47%), Positives = 58/92 (63%), Gaps = 6/92 (7%)
 Frame = +3

Query  102  TAACYTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILDLI  281
            T  CYT+IF FGDS+TD GN ++    G    +   PYG+T+F HPTGR SDGR+I+D I
Sbjct  27   TTTCYTSIFSFGDSITDTGNFLNYTNCGPEARL---PYGKTYFHHPTGRFSDGRIIIDFI  83

Query  282  AEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            A+  G+ + PP L+     G    ++G NFAV
Sbjct  84   AQAIGVPLVPPYLAGPGDHG---FRRGANFAV  112



>gb|ACF83155.1| unknown [Zea mays]
 gb|ACN26853.1| unknown [Zea mays]
 gb|AFW82121.1| esterase isoform 1 [Zea mays]
 gb|AFW82122.1| esterase isoform 2 [Zea mays]
Length=368

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/91 (51%), Positives = 59/91 (65%), Gaps = 12/91 (13%)
 Frame = +3

Query  114  YTAIFGFGDSLTDAGNLIHLETDGSVPHMY---YPPYGETFFGHPTGRCSDGRVILDLIA  284
            Y AI+ FGDS++D GNL      G  P       PPYGETFFG PTGRCSDGRVI+D +A
Sbjct  31   YNAIWSFGDSISDTGNLC---VGGGCPSWLTTGQPPYGETFFGRPTGRCSDGRVIVDFLA  87

Query  285  EYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            E++GL + P S     + GGD +++G N A+
Sbjct  88   EHFGLPLLPAS-----KAGGD-LKKGANMAI  112



>ref|XP_010480704.1| PREDICTED: GDSL esterase/lipase At1g28590-like [Camelina sativa]
Length=352

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 55/88 (63%), Gaps = 4/88 (5%)
 Frame = +3

Query  114  YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILDLIAEYY  293
            + +I  FGDS+ D GNL+ L     +P   +PPYGE+F  HPTGR SDGR+I+D IAE+ 
Sbjct  34   FKSIISFGDSIADTGNLLSLADPNDLPGSAFPPYGESFLKHPTGRFSDGRLIIDFIAEFL  93

Query  294  GLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            GL + PP    +        ++GVNFAV
Sbjct  94   GLPLVPPFYGSQHAN----FEKGVNFAV  117



>ref|XP_004969330.1| PREDICTED: GDSL esterase/lipase At1g28600-like isoform X2 [Setaria 
italica]
Length=380

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 57/92 (62%), Gaps = 10/92 (11%)
 Frame = +3

Query  111  CYTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILDLIAEY  290
            CYT IF FGDSLTD GN +HL      P+   PPYG TFFG PTGR SDGR+++D IAE 
Sbjct  36   CYTRIFSFGDSLTDTGNYVHLTAKSHSPYGA-PPYGRTFFGRPTGRASDGRLVIDFIAEE  94

Query  291  YGLAIPPPSLSRKAQTG---GDYIQQGVNFAV  377
            +GL     S     QTG    D+ + G NFA+
Sbjct  95   FGL-----SNVTAIQTGTAPADF-RHGANFAI  120



>ref|XP_004969329.1| PREDICTED: GDSL esterase/lipase At1g28600-like isoform X1 [Setaria 
italica]
Length=381

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 57/92 (62%), Gaps = 10/92 (11%)
 Frame = +3

Query  111  CYTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILDLIAEY  290
            CYT IF FGDSLTD GN +HL      P+   PPYG TFFG PTGR SDGR+++D IAE 
Sbjct  36   CYTRIFSFGDSLTDTGNYVHLTAKSHSPYGA-PPYGRTFFGRPTGRASDGRLVIDFIAEE  94

Query  291  YGLAIPPPSLSRKAQTG---GDYIQQGVNFAV  377
            +GL     S     QTG    D+ + G NFA+
Sbjct  95   FGL-----SNVTAIQTGTAPADF-RHGANFAI  120



>ref|NP_001064520.1| Os10g0393800 [Oryza sativa Japonica Group]
 gb|AAM22730.1|AC092388_14 putative lipase [Oryza sativa Japonica Group]
 gb|AAP53579.1| GDSL-like Lipase/Acylhydrolase family protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF26434.1| Os10g0393800 [Oryza sativa Japonica Group]
 gb|EAY78350.1| hypothetical protein OsI_33439 [Oryza sativa Indica Group]
 gb|EAZ15958.1| hypothetical protein OsJ_31403 [Oryza sativa Japonica Group]
 dbj|BAG98340.1| unnamed protein product [Oryza sativa Japonica Group]
Length=401

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 57/97 (59%), Gaps = 2/97 (2%)
 Frame = +3

Query  90   IIGSTAACYTAIFGFGDSLTDAGNLIHL-ETDGSVPHMYYPPYGETFFGHPTGRCSDGRV  266
            + G     YT +F FGDSLTD GN +HL  T G       PPYGETFF  PTGR SDGR+
Sbjct  23   VAGGGTGAYTRVFSFGDSLTDTGNALHLPSTGGGGGPASRPPYGETFFRRPTGRASDGRL  82

Query  267  ILDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
             +D I E   L  P P L+   +T  ++ + GVNFAV
Sbjct  83   AVDFIVEALRLRHPAPYLAAGGETAAEF-RHGVNFAV  118



>ref|XP_011086014.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Sesamum indicum]
Length=373

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 57/88 (65%), Gaps = 4/88 (5%)
 Frame = +3

Query  114  YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILDLIAEYY  293
            Y +IF FGDSL D GNL+ L    + P +   PYG+TFF +PTGRCSDGR+I+D IAE  
Sbjct  25   YDSIFSFGDSLADTGNLL-LSGARTFPFIAKLPYGQTFFHYPTGRCSDGRLIVDFIAEAS  83

Query  294  GLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            GL   PP L   A   G+  + GVNFAV
Sbjct  84   GLPYLPPYL---AVAKGETFEHGVNFAV  108



>ref|NP_001151215.1| LOC100284848 precursor [Zea mays]
 gb|ACG41997.1| esterase precursor [Zea mays]
Length=368

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/91 (51%), Positives = 59/91 (65%), Gaps = 12/91 (13%)
 Frame = +3

Query  114  YTAIFGFGDSLTDAGNLIHLETDGSVPHMY---YPPYGETFFGHPTGRCSDGRVILDLIA  284
            Y AI+ FGDS++D GNL      G  P       PPYGETFFG PTGRCSDGRVI+D +A
Sbjct  31   YNAIWSFGDSISDTGNLC---VGGGCPSWLTTGQPPYGETFFGRPTGRCSDGRVIVDFLA  87

Query  285  EYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            E++GL + P S     + GGD +++G N A+
Sbjct  88   EHFGLPLLPAS-----KAGGD-LKKGANMAI  112



>ref|NP_001054912.2| Os05g0209600 [Oryza sativa Japonica Group]
 dbj|BAF16826.2| Os05g0209600, partial [Oryza sativa Japonica Group]
Length=367

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 60/91 (66%), Gaps = 13/91 (14%)
 Frame = +3

Query  114  YTAIFGFGDSLTDAGNLIHLETDGSVPHMY---YPPYGETFFGHPTGRCSDGRVILDLIA  284
            Y AI+ FGDS++D GNL      G  P       PPYG+TFFG PTGRCSDGRV++D +A
Sbjct  31   YNAIYSFGDSISDTGNLCV----GGCPSWLTTGQPPYGKTFFGRPTGRCSDGRVVVDFLA  86

Query  285  EYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            E++GL +PP S     + GGD+ ++G N A+
Sbjct  87   EHFGLPLPPAS-----KGGGDF-KKGANMAI  111



>ref|XP_004952371.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Setaria italica]
Length=371

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 66/100 (66%), Gaps = 10/100 (10%)
 Frame = +3

Query  84   ACIIGSTAACYTAIFGFGDSLTDAGNLIHLETDG--SVPHMYYPPYGETFFGHPTGRCSD  257
            A  + + A  Y+AIF FGDS+TD GNL    T+G  S+     PPYGET+FG PT RCSD
Sbjct  23   ASWVLAAAQNYSAIFNFGDSITDTGNLC---TNGRPSMITFTQPPYGETYFGTPTCRCSD  79

Query  258  GRVILDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            GRV++D +++ +GL + PPS S    + GD+ +QG N A+
Sbjct  80   GRVVVDFLSDQFGLPLLPPSKS----SSGDF-KQGANMAI  114



>ref|XP_008783974.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Phoenix dactylifera]
Length=107

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/88 (50%), Positives = 57/88 (65%), Gaps = 6/88 (7%)
 Frame = +3

Query  114  YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILDLIAEYY  293
            Y +IF FG+SL D GN + +      P +   PYG TFFG PTGRCSDGR+++D IAE  
Sbjct  24   YNSIFSFGNSLADTGNFL-ITGAQQFPGIGRLPYGMTFFGRPTGRCSDGRLVIDFIAEAV  82

Query  294  GLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            GL + PPS +    +G D+ +QG NFAV
Sbjct  83   GLPLLPPSFA----SGQDF-RQGANFAV  105



>gb|KDO77811.1| hypothetical protein CISIN_1g018031mg [Citrus sinensis]
Length=222

 Score = 84.0 bits (206),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/116 (44%), Positives = 67/116 (58%), Gaps = 12/116 (10%)
 Frame = +3

Query  87   CIIGSTAAC---YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSD  257
            C++ S +     Y AIF FGDSL+D GN + +    + P +   PYGETFF H TGRCSD
Sbjct  11   CLLRSVSTSHLKYHAIFNFGDSLSDTGNFL-VSGALAFPVIGKLPYGETFFRHATGRCSD  69

Query  258  GRVILDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAVELHGFASSTPTPSVRF  425
            GR+++D +AE + L   PP L+ K    G   + GVNFAV     A +T   SV F
Sbjct  70   GRLVIDFMAEAFRLPYLPPYLALKE---GQNFKHGVNFAV-----AGATALRSVIF  117



>gb|KHG23842.1| hypothetical protein F383_29871 [Gossypium arboreum]
Length=379

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 59/98 (60%), Gaps = 3/98 (3%)
 Frame = +3

Query  90   IIGSTAACYTAIFGFGDSLTDAGNL--IHLETDGSVPHMYYPPYGETFFGHPTGRCSDGR  263
            II     C+T+IF FGDSLTD GNL  I L     +P   +PP G TFF HP+GR  DGR
Sbjct  26   IIQPVNGCFTSIFSFGDSLTDTGNLLEISLLESNKLPPSAFPPNGRTFFHHPSGRRCDGR  85

Query  264  VILDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            +++D +AE  G+    PS + K      + Q+G+NFAV
Sbjct  86   LVIDFLAEALGIPFLQPSYTTKVGRLQKF-QKGMNFAV  122



>ref|XP_010455496.1| PREDICTED: GDSL esterase/lipase At1g31550-like isoform X1 [Camelina 
sativa]
Length=396

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 61/98 (62%), Gaps = 6/98 (6%)
 Frame = +3

Query  90   IIGSTAAC--YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGR  263
            ++ S + C  +  I  FGDS+ D GNL+ L    ++    +PPYGETFF HPTGR SDGR
Sbjct  26   MVNSESQCQNFEYIISFGDSIADTGNLLCLSDRNNLSLNGFPPYGETFFHHPTGRSSDGR  85

Query  264  VILDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            +I+D IAE+ GL    P    K    G++ Q+GVNFAV
Sbjct  86   LIIDFIAEFLGLPYVTPYFGSK---NGNF-QKGVNFAV  119



>ref|XP_010422035.1| PREDICTED: GDSL esterase/lipase At1g31550-like isoform X2 [Camelina 
sativa]
Length=382

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/88 (50%), Positives = 57/88 (65%), Gaps = 4/88 (5%)
 Frame = +3

Query  114  YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILDLIAEYY  293
            + +I  FGDS+ D GNL+ L    ++    +PPYGETFF HPTGR SDGR+I+D IAE+ 
Sbjct  36   FQSIISFGDSIADTGNLLGLSDRNNLSLNGFPPYGETFFHHPTGRSSDGRLIIDFIAEFL  95

Query  294  GLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            GL    P    K    G++ Q+GVNFAV
Sbjct  96   GLPYVTPYFGSK---NGNF-QKGVNFAV  119



>ref|XP_010915608.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Elaeis guineensis]
Length=368

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 61/93 (66%), Gaps = 6/93 (6%)
 Frame = +3

Query  99   STAACYTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILDL  278
            S  A Y AIF FG+SL D GN + +      P +   PYG TFFG PTGRCSDGR+++D 
Sbjct  19   SFPARYNAIFSFGNSLADTGNFL-ITGAQPFPGIGRLPYGITFFGRPTGRCSDGRLVIDF  77

Query  279  IAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            IAE +GL + PPSL+    +G D+ +QG NFAV
Sbjct  78   IAEAFGLPLLPPSLA----SGQDF-RQGANFAV  105



>ref|XP_010422034.1| PREDICTED: GDSL esterase/lipase At1g31550-like isoform X1 [Camelina 
sativa]
Length=396

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/88 (50%), Positives = 57/88 (65%), Gaps = 4/88 (5%)
 Frame = +3

Query  114  YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILDLIAEYY  293
            + +I  FGDS+ D GNL+ L    ++    +PPYGETFF HPTGR SDGR+I+D IAE+ 
Sbjct  36   FQSIISFGDSIADTGNLLGLSDRNNLSLNGFPPYGETFFHHPTGRSSDGRLIIDFIAEFL  95

Query  294  GLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            GL    P    K    G++ Q+GVNFAV
Sbjct  96   GLPYVTPYFGSK---NGNF-QKGVNFAV  119



>ref|XP_002863442.1| GDSL-motif lipase/hydrolase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH39701.1| GDSL-motif lipase/hydrolase family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=374

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/88 (49%), Positives = 54/88 (61%), Gaps = 1/88 (1%)
 Frame = +3

Query  114  YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILDLIAEYY  293
            Y +IF FGDSL+D GN + +  D   P++  PPYG+TFF   TGRCSDGR+I+D IAE  
Sbjct  28   YDSIFNFGDSLSDTGNFL-ISGDVDSPNIGRPPYGQTFFNRSTGRCSDGRLIIDFIAEAS  86

Query  294  GLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            GL   PP L           ++G NFAV
Sbjct  87   GLPYIPPYLQSVRTNNSVDFKRGANFAV  114



>ref|XP_003565527.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Brachypodium 
distachyon]
Length=367

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 60/97 (62%), Gaps = 12/97 (12%)
 Frame = +3

Query  96   GSTAACYTAIFGFGDSLTDAGNLIHLETDGSVPHMY---YPPYGETFFGHPTGRCSDGRV  266
            GS++  Y AI+ FGDS++D GNL      G  P       PPYG+ +FG PTGRCSDGRV
Sbjct  22   GSSSQGYNAIYNFGDSISDTGNLCL----GGCPSWLTTGQPPYGKNYFGRPTGRCSDGRV  77

Query  267  ILDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
             +D +AEY+GL + PPS     +T G   ++G N A+
Sbjct  78   FVDFLAEYFGLPLLPPS-----KTNGTDFKKGANMAI  109



>ref|NP_001147763.1| esterase precursor [Zea mays]
 gb|ACG28614.1| esterase precursor [Zea mays]
 gb|AFW68832.1| esterase [Zea mays]
Length=414

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 61/107 (57%), Gaps = 8/107 (7%)
 Frame = +3

Query  96   GSTAACYTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILD  275
            G   A Y  +F FGDSLTD GN +HL      P    PPYGETFF   TGR SDGR+++D
Sbjct  48   GGPTARYDRVFSFGDSLTDTGNALHLAATAGGP-ASRPPYGETFFRRATGRASDGRLVID  106

Query  276  LIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNF------AVELHGFAS  398
             I E   +  P P L+    TG D+ ++GVNF      A++LH F S
Sbjct  107  FIVEALAVPQPTPYLAGATATGADF-RRGVNFAFGGATALDLHFFVS  152



>ref|XP_010478236.1| PREDICTED: GDSL esterase/lipase At1g28610-like [Camelina sativa]
Length=400

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/89 (52%), Positives = 59/89 (66%), Gaps = 6/89 (7%)
 Frame = +3

Query  114  YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILDLIAEYY  293
            + +I  FGDS+TD GNL+ L    + PH  +PPYGETFF  PTGR S+GR+I+D IAE+ 
Sbjct  36   FKSIISFGDSITDTGNLLALSDADNPPHSAFPPYGETFFHFPTGRYSNGRLIIDFIAEFL  95

Query  294  GLA-IPPPSLSRKAQTGGDYIQQGVNFAV  377
            GL  +PP   S+ A  G     +GVNFAV
Sbjct  96   GLPYLPPFHGSQNASFG-----KGVNFAV  119



>gb|KJB62808.1| hypothetical protein B456_009G437400 [Gossypium raimondii]
Length=343

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/92 (50%), Positives = 59/92 (64%), Gaps = 5/92 (5%)
 Frame = +3

Query  111  CYTAIFGFGDSLTDAGNLIH---LETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILDLI  281
            C+T+IF FGDS++D GN I    LET G +PH  +PP G TFF  PTGR  DGR+++D +
Sbjct  36   CFTSIFSFGDSMSDTGNSIEISVLET-GKLPHGAFPPNGCTFFHRPTGRFCDGRLVIDFL  94

Query  282  AEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            AE  GL   PP    K  T  ++ + GVNFAV
Sbjct  95   AEALGLPFLPPYYRYKNGTSENF-ENGVNFAV  125



>ref|XP_010041184.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Eucalyptus grandis]
Length=367

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 58/88 (66%), Gaps = 4/88 (5%)
 Frame = +3

Query  114  YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILDLIAEYY  293
            Y AIF FG+SL+D GN + L    + P +   PYGETFF HPTGRCS+GR+++D IAE +
Sbjct  27   YEAIFNFGNSLSDTGNFL-LSGALAFPGIKNLPYGETFFHHPTGRCSNGRLMIDFIAEVF  85

Query  294  GLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            GL   PP L   A   G  ++ GVNFAV
Sbjct  86   GLPFLPPYL---AVAKGPPVRTGVNFAV  110



>gb|KCW44566.1| hypothetical protein EUGRSUZ_L01923 [Eucalyptus grandis]
Length=364

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 58/88 (66%), Gaps = 4/88 (5%)
 Frame = +3

Query  114  YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILDLIAEYY  293
            Y AIF FG+SL+D GN + L    + P +   PYGETFF HPTGRCS+GR+++D IAE +
Sbjct  24   YEAIFNFGNSLSDTGNFL-LSGALAFPGIKNLPYGETFFHHPTGRCSNGRLMIDFIAEVF  82

Query  294  GLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            GL   PP L   A   G  ++ GVNFAV
Sbjct  83   GLPFLPPYL---AVAKGPPVRTGVNFAV  107



>ref|NP_001141565.1| uncharacterized protein LOC100273681 [Zea mays]
 gb|ACF86627.1| unknown [Zea mays]
 gb|AFW70979.1| alpha-L-fucosidase 2 [Zea mays]
Length=378

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 61/98 (62%), Gaps = 10/98 (10%)
 Frame = +3

Query  90   IIGSTAACYTAIFGFGDSLTDAGNLIHLETDGSVPHMYY--PPYGETFFGHPTGRCSDGR  263
            ++ +TA  Y+AIF FGDS+TD GNL    T G    + +  PPYGET+FG PT RCSDGR
Sbjct  32   LVLTTAQNYSAIFNFGDSITDTGNLC---TSGRPSQITFTQPPYGETYFGTPTCRCSDGR  88

Query  264  VILDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            V++D ++  +GL   PPS S  A       +QG N A+
Sbjct  89   VVVDFLSTQFGLPFLPPSKSSSAD-----FRQGANMAI  121



>ref|XP_007025434.1| GDSL-like Lipase/Acylhydrolase superfamily protein [Theobroma 
cacao]
 gb|EOY28056.1| GDSL-like Lipase/Acylhydrolase superfamily protein [Theobroma 
cacao]
Length=369

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 53/118 (45%), Positives = 69/118 (58%), Gaps = 10/118 (8%)
 Frame = +3

Query  90   IIGSTAACYTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVI  269
            ++ S+   Y +IF FGDSL+D GN + L    + P +   PYGETFF H TGRCSDGR+I
Sbjct  18   VLSSSLQKYESIFNFGDSLSDTGNFL-LSGALAFPVIGRLPYGETFFQHATGRCSDGRLI  76

Query  270  LDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAVELHGFASSTPTPSVRFSIDRSI  443
            +D IAE + L   PP L   A T G   + GVNFA     FA +T   +  F  +R+I
Sbjct  77   IDFIAEAFSLPYLPPYL---AVTEGQSSEHGVNFA-----FAGATALDA-EFFYERNI  125



>ref|XP_008643602.1| PREDICTED: esterase isoform X1 [Zea mays]
Length=425

 Score = 85.1 bits (209),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 61/107 (57%), Gaps = 8/107 (7%)
 Frame = +3

Query  96   GSTAACYTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILD  275
            G   A Y  +F FGDSLTD GN +HL      P    PPYGETFF   TGR SDGR+++D
Sbjct  31   GGPTARYDRVFSFGDSLTDTGNALHLAATAGGP-ASRPPYGETFFRRATGRASDGRLVID  89

Query  276  LIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNF------AVELHGFAS  398
             I E   +  P P L+    TG D+ ++GVNF      A++LH F S
Sbjct  90   FIVEALAVPQPTPYLAGATATGADF-RRGVNFAFGGATALDLHFFVS  135



>ref|XP_008439763.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Cucumis melo]
Length=398

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 42/90 (47%), Positives = 56/90 (62%), Gaps = 1/90 (1%)
 Frame = +3

Query  111  CYTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILDLIAEY  290
            C+ +IF FGDSL+D GNL +       P   + PYG+TFF HPTGR SDGR+I+D IA+ 
Sbjct  31   CFNSIFNFGDSLSDTGNLFNNCNSNKPPKSCFTPYGDTFFRHPTGRFSDGRLIIDFIAQS  90

Query  291  YGLAIPPPSLSRKAQTGG-DYIQQGVNFAV  377
             GL +  P L  + Q       ++G+NFAV
Sbjct  91   LGLPLLQPYLGVETQRMSVAEFEKGLNFAV  120



>ref|XP_006844514.1| hypothetical protein AMTR_s00016p00146420, partial [Amborella 
trichopoda]
 gb|ERN06189.1| hypothetical protein AMTR_s00016p00146420, partial [Amborella 
trichopoda]
Length=150

 Score = 81.6 bits (200),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 57/93 (61%), Gaps = 4/93 (4%)
 Frame = +3

Query  99   STAACYTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILDL  278
            S  + Y A+F FGDSL D GN++ L+  G    +   PYGETFF  PTGR SDGR+++D 
Sbjct  25   SNTSSYAALFSFGDSLADTGNMLSLQ--GQSSPIGRLPYGETFFHRPTGRFSDGRLVVDF  82

Query  279  IAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
             A+  GL + P  LS     GGD   +GVNFAV
Sbjct  83   FAQALGLPLLPAYLS--TLDGGDDFSKGVNFAV  113



>ref|NP_001242505.1| uncharacterized protein LOC100815771 precursor [Glycine max]
 gb|ACU18018.1| unknown [Glycine max]
Length=375

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 58/90 (64%), Gaps = 8/90 (9%)
 Frame = +3

Query  114  YTAIFGFGDSLTDAGNLIHLETDGSV--PHMYYPPYGETFFGHPTGRCSDGRVILDLIAE  287
            YTAIF FGDSL+D GN +     G++  P +   PYG+TFF   TGRCSDGR+++D IAE
Sbjct  30   YTAIFNFGDSLSDTGNFL---ASGAILFPVIGKLPYGQTFFKRATGRCSDGRLMIDFIAE  86

Query  288  YYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
             Y L   PP     A T   YIQ+GVNFAV
Sbjct  87   AYDLPYLPP---YPALTKDQYIQRGVNFAV  113



>ref|XP_008777734.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Phoenix dactylifera]
Length=387

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 61/96 (64%), Gaps = 8/96 (8%)
 Frame = +3

Query  96   GSTAACYTAIFGFGDSLTDAGNLIHLETD--GSVPHMYYPPYGETFFGHPTGRCSDGRVI  269
             +TA+C+ +IF FGDSL D GNL+H   D  G++  +   PYGET+F H TGR SDGR+I
Sbjct  39   ATTASCFASIFSFGDSLADTGNLLHYLGDDAGALAQL---PYGETYFHHATGRLSDGRLI  95

Query  270  LDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            +D IA+  GL + PP L   A T     + G NFAV
Sbjct  96   IDFIAQASGLPLVPPYL---AGTSAQDFRYGANFAV  128



>ref|XP_002267222.2| PREDICTED: GDSL esterase/lipase At5g45910 [Vitis vinifera]
Length=364

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 59/100 (59%), Gaps = 7/100 (7%)
 Frame = +3

Query  87   CIIGSTAAC---YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSD  257
            C   + + C   Y +IF FGDSL D GN + L    + P +   PYGETFF H TGRCSD
Sbjct  14   CRFSTVSTCDKRYESIFSFGDSLADTGNFL-LSGALAFPVIRELPYGETFFRHATGRCSD  72

Query  258  GRVILDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            GR+I+D IAE +G+   PP LS      G   + GVNFAV
Sbjct  73   GRLIVDFIAEAFGIPYLPPYLSLGK---GKSFRHGVNFAV  109



>gb|KDO77810.1| hypothetical protein CISIN_1g018031mg [Citrus sinensis]
Length=315

 Score = 83.6 bits (205),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 51/116 (44%), Positives = 67/116 (58%), Gaps = 12/116 (10%)
 Frame = +3

Query  87   CIIGSTAAC---YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSD  257
            C++ S +     Y AIF FGDSL+D GN + +    + P +   PYGETFF H TGRCSD
Sbjct  11   CLLRSVSTSHLKYHAIFNFGDSLSDTGNFL-VSGALAFPVIGKLPYGETFFRHATGRCSD  69

Query  258  GRVILDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAVELHGFASSTPTPSVRF  425
            GR+++D +AE + L   PP L+ K    G   + GVNFAV     A +T   SV F
Sbjct  70   GRLVIDFMAEAFRLPYLPPYLALKE---GQNFKHGVNFAV-----AGATALRSVIF  117



>ref|XP_010052216.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Eucalyptus grandis]
 gb|KCW76154.1| hypothetical protein EUGRSUZ_D00533 [Eucalyptus grandis]
Length=386

 Score = 84.3 bits (207),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 49/95 (52%), Positives = 60/95 (63%), Gaps = 4/95 (4%)
 Frame = +3

Query  93   IGSTAACYTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVIL  272
            I S+   Y AIF FGDSL+D GN +      + P +   PYGETFF H TGRCSDGR+I+
Sbjct  38   ILSSPGRYEAIFNFGDSLSDTGNFLR-SGALAFPVIGKLPYGETFFRHATGRCSDGRLIV  96

Query  273  DLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            D IAE +GL   PP L   A   G +++ GVNFAV
Sbjct  97   DFIAEAFGLPHLPPYL---AVAKGPHVRTGVNFAV  128



>ref|XP_003593742.1| GDSL esterase/lipase [Medicago truncatula]
 gb|AES63993.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=374

 Score = 84.3 bits (207),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 58/89 (65%), Gaps = 5/89 (6%)
 Frame = +3

Query  114  YTAIFGFGDSLTDAGNLIHLETDGSV-PHMYYPPYGETFFGHPTGRCSDGRVILDLIAEY  290
            + AIF FGDSL+D GN   L T  ++ P + +PPYGETFF + TGRCSDGR+++D IAE 
Sbjct  29   FDAIFNFGDSLSDTGNF--LATGANLFPAVGHPPYGETFFRNATGRCSDGRLVIDFIAEA  86

Query  291  YGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            YGL    P L  K       I+ GVNFAV
Sbjct  87   YGLPYLQPYL--KVIKSNQIIRNGVNFAV  113



>ref|NP_973932.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q9SHP6.2|GDL10_ARATH RecName: Full=GDSL esterase/lipase At1g28610; AltName: Full=Extracellular 
lipase At1g28610; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAG22835.1|AC007508_11 F1K23.16 [Arabidopsis thaliana]
 gb|AEE31002.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=383

 Score = 84.3 bits (207),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 60/98 (61%), Gaps = 6/98 (6%)
 Frame = +3

Query  90   IIGSTAAC--YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGR  263
            I+ S   C    +I  FGDS+TD GNL+ L     +P   + PYGETFF HPTGR  +GR
Sbjct  19   IVSSQTQCRNLESIISFGDSITDTGNLVGLSDRNHLPVTAFLPYGETFFHHPTGRSCNGR  78

Query  264  VILDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            +I+D IAE+ GL   PP    K    G++ ++GVNFAV
Sbjct  79   IIIDFIAEFLGLPHVPPFYGSK---NGNF-EKGVNFAV  112



>ref|XP_004134933.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Cucumis sativus]
 ref|XP_004155633.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Cucumis sativus]
Length=397

 Score = 84.3 bits (207),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 42/92 (46%), Positives = 58/92 (63%), Gaps = 1/92 (1%)
 Frame = +3

Query  105  AACYTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILDLIA  284
            A C+ +IF FGDSL+D GNL       + P+  + PYG+TFF  PTGR SDGR+I+D IA
Sbjct  30   ANCFNSIFNFGDSLSDTGNLFINCNSNNPPNFCFTPYGDTFFHRPTGRFSDGRLIIDFIA  89

Query  285  EYYGLAIPPPSLSRKAQTGG-DYIQQGVNFAV  377
            +  G+ +  P L  + Q    D  ++G+NFAV
Sbjct  90   QSLGIPLLQPYLGVETQRMSIDEFEKGLNFAV  121



>ref|XP_008812183.1| PREDICTED: GDSL esterase/lipase At1g31550-like [Phoenix dactylifera]
Length=395

 Score = 84.3 bits (207),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 59/89 (66%), Gaps = 4/89 (4%)
 Frame = +3

Query  111  CYTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILDLIAEY  290
            CYT+IF FGDSL D GNL+H     ++ H+   PYGET+F  PTGR SDGR+++D +A+ 
Sbjct  32   CYTSIFSFGDSLADTGNLLHDVGKNNI-HVGRLPYGETYFRRPTGRFSDGRLVVDFLAQA  90

Query  291  YGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
             GL + PP L+   + G    ++G NFAV
Sbjct  91   MGLPLLPPYLAGPGRKG---FRRGANFAV  116



>ref|XP_008785278.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Phoenix dactylifera]
Length=377

 Score = 84.0 bits (206),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 48/95 (51%), Positives = 58/95 (61%), Gaps = 10/95 (11%)
 Frame = +3

Query  99   STAACYTAIFGFGDSLTDAGNLIHLETDGSVPHM--YYPPYGETFFGHPTGRCSDGRVIL  272
            S +  YTAIF FGDSL D GN  HL  DG  P +   +PPYG TFF  PTGRCSDGR+++
Sbjct  19   SVSEPYTAIFSFGDSLADTGN--HL-VDGPNPILSTTHPPYGMTFFRRPTGRCSDGRLVI  75

Query  273  DLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            D I E +GL + PPS +           QG NFA+
Sbjct  76   DFITEAFGLPLLPPSKAHNTD-----FHQGANFAI  105



>gb|ACG38031.1| alpha-L-fucosidase 2 precursor [Zea mays]
Length=378

 Score = 84.0 bits (206),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 60/98 (61%), Gaps = 10/98 (10%)
 Frame = +3

Query  90   IIGSTAACYTAIFGFGDSLTDAGNLIHLETDGSVPHMYY--PPYGETFFGHPTGRCSDGR  263
            ++ +TA  Y+AIF FGDS+TD GNL    T G    + +  PPYGET+FG PT RCSDGR
Sbjct  32   LVLTTAQNYSAIFNFGDSITDTGNLC---TSGRPSQITFTQPPYGETYFGTPTCRCSDGR  88

Query  264  VILDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            V++D ++  +GL   PPS S  A        QG N A+
Sbjct  89   VVVDFLSTQFGLPFLPPSKSSSAD-----FSQGANMAI  121



>emb|CDY30819.1| BnaC05g21950D [Brassica napus]
Length=397

 Score = 84.3 bits (207),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 43/88 (49%), Positives = 57/88 (65%), Gaps = 4/88 (5%)
 Frame = +3

Query  114  YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILDLIAEYY  293
            + +I  FGDS+TD GNL+HL    ++P   +PPYGETFF  PTGR S+GR+I+D IAE+ 
Sbjct  35   FKSIIIFGDSITDTGNLLHLSEPNNLPQSAFPPYGETFFHVPTGRFSNGRLIIDFIAEFL  94

Query  294  GLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
             L   PP         G + Q+G+NFAV
Sbjct  95   RLPYVPPYF---GSPNGSF-QKGINFAV  118



>ref|XP_010478242.1| PREDICTED: GDSL esterase/lipase At1g28670-like [Camelina sativa]
Length=389

 Score = 84.0 bits (206),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 42/98 (43%), Positives = 59/98 (60%), Gaps = 6/98 (6%)
 Frame = +3

Query  90   IIGSTAAC--YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGR  263
            ++ S + C  + +I  FGDS+ D GN +HL     +P   + PYGE+FF  PTGR SDGR
Sbjct  23   LVSSESRCRRFKSIISFGDSIADTGNYLHLSDVNHLPQTAFLPYGESFFHPPTGRASDGR  82

Query  264  VILDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            +I+D IAE+ GL   PP    +  +     +QG+NFAV
Sbjct  83   LIIDFIAEFLGLPYVPPYFGSQNVS----FEQGINFAV  116



>dbj|BAJ94075.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=381

 Score = 84.0 bits (206),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 63/100 (63%), Gaps = 8/100 (8%)
 Frame = +3

Query  90   IIGSTA----ACYTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSD  257
            +IG+ A    A Y+ +F FGDSLTD GN + L    + P    PPYGETFF  PTGR SD
Sbjct  18   VIGADAGGHEARYSGVFSFGDSLTDTGNSLRLAATRAGPSSR-PPYGETFFRRPTGRASD  76

Query  258  GRVILDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            GR+++D IAE  G+  P P L+ K+    +  ++GVNFAV
Sbjct  77   GRLVVDFIAEALGVPHPTPYLAGKS---AEDFRRGVNFAV  113



>ref|XP_010912577.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Elaeis guineensis]
Length=393

 Score = 84.0 bits (206),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 46/92 (50%), Positives = 57/92 (62%), Gaps = 4/92 (4%)
 Frame = +3

Query  102  TAACYTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILDLI  281
            T +CYTAIF FGDSL D GN +H   + S P +   PYGET+F   TGR SDGR+I+D I
Sbjct  43   TTSCYTAIFSFGDSLADTGNFLHYSGNNSGP-VAQLPYGETYFHRATGRFSDGRLIIDFI  101

Query  282  AEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            A+  GL + PP L+ K        + G NFAV
Sbjct  102  AQAMGLPLVPPYLAGKHSQD---FRHGANFAV  130



>ref|XP_010460659.1| PREDICTED: GDSL esterase/lipase At1g28670-like [Camelina sativa]
Length=389

 Score = 84.0 bits (206),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 42/98 (43%), Positives = 59/98 (60%), Gaps = 6/98 (6%)
 Frame = +3

Query  90   IIGSTAAC--YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGR  263
            ++ S + C  + +I  FGDS+ D GN +HL     +P   + PYGE+FF  PTGR SDGR
Sbjct  23   VVSSESHCRRFKSIISFGDSIADTGNYLHLSDINHLPQTAFLPYGESFFHPPTGRASDGR  82

Query  264  VILDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            +I+D IAE+ GL   PP    +  +     +QG+NFAV
Sbjct  83   LIIDFIAEFLGLPYVPPYFGSQNVS----FEQGINFAV  116



>dbj|BAJ95195.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=381

 Score = 84.0 bits (206),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 63/100 (63%), Gaps = 8/100 (8%)
 Frame = +3

Query  90   IIGSTA----ACYTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSD  257
            +IG+ A    A Y+ +F FGDSLTD GN + L    + P    PPYGETFF  PTGR SD
Sbjct  18   VIGADAGGHEARYSGVFSFGDSLTDTGNSLRLAATRAGPSSR-PPYGETFFRRPTGRASD  76

Query  258  GRVILDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            GR+++D IAE  G+  P P L+ K+    +  ++GVNFAV
Sbjct  77   GRLVVDFIAEALGVPHPTPYLAGKS---AEDFRRGVNFAV  113



>ref|XP_006643905.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Oryza brachyantha]
Length=348

 Score = 83.2 bits (204),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 66/101 (65%), Gaps = 13/101 (13%)
 Frame = +3

Query  84   ACIIGSTAACYTAIFGFGDSLTDAGNLIHLETDGSVPHMY---YPPYGETFFGHPTGRCS  254
            AC  GS+ + Y AI+ FGDS+TD GNL    + G  P       PPYG T+FG PTGRC+
Sbjct  19   ACRPGSSQS-YNAIYNFGDSITDTGNL----SPGGCPSWLTTGQPPYGNTYFGRPTGRCT  73

Query  255  DGRVILDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            DGRVI+D +A+ +GL + PPS +    +GGD+ ++G N A+
Sbjct  74   DGRVIVDFLADRFGLPLLPPSKA----SGGDF-KRGANMAI  109



>ref|NP_564314.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q9FPE4.1|GDL12_ARATH RecName: Full=GDSL esterase/lipase At1g28660; AltName: Full=Extracellular 
lipase At1g28660; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAG42007.1|AF327417_1 unknown protein [Arabidopsis thaliana]
 gb|AAN71956.1| unknown protein [Arabidopsis thaliana]
 gb|AEE31011.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=383

 Score = 83.6 bits (205),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 42/98 (43%), Positives = 60/98 (61%), Gaps = 6/98 (6%)
 Frame = +3

Query  90   IIGSTAAC--YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGR  263
            +  S + C  +T+I  FGDS+ D GN++HL     +P   + PYGE+FF  P+GR SDGR
Sbjct  23   VASSESRCRRFTSIISFGDSIADTGNILHLSDVNHLPQTAFFPYGESFFHPPSGRASDGR  82

Query  264  VILDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            +I+D IAE+ GL   PP    +  +     +QG+NFAV
Sbjct  83   LIIDFIAEFLGLPYVPPYFGSQNVS----FEQGINFAV  116



>ref|NP_849723.1| GDSL esterase/lipase [Arabidopsis thaliana]
 gb|AEE31010.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=382

 Score = 83.6 bits (205),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 42/98 (43%), Positives = 60/98 (61%), Gaps = 6/98 (6%)
 Frame = +3

Query  90   IIGSTAAC--YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGR  263
            +  S + C  +T+I  FGDS+ D GN++HL     +P   + PYGE+FF  P+GR SDGR
Sbjct  23   VASSESRCRRFTSIISFGDSIADTGNILHLSDVNHLPQTAFFPYGESFFHPPSGRASDGR  82

Query  264  VILDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            +I+D IAE+ GL   PP    +  +     +QG+NFAV
Sbjct  83   LIIDFIAEFLGLPYVPPYFGSQNVS----FEQGINFAV  116



>ref|XP_008783908.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Phoenix dactylifera]
Length=413

 Score = 84.0 bits (206),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 46/89 (52%), Positives = 58/89 (65%), Gaps = 6/89 (7%)
 Frame = +3

Query  114  YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILDLIAEYY  293
            YT+IF FGDSL+D GNL+ +     VP    P YG TFFG PTGR SDGR+I+D IA+ +
Sbjct  25   YTSIFNFGDSLSDTGNLLIILNATVVPSGSLP-YGMTFFGGPTGRFSDGRLIIDFIADAF  83

Query  294  GLAIPPPSLSRKAQTGGDYIQQGVNFAVE  380
            GL   PP ++R     G + +QG NFAV 
Sbjct  84   GLPFLPPFVAR-----GQHFRQGANFAVS  107



>ref|XP_009109701.1| PREDICTED: GDSL esterase/lipase At1g28670-like isoform X2 [Brassica 
rapa]
Length=387

 Score = 84.0 bits (206),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 43/88 (49%), Positives = 53/88 (60%), Gaps = 4/88 (5%)
 Frame = +3

Query  114  YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILDLIAEYY  293
            Y +I  FGDS  D GN +HL      P   +PPYGETFF  PTGR SDGR+I+D IAE+ 
Sbjct  32   YKSIISFGDSGADTGNYLHLSDVNHPPQAAFPPYGETFFHTPTGRNSDGRLIIDFIAEFL  91

Query  294  GLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            GL   PP    +  +     +QG+NFAV
Sbjct  92   GLPYVPPYFGSQNVS----FKQGINFAV  115



>ref|XP_009109700.1| PREDICTED: GDSL esterase/lipase At1g28670-like isoform X1 [Brassica 
rapa]
Length=390

 Score = 84.0 bits (206),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 43/88 (49%), Positives = 53/88 (60%), Gaps = 4/88 (5%)
 Frame = +3

Query  114  YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILDLIAEYY  293
            Y +I  FGDS  D GN +HL      P   +PPYGETFF  PTGR SDGR+I+D IAE+ 
Sbjct  32   YKSIISFGDSGADTGNYLHLSDVNHPPQAAFPPYGETFFHTPTGRNSDGRLIIDFIAEFL  91

Query  294  GLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            GL   PP    +  +     +QG+NFAV
Sbjct  92   GLPYVPPYFGSQNVS----FKQGINFAV  115



>ref|XP_009109702.1| PREDICTED: GDSL esterase/lipase At1g28670-like isoform X3 [Brassica 
rapa]
Length=387

 Score = 83.6 bits (205),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 43/88 (49%), Positives = 53/88 (60%), Gaps = 4/88 (5%)
 Frame = +3

Query  114  YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILDLIAEYY  293
            Y +I  FGDS  D GN +HL      P   +PPYGETFF  PTGR SDGR+I+D IAE+ 
Sbjct  32   YKSIISFGDSGADTGNYLHLSDVNHPPQAAFPPYGETFFHTPTGRNSDGRLIIDFIAEFL  91

Query  294  GLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            GL   PP    +  +     +QG+NFAV
Sbjct  92   GLPYVPPYFGSQNVS----FKQGINFAV  115



>gb|KJB66735.1| hypothetical protein B456_010G156100 [Gossypium raimondii]
Length=296

 Score = 82.8 bits (203),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 56/92 (61%), Gaps = 4/92 (4%)
 Frame = +3

Query  99   STAACYTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILDL  278
            ST   Y +IF FGDSL+D GNL+ L      P +   PYGETFF H TGRCSDGR+I+D 
Sbjct  20   STPKKYESIFNFGDSLSDTGNLL-LSGALVFPVIGQLPYGETFFQHATGRCSDGRLIIDF  78

Query  279  IAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFA  374
            IAE + L    P L+ K    G   Q GVNFA
Sbjct  79   IAEAFSLPYLQPYLAVKQ---GQSSQHGVNFA  107



>emb|CDX90162.1| BnaA08g18220D [Brassica napus]
Length=390

 Score = 83.6 bits (205),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 43/88 (49%), Positives = 53/88 (60%), Gaps = 4/88 (5%)
 Frame = +3

Query  114  YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILDLIAEYY  293
            Y +I  FGDS  D GN +HL      P   +PPYGETFF  PTGR SDGR+I+D IAE+ 
Sbjct  32   YKSIISFGDSGADTGNYLHLSDVNHPPQAAFPPYGETFFHAPTGRNSDGRLIIDFIAEFL  91

Query  294  GLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            GL   PP    +  +     +QG+NFAV
Sbjct  92   GLPYVPPYFGSQNVS----FKQGINFAV  115



>dbj|BAD44794.1| lipase-like [Oryza sativa Japonica Group]
 gb|EAZ35697.1| hypothetical protein OsJ_19986 [Oryza sativa Japonica Group]
Length=181

 Score = 81.3 bits (199),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 44/90 (49%), Positives = 60/90 (67%), Gaps = 7/90 (8%)
 Frame = +3

Query  114  YTAIFGFGDSLTDAGNL-IHLE-TDGSVPHMYYPPYGETFFGHPTGRCSDGRVILDLIAE  287
            Y A+F FGDSLTD GN+ +++   + +   M  PPYG TFFGHPT RCSDGR+++D +AE
Sbjct  42   YKAMFSFGDSLTDTGNICVNMSAVNRTELTMAQPPYGITFFGHPTCRCSDGRLVVDFLAE  101

Query  288  YYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
              GL + PPS       GGD+ ++G N A+
Sbjct  102  GLGLPLLPPS----KVIGGDF-RRGANMAI  126



>ref|XP_010912671.1| PREDICTED: GDSL esterase/lipase At1g31550-like [Elaeis guineensis]
Length=436

 Score = 84.0 bits (206),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 60/93 (65%), Gaps = 4/93 (4%)
 Frame = +3

Query  99   STAACYTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILDL  278
            +T  CYT++F FGDSL D GNL+      ++  +   PYGET+F  PTGR  DGR+++D 
Sbjct  68   ATTTCYTSVFSFGDSLADTGNLLRYLGKKNI-DVGRLPYGETYFRRPTGRFCDGRLVVDF  126

Query  279  IAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            IA+  GL + PP L+R++  G    +QG NFAV
Sbjct  127  IAQAMGLPLLPPYLARRSGHG---FRQGANFAV  156



>ref|NP_001241470.1| uncharacterized protein LOC100816865 [Glycine max]
 gb|ACU18909.1| unknown [Glycine max]
 gb|KHN18922.1| GDSL esterase/lipase [Glycine soja]
Length=386

 Score = 83.6 bits (205),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 55/92 (60%), Gaps = 2/92 (2%)
 Frame = +3

Query  105  AAC-YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILDLI  281
            AAC YT+IF FGDSL D GNL +        H  +PPYGETFF H TGRCSDGR+I+D I
Sbjct  30   AACPYTSIFSFGDSLADTGNL-YFSPYPPTNHCLFPPYGETFFHHVTGRCSDGRLIIDFI  88

Query  282  AEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            AE  G+    P L  K        + G NFAV
Sbjct  89   AESLGIPRVKPYLGIKNIGRWSVEEGGANFAV  120



>ref|XP_009102890.1| PREDICTED: GDSL esterase/lipase At1g28670-like [Brassica rapa]
Length=389

 Score = 83.6 bits (205),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 43/88 (49%), Positives = 53/88 (60%), Gaps = 4/88 (5%)
 Frame = +3

Query  114  YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILDLIAEYY  293
            Y +I  FGDS+ D GN +HL      P   + PYGETFF  PTGR SDGR+I+D IAE+ 
Sbjct  32   YKSIISFGDSIADTGNYLHLSDVNHPPQAAFLPYGETFFSVPTGRNSDGRLIIDFIAEFL  91

Query  294  GLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            GL   PP    +  +     +QGVNFAV
Sbjct  92   GLPYVPPYFGSQNVS----FEQGVNFAV  115



>emb|CDY63998.1| BnaA07g36520D [Brassica napus]
Length=389

 Score = 83.6 bits (205),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 43/88 (49%), Positives = 53/88 (60%), Gaps = 4/88 (5%)
 Frame = +3

Query  114  YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILDLIAEYY  293
            Y +I  FGDS+ D GN +HL      P   + PYGETFF  PTGR SDGR+I+D IAE+ 
Sbjct  32   YKSIISFGDSIADTGNYLHLSDVNHPPQAAFLPYGETFFSVPTGRNSDGRLIIDFIAEFL  91

Query  294  GLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            GL   PP    +  +     +QGVNFAV
Sbjct  92   GLPYVPPYFGSQNVS----FEQGVNFAV  115



>gb|EEE54111.1| hypothetical protein OsJ_00875 [Oryza sativa Japonica Group]
Length=374

 Score = 83.2 bits (204),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 63/97 (65%), Gaps = 6/97 (6%)
 Frame = +3

Query  87   CIIGSTAACYTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRV  266
            C  G  A  YT++F FGDSLTD GNL+ + +  S   +   PYG T+F  PTGRCSDGR+
Sbjct  28   CGGGQRAQNYTSMFSFGDSLTDTGNLV-VSSPLSFSIVGKYPYGMTYFHRPTGRCSDGRL  86

Query  267  ILDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            ++D +A+ +GL +  P LSR     G+ + +GVNFAV
Sbjct  87   VVDFLAQAFGLPLLQPYLSR-----GEDVTRGVNFAV  118



>ref|XP_008673536.1| PREDICTED: GDSL esterase/lipase At5g45910 isoform X2 [Zea mays]
 ref|XP_008673537.1| PREDICTED: GDSL esterase/lipase At5g45910 isoform X2 [Zea mays]
 ref|XP_008673538.1| PREDICTED: GDSL esterase/lipase At5g45910 isoform X2 [Zea mays]
 ref|XP_008673539.1| PREDICTED: GDSL esterase/lipase At5g45910 isoform X2 [Zea mays]
Length=434

 Score = 84.0 bits (206),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 46/91 (51%), Positives = 58/91 (64%), Gaps = 9/91 (10%)
 Frame = +3

Query  114  YTAIFGFGDSLTDAGNLIHLETDGSVPHMY---YPPYGETFFGHPTGRCSDGRVILDLIA  284
            Y AI+ FGDS+ D GNL      G  P       PPYG T FGHPTGRC+DGRVILD +A
Sbjct  91   YNAIYSFGDSIADTGNLC--TGSGGCPSWLTTGQPPYGNTHFGHPTGRCTDGRVILDFLA  148

Query  285  EYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            +++GL + PPS   KA   GD +++G N A+
Sbjct  149  DHFGLPLLPPS---KAIGAGD-VRKGANMAI  175



>gb|AAX62802.1| lipase 2 [Brassica napus]
Length=389

 Score = 83.6 bits (205),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 43/88 (49%), Positives = 53/88 (60%), Gaps = 4/88 (5%)
 Frame = +3

Query  114  YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILDLIAEYY  293
            Y +I  FGDS+ D GN +HL      P   + PYGETFF  PTGR SDGR+I+D IAE+ 
Sbjct  32   YKSIISFGDSIADTGNYLHLSDVNHPPQAAFLPYGETFFSVPTGRNSDGRLIIDFIAEFL  91

Query  294  GLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            GL   PP    +  +     +QGVNFAV
Sbjct  92   GLPYVPPYFGSQNVS----FEQGVNFAV  115



>ref|XP_008439761.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Cucumis melo]
Length=384

 Score = 83.2 bits (204),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 61/94 (65%), Gaps = 2/94 (2%)
 Frame = +3

Query  99   STAACYTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILDL  278
            S   CYT+IF FGDSL+D GNL +  +  + P++ + PYGETFF  PTGR SDGR++LD 
Sbjct  19   SVFGCYTSIFNFGDSLSDTGNLYYTCSFPNPPNVCFFPYGETFFHRPTGRFSDGRLVLDF  78

Query  279  IAEYYGL-AIPPPSLSRKAQTGGDYIQQGVNFAV  377
            +A   GL  + P     K  T  D+ Q+G+NFAV
Sbjct  79   LAMSLGLPPVQPYQGVEKGITAEDF-QKGLNFAV  111



>tpg|DAA52848.1| TPA: hypothetical protein ZEAMMB73_895572 [Zea mays]
Length=414

 Score = 83.6 bits (205),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 46/91 (51%), Positives = 58/91 (64%), Gaps = 9/91 (10%)
 Frame = +3

Query  114  YTAIFGFGDSLTDAGNLIHLETDGSVPHMY---YPPYGETFFGHPTGRCSDGRVILDLIA  284
            Y AI+ FGDS+ D GNL      G  P       PPYG T FGHPTGRC+DGRVILD +A
Sbjct  68   YNAIYSFGDSIADTGNLC--TGSGGCPSWLTTGQPPYGNTHFGHPTGRCTDGRVILDFLA  125

Query  285  EYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            +++GL + PPS   KA   GD +++G N A+
Sbjct  126  DHFGLPLLPPS---KAIGAGD-VRKGANMAI  152



>ref|NP_174179.3| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q9FXJ1.1|GDL6_ARATH RecName: Full=GDSL esterase/lipase At1g28570; AltName: Full=Extracellular 
lipase At1g28570; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAG22837.1|AC007508_14 F1K23.19 [Arabidopsis thaliana]
 gb|AEE30994.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=389

 Score = 83.6 bits (205),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 59/97 (61%), Gaps = 6/97 (6%)
 Frame = +3

Query  93   IGSTAAC--YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRV  266
            + S   C  + +I  FGDS+ D GNL+ L    ++P + + PYGETFF HPTGR S+GR+
Sbjct  23   VNSEPQCHNFKSIISFGDSIADTGNLLALSDPTNLPKVAFLPYGETFFHHPTGRFSNGRL  82

Query  267  ILDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            I+D IAE+ G  + PP    +        ++GVNFAV
Sbjct  83   IIDFIAEFLGFPLVPPFYGSQNAN----FEKGVNFAV  115



>ref|XP_004964803.1| PREDICTED: GDSL esterase/lipase At5g45910-like isoform X2 [Setaria 
italica]
Length=363

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/98 (44%), Positives = 58/98 (59%), Gaps = 6/98 (6%)
 Frame = +3

Query  84   ACIIGSTAACYTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGR  263
            AC +  +   Y AIF FGDS++D GNL        +  +  PPYGETFFG  T RCSDGR
Sbjct  15   ACFLAVSGQKYNAIFSFGDSMSDTGNLCVNGAPAGLT-LTQPPYGETFFGRATCRCSDGR  73

Query  264  VILDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            +++D +AE YGL +  PS     + GG   ++G N A+
Sbjct  74   LVVDFLAEKYGLPLLKPS-----KQGGADFKKGANMAI  106



>ref|XP_007020866.1| GDSL-like Lipase/Acylhydrolase superfamily protein, putative 
[Theobroma cacao]
 gb|EOY12391.1| GDSL-like Lipase/Acylhydrolase superfamily protein, putative 
[Theobroma cacao]
Length=789

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 48/98 (49%), Positives = 61/98 (62%), Gaps = 3/98 (3%)
 Frame = +3

Query  90   IIGSTAACYTAIFGFGDSLTDAGNLIHLETDGSVP--HMYYPPYGETFFGHPTGRCSDGR  263
            I+     C+T+IF FGDSLTD GNL+ L    S    H  +PPYG TFF  PTGRCSDGR
Sbjct  55   IVLHVNGCFTSIFSFGDSLTDTGNLLQLSLLESSKLSHFDFPPYGRTFFHSPTGRCSDGR  114

Query  264  VILDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            +++D +AE  GL   PP    +     ++ Q+GVNFAV
Sbjct  115  LVIDFVAEGLGLPFLPPYFGVQNGRPKNF-QKGVNFAV  151


 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 44/65 (68%), Gaps = 1/65 (2%)
 Frame = +3

Query  186  SVPHMYYPPYGETFFGHPTGRCSDGRVILDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGV  365
             +P   +PPYG TFF HPTGRCSDGR+++D IAE +GL   PP    +     ++ Q+GV
Sbjct  453  KLPQSAFPPYGRTFFHHPTGRCSDGRLVIDFIAEDFGLPFLPPYFGGENGRPNNF-QKGV  511

Query  366  NFAVE  380
            NFAVE
Sbjct  512  NFAVE  516



>dbj|BAJ85333.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=372

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 59/95 (62%), Gaps = 10/95 (11%)
 Frame = +3

Query  99   STAACYTAIFGFGDSLTDAGNLIHLETDGSVPHMYYP--PYGETFFGHPTGRCSDGRVIL  272
            + A  Y AIF FGDSL DAGNL+    DG   ++     PYG T+FG+PTGRCSDGR+++
Sbjct  22   AAADKYAAIFNFGDSLVDAGNLV---VDGIPEYLATAKLPYGMTYFGYPTGRCSDGRLVV  78

Query  273  DLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            D IA+  GL + PPS +R A         G NFA+
Sbjct  79   DFIAQELGLPLLPPSKARNAT-----FHHGANFAI  108



>gb|KJB62807.1| hypothetical protein B456_009G437300 [Gossypium raimondii]
Length=401

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 57/91 (63%), Gaps = 3/91 (3%)
 Frame = +3

Query  111  CYTAIFGFGDSLTDAGNL--IHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILDLIA  284
            C+T+IF FGDSLTD GNL  I L     +P   +PP G TFF HP+GR  DGR+++D +A
Sbjct  33   CFTSIFSFGDSLTDTGNLLEISLLESNKLPPSAFPPNGRTFFHHPSGRRCDGRLVIDFLA  92

Query  285  EYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            E  G+    PS + K      + Q+G+NFAV
Sbjct  93   EALGIPFLRPSYTTKVGRLQKF-QKGMNFAV  122



>sp|Q3ZFI4.1|SCE3_BRANA RecName: Full=Sinapine esterase; Short=BnSCE3; AltName: Full=Lipase 
2; Short=BnLIP2; Flags: Precursor [Brassica napus]
 gb|AAX58135.1| lipase 2 [Brassica napus]
Length=389

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/88 (49%), Positives = 53/88 (60%), Gaps = 4/88 (5%)
 Frame = +3

Query  114  YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILDLIAEYY  293
            Y +I  FGDS+ D GN +HL      P   + PYGETFF  PTGR SDGR+I+D IAE+ 
Sbjct  32   YKSIISFGDSIADTGNYLHLSDVNHPPQAAFLPYGETFFSVPTGRDSDGRLIIDFIAEFL  91

Query  294  GLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            GL   PP    +  +     +QGVNFAV
Sbjct  92   GLPYVPPYFGSQNVS----FEQGVNFAV  115



>ref|NP_001043722.1| Os01g0650000 [Oryza sativa Japonica Group]
 dbj|BAF05636.1| Os01g0650000, partial [Oryza sativa Japonica Group]
Length=176

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 55/91 (60%), Gaps = 3/91 (3%)
 Frame = +3

Query  105  AACYTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILDLIA  284
            A CY  +F FGDSLTD GN+  L  + S     +PPYGETFF   TGR S+GR+I+D IA
Sbjct  35   APCYPRVFSFGDSLTDTGNIAFLYGNDSRRPTLWPPYGETFFHRATGRASNGRLIIDFIA  94

Query  285  EYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            +  GL    P  S   +T GD+   G NFAV
Sbjct  95   DALGLPFVRPYWS--GRTAGDF-AHGANFAV  122



>ref|XP_004965532.1| PREDICTED: GDSL esterase/lipase At5g45910-like isoform X2 [Setaria 
italica]
Length=376

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/90 (49%), Positives = 59/90 (66%), Gaps = 10/90 (11%)
 Frame = +3

Query  114  YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYP--PYGETFFGHPTGRCSDGRVILDLIAE  287
            Y A+F FGDSL DAGNL+   TDG   ++     PYG+T+FG+PTGRCSDGR+++D IA+
Sbjct  34   YRAVFNFGDSLVDAGNLV---TDGIPDYLATARLPYGQTYFGYPTGRCSDGRLVVDFIAQ  90

Query  288  YYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
              GL   PPS ++ A        +G NFA+
Sbjct  91   ELGLPFLPPSKAKNAS-----FARGANFAI  115



>ref|XP_010495736.1| PREDICTED: GDSL esterase/lipase At5g45910 [Camelina sativa]
Length=378

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 54/88 (61%), Gaps = 1/88 (1%)
 Frame = +3

Query  114  YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILDLIAEYY  293
            Y +IF FGDSL+D GN + +   G +P++  PPYG+TFF   T RCS+GR+I+D IAE  
Sbjct  28   YESIFNFGDSLSDTGNFL-ISLGGYIPNIGRPPYGQTFFNRSTDRCSNGRLIIDFIAEAS  86

Query  294  GLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            GL   PP L           ++G NFAV
Sbjct  87   GLPYLPPYLQSARTNNSVDFKRGANFAV  114



>ref|XP_007214461.1| hypothetical protein PRUPE_ppa023988mg [Prunus persica]
 gb|EMJ15660.1| hypothetical protein PRUPE_ppa023988mg [Prunus persica]
Length=458

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 62/95 (65%), Gaps = 4/95 (4%)
 Frame = +3

Query  99   STAACYTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILDL  278
            S++ C+ ++  FGDSLTD GNL +   + S+ + +YPPYGET+F HP G C DGR+++D 
Sbjct  151  SSSYCFNSVISFGDSLTDTGNLYYSSPNKSL-NFFYPPYGETYFHHPMGGCLDGRLVIDF  209

Query  279  IAEYYGLAIPPPSLSR--KAQTGGDYIQQGVNFAV  377
            IAE  GL +  P L      QT  ++ + GVNFAV
Sbjct  210  IAESLGLPLVLPYLESLISNQTVQNF-EAGVNFAV  243


 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 43/84 (51%), Gaps = 11/84 (13%)
 Frame = +3

Query  111  CYTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTG----------RCSDG  260
            C+++IF F DSL D GNL ++ +     H ++PPYGET+F HP             C+  
Sbjct  28   CFSSIFSFRDSLADTGNL-YISSHDKPFHFFFPPYGETYFHHPLDDAPMILYQLLSCNCQ  86

Query  261  RVILDLIAEYYGLAIPPPSLSRKA  332
               L   AE+ GL + PP L   +
Sbjct  87   SWTLSFAAEFLGLPLVPPYLESHS  110



>ref|XP_008783975.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Phoenix dactylifera]
Length=377

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 56/90 (62%), Gaps = 10/90 (11%)
 Frame = +3

Query  114  YTAIFGFGDSLTDAGNLIHLETDGSVPHM--YYPPYGETFFGHPTGRCSDGRVILDLIAE  287
            YTAIF FGDSL D GN  HL  +G  P +   +PPYG TFF  PTGRCSDGR++LD I E
Sbjct  24   YTAIFSFGDSLADTGN--HL-VNGPNPLLSTTHPPYGMTFFRRPTGRCSDGRLVLDFITE  80

Query  288  YYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
             +GL + PPS +           QG NFA+
Sbjct  81   AFGLPLLPPSKAHDTD-----FHQGANFAI  105



>dbj|BAJ99647.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=374

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 57/90 (63%), Gaps = 8/90 (9%)
 Frame = +3

Query  114  YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYP--PYGETFFGHPTGRCSDGRVILDLIAE  287
            +T+I  FGDS  D GNL+ L TD  +P +     PYGETFFGHPTGR +DGR++LD IAE
Sbjct  30   FTSIISFGDSYADTGNLV-LWTDPVLPGLLLKNLPYGETFFGHPTGRATDGRLVLDFIAE  88

Query  288  YYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
              GL   PP L++     G     GVNFAV
Sbjct  89   ALGLPSVPPYLAK-----GSNFSAGVNFAV  113



>gb|KJB57433.1| hypothetical protein B456_009G164000 [Gossypium raimondii]
Length=379

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 52/93 (56%), Gaps = 1/93 (1%)
 Frame = +3

Query  99   STAACYTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILDL  278
            S   CY +I  FGDSL D GN + L      P   +PP+G T+F  PTGRC DGR+I+D 
Sbjct  28   SAKRCYRSIISFGDSLADTGNWVILLQQNK-PTPAFPPFGGTYFNRPTGRCCDGRLIVDF  86

Query  279  IAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
             A+  GL + PP       +     Q+GVNFAV
Sbjct  87   FAQKLGLPLVPPYFRDANCSNCRKFQKGVNFAV  119



>gb|KDO77809.1| hypothetical protein CISIN_1g018031mg [Citrus sinensis]
Length=362

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 51/116 (44%), Positives = 67/116 (58%), Gaps = 12/116 (10%)
 Frame = +3

Query  87   CIIGSTAAC---YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSD  257
            C++ S +     Y AIF FGDSL+D GN + +    + P +   PYGETFF H TGRCSD
Sbjct  11   CLLRSVSTSHLKYHAIFNFGDSLSDTGNFL-VSGALAFPVIGKLPYGETFFRHATGRCSD  69

Query  258  GRVILDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAVELHGFASSTPTPSVRF  425
            GR+++D +AE + L   PP L+ K    G   + GVNFAV     A +T   SV F
Sbjct  70   GRLVIDFMAEAFRLPYLPPYLALKE---GQNFKHGVNFAV-----AGATALRSVIF  117



>ref|XP_002457136.1| hypothetical protein SORBIDRAFT_03g001840 [Sorghum bicolor]
 gb|EES02256.1| hypothetical protein SORBIDRAFT_03g001840 [Sorghum bicolor]
Length=386

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 56/89 (63%), Gaps = 7/89 (8%)
 Frame = +3

Query  117  TAIFGFGDSLTDAGNLIHLE--TDGSVPHMYYPPYGETFFGHPTGRCSDGRVILDLIAEY  290
            ++I  FGDS  D GNL+  +     SV  +  PPYGETFFGHP+GR ++GR++LD IA+ 
Sbjct  33   SSILSFGDSYADTGNLVSWDDPVLQSVNLIRNPPYGETFFGHPSGRATNGRIVLDFIADA  92

Query  291  YGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
             GL   PP LSR     G+    GVNFAV
Sbjct  93   LGLPFVPPVLSR-----GENFSTGVNFAV  116



>gb|EMT08653.1| GDSL esterase/lipase [Aegilops tauschii]
Length=416

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/105 (45%), Positives = 65/105 (62%), Gaps = 14/105 (13%)
 Frame = +3

Query  87   CIIGSTAAC--------YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPT  242
            C +   A C        YT++F FGDSLTD GNL+ + +  S   + + PYG T+F  PT
Sbjct  16   CCLARPAQCGGGGGGQNYTSMFSFGDSLTDTGNLL-VSSPLSFNIVGHFPYGMTYFHRPT  74

Query  243  GRCSDGRVILDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            GRCSDGR+++D +A+ +GL +  P LSR     G  ++QGVNFAV
Sbjct  75   GRCSDGRLVVDFLAQAFGLPLLQPYLSR-----GKDVRQGVNFAV  114



>ref|XP_002457140.1| hypothetical protein SORBIDRAFT_03g001880 [Sorghum bicolor]
 gb|EES02260.1| hypothetical protein SORBIDRAFT_03g001880 [Sorghum bicolor]
Length=367

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 58/91 (64%), Gaps = 9/91 (10%)
 Frame = +3

Query  114  YTAIFGFGDSLTDAGNLIHLETDGSVPHMY---YPPYGETFFGHPTGRCSDGRVILDLIA  284
            Y AI+ FGDS+ D GNL      G  P       PPYG T FGHPTGRC+DGRVI+D +A
Sbjct  24   YNAIYSFGDSIADTGNLC--TGSGGCPSWLTTGQPPYGNTHFGHPTGRCTDGRVIVDFLA  81

Query  285  EYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            +++GL + PPS   KA   GD +++G N A+
Sbjct  82   DHFGLPLLPPS---KAIGAGD-VKKGANMAI  108



>ref|XP_008812189.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Phoenix dactylifera]
Length=386

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 63/95 (66%), Gaps = 8/95 (8%)
 Frame = +3

Query  99   STAACYTAIFGFGDSLTDAGNLIHLETD--GSVPHMYYPPYGETFFGHPTGRCSDGRVIL  272
            +T +CYT+IF FGDSL D GNL++  ++  G++  +   PYGET+F  PTGR SDGR+I+
Sbjct  27   ATTSCYTSIFSFGDSLADTGNLLYSPSNNAGAIARL---PYGETYFHRPTGRFSDGRLII  83

Query  273  DLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            D IA+  G+ + PP L+     G    +QG NFAV
Sbjct  84   DFIAQGIGIPLVPPYLAGPGDHG---FRQGANFAV  115



>ref|XP_010480702.1| PREDICTED: uncharacterized protein LOC104759479 [Camelina sativa]
Length=826

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 59/97 (61%), Gaps = 6/97 (6%)
 Frame = +3

Query  93   IGSTAAC--YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRV  266
            + S   C  + +I  FGDS++D GN + L    ++PH  + PYGETFF HPTGR S+GR+
Sbjct  25   VSSETKCREFKSIISFGDSVSDTGNFLGLSDPNNLPHFAFLPYGETFFHHPTGRFSNGRL  84

Query  267  ILDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            I+D IAE+  L + PP    +        ++GVNFAV
Sbjct  85   IIDFIAEFLSLPLVPPFYGSQNAN----FEKGVNFAV  117


 Score = 82.8 bits (203),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 44/98 (45%), Positives = 57/98 (58%), Gaps = 6/98 (6%)
 Frame = +3

Query  90   IIGSTAACYT--AIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGR  263
            ++ S   C    +I  FGDS  D GNL+ L      P +  PPYGETFF HPTGR S+GR
Sbjct  452  MVNSEPECRNLRSIISFGDSTADTGNLLGLSDPNDHPQVALPPYGETFFHHPTGRFSNGR  511

Query  264  VILDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            +I+D IAE+ GL + PP    +        ++GVNFAV
Sbjct  512  LIIDFIAEFLGLPLVPPFYGSQNAN----FEKGVNFAV  545



>dbj|BAJ86481.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=382

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/103 (46%), Positives = 64/103 (62%), Gaps = 12/103 (12%)
 Frame = +3

Query  87   CIIGSTAAC------YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGR  248
            C +   A C      YT++F FGDSLTD GNL+ + +  S   +   PYG T+F  PTGR
Sbjct  30   CCLVRLAQCGGGGQNYTSMFSFGDSLTDTGNLL-VSSPLSFNIVGRFPYGMTYFHRPTGR  88

Query  249  CSDGRVILDLIAEYYGLAIPPPSLSRKAQTGGDYIQQGVNFAV  377
            CSDGR+++D +A+ +GL +  P LSR     G  ++QGVNFAV
Sbjct  89   CSDGRLVVDFLAQAFGLPLLQPYLSR-----GKDVRQGVNFAV  126



>ref|XP_002467296.1| hypothetical protein SORBIDRAFT_01g023210 [Sorghum bicolor]
 gb|EER94294.1| hypothetical protein SORBIDRAFT_01g023210 [Sorghum bicolor]
Length=421

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 61/101 (60%), Gaps = 10/101 (10%)
 Frame = +3

Query  114  YTAIFGFGDSLTDAGNLIHLETDGSVPHMYYPPYGETFFGHPTGRCSDGRVILDLIAEYY  293
            Y  +F FGDSLTD GN +HL      P    PPYGETFF  PTGR SDGR+++D + E  
Sbjct  34   YDRVFSFGDSLTDTGNALHLSATAGGP-ASRPPYGETFFRRPTGRSSDGRLVIDFLVEAL  92

Query  294  GLAIPPPSLSRKAQTGGDYIQQGVNF------AVELHGFAS  398
            G+  P P L+ K  T  D+ ++GVNF      A++LH F S
Sbjct  93   GVPHPTPYLAGK--TAADF-RRGVNFAFGGATALDLHFFES  130



>ref|XP_006646155.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Oryza brachyantha]
Length=375

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 48/65 (74%), Gaps = 2/65 (3%)
 Frame = +3

Query  111  CYTAIFGFGDSLTDAGNLIHLETDGSVPHMY-YPPYGETFFGHPTGRCSDGRVILDLIAE  287
            CY+ IF FGDSLTD GN +HL T G  P  Y  PPYG TFFG PTGR SDGR+++D IA+
Sbjct  36   CYSRIFSFGDSLTDTGNYVHL-TAGKGPSPYGAPPYGRTFFGRPTGRASDGRLVIDFIAQ  94

Query  288  YYGLA  302
             +GLA
Sbjct  95   EFGLA  99



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 564104274800