BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001P15

Length=536
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006365107.1|  PREDICTED: glycine-rich RNA-binding protein ...    135   4e-36   Solanum tuberosum [potatoes]
ref|XP_006365106.1|  PREDICTED: glycine-rich RNA-binding protein ...    135   4e-36   Solanum tuberosum [potatoes]
gb|AIT97256.1|  glycine-rich RNA-binding protein 1-1                    133   8e-36   Capsicum annuum
gb|AIT97254.1|  glycine-rich RNA-binding protein 1-1                    133   8e-36   Capsicum annuum
gb|AAC50020.1|  RNA-binding protein                                     133   1e-35   Nicotiana glutinosa
gb|AIT97253.1|  glycine-rich RNA-binding protein 1-2                    133   2e-35   Capsicum annuum
ref|XP_011092798.1|  PREDICTED: glycine-rich RNA-binding protein ...    132   2e-35   Sesamum indicum [beniseed]
pdb|4C7Q|A  Chain A, Solution Structure Of The Nt. Gr-rbp1 Rrm Do...    130   2e-35   Nicotiana tabacum [American tobacco]
ref|XP_010315305.1|  PREDICTED: glycine-rich RNA-binding protein        132   2e-35   
gb|EPS66737.1|  hypothetical protein M569_08040                         132   3e-35   Genlisea aurea
gb|ACD03270.1|  glycine-rich RNA-binding protein                        132   3e-35   Nicotiana tabacum [American tobacco]
gb|EPS70351.1|  hypothetical protein M569_04412                         129   7e-35   Genlisea aurea
gb|ABB87126.1|  putative glycine-rich RNA binding protein-like          131   1e-34   Solanum tuberosum [potatoes]
dbj|BAA92156.1|  glycine-rich RNA-binding protein                       130   1e-34   Citrus unshiu [satsuma mandarin]
ref|XP_011092799.1|  PREDICTED: glycine-rich RNA-binding protein ...    130   1e-34   Sesamum indicum [beniseed]
gb|EYU42616.1|  hypothetical protein MIMGU_mgv1a016253mg                129   2e-34   Erythranthe guttata [common monkey flower]
gb|ABH07505.1|  glycine-rich RNA-binding protein                        130   2e-34   Nicotiana attenuata
gb|AAF31403.1|AF200322_1  putative glycine-rich RNA binding prote...    130   2e-34   Catharanthus roseus [chatas]
ref|XP_009607320.1|  PREDICTED: glycine-rich RNA-binding protein-...    129   2e-34   Nicotiana tomentosiformis
emb|CAA89058.1|  putative glycine rich RNA binding protein              130   4e-34   Solanum tuberosum [potatoes]
ref|XP_009774643.1|  PREDICTED: glycine-rich RNA-binding protein-...    128   7e-34   Nicotiana sylvestris
gb|KJB78453.1|  hypothetical protein B456_013G036800                    127   8e-34   Gossypium raimondii
gb|KJB78451.1|  hypothetical protein B456_013G036800                    127   9e-34   Gossypium raimondii
gb|AAF31402.1|  putative glycine-rich RNA binding protein 1             127   1e-33   Catharanthus roseus [chatas]
gb|KJB78452.1|  hypothetical protein B456_013G036800                    127   2e-33   Gossypium raimondii
gb|ACJ11730.1|  glycine-rich RNA-binding protein                        127   2e-33   Gossypium hirsutum [American cotton]
gb|KJB78450.1|  hypothetical protein B456_013G036800                    127   2e-33   Gossypium raimondii
gb|KHG02891.1|  Glycine-rich RNA-binding GRP1A                          127   2e-33   Gossypium arboreum [tree cotton]
ref|XP_006487137.1|  PREDICTED: glycine-rich RNA-binding protein-...    127   3e-33   Citrus sinensis [apfelsine]
gb|KDP46256.1|  hypothetical protein JCGZ_10096                         127   3e-33   Jatropha curcas
ref|XP_009804249.1|  PREDICTED: glycine-rich RNA-binding protein-...    127   4e-33   Nicotiana sylvestris
sp|Q03878.1|GRP1_DAUCA  RecName: Full=Glycine-rich RNA-binding pr...    125   8e-33   Daucus carota [carrots]
ref|XP_003561423.1|  PREDICTED: glycine-rich RNA-binding protein ...    125   8e-33   Brachypodium distachyon [annual false brome]
emb|CDP22149.1|  unnamed protein product                                125   9e-33   Coffea canephora [robusta coffee]
ref|XP_011037523.1|  PREDICTED: LOW QUALITY PROTEIN: glycine-rich...    125   1e-32   Populus euphratica
ref|NP_001266231.1|  glycine-rich RNA-binding protein-like              125   1e-32   
ref|XP_009791571.1|  PREDICTED: glycine-rich RNA-binding protein-...    125   1e-32   Nicotiana sylvestris
ref|XP_009618692.1|  PREDICTED: glycine-rich RNA-binding protein ...    125   2e-32   Nicotiana tomentosiformis
ref|XP_008236997.1|  PREDICTED: glycine-rich RNA-binding protein ...    124   2e-32   
emb|CDO97048.1|  unnamed protein product                                125   2e-32   Coffea canephora [robusta coffee]
gb|AAF31404.1|AF200323_1  putative glycine-rich RNA-binding prote...    124   3e-32   Catharanthus roseus [chatas]
ref|XP_006384506.1|  hypothetical protein POPTR_0004s16260g             124   3e-32   
emb|CBI32594.3|  unnamed protein product                                123   3e-32   Vitis vinifera
ref|XP_002305429.1|  glycine-rich RNA-binding family protein            124   4e-32   Populus trichocarpa [western balsam poplar]
gb|ADQ00374.1|  glycine-rich RNA-binding protein                        124   6e-32   Sequoia sempervirens [California redwood]
ref|XP_006404621.1|  hypothetical protein EUTSA_v10000386mg             122   6e-32   
ref|XP_009140299.1|  PREDICTED: glycine-rich RNA-binding protein ...    124   7e-32   Brassica rapa
emb|CAD29693.1|  putative glycine rich protein                          124   7e-32   Rumex obtusifolius
ref|XP_010254827.1|  PREDICTED: glycine-rich RNA-binding protein ...    123   7e-32   Nelumbo nucifera [Indian lotus]
ref|XP_003527212.1|  PREDICTED: glycine-rich RNA-binding protein 7      124   8e-32   Glycine max [soybeans]
ref|XP_009394303.1|  PREDICTED: glycine-rich RNA-binding protein-...    123   8e-32   Musa acuminata subsp. malaccensis [pisang utan]
gb|ADQ08684.1|  putative glycine-rich RNA-binding protein 1             123   8e-32   Malus hupehensis
ref|XP_009618693.1|  PREDICTED: glycine-rich RNA-binding protein-...    122   9e-32   Nicotiana tomentosiformis
ref|XP_008785687.1|  PREDICTED: glycine-rich RNA-binding protein ...    122   9e-32   Phoenix dactylifera
ref|XP_010939297.1|  PREDICTED: glycine-rich RNA-binding protein ...    122   1e-31   Elaeis guineensis
ref|XP_007042188.1|  Glycine-rich RNA-binding protein 7                 123   1e-31   
gb|ADG96008.1|  putative glycine-rich RNA-binding protein 1             123   1e-31   Malus prunifolia
ref|XP_010531429.1|  PREDICTED: glycine-rich RNA-binding protein ...    122   1e-31   Tarenaya hassleriana [spider flower]
ref|XP_009396445.1|  PREDICTED: glycine-rich RNA-binding protein ...    123   1e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009791569.1|  PREDICTED: glycine-rich RNA-binding protein-...    122   1e-31   Nicotiana sylvestris
emb|CAC80549.1|  glycine-rich RNA-binding protein                       123   1e-31   Ricinus communis
ref|XP_002526922.1|  glycine-rich RNA-binding protein, putative         123   1e-31   Ricinus communis
ref|XP_009374202.1|  PREDICTED: glycine-rich RNA-binding protein ...    122   1e-31   
ref|XP_006379241.1|  hypothetical protein POPTR_0009s11920g             122   2e-31   Populus trichocarpa [western balsam poplar]
gb|ABK96349.1|  unknown                                                 122   2e-31   Populus trichocarpa x Populus deltoides
gb|ABG22105.1|  Glycine-rich RNA-binding protein GRP1A, putative,...    120   3e-31   Oryza sativa Japonica Group [Japonica rice]
emb|CDY15876.1|  BnaA04g12350D                                          122   3e-31   Brassica napus [oilseed rape]
emb|CDY72366.1|  BnaUnng05060D                                          122   3e-31   Brassica napus [oilseed rape]
ref|XP_008377301.1|  PREDICTED: LOW QUALITY PROTEIN: glycine-rich...    123   4e-31   
ref|XP_006349599.1|  PREDICTED: glycine-rich RNA-binding protein ...    121   4e-31   Solanum tuberosum [potatoes]
gb|AAL13082.1|  putative glycine-rich RNA-binding protein               122   4e-31   Prunus avium [gean]
ref|XP_007136168.1|  hypothetical protein PHAVU_009G023700g             122   4e-31   Phaseolus vulgaris [French bean]
ref|XP_003631658.1|  PREDICTED: glycine-rich RNA-binding protein ...    121   4e-31   Vitis vinifera
emb|CAA73034.1|  SGRP-1                                                 121   4e-31   Solanum commersonii
ref|XP_011048456.1|  PREDICTED: glycine-rich RNA-binding protein-...    121   5e-31   Populus euphratica
ref|XP_010472164.1|  PREDICTED: glycine-rich RNA-binding protein 7      121   6e-31   Camelina sativa [gold-of-pleasure]
gb|AGO21482.1|  glycine-rich RNA binding protein 7a                     120   6e-31   Camelina sativa [gold-of-pleasure]
ref|XP_010429090.1|  PREDICTED: glycine-rich RNA-binding protein ...    121   6e-31   Camelina sativa [gold-of-pleasure]
ref|XP_010555297.1|  PREDICTED: glycine-rich RNA-binding protein ...    120   1e-30   Tarenaya hassleriana [spider flower]
emb|CAA05728.1|  OsGRP1                                                 120   1e-30   Oryza sativa Japonica Group [Japonica rice]
sp|P49311.1|GRP2_SINAL  RecName: Full=Glycine-rich RNA-binding pr...    120   1e-30   Sinapis alba [bai jie]
ref|XP_006854646.1|  hypothetical protein AMTR_s00030p00195240          120   1e-30   Amborella trichopoda
ref|XP_003606921.1|  Glycine-rich RNA binding protein                   120   2e-30   Medicago truncatula
ref|NP_001067344.1|  Os12g0632000                                       120   2e-30   
gb|ACJ04160.1|  putative glycine-rich RNA-binding protein               120   2e-30   Chorispora bungeana
ref|XP_006590896.1|  PREDICTED: glycine-rich RNA-binding protein ...    120   2e-30   Glycine max [soybeans]
ref|XP_004289673.1|  PREDICTED: glycine-rich RNA-binding, abscisi...    120   2e-30   Fragaria vesca subsp. vesca
ref|XP_010056019.1|  PREDICTED: glycine-rich RNA-binding protein-...    119   2e-30   Eucalyptus grandis [rose gum]
ref|XP_008347751.1|  PREDICTED: glycine-rich RNA-binding protein-...    119   3e-30   Malus domestica [apple tree]
ref|XP_009342794.1|  PREDICTED: glycine-rich RNA-binding protein        119   3e-30   Pyrus x bretschneideri [bai li]
gb|ACA50486.1|  glycine-rich RNA binding protein                        119   3e-30   Oryza sativa Japonica Group [Japonica rice]
gb|EAY84004.1|  hypothetical protein OsI_39235                          119   3e-30   Oryza sativa Indica Group [Indian rice]
gb|ABK21879.1|  unknown                                                 119   3e-30   Picea sitchensis
ref|XP_002880392.1|  hypothetical protein ARALYDRAFT_481034             119   3e-30   
ref|XP_010066154.1|  PREDICTED: glycine-rich RNA-binding, abscisi...    119   3e-30   Eucalyptus grandis [rose gum]
ref|XP_010431895.1|  PREDICTED: glycine-rich RNA-binding protein ...    119   3e-30   Camelina sativa [gold-of-pleasure]
emb|CAC83314.1|  glycine rich RNA binding protein                       120   3e-30   Oryza sativa Indica Group [Indian rice]
dbj|BAH56965.1|  AT2G21660                                              119   3e-30   Arabidopsis thaliana [mouse-ear cress]
ref|NP_850017.1|  glycine-rich RNA-binding protein 7                    119   4e-30   Arabidopsis thaliana [mouse-ear cress]
gb|AAB63581.1|  glycine-rich RNA binding protein 1                      119   5e-30   Pelargonium x hortorum [bedding geranium]
sp|P49310.1|GRP1_SINAL  RecName: Full=Glycine-rich RNA-binding pr...    119   5e-30   Sinapis alba [bai jie]
gb|AAM62447.1|  glycine-rich RNA binding protein 7                      119   6e-30   Arabidopsis thaliana [mouse-ear cress]
gb|KHG24415.1|  Glycine-rich RNA-binding GRP1A                          119   6e-30   Gossypium arboreum [tree cotton]
ref|NP_179760.1|  glycine-rich RNA-binding protein 7                    119   6e-30   Arabidopsis thaliana [mouse-ear cress]
gb|AIN39847.1|  hypothetical protein                                    118   7e-30   Zoysia matrella [Japanese carpet grass]
gb|KFK32876.1|  glycine-rich rna binding protein                        119   7e-30   Arabis alpina [alpine rockcress]
ref|NP_001050870.1|  Os03g0670700                                       119   1e-29   
gb|KHG11483.1|  Glycine-rich RNA-binding GRP1A                          117   1e-29   Gossypium arboreum [tree cotton]
gb|AFL91694.1|  glycine-rich RNA binding protein                        117   1e-29   Raphanus sativus var. raphanistroides [East Asian wild radish]
ref|XP_010254826.1|  PREDICTED: glycine-rich RNA-binding protein ...    117   1e-29   Nelumbo nucifera [Indian lotus]
ref|XP_007131829.1|  hypothetical protein PHAVU_011G045000g             118   1e-29   Phaseolus vulgaris [French bean]
gb|AGU36625.1|  Gly-rich RNA binding protein                            116   1e-29   Helianthus annuus
ref|XP_009117375.1|  PREDICTED: glycine-rich RNA-binding protein ...    118   1e-29   Brassica rapa
gb|KJB32509.1|  hypothetical protein B456_005G243900                    117   1e-29   Gossypium raimondii
gb|AGU36636.1|  Gly-rich RNA binding protein                            116   1e-29   Helianthus annuus
gb|KEH30440.1|  RNA-binding (RRM/RBD/RNP motif) family protein          116   1e-29   Medicago truncatula
ref|XP_010548055.1|  PREDICTED: glycine-rich RNA-binding protein ...    117   1e-29   Tarenaya hassleriana [spider flower]
gb|AGU36634.1|  Gly-rich RNA binding protein                            116   1e-29   Helianthus annuus
ref|XP_009412272.1|  PREDICTED: glycine-rich RNA-binding protein ...    118   1e-29   
gb|EEC75898.1|  hypothetical protein OsI_12955                          117   1e-29   Oryza sativa Indica Group [Indian rice]
gb|AAB66885.1|  glycine-rich protein                                    117   1e-29   Oryza sativa Japonica Group [Japonica rice]
gb|AAC61786.1|  glycine-rich RNA-binding protein                        117   1e-29   Euphorbia esula [wolf's milk]
gb|AAB65412.1|  glycine-rich protein                                    117   1e-29   Oryza sativa Indica Group [Indian rice]
ref|XP_004248717.1|  PREDICTED: glycine-rich RNA-binding protein-...    117   2e-29   Solanum lycopersicum
dbj|BAK07102.1|  predicted protein                                      115   2e-29   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010416924.1|  PREDICTED: glycine-rich RNA-binding protein ...    117   2e-29   
emb|CDY59763.1|  BnaC08g49360D                                          117   2e-29   Brassica napus [oilseed rape]
gb|KJB32510.1|  hypothetical protein B456_005G243900                    115   2e-29   Gossypium raimondii
ref|XP_010446462.1|  PREDICTED: glycine-rich RNA-binding protein ...    117   2e-29   Camelina sativa [gold-of-pleasure]
gb|AGW47685.1|  glycine-rich RNA-binding protein 8 splice variant 6     115   2e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009794537.1|  PREDICTED: glycine-rich RNA-binding protein ...    116   3e-29   Nicotiana sylvestris
ref|XP_004507451.1|  PREDICTED: glycine-rich RNA-binding, abscisi...    116   3e-29   Cicer arietinum [garbanzo]
sp|Q05966.1|GRP10_BRANA  RecName: Full=Glycine-rich RNA-binding p...    117   3e-29   Brassica napus [oilseed rape]
ref|XP_004963286.1|  PREDICTED: glycine-rich RNA-binding protein ...    116   4e-29   Setaria italica
ref|XP_009411337.1|  PREDICTED: glycine-rich RNA-binding protein ...    116   4e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010416925.1|  PREDICTED: glycine-rich RNA-binding protein ...    116   5e-29   
gb|AAC61787.1|  glycine-rich RNA-binding protein                        116   5e-29   Euphorbia esula [wolf's milk]
ref|NP_849524.1|  glycine-rich RNA-binding protein 8                    114   5e-29   Arabidopsis thaliana [mouse-ear cress]
gb|ACN25391.1|  unknown                                                 114   6e-29   Zea mays [maize]
dbj|BAE92287.1|  putative glycine-rich RNA binding protein              116   6e-29   Cryptomeria japonica
ref|XP_010088923.1|  Glycine-rich RNA-binding protein 7                 116   6e-29   
ref|XP_006349600.1|  PREDICTED: glycine-rich RNA-binding protein-...    115   6e-29   
ref|XP_009802591.1|  PREDICTED: glycine-rich RNA-binding protein-...    114   6e-29   Nicotiana sylvestris
ref|XP_003537883.2|  PREDICTED: glycine-rich RNA-binding protein ...    115   7e-29   
gb|ABF98117.1|  retrotransposon protein, putative, Ty1-copia subc...    115   8e-29   Oryza sativa Japonica Group [Japonica rice]
gb|AGU36624.1|  Gly-rich RNA binding protein                            114   9e-29   Helianthus annuus
gb|KHN39785.1|  Glycine-rich RNA-binding protein GRP1A                  115   1e-28   Glycine soja [wild soybean]
gb|AAT85299.1|  glycine-rich RNA-binding protein, putative              115   1e-28   Oryza sativa Japonica Group [Japonica rice]
emb|CDY42616.1|  BnaC01g00280D                                          115   1e-28   Brassica napus [oilseed rape]
ref|NP_001235801.1|  uncharacterized protein LOC100305467               115   1e-28   
gb|ACL54717.1|  unknown                                                 114   1e-28   Zea mays [maize]
gb|AAB63589.1|  glycine-rich RNA-binding protein                        115   1e-28   Oryza sativa Indica Group [Indian rice]
gb|ACR36732.1|  unknown                                                 114   1e-28   Zea mays [maize]
ref|XP_003606910.1|  Glycine-rich RNA binding protein                   115   1e-28   Medicago truncatula
gb|ACG28088.1|  glycine-rich RNA-binding protein 2                      114   1e-28   Zea mays [maize]
gb|ACG26657.1|  glycine-rich RNA-binding protein 2                      114   1e-28   Zea mays [maize]
gb|AGW47684.1|  glycine-rich RNA-binding protein 8 splice variant 5     113   2e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009109892.1|  PREDICTED: glycine-rich RNA-binding protein ...    114   2e-28   Brassica rapa
ref|NP_849523.1|  glycine-rich RNA-binding protein 8                    113   2e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010531568.1|  PREDICTED: glycine-rich RNA-binding protein ...    114   2e-28   Tarenaya hassleriana [spider flower]
ref|XP_002868897.1|  hypothetical protein ARALYDRAFT_490700             114   2e-28   
ref|NP_001238373.1|  glycine-rich RNA-binding protein                   114   2e-28   Glycine max [soybeans]
gb|AAD28176.1|AF109917_1  glycine-rich RNA-binding protein              114   2e-28   Picea glauca
ref|XP_003537882.1|  PREDICTED: glycine-rich RNA-binding protein ...    114   2e-28   
emb|CDY41969.1|  BnaA01g05410D                                          113   3e-28   Brassica napus [oilseed rape]
ref|XP_004500810.1|  PREDICTED: glycine-rich RNA-binding protein ...    115   3e-28   Cicer arietinum [garbanzo]
dbj|BAJ89718.1|  predicted protein                                      114   3e-28   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AGI04359.1|  low temperature-responsive RNA-binding protein          114   3e-28   Triticum aestivum [Canadian hard winter wheat]
dbj|BAF30986.1|  glycine-rich RNA-binding protein                       114   3e-28   Triticum aestivum [Canadian hard winter wheat]
gb|ACN31562.1|  unknown                                                 117   4e-28   Zea mays [maize]
ref|XP_003522939.1|  PREDICTED: glycine-rich RNA-binding protein ...    114   4e-28   Glycine max [soybeans]
sp|Q43472.1|GRP_HORVU  RecName: Full=Glycine-rich RNA-binding pro...    113   4e-28   Hordeum vulgare [barley]
ref|XP_009109480.1|  PREDICTED: glycine-rich RNA-binding protein ...    113   5e-28   Brassica rapa
ref|XP_008790382.1|  PREDICTED: glycine-rich RNA-binding protein ...    113   5e-28   Phoenix dactylifera
ref|XP_002442600.1|  hypothetical protein SORBIDRAFT_08g022740          113   5e-28   Sorghum bicolor [broomcorn]
ref|NP_195637.1|  glycine-rich RNA-binding protein 8                    113   6e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004507448.1|  PREDICTED: glycine-rich RNA-binding protein ...    113   6e-28   Cicer arietinum [garbanzo]
ref|XP_009782496.1|  PREDICTED: glycine-rich RNA-binding, abscisi...    111   8e-28   Nicotiana sylvestris
gb|EMT06730.1|  Glycine-rich RNA-binding protein                        111   8e-28   
dbj|BAJ34207.1|  unnamed protein product                                112   1e-27   Eutrema halophilum
ref|XP_006854654.1|  hypothetical protein AMTR_s00030p00198740          112   1e-27   Amborella trichopoda
gb|AAF06329.1|AF191305_1  glycine-rich RNA binding protein              110   1e-27   Medicago sativa [alfalfa]
ref|NP_001132731.1|  responsive to abscisic acid15                      110   2e-27   
emb|CDY12133.1|  BnaC03g60490D                                          111   4e-27   Brassica napus [oilseed rape]
gb|AAA75104.1|  single-stranded nucleic acid binding protein            111   4e-27   Triticum aestivum [Canadian hard winter wheat]
dbj|BAE91897.1|  glycine-rich RNA-binding protein                       109   5e-27   Lolium perenne [perennial ryegrass]
ref|XP_003606916.1|  Glycine-rich RNA binding protein                   111   5e-27   Medicago truncatula
gb|ACF80971.1|  unknown                                                 110   5e-27   Zea mays [maize]
gb|ACF84263.1|  unknown                                                 110   6e-27   Zea mays [maize]
gb|ACG41989.1|  glycine-rich RNA-binding protein 2                      110   6e-27   Zea mays [maize]
dbj|BAH57166.1|  AT2G21660                                              108   6e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008664443.1|  PREDICTED: glycine-rich RNA-binding protein ...    110   6e-27   
ref|NP_001105572.1|  glycine-rich RNA binding protein                   110   6e-27   Zea mays [maize]
gb|ACG31231.1|  glycine-rich RNA-binding protein 2                      110   7e-27   Zea mays [maize]
ref|NP_001105707.1|  glycine-rich protein1                              110   7e-27   
gb|AAM16023.1|  glycine-rich RNA binding protein                        110   7e-27   Zea mays [maize]
dbj|BAF34340.1|  putative glycine-rich RNA-binding protein              110   7e-27   Dianthus caryophyllus [carnation]
gb|AAM16009.1|  glycine-rich RNA binding protein                        110   7e-27   Zea mays [maize]
gb|AAM16010.1|  glycine-rich RNA binding protein                        110   7e-27   Zea mays [maize]
gb|AAM16013.1|  glycine-rich RNA binding protein                        110   9e-27   Zea mays [maize]
gb|ACG43341.1|  glycine-rich RNA-binding protein 2                      110   9e-27   Zea mays [maize]
emb|CDY46213.1|  BnaA07g03570D                                          109   9e-27   Brassica napus [oilseed rape]
sp|P10979.1|GRPA_MAIZE  RecName: Full=Glycine-rich RNA-binding, a...    110   9e-27   Zea mays [maize]
gb|KFK30502.1|  hypothetical protein AALP_AA7G270500                    110   9e-27   Arabis alpina [alpine rockcress]
ref|XP_008681237.1|  PREDICTED: responsive to abscisic acid15 iso...    110   1e-26   
gb|AAM16021.1|  glycine-rich RNA binding protein                        109   1e-26   Zea mays [maize]
gb|AAB66884.1|  glycine-rich protein                                    110   1e-26   Oryza sativa Japonica Group [Japonica rice]
gb|AAM16007.1|  glycine-rich RNA binding protein                        109   1e-26   Zea mays [maize]
gb|AAB61213.1|  glycine-rich protein                                    110   1e-26   Oryza sativa Japonica Group [Japonica rice]
gb|AAM15999.1|  glycine-rich RNA binding protein                        109   1e-26   Zea mays [maize]
gb|AAM16000.1|  glycine-rich RNA binding protein                        109   2e-26   Zea mays [maize]
gb|AAM16011.1|  glycine-rich RNA binding protein                        109   2e-26   Zea mays [maize]
gb|AAM16003.1|  glycine-rich RNA binding protein                        109   2e-26   Zea mays [maize]
gb|AAM16019.1|  glycine-rich RNA binding protein                        109   2e-26   Zea mays [maize]
gb|ACG35271.1|  glycine-rich RNA-binding protein 2                      110   2e-26   Zea mays [maize]
sp|Q99070.1|GRP2_SORBI  RecName: Full=Glycine-rich RNA-binding pr...    109   2e-26   Sorghum bicolor [broomcorn]
ref|XP_009121223.1|  PREDICTED: glycine-rich RNA-binding protein ...    109   3e-26   Brassica rapa
emb|CDX71276.1|  BnaC07g05550D                                          109   3e-26   
gb|KFK41270.1|  hypothetical protein AALP_AA2G108100                    108   4e-26   Arabis alpina [alpine rockcress]
gb|ACG32421.1|  glycine-rich RNA-binding protein 2                      107   6e-26   Zea mays [maize]
gb|AAM16006.1|  glycine-rich RNA binding protein                        107   7e-26   Zea mays [maize]
gb|AAG23220.1|  glycine-rich RNA-binding protein                        108   7e-26   Sorghum bicolor [broomcorn]
gb|AAM16002.1|  glycine-rich RNA binding protein                        107   8e-26   Zea mays [maize]
dbj|BAJ85361.1|  predicted protein                                      108   8e-26   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004162998.1|  PREDICTED: glycine-rich RNA-binding protein ...    107   9e-26   
gb|AAM16012.1|  glycine-rich RNA binding protein                        107   9e-26   Zea mays [maize]
ref|XP_004148848.1|  PREDICTED: glycine-rich RNA-binding protein ...    107   9e-26   
ref|XP_001771291.1|  predicted protein                                  105   9e-26   
ref|XP_004148847.1|  PREDICTED: glycine-rich RNA-binding protein ...    107   1e-25   
emb|CAA88558.1|  glycine rich protein, RNA binding protein              107   1e-25   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004982205.1|  PREDICTED: glycine-rich RNA-binding protein ...    107   1e-25   Setaria italica
gb|AAM16005.1|  glycine-rich RNA binding protein                        107   1e-25   Zea mays [maize]
gb|AAM16015.1|  glycine-rich RNA binding protein                        107   1e-25   Zea mays [maize]
ref|XP_004148846.1|  PREDICTED: glycine-rich RNA-binding protein ...    107   1e-25   
gb|KGN61792.1|  hypothetical protein Csa_2G247040                       107   1e-25   Cucumis sativus [cucumbers]
ref|XP_004148845.1|  PREDICTED: glycine-rich RNA-binding protein ...    107   2e-25   
gb|AAM16020.1|  glycine-rich RNA binding protein                        106   3e-25   Zea mays [maize]
pdb|2MPU|A  Chain A, Structural And Functional Analysis Of The Ho...    103   4e-25   Hordeum vulgare [barley]
ref|XP_010472509.1|  PREDICTED: glycine-rich RNA-binding protein ...    106   5e-25   Camelina sativa [gold-of-pleasure]
ref|XP_010429491.1|  PREDICTED: probable glycine-rich RNA-binding...    105   6e-25   Camelina sativa [gold-of-pleasure]
ref|XP_004507450.1|  PREDICTED: glycine-rich RNA-binding protein ...    105   6e-25   
ref|XP_004507449.1|  PREDICTED: glycine-rich RNA-binding protein ...    105   8e-25   Cicer arietinum [garbanzo]
ref|XP_008460935.1|  PREDICTED: glycine-rich RNA-binding protein ...    105   1e-24   Cucumis melo [Oriental melon]
ref|XP_001760393.1|  predicted protein                                  104   1e-24   
gb|AFP52931.1|  RBP1                                                    104   2e-24   Hordeum vulgare [barley]
gb|AAM16014.1|  glycine-rich RNA binding protein                        103   4e-24   Zea mays [maize]
ref|XP_001770275.1|  predicted protein                                  101   5e-24   
ref|XP_010690881.1|  PREDICTED: glycine-rich RNA-binding protein-...    103   6e-24   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010417257.1|  PREDICTED: glycine-rich RNA-binding protein ...    102   7e-24   Camelina sativa [gold-of-pleasure]
gb|AAM16016.1|  glycine-rich RNA binding protein                        102   7e-24   Zea mays [maize]
gb|EMS57277.1|  Glycine-rich RNA-binding protein GRP1A                  102   7e-24   Triticum urartu
gb|EMT31367.1|  Glycine-rich RNA-binding protein GRP1A                  102   9e-24   
ref|XP_003576265.1|  PREDICTED: glycine-rich RNA-binding protein ...    102   1e-23   Brachypodium distachyon [annual false brome]
ref|XP_002988685.1|  hypothetical protein SELMODRAFT_18499              100   4e-23   
dbj|BAC00786.1|  glycine-rich RNA-binding protein                       100   4e-23   Physcomitrella patens
ref|XP_010690882.1|  PREDICTED: glycine-rich RNA-binding protein ...    100   5e-23   Beta vulgaris subsp. vulgaris [field beet]
gb|AEE42608.1|  glycine-rich RNA-binding protein 1                      100   5e-23   Chelidonium majus
ref|XP_002986384.1|  hypothetical protein SELMODRAFT_49298            97.8    3e-22   
ref|XP_008664413.1|  PREDICTED: glycine-rich RNA-binding protein ...  97.8    4e-22   
ref|XP_003576037.1|  PREDICTED: glycine-rich RNA-binding protein ...  95.9    6e-22   Brachypodium distachyon [annual false brome]
gb|ACR38140.1|  unknown                                               96.3    4e-21   Zea mays [maize]
ref|NP_001149519.1|  glycine-rich RNA-binding protein 8               96.3    5e-21   
gb|ACH60524.1|  glycine-rich RNA-binding protein                      92.4    6e-21   Pseudotsuga menziesii
ref|NP_001132163.1|  uncharacterized protein LOC100193584             96.3    6e-21   
gb|ABA81883.1|  putative glycine-rich RNA binding protein-like        95.1    7e-21   Solanum tuberosum [potatoes]
gb|AAS67333.1|  glycine-rich RNA-binding protein RGP-1c               93.6    9e-21   Nicotiana sylvestris
gb|AFK35888.1|  unknown                                               92.0    2e-20   Medicago truncatula
ref|XP_010245267.1|  PREDICTED: glycine-rich RNA-binding protein      95.1    2e-20   Nelumbo nucifera [Indian lotus]
ref|XP_009117376.1|  PREDICTED: glycine-rich RNA-binding protein ...  93.2    2e-20   Brassica rapa
ref|XP_010056020.1|  PREDICTED: glycine-rich RNA-binding protein ...  92.8    3e-20   Eucalyptus grandis [rose gum]
ref|XP_004981140.1|  PREDICTED: glycine-rich RNA-binding protein-...  93.6    5e-20   
ref|XP_004981784.1|  PREDICTED: glycine-rich RNA-binding, abscisi...  93.6    5e-20   
ref|XP_007205498.1|  hypothetical protein PRUPE_ppa008245mg           95.1    5e-20   
dbj|BAK05765.1|  predicted protein                                    94.4    5e-20   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAG15857.1|  glycine-rich protein                                 92.4    6e-20   Bruguiera gymnorhiza [Burma mangrove]
ref|NP_001241701.1|  glycine-rich RNA-binding protein                 92.0    7e-20   
ref|NP_849525.1|  glycine-rich RNA-binding protein 8                  90.5    7e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006349603.1|  PREDICTED: glycine-rich RNA-binding protein ...  91.3    1e-19   
ref|XP_004289674.1|  PREDICTED: glycine-rich RNA-binding protein ...  90.9    2e-19   Fragaria vesca subsp. vesca
gb|AAD22311.1|  putative glycine-rich RNA-binding protein             91.3    2e-19   
ref|XP_006339763.1|  PREDICTED: glycine-rich RNA-binding protein ...  91.3    2e-19   
gb|ABK22248.1|  unknown                                               91.7    3e-19   
ref|XP_008246514.1|  PREDICTED: glycine-rich RNA-binding protein ...  91.7    3e-19   
sp|Q9SIX3.2|RBG1_ARATH  RecName: Full=Probable glycine-rich RNA-b...  89.7    4e-19   
ref|XP_006650865.1|  PREDICTED: glycine-rich RNA-binding protein-...  90.1    9e-19   
ref|XP_009335630.1|  PREDICTED: glycine-rich RNA-binding protein ...  90.1    1e-18   
ref|NP_001051823.1|  Os03g0836200                                     89.7    1e-18   
ref|XP_010431896.1|  PREDICTED: glycine-rich RNA-binding protein ...  88.2    1e-18   
ref|XP_004302455.1|  PREDICTED: glycine-rich RNA-binding protein ...  89.7    2e-18   
ref|XP_008370514.1|  PREDICTED: glycine-rich RNA-binding protein ...  89.4    2e-18   
ref|XP_010065540.1|  PREDICTED: glycine-rich RNA-binding protein      89.4    2e-18   
ref|XP_010111854.1|  Glycine-rich RNA-binding protein                 89.7    2e-18   
emb|CDY52166.1|  BnaC02g48060D                                        89.4    2e-18   
gb|ACH60531.1|  glycine-rich RNA-binding protein                      85.1    3e-18   
ref|XP_009110538.1|  PREDICTED: glycine-rich RNA-binding protein ...  87.0    3e-18   
ref|XP_009373970.1|  PREDICTED: glycine-rich RNA-binding protein-...  88.6    4e-18   
ref|XP_008388589.1|  PREDICTED: glycine-rich RNA-binding protein-...  88.2    4e-18   
ref|XP_009587123.1|  PREDICTED: glycine-rich RNA-binding protein-...  88.2    4e-18   
ref|NP_001289534.1|  glycine-rich RNA-binding protein-like            88.2    5e-18   
ref|XP_011092398.1|  PREDICTED: glycine-rich RNA-binding protein ...  88.2    5e-18   
ref|XP_011092396.1|  PREDICTED: glycine-rich RNA-binding protein ...  88.2    5e-18   
gb|KJB63237.1|  hypothetical protein B456_010G1391002                 87.8    5e-18   
ref|XP_003593133.1|  Glycine-rich RNA-binding protein                 90.5    7e-18   
ref|XP_007037358.1|  RNA-binding family protein with retrovirus z...  87.4    9e-18   
ref|XP_007037359.1|  RNA-binding family protein with retrovirus z...  87.4    1e-17   
gb|ACX71299.1|  RNA-binding protein RZ-1                              87.0    1e-17   
ref|XP_011046127.1|  PREDICTED: glycine-rich RNA-binding protein ...  87.4    1e-17   
ref|XP_010234241.1|  PREDICTED: glycine-rich RNA-binding protein      87.4    1e-17   
ref|XP_002299678.2|  hypothetical protein POPTR_0001s21460g           86.7    2e-17   
ref|XP_009129506.1|  PREDICTED: glycine-rich RNA-binding protein ...  86.7    2e-17   
ref|XP_009152057.1|  PREDICTED: glycine-rich RNA-binding protein ...  86.7    2e-17   
emb|CDX83617.1|  BnaC07g23570D                                        86.7    2e-17   
ref|XP_009152058.1|  PREDICTED: glycine-rich RNA-binding protein ...  86.3    2e-17   
emb|CDY13632.1|  BnaA06g32910D                                        86.7    2e-17   
ref|XP_001757165.1|  predicted protein                                85.1    2e-17   
ref|XP_009129504.1|  PREDICTED: glycine-rich RNA-binding protein ...  86.7    2e-17   
ref|XP_009129505.1|  PREDICTED: glycine-rich RNA-binding protein ...  86.3    3e-17   
gb|AFK43882.1|  unknown                                               85.9    3e-17   
ref|XP_007217509.1|  hypothetical protein PRUPE_ppa025004mg           83.2    3e-17   
gb|KDP37561.1|  hypothetical protein JCGZ_06000                       85.9    3e-17   
gb|KHN28499.1|  Glycine-rich RNA-binding protein 10                   85.5    4e-17   
ref|NP_001235732.1|  uncharacterized protein LOC100526902             85.1    4e-17   
ref|NP_001240860.1|  uncharacterized protein LOC100815224             85.5    4e-17   
emb|CBI35498.3|  unnamed protein product                              84.3    4e-17   
ref|XP_010911945.1|  PREDICTED: glycine-rich RNA-binding protein ...  85.5    4e-17   
gb|KHN39195.1|  Glycine-rich RNA-binding protein 10                   85.5    5e-17   
ref|XP_001770702.1|  predicted protein                                84.3    5e-17   
ref|XP_004230614.1|  PREDICTED: glycine-rich RNA-binding, abscisi...  85.1    5e-17   
ref|XP_010547817.1|  PREDICTED: glycine-rich RNA-binding protein ...  85.1    5e-17   
ref|XP_006351815.1|  PREDICTED: glycine-rich RNA-binding protein ...  85.1    6e-17   
ref|XP_002977297.1|  hypothetical protein SELMODRAFT_107195           84.7    6e-17   
gb|KHG13585.1|  hypothetical protein F383_18387                       85.1    6e-17   
ref|XP_010911946.1|  PREDICTED: glycine-rich RNA-binding protein ...  84.7    7e-17   
ref|XP_002971930.1|  hypothetical protein SELMODRAFT_172546           84.3    7e-17   
ref|XP_006291770.1|  hypothetical protein CARUB_v10017941mg           85.1    8e-17   
emb|CDY13550.1|  BnaC02g23610D                                        82.0    8e-17   
gb|AAK01176.1|  RNA-binding protein                                   84.0    1e-16   
ref|XP_002264022.1|  PREDICTED: glycine-rich RNA-binding protein ...  84.3    1e-16   
ref|XP_010550605.1|  PREDICTED: glycine-rich RNA-binding protein ...  84.3    1e-16   
gb|AAL09710.1|  AT3g26420/F20C19_14                                   83.2    1e-16   
gb|EMS54208.1|  Glycine-rich RNA-binding protein 2                    84.7    1e-16   
ref|XP_004136860.1|  PREDICTED: uncharacterized protein LOC101215898  84.3    1e-16   
gb|AFK34101.1|  unknown                                               84.3    1e-16   
ref|XP_002523766.1|  dc50, putative                                   84.3    1e-16   
sp|Q99069.1|GRP1_SORBI  RecName: Full=Glycine-rich RNA-binding pr...  82.4    2e-16   
ref|XP_002875318.1|  predicted protein                                84.3    2e-16   
ref|XP_010502559.1|  PREDICTED: glycine-rich RNA-binding protein ...  84.3    2e-16   
ref|XP_008455237.1|  PREDICTED: glycine-rich RNA-binding protein 10   84.0    2e-16   
ref|XP_004504757.1|  PREDICTED: glycine-rich RNA-binding protein-...  84.0    2e-16   
ref|XP_010502563.1|  PREDICTED: glycine-rich RNA-binding protein ...  84.3    2e-16   
ref|XP_010502562.1|  PREDICTED: glycine-rich RNA-binding protein ...  84.3    2e-16   
ref|XP_010502561.1|  PREDICTED: glycine-rich RNA-binding protein ...  84.3    2e-16   
ref|XP_004504758.1|  PREDICTED: glycine-rich RNA-binding protein-...  83.6    2e-16   
ref|XP_010502566.1|  PREDICTED: glycine-rich RNA-binding protein ...  84.0    2e-16   
ref|XP_010514278.1|  PREDICTED: glycine-rich RNA-binding protein ...  84.3    2e-16   
ref|XP_010425335.1|  PREDICTED: glycine-rich RNA-binding protein ...  84.0    2e-16   
ref|XP_010514279.1|  PREDICTED: glycine-rich RNA-binding protein ...  84.0    2e-16   
ref|XP_010680268.1|  PREDICTED: glycine-rich RNA-binding protein ...  83.6    2e-16   
ref|XP_008785787.1|  PREDICTED: glycine-rich RNA-binding protein      83.2    3e-16   
ref|XP_006395557.1|  hypothetical protein EUTSA_v10004793mg           83.6    3e-16   
gb|KHG04541.1|  Glycine-rich RNA-binding protein                      83.6    3e-16   
ref|XP_010243235.1|  PREDICTED: glycine-rich RNA-binding, abscisi...  83.6    3e-16   
ref|NP_189273.1|  zinc finger-containing glycine-rich  RNA-bindin...  83.2    4e-16   
ref|XP_007159067.1|  hypothetical protein PHAVU_002G205400g           82.8    4e-16   
dbj|BAJ95525.1|  predicted protein                                    82.4    7e-16   
gb|KJB08260.1|  hypothetical protein B456_001G074700                  82.0    7e-16   
gb|EMT32326.1|  Glycine-rich RNA-binding protein                      82.4    7e-16   
ref|XP_010267222.1|  PREDICTED: glycine-rich RNA-binding, abscisi...  82.4    1e-15   
ref|XP_010438702.1|  PREDICTED: glycine-rich RNA-binding protein ...  79.3    1e-15   
gb|ACJ84330.1|  unknown                                               81.3    1e-15   
emb|CDO97493.1|  unnamed protein product                              81.3    1e-15   
ref|XP_009107499.1|  PREDICTED: glycine-rich RNA-binding protein ...  80.1    1e-15   
emb|CDY47311.1|  BnaAnng08850D                                        80.1    1e-15   
gb|AFK08576.1|  glycine-rich RNA binding protein 2a                   80.5    1e-15   
ref|XP_006854598.1|  hypothetical protein AMTR_s00030p00132070        81.3    1e-15   
gb|EPS72946.1|  hypothetical protein M569_01808                       81.6    1e-15   
ref|XP_010435219.1|  PREDICTED: glycine-rich RNA-binding protein ...  80.5    2e-15   
emb|CDY53035.1|  BnaCnng24070D                                        80.1    2e-15   
gb|KHG17933.1|  Glycine-rich RNA-binding protein                      81.3    2e-15   
gb|KJB50920.1|  hypothetical protein B456_008G193200                  80.9    2e-15   
emb|CDY47314.1|  BnaAnng08880D                                        80.1    2e-15   
ref|XP_011101393.1|  PREDICTED: glycine-rich RNA-binding protein ...  80.9    2e-15   
ref|XP_010495842.1|  PREDICTED: glycine-rich RNA-binding protein ...  80.1    2e-15   
ref|XP_010513265.1|  PREDICTED: glycine-rich RNA-binding protein ...  80.1    2e-15   
ref|XP_010450153.1|  PREDICTED: glycine-rich RNA-binding protein ...  79.7    2e-15   
ref|XP_006365467.1|  PREDICTED: glycine-rich RNA-binding protein ...  79.3    2e-15   
ref|XP_009608205.1|  PREDICTED: glycine-rich RNA-binding protein ...  79.3    2e-15   
ref|NP_001289913.1|  glycine-rich RNA-binding protein 2, mitochon...  79.7    2e-15   
gb|ABA40453.1|  RNA binding protein-like protein                      79.3    2e-15   
ref|XP_009777998.1|  PREDICTED: glycine-rich RNA-binding protein ...  79.3    3e-15   
gb|KIL87680.1|  rna-binding glycine-rich protein                      77.8    4e-15   
ref|XP_009107498.1|  PREDICTED: glycine-rich RNA-binding protein ...  80.1    4e-15   
ref|XP_006298696.1|  hypothetical protein CARUB_v10014791mg           79.3    4e-15   
gb|EMS65575.1|  Glycine-rich RNA-binding protein 2, mitochondrial     79.3    5e-15   
gb|AFK08578.1|  glycine-rich RNA binding protein 2c                   79.0    5e-15   
ref|XP_010696295.1|  PREDICTED: glycine-rich RNA-binding protein ...  80.1    5e-15   
ref|XP_010098799.1|  Glycine-rich RNA-binding, abscisic acid-indu...  80.1    5e-15   
ref|XP_010430651.1|  PREDICTED: glycine-rich RNA-binding protein ...  79.0    7e-15   
ref|XP_010513266.1|  PREDICTED: glycine-rich RNA-binding protein ...  79.0    7e-15   
ref|XP_007224492.1|  hypothetical protein PRUPE_ppa022930mg           77.4    7e-15   
ref|XP_009402624.1|  PREDICTED: glycine-rich RNA-binding protein-...  79.3    8e-15   
emb|CBI30155.3|  unnamed protein product                              79.0    8e-15   
ref|XP_004239853.1|  PREDICTED: glycine-rich RNA-binding protein ...  78.2    8e-15   
ref|XP_002870351.1|  hypothetical protein ARALYDRAFT_493528           78.2    9e-15   
gb|AFP57450.1|  RNA-binding glycine-rich protein                      77.4    1e-14   
ref|XP_010488462.1|  PREDICTED: glycine-rich RNA-binding protein ...  77.4    1e-14   
ref|XP_003564921.1|  PREDICTED: glycine-rich RNA-binding protein ...  77.4    2e-14   
ref|XP_004248805.1|  PREDICTED: glycine-rich RNA-binding protein      78.2    2e-14   
emb|CDQ77436.1|  unnamed protein product                              77.0    2e-14   
ref|XP_010512958.1|  PREDICTED: glycine-rich RNA-binding protein ...  76.6    2e-14   
ref|XP_009784393.1|  PREDICTED: glycine-rich RNA-binding protein-...  77.4    3e-14   
ref|XP_009607130.1|  PREDICTED: glycine-rich RNA-binding protein-...  77.4    3e-14   
ref|XP_007021765.1|  Uncharacterized protein TCM_031823               75.9    3e-14   
ref|XP_002265930.1|  PREDICTED: glycine-rich RNA-binding protein ...  78.6    3e-14   
ref|XP_006341831.1|  PREDICTED: glycine-rich RNA-binding protein ...  77.0    4e-14   
gb|ACM09312.1|  Cold-inducible RNA-binding protein                    75.9    4e-14   
ref|NP_001078386.1|  glycine-rich RNA-binding protein 2               75.5    4e-14   
ref|XP_002987284.1|  hypothetical protein SELMODRAFT_37571            76.3    4e-14   
ref|XP_002989199.1|  hypothetical protein SELMODRAFT_37572            76.3    5e-14   
gb|AFP57449.1|  RNA-binding glycine-rich protein                      75.9    5e-14   
gb|AFP57448.1|  RNA-binding glycine-rich protein                      75.9    5e-14   
ref|XP_009594591.1|  PREDICTED: glycine-rich RNA-binding protein ...  75.9    5e-14   
ref|XP_006681369.1|  hypothetical protein BATDEDRAFT_27077            74.7    5e-14   
gb|AFP57455.1|  RNA-binding glycine-rich protein                      75.5    6e-14   
ref|NP_001133148.1|  cold inducible RNA binding protein               75.9    6e-14   
gb|AFP57452.1|  RNA-binding glycine-rich protein                      75.5    6e-14   
ref|XP_003333535.1|  hypothetical protein PGTG_14957                  76.3    7e-14   
ref|XP_009411943.1|  PREDICTED: glycine-rich RNA-binding protein-...  76.3    7e-14   
gb|EEE62794.1|  hypothetical protein OsJ_17597                        74.3    8e-14   
emb|CDY06468.1|  BnaC06g11760D                                        75.1    9e-14   
ref|XP_010666527.1|  PREDICTED: glycine-rich RNA-binding protein-...  75.9    1e-13   
dbj|BAA11089.1|  RGP-3                                                74.7    1e-13   
ref|NP_001289492.1|  glycine-rich RNA-binding protein 2, mitochon...  74.7    1e-13   
ref|XP_009144682.1|  PREDICTED: glycine-rich RNA-binding protein ...  74.7    1e-13   
ref|XP_010466745.1|  PREDICTED: glycine-rich RNA-binding protein ...  74.7    1e-13   
emb|CDY08312.1|  BnaA05g13070D                                        74.7    1e-13   
ref|WP_012828539.1|  RNA-binding protein                              73.9    2e-13   
ref|XP_004971051.1|  PREDICTED: glycine-rich RNA-binding protein ...  74.7    2e-13   
ref|XP_002459459.1|  hypothetical protein SORBIDRAFT_02g004930        75.9    2e-13   
ref|NP_001066827.1|  Os12g0502200                                     75.5    2e-13   
ref|XP_010862449.1|  PREDICTED: glycine-rich RNA-binding protein ...  75.9    3e-13   
gb|EAY83219.1|  hypothetical protein OsI_38428                        75.1    3e-13   
gb|KIO30897.1|  hypothetical protein M407DRAFT_241996                 72.8    3e-13   
ref|XP_006418832.1|  hypothetical protein EUTSA_v10002711mg           73.2    3e-13   
gb|AFK44852.1|  unknown                                               71.2    4e-13   
gb|ACG40707.1|  glycine-rich RNA-binding protein 2                    73.2    5e-13   
ref|XP_010903912.1|  PREDICTED: glycine-rich RNA-binding protein ...  73.2    5e-13   
gb|ACI68319.1|  Cold-inducible RNA-binding protein                    72.0    6e-13   
ref|XP_010673390.1|  PREDICTED: glycine-rich RNA-binding protein ...  73.2    6e-13   
ref|NP_001150149.1|  LOC100283778                                     72.8    7e-13   
ref|NP_001133190.1|  hyperosmotic glycine rich protein                72.0    7e-13   
gb|EKD91001.1|  Glycine-rich RNA-binding protein                      71.2    7e-13   
ref|NP_001151678.1|  LOC100285313                                     74.3    7e-13   
ref|XP_008652144.1|  PREDICTED: glycine-rich RNA-binding protein ...  73.9    7e-13   
emb|CDQ79218.1|  unnamed protein product                              73.6    7e-13   
ref|XP_003333538.1|  hypothetical protein PGTG_14960                  73.2    8e-13   
ref|WP_034107996.1|  RNA-binding protein                              70.9    8e-13   
ref|NP_001054954.1|  Os05g0223200                                     71.2    1e-12   
ref|NP_001150604.1|  glycine-rich RNA-binding protein 7               73.9    1e-12   
ref|WP_037341522.1|  RNA-binding protein                              70.9    1e-12   
gb|ACH85335.1|  hyperosmotic glycine rich protein-like                72.4    1e-12   
gb|ACM08990.1|  Cold-inducible RNA-binding protein                    72.4    1e-12   
ref|WP_002770086.1|  RNA-binding protein                              70.9    2e-12   
gb|ACN30953.1|  unknown                                               72.0    2e-12   
ref|XP_010886266.1|  PREDICTED: glycine-rich RNA-binding, abscisi...  72.0    2e-12   
ref|NP_001117016.1|  hyperosmotic glycine rich protein                72.4    2e-12   
gb|ABK22994.1|  unknown                                               71.6    2e-12   
gb|KHF99043.1|  Glycine-rich RNA-binding 2, mitochondrial -like p...  70.9    2e-12   
ref|XP_010886253.1|  PREDICTED: cold-inducible RNA-binding protei...  72.0    2e-12   
gb|ADM16300.1|  Cold-inducible RNA-binding protein                    70.5    2e-12   
ref|XP_008230489.1|  PREDICTED: 28 kDa ribonucleoprotein, chlorop...  72.8    3e-12   
gb|EAY97020.1|  hypothetical protein OsI_18941                        70.1    3e-12   
gb|ACN10466.1|  Cold-inducible RNA-binding protein                    71.6    3e-12   
ref|XP_004955701.1|  PREDICTED: glycine-rich RNA-binding protein ...  72.4    3e-12   
ref|NP_001017797.1|  cold inducible RNA binding protein               71.2    3e-12   
ref|XP_007215709.1|  hypothetical protein PRUPE_ppa008913mg           72.4    4e-12   
gb|ENH67323.1|  Glycine-rich RNA-binding protein 2                    69.7    4e-12   
gb|EGU83098.1|  hypothetical protein FOXB_06359                       69.7    4e-12   
ref|XP_007034230.1|  Glycine-rich RNA-binding protein 4 isoform 1     70.5    4e-12   
gb|EWZ32470.1|  hypothetical protein FOZG_14019                       69.7    4e-12   
ref|WP_013841100.1|  RNA-binding protein                              68.9    4e-12   
gb|EDL33955.1|  mCG116386, isoform CRA_e                              70.9    5e-12   
gb|KJB28116.1|  hypothetical protein B456_005G028100                  70.1    5e-12   
ref|XP_007252683.1|  PREDICTED: cold-inducible RNA-binding protei...  71.2    5e-12   
ref|XP_007252684.1|  PREDICTED: cold-inducible RNA-binding protei...  71.2    6e-12   
ref|XP_009371733.1|  PREDICTED: 28 kDa ribonucleoprotein, chlorop...  71.6    6e-12   
ref|XP_007034231.1|  Glycine-rich RNA-binding protein 4 isoform 2     70.1    6e-12   
ref|XP_009370331.1|  PREDICTED: 28 kDa ribonucleoprotein, chlorop...  71.6    6e-12   
ref|XP_009396794.1|  PREDICTED: glycine-rich RNA-binding protein ...  70.1    6e-12   
gb|EGN99565.1|  hypothetical protein SERLA73DRAFT_159820              69.3    7e-12   
ref|WP_003542245.1|  MULTISPECIES: RNA-binding protein                68.6    7e-12   
emb|CDQ94534.1|  unnamed protein product                              70.5    7e-12   
gb|AGH15797.1|  cold-induced RNA-binding protein                      69.7    7e-12   
ref|WP_020413665.1|  RNA-binding protein                              68.6    7e-12   
gb|KJB72006.1|  hypothetical protein B456_011G153300                  69.3    8e-12   
ref|XP_007766350.1|  RNA-binding domain-containing protein            68.9    9e-12   
gb|AIT97255.1|  glycine-rich RNA-binding protein 1-3                  67.4    9e-12   
ref|XP_002961728.1|  hypothetical protein SELMODRAFT_140819           68.9    1e-11   
gb|EMT07784.1|  Glycine-rich RNA-binding protein GRP2A                68.6    1e-11   
ref|XP_002298568.1|  hypothetical protein POPTR_0001s35830g           70.9    1e-11   



>ref|XP_006365107.1| PREDICTED: glycine-rich RNA-binding protein 7-like isoform X2 
[Solanum tuberosum]
Length=176

 Score =   135 bits (339),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 80/134 (60%), Gaps = 50/134 (37%)
 Frame = +2

Query  53   MAEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slc  232
            MA+VE+RCFVGGLAWATT+ +L DAFS +GEV+ESK                        
Sbjct  1    MADVEYRCFVGGLAWATTDQTLSDAFSQYGEVVESK------------------------  36

Query  233  yyyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQ  412
                                      IINDRETGRSRGFGFVTFKDEQAM+DAIEGMNGQ
Sbjct  37   --------------------------IINDRETGRSRGFGFVTFKDEQAMRDAIEGMNGQ  70

Query  413  SLDGRNITVNEAQS  454
             LDGRNITVNEAQS
Sbjct  71   DLDGRNITVNEAQS  84



>ref|XP_006365106.1| PREDICTED: glycine-rich RNA-binding protein 7-like isoform X1 
[Solanum tuberosum]
Length=178

 Score =   135 bits (339),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 80/134 (60%), Gaps = 50/134 (37%)
 Frame = +2

Query  53   MAEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slc  232
            MA+VE+RCFVGGLAWATT+ +L DAFS +GEV+ESK                        
Sbjct  1    MADVEYRCFVGGLAWATTDQTLSDAFSQYGEVVESK------------------------  36

Query  233  yyyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQ  412
                                      IINDRETGRSRGFGFVTFKDEQAM+DAIEGMNGQ
Sbjct  37   --------------------------IINDRETGRSRGFGFVTFKDEQAMRDAIEGMNGQ  70

Query  413  SLDGRNITVNEAQS  454
             LDGRNITVNEAQS
Sbjct  71   DLDGRNITVNEAQS  84



>gb|AIT97256.1| glycine-rich RNA-binding protein 1-1 [Capsicum annuum]
Length=144

 Score =   133 bits (334),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 74/134 (55%), Positives = 78/134 (58%), Gaps = 50/134 (37%)
 Frame = +2

Query  53   MAEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slc  232
            MAEVE+RCFVGGLAWAT + +L DAFS FGEV ESK                        
Sbjct  1    MAEVEYRCFVGGLAWATNDQTLADAFSQFGEVTESK------------------------  36

Query  233  yyyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQ  412
                                      IINDRETGRSRGFGFVTFKDEQ+MKDAIEGMNGQ
Sbjct  37   --------------------------IINDRETGRSRGFGFVTFKDEQSMKDAIEGMNGQ  70

Query  413  SLDGRNITVNEAQS  454
             LDGRNITVNEAQS
Sbjct  71   DLDGRNITVNEAQS  84



>gb|AIT97254.1| glycine-rich RNA-binding protein 1-1 [Capsicum annuum]
Length=145

 Score =   133 bits (334),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 74/134 (55%), Positives = 78/134 (58%), Gaps = 50/134 (37%)
 Frame = +2

Query  53   MAEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slc  232
            MAEVE+RCFVGGLAWAT + +L DAFS FGEV ESK                        
Sbjct  1    MAEVEYRCFVGGLAWATNDQTLADAFSQFGEVTESK------------------------  36

Query  233  yyyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQ  412
                                      IINDRETGRSRGFGFVTFKDEQ+MKDAIEGMNGQ
Sbjct  37   --------------------------IINDRETGRSRGFGFVTFKDEQSMKDAIEGMNGQ  70

Query  413  SLDGRNITVNEAQS  454
             LDGRNITVNEAQS
Sbjct  71   DLDGRNITVNEAQS  84



>gb|AAC50020.1| RNA-binding protein [Nicotiana glutinosa]
Length=156

 Score =   133 bits (334),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 80/134 (60%), Gaps = 50/134 (37%)
 Frame = +2

Query  53   MAEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slc  232
            MAEVE+RCFVGGLAWATT+ +L DAFS +GE+++SK                        
Sbjct  1    MAEVEYRCFVGGLAWATTDQTLGDAFSQYGEILDSK------------------------  36

Query  233  yyyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQ  412
                                      IINDRETGRSRGFGFVTFKDEQAM+DAIEGMNGQ
Sbjct  37   --------------------------IINDRETGRSRGFGFVTFKDEQAMRDAIEGMNGQ  70

Query  413  SLDGRNITVNEAQS  454
             LDGRNITVNEAQS
Sbjct  71   DLDGRNITVNEAQS  84



>gb|AIT97253.1| glycine-rich RNA-binding protein 1-2 [Capsicum annuum]
 gb|AIT97257.1| glycine-rich RNA-binding protein 1-2 [Capsicum annuum]
Length=172

 Score =   133 bits (334),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 74/134 (55%), Positives = 78/134 (58%), Gaps = 50/134 (37%)
 Frame = +2

Query  53   MAEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slc  232
            MAEVE+RCFVGGLAWAT + +L DAFS FGEV ESK                        
Sbjct  1    MAEVEYRCFVGGLAWATNDQTLADAFSQFGEVTESK------------------------  36

Query  233  yyyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQ  412
                                      IINDRETGRSRGFGFVTFKDEQ+MKDAIEGMNGQ
Sbjct  37   --------------------------IINDRETGRSRGFGFVTFKDEQSMKDAIEGMNGQ  70

Query  413  SLDGRNITVNEAQS  454
             LDGRNITVNEAQS
Sbjct  71   DLDGRNITVNEAQS  84



>ref|XP_011092798.1| PREDICTED: glycine-rich RNA-binding protein 2-like [Sesamum indicum]
Length=161

 Score =   132 bits (333),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 78/133 (59%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            A+VEFRCFVGGLAWATT+ SL  AFS FGEVIESK                         
Sbjct  4    ADVEFRCFVGGLAWATTDQSLEQAFSQFGEVIESK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     IINDRETGRSRGFGFVTFKDEQAM+DAIEGMNGQ 
Sbjct  39   -------------------------IINDRETGRSRGFGFVTFKDEQAMRDAIEGMNGQE  73

Query  416  LDGRNITVNEAQS  454
            LDGRNITVNEAQS
Sbjct  74   LDGRNITVNEAQS  86



>pdb|4C7Q|A Chain A, Solution Structure Of The Nt. Gr-rbp1 Rrm Domain
Length=86

 Score =   130 bits (327),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 80/134 (60%), Gaps = 50/134 (37%)
 Frame = +2

Query  53   MAEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slc  232
            MAEVE+RCFVGGLAWATT+ +L +AFS FGE+++SK                        
Sbjct  2    MAEVEYRCFVGGLAWATTDQTLGEAFSQFGEILDSK------------------------  37

Query  233  yyyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQ  412
                                      IINDRETGRSRGFGFVTFKDE+AM+DAIEGMNGQ
Sbjct  38   --------------------------IINDRETGRSRGFGFVTFKDEKAMRDAIEGMNGQ  71

Query  413  SLDGRNITVNEAQS  454
             LDGRNITVNEAQS
Sbjct  72   DLDGRNITVNEAQS  85



>ref|XP_010315305.1| PREDICTED: glycine-rich RNA-binding protein [Solanum lycopersicum]
Length=175

 Score =   132 bits (333),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 80/134 (60%), Gaps = 50/134 (37%)
 Frame = +2

Query  53   MAEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slc  232
            MA+VE+RCFVGGLAWATT+ +L +AFS +GEV+ESK                        
Sbjct  1    MADVEYRCFVGGLAWATTDQTLSEAFSQYGEVVESK------------------------  36

Query  233  yyyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQ  412
                                      IINDRETGRSRGFGFVTFKDEQAM+DAIEGMNGQ
Sbjct  37   --------------------------IINDRETGRSRGFGFVTFKDEQAMRDAIEGMNGQ  70

Query  413  SLDGRNITVNEAQS  454
             LDGRNITVNEAQS
Sbjct  71   DLDGRNITVNEAQS  84



>gb|EPS66737.1| hypothetical protein M569_08040 [Genlisea aurea]
Length=169

 Score =   132 bits (333),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 73/133 (55%), Positives = 79/133 (59%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            AE+E+RCFVGGLAWATT+ SL DAFS FGEVIESKV                        
Sbjct  4    AEIEYRCFVGGLAWATTDQSLEDAFSRFGEVIESKV------------------------  39

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                      INDRETGRSRGFGFVTFKDEQ+M+DAI+GMNGQ 
Sbjct  40   --------------------------INDRETGRSRGFGFVTFKDEQSMRDAIDGMNGQE  73

Query  416  LDGRNITVNEAQS  454
            LDGRNITVNEAQS
Sbjct  74   LDGRNITVNEAQS  86



>gb|ACD03270.1| glycine-rich RNA-binding protein [Nicotiana tabacum]
Length=157

 Score =   132 bits (332),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 79/133 (59%), Gaps = 50/133 (38%)
 Frame = +2

Query  53   MAEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slc  232
            MAEVE+RCFVGGLAWATT+ +L DAFS +GE+++SK                        
Sbjct  1    MAEVEYRCFVGGLAWATTDQTLGDAFSQYGEIVDSK------------------------  36

Query  233  yyyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQ  412
                                      IINDRETGRSRGFGFVTFKDEQAM+DAIEGMNGQ
Sbjct  37   --------------------------IINDRETGRSRGFGFVTFKDEQAMRDAIEGMNGQ  70

Query  413  SLDGRNITVNEAQ  451
             LDGRNITVNEAQ
Sbjct  71   DLDGRNITVNEAQ  83



>gb|EPS70351.1| hypothetical protein M569_04412, partial [Genlisea aurea]
Length=104

 Score =   129 bits (325),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 78/133 (59%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            A+VEFRCFVGGLAWATT+ SL  AF+ +G+VI+SK                         
Sbjct  4    ADVEFRCFVGGLAWATTDQSLEQAFAQYGQVIDSK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     IINDRETGRSRGFGFVTFKDEQ+MKDAIEGMNGQ 
Sbjct  39   -------------------------IINDRETGRSRGFGFVTFKDEQSMKDAIEGMNGQE  73

Query  416  LDGRNITVNEAQS  454
            LDGRNITVNEAQS
Sbjct  74   LDGRNITVNEAQS  86



>gb|ABB87126.1| putative glycine-rich RNA binding protein-like [Solanum tuberosum]
Length=178

 Score =   131 bits (330),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 80/134 (60%), Gaps = 50/134 (37%)
 Frame = +2

Query  53   MAEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slc  232
            M +VE+RCFVGGLAWATT+++L +AFS +GEV+ESK                        
Sbjct  1    MGDVEYRCFVGGLAWATTDNTLSEAFSQYGEVVESK------------------------  36

Query  233  yyyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQ  412
                                      IINDRETGRSRGFGFVTFKDEQAM+DAIEGMNGQ
Sbjct  37   --------------------------IINDRETGRSRGFGFVTFKDEQAMRDAIEGMNGQ  70

Query  413  SLDGRNITVNEAQS  454
             LDGRNITVNEAQS
Sbjct  71   DLDGRNITVNEAQS  84



>dbj|BAA92156.1| glycine-rich RNA-binding protein [Citrus unshiu]
Length=167

 Score =   130 bits (328),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 82/132 (62%), Gaps = 50/132 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            A+VEFRCFVGGLAWATT+SSLH+AFS++G+++ESK                         
Sbjct  4    ADVEFRCFVGGLAWATTDSSLHEAFSAYGDILESK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     IINDRETGRSRGFGFVTF+DE++M+DAIEGMNGQ+
Sbjct  39   -------------------------IINDRETGRSRGFGFVTFRDEKSMRDAIEGMNGQN  73

Query  416  LDGRNITVNEAQ  451
            LDGRNITVNEAQ
Sbjct  74   LDGRNITVNEAQ  85



>ref|XP_011092799.1| PREDICTED: glycine-rich RNA-binding protein 2-like [Sesamum indicum]
Length=162

 Score =   130 bits (327),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/133 (55%), Positives = 78/133 (59%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            A+VEFRCFVGGLAWAT++ SL  AFS FGEVIESK                         
Sbjct  4    ADVEFRCFVGGLAWATSDQSLEQAFSQFGEVIESK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     IINDRETGRSRGFGFVTFKDEQ+M+DAIEGMNGQ 
Sbjct  39   -------------------------IINDRETGRSRGFGFVTFKDEQSMRDAIEGMNGQE  73

Query  416  LDGRNITVNEAQS  454
            LDGRNITVNEAQS
Sbjct  74   LDGRNITVNEAQS  86



>gb|EYU42616.1| hypothetical protein MIMGU_mgv1a016253mg [Erythranthe guttata]
Length=129

 Score =   129 bits (324),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 79/134 (59%), Gaps = 50/134 (37%)
 Frame = +2

Query  53   MAEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slc  232
            MA+VEFRCFVGGLAWATT+ SL  AFS FGEVIESK                        
Sbjct  1    MADVEFRCFVGGLAWATTDQSLEHAFSQFGEVIESK------------------------  36

Query  233  yyyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQ  412
                                      IINDRETGRSRGFGFVTFKDE++M++AIEGMNGQ
Sbjct  37   --------------------------IINDRETGRSRGFGFVTFKDERSMREAIEGMNGQ  70

Query  413  SLDGRNITVNEAQS  454
             LDGRNITVNEAQS
Sbjct  71   ELDGRNITVNEAQS  84



>gb|ABH07505.1| glycine-rich RNA-binding protein [Nicotiana attenuata]
Length=152

 Score =   130 bits (326),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 79/134 (59%), Gaps = 50/134 (37%)
 Frame = +2

Query  53   MAEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slc  232
            MAEVE+RCFVGGLAWATT+ +L DAFS FGE+++SK                        
Sbjct  1    MAEVEYRCFVGGLAWATTDQTLGDAFSQFGEILDSK------------------------  36

Query  233  yyyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQ  412
                                      IINDRETGRSRGFGFVTFKDE+AM+DAIEGM GQ
Sbjct  37   --------------------------IINDRETGRSRGFGFVTFKDEKAMRDAIEGMKGQ  70

Query  413  SLDGRNITVNEAQS  454
             LDGRNITVNEAQS
Sbjct  71   DLDGRNITVNEAQS  84



>gb|AAF31403.1|AF200322_1 putative glycine-rich RNA binding protein 3 [Catharanthus roseus]
Length=164

 Score =   130 bits (326),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 80/133 (60%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            A+VE+RCFVGGLAWATT+ SL +AFS +GE++ESK                         
Sbjct  4    ADVEYRCFVGGLAWATTDQSLSEAFSQYGEILESK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     IINDRETGRSRGFGFVTFKDEQ+M+DAIEGMNGQ+
Sbjct  39   -------------------------IINDRETGRSRGFGFVTFKDEQSMRDAIEGMNGQT  73

Query  416  LDGRNITVNEAQS  454
            LDGRNITVNEAQS
Sbjct  74   LDGRNITVNEAQS  86



>ref|XP_009607320.1| PREDICTED: glycine-rich RNA-binding protein-like [Nicotiana tomentosiformis]
Length=157

 Score =   129 bits (325),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 78/133 (59%), Gaps = 50/133 (38%)
 Frame = +2

Query  53   MAEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slc  232
            MA+ E+RCFVGGLAWATT+ +L DAFS +GE+++SK                        
Sbjct  1    MADAEYRCFVGGLAWATTDQTLGDAFSQYGEIVDSK------------------------  36

Query  233  yyyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQ  412
                                      IINDRETGRSRGFGFVTFKDEQAM+DAIEGMNGQ
Sbjct  37   --------------------------IINDRETGRSRGFGFVTFKDEQAMRDAIEGMNGQ  70

Query  413  SLDGRNITVNEAQ  451
             LDGRNITVNEAQ
Sbjct  71   DLDGRNITVNEAQ  83



>emb|CAA89058.1| putative glycine rich RNA binding protein [Solanum tuberosum]
Length=175

 Score =   130 bits (326),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 78/134 (58%), Gaps = 50/134 (37%)
 Frame = +2

Query  53   MAEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slc  232
            MA+VE+RCFVGGLAWATT+ +L DAFS + EV+ESK                        
Sbjct  1    MADVEYRCFVGGLAWATTDQTLSDAFSQYAEVVESK------------------------  36

Query  233  yyyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQ  412
                                      IINDRETGRSRGFGFVTFKDEQAM+DAIEGMN Q
Sbjct  37   --------------------------IINDRETGRSRGFGFVTFKDEQAMRDAIEGMNRQ  70

Query  413  SLDGRNITVNEAQS  454
             LDGRNITVNEAQS
Sbjct  71   DLDGRNITVNEAQS  84



>ref|XP_009774643.1| PREDICTED: glycine-rich RNA-binding protein-like [Nicotiana sylvestris]
 dbj|BAA03741.1| RNA-binding glycine-rich protein-1a [Nicotiana sylvestris]
 gb|ADG03637.1| RNA-binding glycine-rich protein [Nicotiana tabacum]
Length=156

 Score =   128 bits (322),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 79/133 (59%), Gaps = 50/133 (38%)
 Frame = +2

Query  53   MAEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slc  232
            MAEVE+RCFVGGLAWATT+ +L +AFS FGE+++SK                        
Sbjct  1    MAEVEYRCFVGGLAWATTDQTLGEAFSQFGEILDSK------------------------  36

Query  233  yyyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQ  412
                                      IINDRETGRSRGFGFVTFKDE+AM+DAIEGMNGQ
Sbjct  37   --------------------------IINDRETGRSRGFGFVTFKDEKAMRDAIEGMNGQ  70

Query  413  SLDGRNITVNEAQ  451
             LDGRNITVNEAQ
Sbjct  71   DLDGRNITVNEAQ  83



>gb|KJB78453.1| hypothetical protein B456_013G036800 [Gossypium raimondii]
Length=116

 Score =   127 bits (318),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 80/135 (59%), Gaps = 50/135 (37%)
 Frame = +2

Query  50   VMAEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*sl  229
              A+VEFRCFVGGLAWAT + +L +AFS+FGE++ESK                       
Sbjct  2    AAADVEFRCFVGGLAWATDDRALEEAFSAFGEIVESK-----------------------  38

Query  230  cyyyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNG  409
                                       IINDRETGRSRGFGFVTF+DE+AM+DAIEGMNG
Sbjct  39   ---------------------------IINDRETGRSRGFGFVTFRDEKAMRDAIEGMNG  71

Query  410  QSLDGRNITVNEAQS  454
            Q+LDGRNITVNEAQS
Sbjct  72   QNLDGRNITVNEAQS  86



>gb|KJB78451.1| hypothetical protein B456_013G036800 [Gossypium raimondii]
Length=133

 Score =   127 bits (319),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 80/133 (60%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            A+VEFRCFVGGLAWAT + +L +AFS+FGE++ESK                         
Sbjct  4    ADVEFRCFVGGLAWATDDRALEEAFSAFGEIVESK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     IINDRETGRSRGFGFVTF+DE+AM+DAIEGMNGQ+
Sbjct  39   -------------------------IINDRETGRSRGFGFVTFRDEKAMRDAIEGMNGQN  73

Query  416  LDGRNITVNEAQS  454
            LDGRNITVNEAQS
Sbjct  74   LDGRNITVNEAQS  86



>gb|AAF31402.1| putative glycine-rich RNA binding protein 1 [Catharanthus roseus]
Length=137

 Score =   127 bits (319),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 79/133 (59%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            A+VEFRCFVGGLAWATT+ SL +AFS +GEV+ESK                         
Sbjct  4    ADVEFRCFVGGLAWATTDQSLSEAFSQYGEVLESK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     IINDRETGRSRGFGFVTF DE++MKDAIEGMNGQ+
Sbjct  39   -------------------------IINDRETGRSRGFGFVTFGDEKSMKDAIEGMNGQT  73

Query  416  LDGRNITVNEAQS  454
            LDGRN+TVNEAQS
Sbjct  74   LDGRNVTVNEAQS  86



>gb|KJB78452.1| hypothetical protein B456_013G036800 [Gossypium raimondii]
Length=158

 Score =   127 bits (319),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 80/133 (60%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            A+VEFRCFVGGLAWAT + +L +AFS+FGE++ESK                         
Sbjct  4    ADVEFRCFVGGLAWATDDRALEEAFSAFGEIVESK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     IINDRETGRSRGFGFVTF+DE+AM+DAIEGMNGQ+
Sbjct  39   -------------------------IINDRETGRSRGFGFVTFRDEKAMRDAIEGMNGQN  73

Query  416  LDGRNITVNEAQS  454
            LDGRNITVNEAQS
Sbjct  74   LDGRNITVNEAQS  86



>gb|ACJ11730.1| glycine-rich RNA-binding protein [Gossypium hirsutum]
Length=168

 Score =   127 bits (319),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 80/133 (60%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            A+VEFRCFVGGLAWAT + +L +AFS+FGE++ESK                         
Sbjct  4    ADVEFRCFVGGLAWATDDRALEEAFSAFGEIVESK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     IINDRETGRSRGFGFVTF+DE+AM+DAIEGMNGQ+
Sbjct  39   -------------------------IINDRETGRSRGFGFVTFRDEKAMRDAIEGMNGQN  73

Query  416  LDGRNITVNEAQS  454
            LDGRNITVNEAQS
Sbjct  74   LDGRNITVNEAQS  86



>gb|KJB78450.1| hypothetical protein B456_013G036800 [Gossypium raimondii]
Length=169

 Score =   127 bits (319),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 80/133 (60%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            A+VEFRCFVGGLAWAT + +L +AFS+FGE++ESK                         
Sbjct  4    ADVEFRCFVGGLAWATDDRALEEAFSAFGEIVESK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     IINDRETGRSRGFGFVTF+DE+AM+DAIEGMNGQ+
Sbjct  39   -------------------------IINDRETGRSRGFGFVTFRDEKAMRDAIEGMNGQN  73

Query  416  LDGRNITVNEAQS  454
            LDGRNITVNEAQS
Sbjct  74   LDGRNITVNEAQS  86



>gb|KHG02891.1| Glycine-rich RNA-binding GRP1A [Gossypium arboreum]
Length=168

 Score =   127 bits (319),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 80/133 (60%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            A+VEFRCFVGGLAWAT + +L +AFS+FGE++ESK                         
Sbjct  4    ADVEFRCFVGGLAWATDDRALEEAFSAFGEIVESK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     IINDRETGRSRGFGFVTF+DE+AM+DAIEGMNGQ+
Sbjct  39   -------------------------IINDRETGRSRGFGFVTFRDEKAMRDAIEGMNGQN  73

Query  416  LDGRNITVNEAQS  454
            LDGRNITVNEAQS
Sbjct  74   LDGRNITVNEAQS  86



>ref|XP_006487137.1| PREDICTED: glycine-rich RNA-binding protein-like [Citrus sinensis]
Length=168

 Score =   127 bits (319),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 67/132 (51%), Positives = 80/132 (61%), Gaps = 50/132 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
             +VEFRCFVGGLAWATT+SSLH+AF ++G+++ESK                         
Sbjct  4    GDVEFRCFVGGLAWATTDSSLHEAFGAYGDILESK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     IINDRETGRSRGFGFVTF+DE++M+DAIEGMNGQ+
Sbjct  39   -------------------------IINDRETGRSRGFGFVTFRDEKSMRDAIEGMNGQN  73

Query  416  LDGRNITVNEAQ  451
            LDGRNITVNEAQ
Sbjct  74   LDGRNITVNEAQ  85



>gb|KDP46256.1| hypothetical protein JCGZ_10096 [Jatropha curcas]
Length=168

 Score =   127 bits (319),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 66/133 (50%), Positives = 81/133 (61%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            AE+E+RCFVGGLAWATT+ +LH+AFS++G+++ESK                         
Sbjct  4    AEIEYRCFVGGLAWATTDQALHEAFSAYGDILESK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     IINDRETGRSRGFGFVTF +E++M+DAIEGMNGQ+
Sbjct  39   -------------------------IINDRETGRSRGFGFVTFNNEKSMRDAIEGMNGQN  73

Query  416  LDGRNITVNEAQS  454
            LDGRNITVNEAQS
Sbjct  74   LDGRNITVNEAQS  86



>ref|XP_009804249.1| PREDICTED: glycine-rich RNA-binding protein-like [Nicotiana sylvestris]
 dbj|BAA03743.1| RNA-binding gricine-rich protein-1c [Nicotiana sylvestris]
Length=165

 Score =   127 bits (318),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 70/134 (52%), Positives = 79/134 (59%), Gaps = 50/134 (37%)
 Frame = +2

Query  53   MAEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slc  232
            MAEVE+RCFVGGLAWATT+ +L +AFS +GEV+ESK                        
Sbjct  1    MAEVEYRCFVGGLAWATTDRTLGEAFSQYGEVLESK------------------------  36

Query  233  yyyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQ  412
                                      IINDRETGRSRGFGFVTF DE++M+DAIEGMNGQ
Sbjct  37   --------------------------IINDRETGRSRGFGFVTFGDEKSMRDAIEGMNGQ  70

Query  413  SLDGRNITVNEAQS  454
             LDGRNITVNEAQS
Sbjct  71   DLDGRNITVNEAQS  84



>sp|Q03878.1|GRP1_DAUCA RecName: Full=Glycine-rich RNA-binding protein [Daucus carota]
 emb|CAA41152.1| glycine-rich protein [Daucus carota]
 prf||1908438A Gly-rich protein
Length=157

 Score =   125 bits (315),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 77/134 (57%), Gaps = 50/134 (37%)
 Frame = +2

Query  53   MAEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slc  232
            MAEVE+RCFVGGLAWAT + SL  AFS FG++ +SK                        
Sbjct  1    MAEVEYRCFVGGLAWATNDESLEQAFSQFGDITDSK------------------------  36

Query  233  yyyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQ  412
                                      IINDRETGRSRGFGFVTFKDE++M+DAIEGMNGQ
Sbjct  37   --------------------------IINDRETGRSRGFGFVTFKDEKSMRDAIEGMNGQ  70

Query  413  SLDGRNITVNEAQS  454
             LDGRNITVNEAQS
Sbjct  71   ELDGRNITVNEAQS  84



>ref|XP_003561423.1| PREDICTED: glycine-rich RNA-binding protein blt801-like [Brachypodium 
distachyon]
Length=161

 Score =   125 bits (315),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 70/134 (52%), Positives = 77/134 (57%), Gaps = 50/134 (37%)
 Frame = +2

Query  53   MAEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slc  232
            MAEVE+RCFVGGLAWAT +  L DAFSSFGE+I+SK                        
Sbjct  1    MAEVEYRCFVGGLAWATDDRGLQDAFSSFGEIIDSK------------------------  36

Query  233  yyyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQ  412
                                      IINDRETGRSRGFGFVTF  EQ+M+DAIEGMNG+
Sbjct  37   --------------------------IINDRETGRSRGFGFVTFASEQSMRDAIEGMNGK  70

Query  413  SLDGRNITVNEAQS  454
             LDGRNITVNEAQS
Sbjct  71   DLDGRNITVNEAQS  84



>emb|CDP22149.1| unnamed protein product [Coffea canephora]
Length=160

 Score =   125 bits (315),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 78/133 (59%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            ++VE+RCFVGGLAWATT+ SL  AF+ +GEVIESK                         
Sbjct  4    SDVEYRCFVGGLAWATTDQSLEQAFAQYGEVIESK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     IINDRETGRSRGFGFVTF+DEQ+M+DAIE MNGQ+
Sbjct  39   -------------------------IINDRETGRSRGFGFVTFRDEQSMRDAIEAMNGQN  73

Query  416  LDGRNITVNEAQS  454
            LDGRNITVNEAQS
Sbjct  74   LDGRNITVNEAQS  86



>ref|XP_011037523.1| PREDICTED: LOW QUALITY PROTEIN: glycine-rich RNA-binding protein-like 
[Populus euphratica]
Length=166

 Score =   125 bits (315),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 68/135 (50%), Positives = 79/135 (59%), Gaps = 50/135 (37%)
 Frame = +2

Query  50   VMAEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*sl  229
            + AEVE+RCFVGGLAWATT+ SL +AFS +GE+I+SK                       
Sbjct  1    MAAEVEYRCFVGGLAWATTDQSLQEAFSQYGEIIDSK-----------------------  37

Query  230  cyyyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNG  409
                                       IINDRETGRSRGFGFVTF +E+AM+DAI+GMNG
Sbjct  38   ---------------------------IINDRETGRSRGFGFVTFNNEKAMRDAIDGMNG  70

Query  410  QSLDGRNITVNEAQS  454
            Q LDGRNITVNEAQS
Sbjct  71   QDLDGRNITVNEAQS  85



>ref|NP_001266231.1| glycine-rich RNA-binding protein-like [Solanum lycopersicum]
 gb|AFX73254.1| glycine rich RNA binding protein 1a [Solanum lycopersicum]
Length=164

 Score =   125 bits (315),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 68/135 (50%), Positives = 79/135 (59%), Gaps = 50/135 (37%)
 Frame = +2

Query  50   VMAEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*sl  229
            + AEVE+ CFVGGLAWATT+ +L DAFS++GEV++SK                       
Sbjct  1    MAAEVEYSCFVGGLAWATTDRTLSDAFSTYGEVVDSK-----------------------  37

Query  230  cyyyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNG  409
                                       IINDRETGRSRGFGFVTFKDE++MKDAI GMNG
Sbjct  38   ---------------------------IINDRETGRSRGFGFVTFKDEKSMKDAISGMNG  70

Query  410  QSLDGRNITVNEAQS  454
            Q LDGRNITVNEAQ+
Sbjct  71   QELDGRNITVNEAQA  85



>ref|XP_009791571.1| PREDICTED: glycine-rich RNA-binding protein-like [Nicotiana sylvestris]
Length=169

 Score =   125 bits (315),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 79/134 (59%), Gaps = 50/134 (37%)
 Frame = +2

Query  50   VMAEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*sl  229
            + AEVE+RCFVGGLAWATT+ +L DAF+ +GEV++SK                       
Sbjct  1    MAAEVEYRCFVGGLAWATTDRTLGDAFAHYGEVVDSK-----------------------  37

Query  230  cyyyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNG  409
                                       IINDRETGRSRGFGFVTF DE+AM+DAIEGMNG
Sbjct  38   ---------------------------IINDRETGRSRGFGFVTFNDEKAMRDAIEGMNG  70

Query  410  QSLDGRNITVNEAQ  451
            Q+LDGRNITVNEAQ
Sbjct  71   QNLDGRNITVNEAQ  84



>ref|XP_009618692.1| PREDICTED: glycine-rich RNA-binding protein GRP1A-like [Nicotiana 
tomentosiformis]
Length=171

 Score =   125 bits (314),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 79/134 (59%), Gaps = 50/134 (37%)
 Frame = +2

Query  50   VMAEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*sl  229
            + AEVE+RCFVGGLAWATT+ +L DAF+ +GEV++SK                       
Sbjct  1    MAAEVEYRCFVGGLAWATTDRTLGDAFAHYGEVVDSK-----------------------  37

Query  230  cyyyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNG  409
                                       IINDRETGRSRGFGFVTF DE+AM+DAIEGMNG
Sbjct  38   ---------------------------IINDRETGRSRGFGFVTFSDEKAMRDAIEGMNG  70

Query  410  QSLDGRNITVNEAQ  451
            Q+LDGRNITVNEAQ
Sbjct  71   QNLDGRNITVNEAQ  84



>ref|XP_008236997.1| PREDICTED: glycine-rich RNA-binding protein GRP1A [Prunus mume]
Length=133

 Score =   124 bits (311),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 76/133 (57%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            AE+EFRCFVGGLAWAT   +L  AFS FGE+IESK                         
Sbjct  4    AEIEFRCFVGGLAWATDNDALERAFSPFGEIIESK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     IINDRETGRSRGFGFVTF +E+AM+DAIEGMNGQ+
Sbjct  39   -------------------------IINDRETGRSRGFGFVTFSNEKAMRDAIEGMNGQN  73

Query  416  LDGRNITVNEAQS  454
            LDGRNITVNEAQS
Sbjct  74   LDGRNITVNEAQS  86



>emb|CDO97048.1| unnamed protein product [Coffea canephora]
Length=160

 Score =   125 bits (313),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 77/133 (58%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            ++VEFRCFVGGLAWATT+ SL  AF  +GE+IESK                         
Sbjct  4    SDVEFRCFVGGLAWATTDQSLEQAFGQYGEIIESK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     IINDRETGRSRGFGFVTF+DEQ+M+DAIE MNGQ+
Sbjct  39   -------------------------IINDRETGRSRGFGFVTFRDEQSMRDAIEAMNGQN  73

Query  416  LDGRNITVNEAQS  454
            LDGRNITVNEAQS
Sbjct  74   LDGRNITVNEAQS  86



>gb|AAF31404.1|AF200323_1 putative glycine-rich RNA-binding protein 2 [Catharanthus roseus]
Length=160

 Score =   124 bits (311),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 78/133 (59%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            A+VEFRCFVGGLAWATT+ SL +AFS +GEV+ESKV                        
Sbjct  4    ADVEFRCFVGGLAWATTDQSLSEAFSQYGEVLESKV------------------------  39

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                      INDRETGRSRGFGFVTF DE++MKDAI GMNGQ+
Sbjct  40   --------------------------INDRETGRSRGFGFVTFGDEKSMKDAIVGMNGQT  73

Query  416  LDGRNITVNEAQS  454
            LDGRNITVNEAQS
Sbjct  74   LDGRNITVNEAQS  86



>ref|XP_006384506.1| hypothetical protein POPTR_0004s16260g [Populus trichocarpa]
 gb|ERP62303.1| hypothetical protein POPTR_0004s16260g [Populus trichocarpa]
Length=158

 Score =   124 bits (311),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 78/134 (58%), Gaps = 50/134 (37%)
 Frame = +2

Query  50   VMAEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*sl  229
            + AEVE+RCFVGGLAWATT+ SL +AFS +GE+I+SK                       
Sbjct  1    MAAEVEYRCFVGGLAWATTDQSLQEAFSQYGEIIDSK-----------------------  37

Query  230  cyyyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNG  409
                                       IINDRETGRSRGFGFVTF +E+AM+DAI+GMNG
Sbjct  38   ---------------------------IINDRETGRSRGFGFVTFNNEKAMRDAIDGMNG  70

Query  410  QSLDGRNITVNEAQ  451
            Q LDGRNITVNEAQ
Sbjct  71   QDLDGRNITVNEAQ  84



>emb|CBI32594.3| unnamed protein product [Vitis vinifera]
Length=121

 Score =   123 bits (308),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 76/133 (57%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            AE+E+RCFVGGLAWAT + SL  AFS FGE++ESK                         
Sbjct  4    AEIEYRCFVGGLAWATDDQSLERAFSQFGEILESK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     IINDRETGRSRGFGFVTF  EQ+M+DAIEGMNGQ+
Sbjct  39   -------------------------IINDRETGRSRGFGFVTFSSEQSMRDAIEGMNGQN  73

Query  416  LDGRNITVNEAQS  454
            LDGRNITVNEAQS
Sbjct  74   LDGRNITVNEAQS  86



>ref|XP_002305429.1| glycine-rich RNA-binding family protein [Populus trichocarpa]
 gb|ABK92850.1| unknown [Populus trichocarpa]
 gb|EEE85940.1| glycine-rich RNA-binding family protein [Populus trichocarpa]
Length=165

 Score =   124 bits (311),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 78/134 (58%), Gaps = 50/134 (37%)
 Frame = +2

Query  50   VMAEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*sl  229
            + AEVE+RCFVGGLAWATT+ SL +AFS +GE+I+SK                       
Sbjct  1    MAAEVEYRCFVGGLAWATTDQSLQEAFSQYGEIIDSK-----------------------  37

Query  230  cyyyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNG  409
                                       IINDRETGRSRGFGFVTF +E+AM+DAI+GMNG
Sbjct  38   ---------------------------IINDRETGRSRGFGFVTFNNEKAMRDAIDGMNG  70

Query  410  QSLDGRNITVNEAQ  451
            Q LDGRNITVNEAQ
Sbjct  71   QDLDGRNITVNEAQ  84



>gb|ADQ00374.1| glycine-rich RNA-binding protein [Sequoia sempervirens]
Length=194

 Score =   124 bits (312),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 76/133 (57%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            AE+EFRCFVGGLAWAT + SLHDAFS FGEV+ESK                         
Sbjct  4    AEIEFRCFVGGLAWATDDRSLHDAFSPFGEVLESK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     I++DRETGRSRGFGFVTF DEQAM DAIE MNG+ 
Sbjct  39   -------------------------IVSDRETGRSRGFGFVTFSDEQAMMDAIEAMNGKE  73

Query  416  LDGRNITVNEAQS  454
            LDGRNITVN+AQS
Sbjct  74   LDGRNITVNQAQS  86



>ref|XP_006404621.1| hypothetical protein EUTSA_v10000386mg [Eutrema salsugineum]
 gb|ESQ46074.1| hypothetical protein EUTSA_v10000386mg [Eutrema salsugineum]
Length=103

 Score =   122 bits (305),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 77/133 (58%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            A+VEFRCFVGGLAWAT + +L  AFS +G+VI+SK                         
Sbjct  4    ADVEFRCFVGGLAWATDDRALETAFSQYGDVIDSK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     IINDRETGRSRGFGFVTFKDE++MKDAIEGMNGQ 
Sbjct  39   -------------------------IINDRETGRSRGFGFVTFKDEKSMKDAIEGMNGQE  73

Query  416  LDGRNITVNEAQS  454
            LDGR+ITVNEAQS
Sbjct  74   LDGRSITVNEAQS  86



>ref|XP_009140299.1| PREDICTED: glycine-rich RNA-binding protein GRP2A [Brassica rapa]
Length=168

 Score =   124 bits (310),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 76/133 (57%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
             +VE+RCFVGGLAWAT E SL  AFS FGE+++SK                         
Sbjct  4    PDVEYRCFVGGLAWATDERSLETAFSKFGELVDSK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     IINDRETGRSRGFGFVTFKDEQ+MKDAIEGMNGQ 
Sbjct  39   -------------------------IINDRETGRSRGFGFVTFKDEQSMKDAIEGMNGQD  73

Query  416  LDGRNITVNEAQS  454
            LDGR+ITVNEAQS
Sbjct  74   LDGRSITVNEAQS  86



>emb|CAD29693.1| putative glycine rich protein [Rumex obtusifolius]
Length=168

 Score =   124 bits (310),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 76/133 (57%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            AEVE+RCFVGGLAWAT + SL  AFS++G+V+ESK                         
Sbjct  3    AEVEYRCFVGGLAWATDDQSLERAFSNYGQVLESK-------------------------  37

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     IINDRETGRSRGFGFVTF  EQAM+DAIEGMNGQ 
Sbjct  38   -------------------------IINDRETGRSRGFGFVTFSSEQAMRDAIEGMNGQD  72

Query  416  LDGRNITVNEAQS  454
            LDGRNITVNEAQS
Sbjct  73   LDGRNITVNEAQS  85



>ref|XP_010254827.1| PREDICTED: glycine-rich RNA-binding protein GRP1A-like [Nelumbo 
nucifera]
Length=153

 Score =   123 bits (308),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 66/132 (50%), Positives = 77/132 (58%), Gaps = 50/132 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            A+VE+RCFVGGLAWAT + SL  AFS +GE++ESK                         
Sbjct  4    ADVEYRCFVGGLAWATDDQSLERAFSPYGEILESK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     IINDRETGRSRGFGFVTF+DEQ+M+DAIEGMNGQ+
Sbjct  39   -------------------------IINDRETGRSRGFGFVTFRDEQSMRDAIEGMNGQN  73

Query  416  LDGRNITVNEAQ  451
            LDGRNITVN+AQ
Sbjct  74   LDGRNITVNQAQ  85



>ref|XP_003527212.1| PREDICTED: glycine-rich RNA-binding protein 7 [Glycine max]
Length=182

 Score =   124 bits (310),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 75/133 (56%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            AEVEFRCFVGGLAWAT   +L  AFS FGE++ESKV                        
Sbjct  4    AEVEFRCFVGGLAWATDHDALEKAFSQFGEIVESKV------------------------  39

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                      INDRETGRSRGFGFVTF  EQAM+DAIEGMNGQ+
Sbjct  40   --------------------------INDRETGRSRGFGFVTFATEQAMRDAIEGMNGQN  73

Query  416  LDGRNITVNEAQS  454
            LDGRNITVNEAQS
Sbjct  74   LDGRNITVNEAQS  86



>ref|XP_009394303.1| PREDICTED: glycine-rich RNA-binding protein-like [Musa acuminata 
subsp. malaccensis]
Length=170

 Score =   123 bits (309),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 78/133 (59%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            ++VEFRCFVGGLAWAT + +L  AFS +GE+IESK                         
Sbjct  4    SDVEFRCFVGGLAWATDDRTLEQAFSPYGEIIESK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     IINDRETGRSRGFGFVTF+DEQ+M+DAIEGMNGQ+
Sbjct  39   -------------------------IINDRETGRSRGFGFVTFRDEQSMRDAIEGMNGQN  73

Query  416  LDGRNITVNEAQS  454
            LDGRNITVNEAQ+
Sbjct  74   LDGRNITVNEAQN  86



>gb|ADQ08684.1| putative glycine-rich RNA-binding protein 1 [Malus hupehensis]
Length=164

 Score =   123 bits (309),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 75/133 (56%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            AE+EFRCFVGGLAWAT   +L  AFS +GE+IESK                         
Sbjct  4    AEIEFRCFVGGLAWATDNEALERAFSQYGEIIESK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     IINDRETGRSRGFGFVTF  EQAM+DAIEGMNGQ+
Sbjct  39   -------------------------IINDRETGRSRGFGFVTFGSEQAMRDAIEGMNGQN  73

Query  416  LDGRNITVNEAQS  454
            LDGRNITVNEAQS
Sbjct  74   LDGRNITVNEAQS  86



>ref|XP_009618693.1| PREDICTED: glycine-rich RNA-binding protein-like [Nicotiana tomentosiformis]
Length=147

 Score =   122 bits (307),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 67/135 (50%), Positives = 78/135 (58%), Gaps = 50/135 (37%)
 Frame = +2

Query  50   VMAEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*sl  229
            + AEVE+ CFVGGLAWATT+ +L DAF ++GEV++SK                       
Sbjct  1    MAAEVEYSCFVGGLAWATTDRTLADAFGTYGEVLDSK-----------------------  37

Query  230  cyyyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNG  409
                                       IINDRETGRSRGFGFVTFKDE+ M+DAIEGMNG
Sbjct  38   ---------------------------IINDRETGRSRGFGFVTFKDEKCMRDAIEGMNG  70

Query  410  QSLDGRNITVNEAQS  454
            Q LDGRNITVNEAQ+
Sbjct  71   QELDGRNITVNEAQA  85



>ref|XP_008785687.1| PREDICTED: glycine-rich RNA-binding protein GRP2A-like [Phoenix 
dactylifera]
Length=149

 Score =   122 bits (307),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 68/131 (52%), Positives = 76/131 (58%), Gaps = 50/131 (38%)
 Frame = +2

Query  59   EVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcyy  238
            +VE+RCFVGGLAWAT ++SL  AFS FGE+IESK                          
Sbjct  5    DVEYRCFVGGLAWATDDASLERAFSQFGEIIESK--------------------------  38

Query  239  yyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQSL  418
                                    IINDRETGRSRGFGFVTF+ EQAM+DAIEGMNGQ+L
Sbjct  39   ------------------------IINDRETGRSRGFGFVTFRSEQAMRDAIEGMNGQTL  74

Query  419  DGRNITVNEAQ  451
            DGRNITVNEAQ
Sbjct  75   DGRNITVNEAQ  85



>ref|XP_010939297.1| PREDICTED: glycine-rich RNA-binding protein GRP2A-like [Elaeis 
guineensis]
 gb|AIC33067.1| glycine-rich RNA-binding protein [Elaeis guineensis]
Length=150

 Score =   122 bits (307),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 76/132 (58%), Gaps = 50/132 (38%)
 Frame = +2

Query  59   EVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcyy  238
            +VE+RCFVGGLAWAT  +SL  AFS FGEV+ESK                          
Sbjct  5    DVEYRCFVGGLAWATDGASLERAFSQFGEVVESK--------------------------  38

Query  239  yyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQSL  418
                                    IINDRETGRSRGFGFVTF +EQAM+DAIEGMNGQ+L
Sbjct  39   ------------------------IINDRETGRSRGFGFVTFSNEQAMRDAIEGMNGQTL  74

Query  419  DGRNITVNEAQS  454
            DGRNITVNEAQS
Sbjct  75   DGRNITVNEAQS  86



>ref|XP_007042188.1| Glycine-rich RNA-binding protein 7 [Theobroma cacao]
 gb|EOX98019.1| Glycine-rich RNA-binding protein 7 [Theobroma cacao]
Length=168

 Score =   123 bits (309),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 66/132 (50%), Positives = 77/132 (58%), Gaps = 50/132 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            A++EFRCFVGGLAWAT + +L  AFS +GE++ESK                         
Sbjct  4    ADIEFRCFVGGLAWATDDRALEQAFSQYGEIVESK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     IINDRETGRSRGFGFVTF+DE+AM+DAIEGMNGQ+
Sbjct  39   -------------------------IINDRETGRSRGFGFVTFRDEKAMRDAIEGMNGQN  73

Query  416  LDGRNITVNEAQ  451
            LDGRNITVNEAQ
Sbjct  74   LDGRNITVNEAQ  85



>gb|ADG96008.1| putative glycine-rich RNA-binding protein 1 [Malus prunifolia]
Length=171

 Score =   123 bits (309),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 75/133 (56%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            AE+EFRCFVGGLAWAT   +L  AFS +GE+IESK                         
Sbjct  4    AEIEFRCFVGGLAWATDNEALERAFSQYGEIIESK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     IINDRETGRSRGFGFVTF  EQAM+DAIEGMNGQ+
Sbjct  39   -------------------------IINDRETGRSRGFGFVTFGSEQAMRDAIEGMNGQN  73

Query  416  LDGRNITVNEAQS  454
            LDGRNITVNEAQS
Sbjct  74   LDGRNITVNEAQS  86



>ref|XP_010531429.1| PREDICTED: glycine-rich RNA-binding protein GRP1A-like [Tarenaya 
hassleriana]
Length=154

 Score =   122 bits (307),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 75/132 (57%), Gaps = 50/132 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            A+VEFRCFVGGLAWAT + +L  AFS FGEV++SK                         
Sbjct  4    ADVEFRCFVGGLAWATDDQALERAFSQFGEVVDSK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     IINDRETGRSRGFGFVTFKDE+AMKDAIE MNGQ 
Sbjct  39   -------------------------IINDRETGRSRGFGFVTFKDEKAMKDAIESMNGQE  73

Query  416  LDGRNITVNEAQ  451
            LDGRNITVNEAQ
Sbjct  74   LDGRNITVNEAQ  85



>ref|XP_009396445.1| PREDICTED: glycine-rich RNA-binding protein 7-like [Musa acuminata 
subsp. malaccensis]
Length=158

 Score =   123 bits (308),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 80/133 (60%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            ++VEFRCFVGGLAWAT ++SL  AFS++G+++ESK                         
Sbjct  4    SDVEFRCFVGGLAWATDDASLERAFSTYGDIVESK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     IINDRETGRSRGFGFVTF+DEQ+M+DAI+GMNGQ+
Sbjct  39   -------------------------IINDRETGRSRGFGFVTFRDEQSMRDAIKGMNGQT  73

Query  416  LDGRNITVNEAQS  454
            LDGRNITVNEAQ+
Sbjct  74   LDGRNITVNEAQN  86



>ref|XP_009791569.1| PREDICTED: glycine-rich RNA-binding protein-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009791570.1| PREDICTED: glycine-rich RNA-binding protein-like isoform X2 [Nicotiana 
sylvestris]
 dbj|BAA03742.1| RNA-binding glycine-rich protein-1b [Nicotiana sylvestris]
 gb|ADG03638.1| RNA-binding glycine-rich protein [Nicotiana tabacum]
Length=148

 Score =   122 bits (307),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 78/134 (58%), Gaps = 50/134 (37%)
 Frame = +2

Query  53   MAEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slc  232
            MAEVE+ CFVGGLAWATT+ +L DAF ++GEV++SK                        
Sbjct  1    MAEVEYSCFVGGLAWATTDRTLADAFGTYGEVLDSK------------------------  36

Query  233  yyyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQ  412
                                      IINDRETGRSRGFGFVTFKDE+ M+DAIEGMNGQ
Sbjct  37   --------------------------IINDRETGRSRGFGFVTFKDEKCMRDAIEGMNGQ  70

Query  413  SLDGRNITVNEAQS  454
             LDGR+ITVNEAQ+
Sbjct  71   ELDGRSITVNEAQA  84



>emb|CAC80549.1| glycine-rich RNA-binding protein [Ricinus communis]
Length=165

 Score =   123 bits (308),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 80/133 (60%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            A++E+RCFVGGLAWAT++ +L +AFS++GEV+ESK                         
Sbjct  4    ADIEYRCFVGGLAWATSDKALEEAFSAYGEVLESK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     IINDRETGRSRGFGFVTF +E++M+DAIEGMNGQ+
Sbjct  39   -------------------------IINDRETGRSRGFGFVTFNNEKSMRDAIEGMNGQN  73

Query  416  LDGRNITVNEAQS  454
            LDGRNITVNEAQS
Sbjct  74   LDGRNITVNEAQS  86



>ref|XP_002526922.1| glycine-rich RNA-binding protein, putative [Ricinus communis]
 gb|EEF35409.1| glycine-rich RNA-binding protein, putative [Ricinus communis]
Length=166

 Score =   123 bits (308),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 80/133 (60%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            A++E+RCFVGGLAWAT++ +L +AFS++GEV+ESK                         
Sbjct  4    ADIEYRCFVGGLAWATSDKALEEAFSAYGEVLESK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     IINDRETGRSRGFGFVTF +E++M+DAIEGMNGQ+
Sbjct  39   -------------------------IINDRETGRSRGFGFVTFNNEKSMRDAIEGMNGQN  73

Query  416  LDGRNITVNEAQS  454
            LDGRNITVNEAQS
Sbjct  74   LDGRNITVNEAQS  86



>ref|XP_009374202.1| PREDICTED: glycine-rich RNA-binding protein 7-like [Pyrus x bretschneideri]
Length=148

 Score =   122 bits (306),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 74/132 (56%), Gaps = 50/132 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            AE+EFRCFVGGLAWAT   +L  AFS FGE+IESK                         
Sbjct  4    AEIEFRCFVGGLAWATDNEALERAFSQFGEIIESK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     IINDRETGRSRGFGFVTF  EQAM+DAIEGMNGQ+
Sbjct  39   -------------------------IINDRETGRSRGFGFVTFGSEQAMRDAIEGMNGQN  73

Query  416  LDGRNITVNEAQ  451
            LDGRNITVNEAQ
Sbjct  74   LDGRNITVNEAQ  85



>ref|XP_006379241.1| hypothetical protein POPTR_0009s11920g [Populus trichocarpa]
 gb|ABK92779.1| unknown [Populus trichocarpa]
 gb|ABK92791.1| unknown [Populus trichocarpa]
 gb|ABK93295.1| unknown [Populus trichocarpa]
 gb|ABK93505.1| unknown [Populus trichocarpa]
 gb|ERP57038.1| hypothetical protein POPTR_0009s11920g [Populus trichocarpa]
Length=170

 Score =   122 bits (306),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 77/133 (58%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            AEVE+RCFVGGLAWATT+  L +AFS +GE+I+SK                         
Sbjct  3    AEVEYRCFVGGLAWATTDQVLQEAFSQYGEIIDSK-------------------------  37

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     IINDRETGRSRGFGFVTF +E+AM+DAI+GMNGQ 
Sbjct  38   -------------------------IINDRETGRSRGFGFVTFGNEKAMRDAIDGMNGQD  72

Query  416  LDGRNITVNEAQS  454
            LDGRNITVNEAQS
Sbjct  73   LDGRNITVNEAQS  85



>gb|ABK96349.1| unknown [Populus trichocarpa x Populus deltoides]
Length=171

 Score =   122 bits (306),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 77/133 (58%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            AEVE+RCFVGGLAWATT+  L +AFS +GE+I+SK                         
Sbjct  3    AEVEYRCFVGGLAWATTDQVLQEAFSQYGEIIDSK-------------------------  37

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     IINDRETGRSRGFGFVTF +E+AM+DAI+GMNGQ 
Sbjct  38   -------------------------IINDRETGRSRGFGFVTFGNEKAMRDAIDGMNGQD  72

Query  416  LDGRNITVNEAQS  454
            LDGRNITVNEAQS
Sbjct  73   LDGRNITVNEAQS  85



>gb|ABG22105.1| Glycine-rich RNA-binding protein GRP1A, putative, expressed [Oryza 
sativa Japonica Group]
Length=117

 Score =   120 bits (301),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 67/132 (51%), Positives = 75/132 (57%), Gaps = 50/132 (38%)
 Frame = +2

Query  59   EVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcyy  238
            +VE+RCFVGGLAWAT + SL  AFS+FGE++ESK                          
Sbjct  5    DVEYRCFVGGLAWATDDRSLEAAFSTFGEILESK--------------------------  38

Query  239  yyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQSL  418
                                    IINDRETGRSRGFGFVTF  EQAM+DAIEGMNG+ L
Sbjct  39   ------------------------IINDRETGRSRGFGFVTFSSEQAMRDAIEGMNGKEL  74

Query  419  DGRNITVNEAQS  454
            DGRNITVNEAQS
Sbjct  75   DGRNITVNEAQS  86



>emb|CDY15876.1| BnaA04g12350D [Brassica napus]
Length=169

 Score =   122 bits (305),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 75/132 (57%), Gaps = 50/132 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
             +VE+RCFVGGLAWAT E SL  AFS FGE+++SK                         
Sbjct  4    PDVEYRCFVGGLAWATDERSLETAFSKFGELVDSK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     IINDRETGRSRGFGFVTFKDEQ+MKDAIEGMNGQ 
Sbjct  39   -------------------------IINDRETGRSRGFGFVTFKDEQSMKDAIEGMNGQD  73

Query  416  LDGRNITVNEAQ  451
            LDGR+ITVNEAQ
Sbjct  74   LDGRSITVNEAQ  85



>emb|CDY72366.1| BnaUnng05060D [Brassica napus]
Length=171

 Score =   122 bits (305),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 75/132 (57%), Gaps = 50/132 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
             +VE+RCFVGGLAWAT E SL  AFS FGE+++SK                         
Sbjct  4    PDVEYRCFVGGLAWATDERSLETAFSKFGELVDSK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     IINDRETGRSRGFGFVTFKDEQ+MKDAIEGMNGQ 
Sbjct  39   -------------------------IINDRETGRSRGFGFVTFKDEQSMKDAIEGMNGQD  73

Query  416  LDGRNITVNEAQ  451
            LDGR+ITVNEAQ
Sbjct  74   LDGRSITVNEAQ  85



>ref|XP_008377301.1| PREDICTED: LOW QUALITY PROTEIN: glycine-rich RNA-binding protein 
GRP1A-like [Malus domestica]
Length=217

 Score =   123 bits (308),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 75/133 (56%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            AE+EFRCFVGGLAWAT   +L  AFS +GE+IESK                         
Sbjct  50   AEIEFRCFVGGLAWATDNEALERAFSQYGEIIESK-------------------------  84

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     IINDRETGRSRGFGFVTF  EQAM+DAIEGMNGQ+
Sbjct  85   -------------------------IINDRETGRSRGFGFVTFGSEQAMRDAIEGMNGQN  119

Query  416  LDGRNITVNEAQS  454
            LDGRNITVNEAQS
Sbjct  120  LDGRNITVNEAQS  132



>ref|XP_006349599.1| PREDICTED: glycine-rich RNA-binding protein GRP1A-like [Solanum 
tuberosum]
Length=161

 Score =   121 bits (304),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 66/135 (49%), Positives = 78/135 (58%), Gaps = 50/135 (37%)
 Frame = +2

Query  50   VMAEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*sl  229
            + AEVE+ CFVGGLAWATT+ +L DAFS++GEV++SK                       
Sbjct  1    MAAEVEYSCFVGGLAWATTDRTLSDAFSTYGEVVDSK-----------------------  37

Query  230  cyyyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNG  409
                                       IINDRETGRSRGFGFVTFKDE++MK+AI GMNG
Sbjct  38   ---------------------------IINDRETGRSRGFGFVTFKDEKSMKEAISGMNG  70

Query  410  QSLDGRNITVNEAQS  454
              LDGRNITVNEAQ+
Sbjct  71   SELDGRNITVNEAQA  85



>gb|AAL13082.1| putative glycine-rich RNA-binding protein [Prunus avium]
Length=178

 Score =   122 bits (305),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 75/132 (57%), Gaps = 50/132 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            AE+EFRCFVGGLAWAT   +L  AFS FGE+IESK                         
Sbjct  4    AEIEFRCFVGGLAWATDNDALERAFSPFGEIIESK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     IINDRETGRSRGFGFVTF +E+AM+DAIEGMNGQ+
Sbjct  39   -------------------------IINDRETGRSRGFGFVTFSNEKAMRDAIEGMNGQN  73

Query  416  LDGRNITVNEAQ  451
            LDGRNITVNEAQ
Sbjct  74   LDGRNITVNEAQ  85



>ref|XP_007136168.1| hypothetical protein PHAVU_009G023700g [Phaseolus vulgaris]
 gb|ESW08162.1| hypothetical protein PHAVU_009G023700g [Phaseolus vulgaris]
Length=185

 Score =   122 bits (305),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 75/133 (56%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            AE+EFRCFVGGLAWAT   +L  AFS +G++IESKV                        
Sbjct  4    AEIEFRCFVGGLAWATDSEALDKAFSKYGQIIESKV------------------------  39

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                      INDRETGRSRGFGFVTF  EQAM+DAIEGMNGQ+
Sbjct  40   --------------------------INDRETGRSRGFGFVTFATEQAMRDAIEGMNGQN  73

Query  416  LDGRNITVNEAQS  454
            LDGRNITVNEAQS
Sbjct  74   LDGRNITVNEAQS  86



>ref|XP_003631658.1| PREDICTED: glycine-rich RNA-binding protein GRP2A [Vitis vinifera]
Length=162

 Score =   121 bits (304),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 67/132 (51%), Positives = 75/132 (57%), Gaps = 50/132 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            AE+E+RCFVGGLAWAT + SL  AFS FGE++ESK                         
Sbjct  4    AEIEYRCFVGGLAWATDDQSLERAFSQFGEILESK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     IINDRETGRSRGFGFVTF  EQ+M+DAIEGMNGQ+
Sbjct  39   -------------------------IINDRETGRSRGFGFVTFSSEQSMRDAIEGMNGQN  73

Query  416  LDGRNITVNEAQ  451
            LDGRNITVNEAQ
Sbjct  74   LDGRNITVNEAQ  85



>emb|CAA73034.1| SGRP-1 [Solanum commersonii]
Length=162

 Score =   121 bits (304),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 66/135 (49%), Positives = 78/135 (58%), Gaps = 50/135 (37%)
 Frame = +2

Query  50   VMAEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*sl  229
            + AEVE+ CFVGGLAWATT+ +L DAFS++GEV++SK                       
Sbjct  1    MAAEVEYSCFVGGLAWATTDRTLSDAFSTYGEVVDSK-----------------------  37

Query  230  cyyyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNG  409
                                       IINDRETGRSRGFGFVTFKDE++MK+AI GMNG
Sbjct  38   ---------------------------IINDRETGRSRGFGFVTFKDEKSMKEAISGMNG  70

Query  410  QSLDGRNITVNEAQS  454
              LDGRNITVNEAQ+
Sbjct  71   SELDGRNITVNEAQA  85



>ref|XP_011048456.1| PREDICTED: glycine-rich RNA-binding protein-like [Populus euphratica]
Length=165

 Score =   121 bits (303),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 66/134 (49%), Positives = 77/134 (57%), Gaps = 50/134 (37%)
 Frame = +2

Query  50   VMAEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*sl  229
            + AEVE+RCFVGGLAWATT+  L +AFS +GE+I+SK                       
Sbjct  1    MAAEVEYRCFVGGLAWATTDQVLQEAFSQYGEIIDSK-----------------------  37

Query  230  cyyyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNG  409
                                       IINDRETGRSRGFGFVTF +E+AM+DAI+GMNG
Sbjct  38   ---------------------------IINDRETGRSRGFGFVTFGNEKAMRDAIDGMNG  70

Query  410  QSLDGRNITVNEAQ  451
            Q LDGRNITVNEAQ
Sbjct  71   QDLDGRNITVNEAQ  84



>ref|XP_010472164.1| PREDICTED: glycine-rich RNA-binding protein 7 [Camelina sativa]
Length=173

 Score =   121 bits (304),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 77/133 (58%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            A+VEFRCFVGGLAWAT + +L  AFS +G+V++SK                         
Sbjct  4    ADVEFRCFVGGLAWATDDRALETAFSQYGDVVDSK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     IINDRETGRSRGFGFVTFKDE++MKDAIEGMNGQ 
Sbjct  39   -------------------------IINDRETGRSRGFGFVTFKDEKSMKDAIEGMNGQE  73

Query  416  LDGRNITVNEAQS  454
            LDGR+ITVNEAQS
Sbjct  74   LDGRSITVNEAQS  86



>gb|AGO21482.1| glycine-rich RNA binding protein 7a [Camelina sativa]
Length=123

 Score =   120 bits (300),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 66/132 (50%), Positives = 76/132 (58%), Gaps = 50/132 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            A+VEFRCFVGGLAWAT + +L  AFS +G+V++SK                         
Sbjct  4    ADVEFRCFVGGLAWATDDRALETAFSQYGDVVDSK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     IINDRETGRSRGFGFVTFKDE++MKDAIEGMNGQ 
Sbjct  39   -------------------------IINDRETGRSRGFGFVTFKDEKSMKDAIEGMNGQE  73

Query  416  LDGRNITVNEAQ  451
            LDGR+ITVNEAQ
Sbjct  74   LDGRSITVNEAQ  85



>ref|XP_010429090.1| PREDICTED: glycine-rich RNA-binding protein GRP1A-like [Camelina 
sativa]
Length=175

 Score =   121 bits (304),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 77/133 (58%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            A+VEFRCFVGGLAWAT + +L  AFS +G+V++SK                         
Sbjct  4    ADVEFRCFVGGLAWATDDRALETAFSQYGDVVDSK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     IINDRETGRSRGFGFVTFKDE++MKDAIEGMNGQ 
Sbjct  39   -------------------------IINDRETGRSRGFGFVTFKDEKSMKDAIEGMNGQE  73

Query  416  LDGRNITVNEAQS  454
            LDGR+ITVNEAQS
Sbjct  74   LDGRSITVNEAQS  86



>ref|XP_010555297.1| PREDICTED: glycine-rich RNA-binding protein GRP1A-like [Tarenaya 
hassleriana]
Length=156

 Score =   120 bits (301),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 66/132 (50%), Positives = 75/132 (57%), Gaps = 50/132 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            A+VE+RCFVGGLAWAT + +L  AFS FGEV++SK                         
Sbjct  3    ADVEYRCFVGGLAWATDDQALEQAFSQFGEVVDSK-------------------------  37

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     IINDRETGRSRGFGFVTFKDE++M+DAIE MNGQ 
Sbjct  38   -------------------------IINDRETGRSRGFGFVTFKDEKSMRDAIESMNGQE  72

Query  416  LDGRNITVNEAQ  451
            LDGRNITVNEAQ
Sbjct  73   LDGRNITVNEAQ  84



>emb|CAA05728.1| OsGRP1 [Oryza sativa Japonica Group]
Length=160

 Score =   120 bits (301),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 67/132 (51%), Positives = 75/132 (57%), Gaps = 50/132 (38%)
 Frame = +2

Query  59   EVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcyy  238
            +VE+RCFVGGLAWAT + SL  AFS+FGE++ESK                          
Sbjct  5    DVEYRCFVGGLAWATDDRSLEAAFSTFGEILESK--------------------------  38

Query  239  yyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQSL  418
                                    IINDRETGRSRGFGFVTF  EQAM+DAIEGMNG+ L
Sbjct  39   ------------------------IINDRETGRSRGFGFVTFSSEQAMRDAIEGMNGKEL  74

Query  419  DGRNITVNEAQS  454
            DGRNITVNEAQS
Sbjct  75   DGRNITVNEAQS  86



>sp|P49311.1|GRP2_SINAL RecName: Full=Glycine-rich RNA-binding protein GRP2A [Sinapis 
alba]
 gb|AAA59213.1| homology with RNA-binding proteins in meristematic tissue [Sinapis 
alba]
Length=169

 Score =   120 bits (301),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 67/132 (51%), Positives = 75/132 (57%), Gaps = 50/132 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
             +VE+RCFVGGLAWAT E SL  AFS FGE+++SK                         
Sbjct  4    PDVEYRCFVGGLAWATDERSLETAFSQFGELVDSK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     IINDRETGRSRGFGFVTFKDE++MKDAIEGMNGQ 
Sbjct  39   -------------------------IINDRETGRSRGFGFVTFKDEKSMKDAIEGMNGQD  73

Query  416  LDGRNITVNEAQ  451
            LDGR+ITVNEAQ
Sbjct  74   LDGRSITVNEAQ  85



>ref|XP_006854646.1| hypothetical protein AMTR_s00030p00195240 [Amborella trichopoda]
 gb|ERN16113.1| hypothetical protein AMTR_s00030p00195240 [Amborella trichopoda]
Length=154

 Score =   120 bits (300),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 66/132 (50%), Positives = 77/132 (58%), Gaps = 50/132 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            A+VEFRCFVGGLAWAT + +L  AFS++G+VIESK                         
Sbjct  4    ADVEFRCFVGGLAWATDDKALDKAFSAYGDVIESK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     II+DRETGRSRGFGFVTF +EQ+M+DAIEGMNGQ+
Sbjct  39   -------------------------IISDRETGRSRGFGFVTFSNEQSMRDAIEGMNGQT  73

Query  416  LDGRNITVNEAQ  451
            LDGRNITVNEAQ
Sbjct  74   LDGRNITVNEAQ  85



>ref|XP_003606921.1| Glycine-rich RNA binding protein [Medicago truncatula]
 gb|AES89118.1| RNA-binding (RRM/RBD/RNP motif) family protein [Medicago truncatula]
Length=164

 Score =   120 bits (300),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 75/133 (56%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            A+VE+RCFVGGLAWAT   +L  AFS +GE+I+SK                         
Sbjct  4    ADVEYRCFVGGLAWATDSEALEKAFSQYGEIIDSK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     IINDRETGRSRGFGFVTF DE++M+DAIEGMNGQ 
Sbjct  39   -------------------------IINDRETGRSRGFGFVTFADEKSMRDAIEGMNGQD  73

Query  416  LDGRNITVNEAQS  454
            +DGRNITVNEAQS
Sbjct  74   MDGRNITVNEAQS  86



>ref|NP_001067344.1| Os12g0632000 [Oryza sativa Japonica Group]
 gb|ABA99935.1| Glycine-rich RNA-binding protein GRP1A, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF30363.1| Os12g0632000 [Oryza sativa Japonica Group]
 gb|EAZ21319.1| hypothetical protein OsJ_36973 [Oryza sativa Japonica Group]
 dbj|BAH01685.1| unnamed protein product [Oryza sativa Japonica Group]
Length=162

 Score =   120 bits (300),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 67/132 (51%), Positives = 75/132 (57%), Gaps = 50/132 (38%)
 Frame = +2

Query  59   EVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcyy  238
            +VE+RCFVGGLAWAT + SL  AFS+FGE++ESK                          
Sbjct  5    DVEYRCFVGGLAWATDDRSLEAAFSTFGEILESK--------------------------  38

Query  239  yyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQSL  418
                                    IINDRETGRSRGFGFVTF  EQAM+DAIEGMNG+ L
Sbjct  39   ------------------------IINDRETGRSRGFGFVTFSSEQAMRDAIEGMNGKEL  74

Query  419  DGRNITVNEAQS  454
            DGRNITVNEAQS
Sbjct  75   DGRNITVNEAQS  86



>gb|ACJ04160.1| putative glycine-rich RNA-binding protein [Chorispora bungeana]
Length=175

 Score =   120 bits (300),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/132 (50%), Positives = 76/132 (58%), Gaps = 50/132 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            A+VEFRCFVGGLAWAT + +L  AFS +G+V++SK                         
Sbjct  4    ADVEFRCFVGGLAWATDDRALETAFSQYGDVVDSK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     IINDRETGRSRGFGFVTFKDE++MKDAIEGMNGQ 
Sbjct  39   -------------------------IINDRETGRSRGFGFVTFKDEKSMKDAIEGMNGQD  73

Query  416  LDGRNITVNEAQ  451
            LDGR+ITVNEAQ
Sbjct  74   LDGRSITVNEAQ  85



>ref|XP_006590896.1| PREDICTED: glycine-rich RNA-binding protein 7-like [Glycine max]
Length=171

 Score =   120 bits (300),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 76/133 (57%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            ++VE+RCFVGGLAWAT + +L  AFS +GE++E+K                         
Sbjct  4    SDVEYRCFVGGLAWATDDQALERAFSQYGEIVETK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     IINDRETGRSRGFGFVTF  EQ+MKDAIEGMNGQ+
Sbjct  39   -------------------------IINDRETGRSRGFGFVTFASEQSMKDAIEGMNGQN  73

Query  416  LDGRNITVNEAQS  454
            LDGRNITVNEAQS
Sbjct  74   LDGRNITVNEAQS  86



>ref|XP_004289673.1| PREDICTED: glycine-rich RNA-binding, abscisic acid-inducible 
protein-like isoform X1 [Fragaria vesca subsp. vesca]
Length=177

 Score =   120 bits (300),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 67/132 (51%), Positives = 74/132 (56%), Gaps = 50/132 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            AE+EFRCFVGGLAWAT   +L  AF+ FGE+IESK                         
Sbjct  4    AEIEFRCFVGGLAWATDNDALERAFAPFGEIIESK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     IINDRETGRSRGFGFVTF +E+AM+DAIEGMNGQ 
Sbjct  39   -------------------------IINDRETGRSRGFGFVTFSNEKAMRDAIEGMNGQD  73

Query  416  LDGRNITVNEAQ  451
            LDGRNITVNEAQ
Sbjct  74   LDGRNITVNEAQ  85



>ref|XP_010056019.1| PREDICTED: glycine-rich RNA-binding protein-like isoform X1 [Eucalyptus 
grandis]
Length=167

 Score =   119 bits (299),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/132 (50%), Positives = 76/132 (58%), Gaps = 50/132 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            AEVE+RCFVGGLAWAT + SL  AFS FG++++SK                         
Sbjct  4    AEVEYRCFVGGLAWATDDQSLERAFSQFGDILDSK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     IINDRETGRSRGFGFVTF +E+AM+DAIEGMNGQ+
Sbjct  39   -------------------------IINDRETGRSRGFGFVTFGNEKAMRDAIEGMNGQN  73

Query  416  LDGRNITVNEAQ  451
            LDGRNITVNEAQ
Sbjct  74   LDGRNITVNEAQ  85



>ref|XP_008347751.1| PREDICTED: glycine-rich RNA-binding protein-like [Malus domestica]
Length=172

 Score =   119 bits (299),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 66/132 (50%), Positives = 74/132 (56%), Gaps = 50/132 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            AE+E+RCFVGGLAWAT   +L  AFS +GE+IESK                         
Sbjct  4    AEIEYRCFVGGLAWATDNEALERAFSQYGEIIESK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     IINDRETGRSRGFGFVTF +EQAM+DAIE MNGQ+
Sbjct  39   -------------------------IINDRETGRSRGFGFVTFGNEQAMRDAIEAMNGQN  73

Query  416  LDGRNITVNEAQ  451
            LDGRNITVNEAQ
Sbjct  74   LDGRNITVNEAQ  85



>ref|XP_009342794.1| PREDICTED: glycine-rich RNA-binding protein [Pyrus x bretschneideri]
Length=173

 Score =   119 bits (299),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 66/132 (50%), Positives = 74/132 (56%), Gaps = 50/132 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            AE+E+RCFVGGLAWAT   +L  AFS +GE+IESK                         
Sbjct  4    AEIEYRCFVGGLAWATDNEALERAFSQYGEIIESK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     IINDRETGRSRGFGFVTF +EQAM+DAIE MNGQ+
Sbjct  39   -------------------------IINDRETGRSRGFGFVTFGNEQAMRDAIEAMNGQN  73

Query  416  LDGRNITVNEAQ  451
            LDGRNITVNEAQ
Sbjct  74   LDGRNITVNEAQ  85



>gb|ACA50486.1| glycine-rich RNA binding protein [Oryza sativa Japonica Group]
 gb|ADM86856.1| glycine-rich RNA binding protein [Oryza sativa Japonica Group]
 gb|AFI71864.1| Glycin-rich RNA binding protein [Oryza sativa]
Length=161

 Score =   119 bits (298),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 66/132 (50%), Positives = 75/132 (57%), Gaps = 50/132 (38%)
 Frame = +2

Query  59   EVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcyy  238
            +VE+RCFVGGLAWAT + SL  AFS++GE++ESK                          
Sbjct  5    DVEYRCFVGGLAWATDDRSLEAAFSTYGEILESK--------------------------  38

Query  239  yyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQSL  418
                                    IINDRETGRSRGFGFVTF  EQAM+DAIEGMNG+ L
Sbjct  39   ------------------------IINDRETGRSRGFGFVTFSSEQAMRDAIEGMNGKEL  74

Query  419  DGRNITVNEAQS  454
            DGRNITVNEAQS
Sbjct  75   DGRNITVNEAQS  86



>gb|EAY84004.1| hypothetical protein OsI_39235 [Oryza sativa Indica Group]
Length=161

 Score =   119 bits (298),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 66/132 (50%), Positives = 75/132 (57%), Gaps = 50/132 (38%)
 Frame = +2

Query  59   EVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcyy  238
            +VE+RCFVGGLAWAT + SL  AFS++GE++ESK                          
Sbjct  5    DVEYRCFVGGLAWATDDRSLEAAFSTYGEILESK--------------------------  38

Query  239  yyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQSL  418
                                    IINDRETGRSRGFGFVTF  EQAM+DAIEGMNG+ L
Sbjct  39   ------------------------IINDRETGRSRGFGFVTFSSEQAMRDAIEGMNGKEL  74

Query  419  DGRNITVNEAQS  454
            DGRNITVNEAQS
Sbjct  75   DGRNITVNEAQS  86



>gb|ABK21879.1| unknown [Picea sitchensis]
Length=172

 Score =   119 bits (299),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 66/133 (50%), Positives = 75/133 (56%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            AEVE+RCFVGGLAWAT + SL DAFS FGE++ESK                         
Sbjct  5    AEVEYRCFVGGLAWATDDRSLQDAFSPFGEILESK-------------------------  39

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     II+DRETGRSRGFGFVTF DEQ+M+DAI+ MNG+ 
Sbjct  40   -------------------------IISDRETGRSRGFGFVTFSDEQSMRDAIDAMNGKV  74

Query  416  LDGRNITVNEAQS  454
            LDGRNITVN AQS
Sbjct  75   LDGRNITVNPAQS  87



>ref|XP_002880392.1| hypothetical protein ARALYDRAFT_481034 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56651.1| hypothetical protein ARALYDRAFT_481034 [Arabidopsis lyrata subsp. 
lyrata]
Length=159

 Score =   119 bits (298),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 76/132 (58%), Gaps = 50/132 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            A+VE+RCFVGGLAWAT + +L  AFS +G+V++SK                         
Sbjct  4    ADVEYRCFVGGLAWATDDRALETAFSQYGDVVDSK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     IINDRETGRSRGFGFVTFKDE++MKDAIEGMNGQ 
Sbjct  39   -------------------------IINDRETGRSRGFGFVTFKDEKSMKDAIEGMNGQE  73

Query  416  LDGRNITVNEAQ  451
            LDGR+ITVNEAQ
Sbjct  74   LDGRSITVNEAQ  85



>ref|XP_010066154.1| PREDICTED: glycine-rich RNA-binding, abscisic acid-inducible 
protein-like [Eucalyptus grandis]
Length=169

 Score =   119 bits (299),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 67/132 (51%), Positives = 75/132 (57%), Gaps = 50/132 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            AEVE+RCFVGGLAWAT + SL  AFS FGE++ESKV                        
Sbjct  4    AEVEYRCFVGGLAWATDDQSLERAFSQFGEILESKV------------------------  39

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                      INDRETGRSRGFGFVTF  E+AM+DAI+GMNGQ+
Sbjct  40   --------------------------INDRETGRSRGFGFVTFGSEKAMRDAIDGMNGQN  73

Query  416  LDGRNITVNEAQ  451
            LDGRNITVNEAQ
Sbjct  74   LDGRNITVNEAQ  85



>ref|XP_010431895.1| PREDICTED: glycine-rich RNA-binding protein 8-like isoform X1 
[Camelina sativa]
Length=167

 Score =   119 bits (298),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 66/133 (50%), Positives = 75/133 (56%), Gaps = 50/133 (38%)
 Frame = +2

Query  53   MAEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slc  232
            MAEVE+RCFVGGLAWAT +  L + FS FGEVI+SK                        
Sbjct  1    MAEVEYRCFVGGLAWATRDEDLQNTFSQFGEVIDSK------------------------  36

Query  233  yyyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQ  412
                                      IINDR+TGRSRGFGFVTFKDE++M+DAIE MNG+
Sbjct  37   --------------------------IINDRDTGRSRGFGFVTFKDEKSMRDAIEEMNGK  70

Query  413  SLDGRNITVNEAQ  451
             LDGRNITVNEAQ
Sbjct  71   ELDGRNITVNEAQ  83



>emb|CAC83314.1| glycine rich RNA binding protein [Oryza sativa Indica Group]
Length=194

 Score =   120 bits (300),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 66/133 (50%), Positives = 75/133 (56%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
             +VE+RCFVGGLAWAT + SL  AFS++GE++ESK                         
Sbjct  4    PDVEYRCFVGGLAWATDDRSLEAAFSTYGEILESK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     IINDRETGRSRGFGFVTF  EQAM+DAIEGMNG+ 
Sbjct  39   -------------------------IINDRETGRSRGFGFVTFSSEQAMRDAIEGMNGKE  73

Query  416  LDGRNITVNEAQS  454
            LDGRNITVNEAQS
Sbjct  74   LDGRNITVNEAQS  86



>dbj|BAH56965.1| AT2G21660 [Arabidopsis thaliana]
Length=153

 Score =   119 bits (297),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 75/132 (57%), Gaps = 50/132 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
             +VE+RCFVGGLAWAT + +L  AF+ +G+VI+SK                         
Sbjct  4    GDVEYRCFVGGLAWATDDRALETAFAQYGDVIDSK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     IINDRETGRSRGFGFVTFKDE+AMKDAIEGMNGQ 
Sbjct  39   -------------------------IINDRETGRSRGFGFVTFKDEKAMKDAIEGMNGQD  73

Query  416  LDGRNITVNEAQ  451
            LDGR+ITVNEAQ
Sbjct  74   LDGRSITVNEAQ  85



>ref|NP_850017.1| glycine-rich RNA-binding protein 7 [Arabidopsis thaliana]
 gb|AEC07210.1| glycine-rich RNA-binding protein 7 [Arabidopsis thaliana]
Length=159

 Score =   119 bits (297),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 75/132 (57%), Gaps = 50/132 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
             +VE+RCFVGGLAWAT + +L  AF+ +G+VI+SK                         
Sbjct  4    GDVEYRCFVGGLAWATDDRALETAFAQYGDVIDSK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     IINDRETGRSRGFGFVTFKDE+AMKDAIEGMNGQ 
Sbjct  39   -------------------------IINDRETGRSRGFGFVTFKDEKAMKDAIEGMNGQD  73

Query  416  LDGRNITVNEAQ  451
            LDGR+ITVNEAQ
Sbjct  74   LDGRSITVNEAQ  85



>gb|AAB63581.1| glycine-rich RNA binding protein 1 [Pelargonium x hortorum]
 gb|AAB63582.1| glycine-rich RNA binding protein 2 [Pelargonium x hortorum]
Length=166

 Score =   119 bits (297),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 75/132 (57%), Gaps = 50/132 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            A+VE+RCFVGGLAWAT + +L  AFS +GEV+ESK                         
Sbjct  4    ADVEYRCFVGGLAWATDDHALEQAFSQYGEVVESK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     IINDRETGRSRGFGFVTF +E++M DAIEGMNGQ+
Sbjct  39   -------------------------IINDRETGRSRGFGFVTFSNEKSMNDAIEGMNGQN  73

Query  416  LDGRNITVNEAQ  451
            LDGRNITVNEAQ
Sbjct  74   LDGRNITVNEAQ  85



>sp|P49310.1|GRP1_SINAL RecName: Full=Glycine-rich RNA-binding protein GRP1A [Sinapis 
alba]
 gb|AAA59212.1| homology with RNA-binding proteins in meristematic tissue [Sinapis 
alba]
Length=166

 Score =   119 bits (297),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 75/132 (57%), Gaps = 50/132 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
             +VE+RCFVGGLAWAT + +L  AFS +GEV++SK                         
Sbjct  4    PDVEYRCFVGGLAWATDDRALETAFSQYGEVLDSK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     IINDRETGRSRGFGFVTFKDE++MKDAIEGMNGQ 
Sbjct  39   -------------------------IINDRETGRSRGFGFVTFKDEKSMKDAIEGMNGQD  73

Query  416  LDGRNITVNEAQ  451
            LDGR+ITVNEAQ
Sbjct  74   LDGRSITVNEAQ  85



>gb|AAM62447.1| glycine-rich RNA binding protein 7 [Arabidopsis thaliana]
Length=175

 Score =   119 bits (297),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 75/132 (57%), Gaps = 50/132 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
             +VE+RCFVGGLAWAT + +L  AF+ +G+VI+SK                         
Sbjct  4    GDVEYRCFVGGLAWATDDRALETAFAQYGDVIDSK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     IINDRETGRSRGFGFVTFKDE+AMKDAIEGMNGQ 
Sbjct  39   -------------------------IINDRETGRSRGFGFVTFKDEKAMKDAIEGMNGQD  73

Query  416  LDGRNITVNEAQ  451
            LDGR+ITVNEAQ
Sbjct  74   LDGRSITVNEAQ  85



>gb|KHG24415.1| Glycine-rich RNA-binding GRP1A [Gossypium arboreum]
Length=196

 Score =   119 bits (298),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 63/132 (48%), Positives = 78/132 (59%), Gaps = 50/132 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            A+V++RCFVGGLAWAT + +L +AFS +GE++ESK                         
Sbjct  4    ADVDYRCFVGGLAWATDDRALEEAFSVYGEIVESK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     IINDRE+GRSRGFGFVTF+DE++M+DAIEGMNGQ+
Sbjct  39   -------------------------IINDRESGRSRGFGFVTFRDEKSMRDAIEGMNGQN  73

Query  416  LDGRNITVNEAQ  451
            LDGRNITVNEAQ
Sbjct  74   LDGRNITVNEAQ  85



>ref|NP_179760.1| glycine-rich RNA-binding protein 7 [Arabidopsis thaliana]
 sp|Q03250.1|RBG7_ARATH RecName: Full=Glycine-rich RNA-binding protein 7; Short=AtGR-RBP7; 
AltName: Full=AtRBG7; AltName: Full=Glycine-rich protein 
7; Short=AtGRP7; AltName: Full=Protein COLD, CIRCADIAN RHYTHM, 
AND RNA BINDING 2; Short=Protein CCR2 [Arabidopsis thaliana]
 gb|AAL16149.1|AF428381_1 At2g22292/F2G1.7_ [Arabidopsis thaliana]
 emb|CAA78711.1| glycine rich protein [Arabidopsis thaliana]
 gb|AAA32853.1| RNA-binding protein [Arabidopsis thaliana]
 gb|AAD23639.1| glycine-rich RNA binding protein 7 [Arabidopsis thaliana]
 gb|AAL06943.1| At2g21660/F2G1.7 [Arabidopsis thaliana]
 gb|AEC07209.1| glycine-rich RNA-binding protein 7 [Arabidopsis thaliana]
Length=176

 Score =   119 bits (297),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 75/132 (57%), Gaps = 50/132 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
             +VE+RCFVGGLAWAT + +L  AF+ +G+VI+SK                         
Sbjct  4    GDVEYRCFVGGLAWATDDRALETAFAQYGDVIDSK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     IINDRETGRSRGFGFVTFKDE+AMKDAIEGMNGQ 
Sbjct  39   -------------------------IINDRETGRSRGFGFVTFKDEKAMKDAIEGMNGQD  73

Query  416  LDGRNITVNEAQ  451
            LDGR+ITVNEAQ
Sbjct  74   LDGRSITVNEAQ  85



>gb|AIN39847.1| hypothetical protein [Zoysia matrella]
Length=148

 Score =   118 bits (295),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 65/134 (49%), Positives = 75/134 (56%), Gaps = 50/134 (37%)
 Frame = +2

Query  50   VMAEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*sl  229
            + AEVE+RCFVGGLAWAT + SL  AFS +GEV++SK                       
Sbjct  1    MAAEVEYRCFVGGLAWATDDRSLEQAFSQYGEVLDSK-----------------------  37

Query  230  cyyyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNG  409
                                       IINDRETGRSRGFGF+TFKDEQ+M DAIE MNG
Sbjct  38   ---------------------------IINDRETGRSRGFGFITFKDEQSMLDAIENMNG  70

Query  410  QSLDGRNITVNEAQ  451
            + LDGRNITVN+AQ
Sbjct  71   KELDGRNITVNQAQ  84



>gb|KFK32876.1| glycine-rich rna binding protein [Arabis alpina]
Length=179

 Score =   119 bits (297),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 77/132 (58%), Gaps = 50/132 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            A+VE+RCFVGGLAWAT + +L  AF+++G+V++SK                         
Sbjct  4    ADVEYRCFVGGLAWATDDRALETAFAAYGDVVDSK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     IINDRETGRSRGFGFVTFKDE++MKDAIEGMNGQ 
Sbjct  39   -------------------------IINDRETGRSRGFGFVTFKDEKSMKDAIEGMNGQE  73

Query  416  LDGRNITVNEAQ  451
            LDGR+ITVNEAQ
Sbjct  74   LDGRSITVNEAQ  85



>ref|NP_001050870.1| Os03g0670700 [Oryza sativa Japonica Group]
 gb|ABF98116.1| retrotransposon protein, putative, Ty1-copia subclass, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF12784.1| Os03g0670700 [Oryza sativa Japonica Group]
Length=196

 Score =   119 bits (297),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 75/133 (56%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
             +VE+RCFVGGLAWAT + SL  AFS++GE+++SK                         
Sbjct  4    PDVEYRCFVGGLAWATDDRSLEAAFSTYGEILDSK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     IINDRETGRSRGFGFVTF  EQ+M+DAIEGMNG+ 
Sbjct  39   -------------------------IINDRETGRSRGFGFVTFSSEQSMRDAIEGMNGKE  73

Query  416  LDGRNITVNEAQS  454
            LDGRNITVNEAQS
Sbjct  74   LDGRNITVNEAQS  86



>gb|KHG11483.1| Glycine-rich RNA-binding GRP1A [Gossypium arboreum]
Length=150

 Score =   117 bits (294),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 62/133 (47%), Positives = 78/133 (59%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            A+VE++CFVGGLAW   + +L +AFS++GE+++SK                         
Sbjct  4    ADVEYQCFVGGLAWTINDRALEEAFSAYGEIVDSK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     IINDRETGRSRGFGFVTF+DE++M+DAIEGMNG+S
Sbjct  39   -------------------------IINDRETGRSRGFGFVTFRDEKSMRDAIEGMNGRS  73

Query  416  LDGRNITVNEAQS  454
            LDGRNITVNEAQS
Sbjct  74   LDGRNITVNEAQS  86



>gb|AFL91694.1| glycine-rich RNA binding protein [Raphanus sativus var. raphanistroides]
Length=153

 Score =   117 bits (294),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 76/133 (57%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            A+VE+RCFVGGLAWAT + +L  AFS +G+V++SK                         
Sbjct  4    ADVEYRCFVGGLAWATDDRALETAFSQYGDVLDSK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     IINDRETGRSRGFGFVTFKDE++M+DAIE MNGQ 
Sbjct  39   -------------------------IINDRETGRSRGFGFVTFKDEKSMRDAIEAMNGQD  73

Query  416  LDGRNITVNEAQS  454
            LDGR+ITVNEAQS
Sbjct  74   LDGRSITVNEAQS  86



>ref|XP_010254826.1| PREDICTED: glycine-rich RNA-binding protein GRP1A-like [Nelumbo 
nucifera]
Length=146

 Score =   117 bits (293),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 76/132 (58%), Gaps = 50/132 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            AE E+RCFVGGLAW+T + SL  AFS++GE+ ESK                         
Sbjct  4    AEFEYRCFVGGLAWSTDDQSLERAFSAYGEIQESK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     II+DRETGRSRGFGFVTF+DEQ+M+DAIEGMNGQ+
Sbjct  39   -------------------------IISDRETGRSRGFGFVTFRDEQSMRDAIEGMNGQN  73

Query  416  LDGRNITVNEAQ  451
            LDGRNITVN+AQ
Sbjct  74   LDGRNITVNQAQ  85



>ref|XP_007131829.1| hypothetical protein PHAVU_011G045000g [Phaseolus vulgaris]
 gb|ESW03823.1| hypothetical protein PHAVU_011G045000g [Phaseolus vulgaris]
Length=174

 Score =   118 bits (295),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 74/133 (56%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            A+VEFRCFVGGLAWAT   +L  AFS +G V+ESK                         
Sbjct  4    ADVEFRCFVGGLAWATDGEALEKAFSKYGPVLESK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     IINDRETGRSRGFGFVTF  EQAM++AIEGMNGQ+
Sbjct  39   -------------------------IINDRETGRSRGFGFVTFSSEQAMREAIEGMNGQN  73

Query  416  LDGRNITVNEAQS  454
            LDGRNITVNEAQS
Sbjct  74   LDGRNITVNEAQS  86



>gb|AGU36625.1| Gly-rich RNA binding protein, partial [Helianthus annuus]
 gb|AGU36626.1| Gly-rich RNA binding protein, partial [Helianthus annuus]
 gb|AGU36627.1| Gly-rich RNA binding protein, partial [Helianthus annuus]
 gb|AGU36628.1| Gly-rich RNA binding protein, partial [Helianthus annuus]
 gb|AGU36629.1| Gly-rich RNA binding protein, partial [Helianthus annuus]
 gb|AGU36630.1| Gly-rich RNA binding protein, partial [Helianthus annuus]
 gb|AGU36631.1| Gly-rich RNA binding protein, partial [Helianthus annuus]
 gb|AGU36632.1| Gly-rich RNA binding protein, partial [Helianthus annuus]
 gb|AGU36633.1| Gly-rich RNA binding protein, partial [Helianthus annuus]
 gb|AGU36635.1| Gly-rich RNA binding protein, partial [Helianthus annuus]
 gb|AGU36638.1| Gly-rich RNA binding protein, partial [Helianthus annuus]
 gb|AGU36639.1| Gly-rich RNA binding protein, partial [Helianthus annuus]
 gb|AGU36640.1| Gly-rich RNA binding protein, partial [Helianthus annuus]
 gb|AGU36641.1| Gly-rich RNA binding protein, partial [Helianthus annuus]
 gb|AGU36642.1| Gly-rich RNA binding protein, partial [Helianthus annuus]
 gb|AGU36643.1| Gly-rich RNA binding protein, partial [Helianthus annuus]
 gb|AGU36644.1| Gly-rich RNA binding protein, partial [Helianthus petiolaris]
Length=120

 Score =   116 bits (291),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 65/126 (52%), Positives = 72/126 (57%), Gaps = 50/126 (40%)
 Frame = +2

Query  77   FVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcyyyyvtlI  256
            FVGGLAWATT+ SL DAF  +GEV++SK                                
Sbjct  1    FVGGLAWATTDRSLEDAFRQYGEVLDSK--------------------------------  28

Query  257  ycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQSLDGRNIT  436
                              IINDRETGRSRGFGFVTFKDEQ+++DAIEGMNGQSLDGRNIT
Sbjct  29   ------------------IINDRETGRSRGFGFVTFKDEQSLRDAIEGMNGQSLDGRNIT  70

Query  437  VNEAQS  454
            VNEAQS
Sbjct  71   VNEAQS  76



>ref|XP_009117375.1| PREDICTED: glycine-rich RNA-binding protein GRP1A isoform X1 
[Brassica rapa]
 emb|CDY70933.1| BnaAnng35580D [Brassica napus]
Length=168

 Score =   118 bits (295),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 75/132 (57%), Gaps = 50/132 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
             +VE+RCFVGGLAWAT + +L  AFS FG+V++SK                         
Sbjct  4    PDVEYRCFVGGLAWATDDRALETAFSQFGDVLDSK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     IINDRETGRSRGFGFVTFKDE++MKDAIEGMNGQ 
Sbjct  39   -------------------------IINDRETGRSRGFGFVTFKDEKSMKDAIEGMNGQD  73

Query  416  LDGRNITVNEAQ  451
            LDGR+ITVNEAQ
Sbjct  74   LDGRSITVNEAQ  85



>gb|KJB32509.1| hypothetical protein B456_005G243900 [Gossypium raimondii]
Length=150

 Score =   117 bits (293),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 62/133 (47%), Positives = 78/133 (59%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            A+VE++CFVGGLAW   + +L +AFS++GE+++SK                         
Sbjct  4    ADVEYQCFVGGLAWTINDRALEEAFSAYGEIVDSK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     IINDRETGRSRGFGFVTF+DE++M+DAIEGMNG+S
Sbjct  39   -------------------------IINDRETGRSRGFGFVTFRDEKSMRDAIEGMNGRS  73

Query  416  LDGRNITVNEAQS  454
            LDGRNITVNEAQS
Sbjct  74   LDGRNITVNEAQS  86



>gb|AGU36636.1| Gly-rich RNA binding protein, partial [Helianthus annuus]
Length=122

 Score =   116 bits (291),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 65/126 (52%), Positives = 72/126 (57%), Gaps = 50/126 (40%)
 Frame = +2

Query  77   FVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcyyyyvtlI  256
            FVGGLAWATT+ SL DAF  +GEV++SK                                
Sbjct  1    FVGGLAWATTDRSLEDAFRQYGEVLDSK--------------------------------  28

Query  257  ycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQSLDGRNIT  436
                              IINDRETGRSRGFGFVTFKDEQ+++DAIEGMNGQSLDGRNIT
Sbjct  29   ------------------IINDRETGRSRGFGFVTFKDEQSLRDAIEGMNGQSLDGRNIT  70

Query  437  VNEAQS  454
            VNEAQS
Sbjct  71   VNEAQS  76



>gb|KEH30440.1| RNA-binding (RRM/RBD/RNP motif) family protein [Medicago truncatula]
Length=128

 Score =   116 bits (291),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 63/134 (47%), Positives = 74/134 (55%), Gaps = 50/134 (37%)
 Frame = +2

Query  53   MAEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slc  232
            MA+VE+RCFVGGLAWAT   +L  AFS +GE+++SK                        
Sbjct  1    MADVEYRCFVGGLAWATDNEALEKAFSQYGEIVDSK------------------------  36

Query  233  yyyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQ  412
                                      IINDRETGRSRGFGFVTF +E++M DAIE MNGQ
Sbjct  37   --------------------------IINDRETGRSRGFGFVTFANEKSMNDAIEAMNGQ  70

Query  413  SLDGRNITVNEAQS  454
             LDGRNITVN+AQS
Sbjct  71   DLDGRNITVNQAQS  84



>ref|XP_010548055.1| PREDICTED: glycine-rich RNA-binding protein GRP2A-like [Tarenaya 
hassleriana]
Length=160

 Score =   117 bits (294),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 66/133 (50%), Positives = 75/133 (56%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            AEVE+RCFVGGLAWAT + SL  AFS FGEV++SKV                        
Sbjct  4    AEVEYRCFVGGLAWATDDQSLERAFSQFGEVVDSKV------------------------  39

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                      INDRETGRS+GFGFVTFKDE +MK AIEGMNGQ 
Sbjct  40   --------------------------INDRETGRSKGFGFVTFKDEDSMKAAIEGMNGQE  73

Query  416  LDGRNITVNEAQS  454
            LDGR++TVNEAQ+
Sbjct  74   LDGRSVTVNEAQA  86



>gb|AGU36634.1| Gly-rich RNA binding protein, partial [Helianthus annuus]
 gb|AGU36637.1| Gly-rich RNA binding protein, partial [Helianthus annuus]
Length=123

 Score =   116 bits (291),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 65/126 (52%), Positives = 72/126 (57%), Gaps = 50/126 (40%)
 Frame = +2

Query  77   FVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcyyyyvtlI  256
            FVGGLAWATT+ SL DAF  +GEV++SK                                
Sbjct  1    FVGGLAWATTDRSLEDAFRQYGEVLDSK--------------------------------  28

Query  257  ycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQSLDGRNIT  436
                              IINDRETGRSRGFGFVTFKDEQ+++DAIEGMNGQSLDGRNIT
Sbjct  29   ------------------IINDRETGRSRGFGFVTFKDEQSLRDAIEGMNGQSLDGRNIT  70

Query  437  VNEAQS  454
            VNEAQS
Sbjct  71   VNEAQS  76



>ref|XP_009412272.1| PREDICTED: glycine-rich RNA-binding protein GRP1A-like [Musa 
acuminata subsp. malaccensis]
Length=176

 Score =   118 bits (295),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 66/133 (50%), Positives = 77/133 (58%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            ++ EFRCFVGGLAWAT ++SL  AFS FGE+IESK                         
Sbjct  4    SDSEFRCFVGGLAWATDDASLERAFSPFGEIIESK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     IIND+ETGRSRGFGFVTF+DEQ+M+DAIEGMNGQ 
Sbjct  39   -------------------------IINDKETGRSRGFGFVTFRDEQSMRDAIEGMNGQI  73

Query  416  LDGRNITVNEAQS  454
            LDGR+ITVNEAQ+
Sbjct  74   LDGRSITVNEAQA  86



>gb|EEC75898.1| hypothetical protein OsI_12955 [Oryza sativa Indica Group]
Length=139

 Score =   117 bits (292),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 75/132 (57%), Gaps = 50/132 (38%)
 Frame = +2

Query  59   EVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcyy  238
            +VE+RCFVGGLAWAT + SL  AFS++GE+++SK                          
Sbjct  5    DVEYRCFVGGLAWATDDRSLEAAFSTYGEILDSK--------------------------  38

Query  239  yyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQSL  418
                                    IINDRETGRSRGFGFVTF  EQ+M+DAIEGMNG+ L
Sbjct  39   ------------------------IINDRETGRSRGFGFVTFSSEQSMRDAIEGMNGKEL  74

Query  419  DGRNITVNEAQS  454
            DGRNITVNEAQS
Sbjct  75   DGRNITVNEAQS  86



>gb|AAB66885.1| glycine-rich protein [Oryza sativa Japonica Group]
Length=161

 Score =   117 bits (294),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 74/132 (56%), Gaps = 50/132 (38%)
 Frame = +2

Query  59   EVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcyy  238
            +V++RCFVGGLAWAT   SL  AFS++GE++ESK                          
Sbjct  5    DVDYRCFVGGLAWATDNRSLEAAFSTYGEILESK--------------------------  38

Query  239  yyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQSL  418
                                    IINDRETGRSRGFGFVTF  EQAM+DAIEGMNG+ L
Sbjct  39   ------------------------IINDRETGRSRGFGFVTFSSEQAMRDAIEGMNGKEL  74

Query  419  DGRNITVNEAQS  454
            DGRNITVNEAQS
Sbjct  75   DGRNITVNEAQS  86



>gb|AAC61786.1| glycine-rich RNA-binding protein [Euphorbia esula]
Length=164

 Score =   117 bits (294),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 62/132 (47%), Positives = 76/132 (58%), Gaps = 50/132 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            A++E+RCFVGGLAWATT+ SL +AFS +GE+++SK                         
Sbjct  3    ADIEYRCFVGGLAWATTDQSLQEAFSPYGEILDSK-------------------------  37

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     IINDRETGRSRGFGFVTF +E++M+DAI+GMN Q 
Sbjct  38   -------------------------IINDRETGRSRGFGFVTFNNEKSMRDAIQGMNSQE  72

Query  416  LDGRNITVNEAQ  451
            LDGRNITVNEAQ
Sbjct  73   LDGRNITVNEAQ  84



>gb|AAB65412.1| glycine-rich protein [Oryza sativa Indica Group]
Length=161

 Score =   117 bits (293),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 65/131 (50%), Positives = 74/131 (56%), Gaps = 50/131 (38%)
 Frame = +2

Query  59   EVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcyy  238
            +VE+RCFVGGLAWAT + SL  AFS++GE++ESK                          
Sbjct  5    DVEYRCFVGGLAWATDDRSLEAAFSTYGEILESK--------------------------  38

Query  239  yyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQSL  418
                                    IINDRETGRSRGFGFVTF  EQAM+DAIEGMNG+ L
Sbjct  39   ------------------------IINDRETGRSRGFGFVTFSSEQAMRDAIEGMNGKEL  74

Query  419  DGRNITVNEAQ  451
            DGRNITVNEAQ
Sbjct  75   DGRNITVNEAQ  85



>ref|XP_004248717.1| PREDICTED: glycine-rich RNA-binding protein-like [Solanum lycopersicum]
Length=163

 Score =   117 bits (293),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 76/133 (57%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            AEVE+RCFVGGLAWAT + +L +AFS +G V++SK                         
Sbjct  3    AEVEYRCFVGGLAWATNDRTLGEAFSQYGNVVDSK-------------------------  37

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     IINDRETGRSRGFGFVTF DE++M++AIE MNGQ+
Sbjct  38   -------------------------IINDRETGRSRGFGFVTFTDEKSMRNAIEAMNGQN  72

Query  416  LDGRNITVNEAQS  454
            LDGRNITVNEAQS
Sbjct  73   LDGRNITVNEAQS  85



>dbj|BAK07102.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=104

 Score =   115 bits (289),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/134 (48%), Positives = 74/134 (55%), Gaps = 50/134 (37%)
 Frame = +2

Query  53   MAEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slc  232
            MA+VE+RCFVGGLAWAT + SL +AFS +G+VI+SK                        
Sbjct  1    MADVEYRCFVGGLAWATDDQSLQNAFSKYGDVIDSK------------------------  36

Query  233  yyyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQ  412
                                      II DRETGRSRGFGFVTF  ++AM+ AIE MNGQ
Sbjct  37   --------------------------IITDRETGRSRGFGFVTFASDEAMRQAIEAMNGQ  70

Query  413  SLDGRNITVNEAQS  454
             LDGRNITVNEAQS
Sbjct  71   DLDGRNITVNEAQS  84



>ref|XP_010416924.1| PREDICTED: glycine-rich RNA-binding protein 7-like isoform X1 
[Camelina sativa]
Length=173

 Score =   117 bits (294),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 76/133 (57%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            ++VE+RCFVGGLAWAT + +L  AFS +G+V++SK                         
Sbjct  4    SDVEYRCFVGGLAWATDDRALETAFSQYGDVVDSK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     IINDRETGRSRGFGFVTFKDE++MKDAIE MNGQ 
Sbjct  39   -------------------------IINDRETGRSRGFGFVTFKDEKSMKDAIEAMNGQE  73

Query  416  LDGRNITVNEAQS  454
            LDGR+ITVNEAQS
Sbjct  74   LDGRSITVNEAQS  86



>emb|CDY59763.1| BnaC08g49360D [Brassica napus]
Length=167

 Score =   117 bits (294),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 75/132 (57%), Gaps = 50/132 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
             +VE+RCFVGGLAWAT + +L  AFS +G+V++SK                         
Sbjct  4    PDVEYRCFVGGLAWATDDRALETAFSQYGDVLDSK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     IINDRETGRSRGFGFVTFKDE++MKDAIEGMNGQ 
Sbjct  39   -------------------------IINDRETGRSRGFGFVTFKDEKSMKDAIEGMNGQD  73

Query  416  LDGRNITVNEAQ  451
            LDGR+ITVNEAQ
Sbjct  74   LDGRSITVNEAQ  85



>gb|KJB32510.1| hypothetical protein B456_005G243900 [Gossypium raimondii]
Length=121

 Score =   115 bits (289),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/132 (46%), Positives = 77/132 (58%), Gaps = 50/132 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            A+VE++CFVGGLAW   + +L +AFS++GE+++SK                         
Sbjct  4    ADVEYQCFVGGLAWTINDRALEEAFSAYGEIVDSK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     IINDRETGRSRGFGFVTF+DE++M+DAIEGMNG+S
Sbjct  39   -------------------------IINDRETGRSRGFGFVTFRDEKSMRDAIEGMNGRS  73

Query  416  LDGRNITVNEAQ  451
            LDGRNITVNEAQ
Sbjct  74   LDGRNITVNEAQ  85



>ref|XP_010446462.1| PREDICTED: glycine-rich RNA-binding protein 8-like [Camelina 
sativa]
Length=170

 Score =   117 bits (293),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/133 (50%), Positives = 73/133 (55%), Gaps = 50/133 (38%)
 Frame = +2

Query  53   MAEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slc  232
            MAEVE+RCFVGGLAWAT +  L   F  FGEVI+SK                        
Sbjct  1    MAEVEYRCFVGGLAWATGDQDLQRTFEQFGEVIDSK------------------------  36

Query  233  yyyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQ  412
                                      IINDRETGRSRGFGFVTFKDE++M+DAIE MNG+
Sbjct  37   --------------------------IINDRETGRSRGFGFVTFKDEKSMRDAIEEMNGK  70

Query  413  SLDGRNITVNEAQ  451
             LDGRNITVNEAQ
Sbjct  71   ELDGRNITVNEAQ  83



>gb|AGW47685.1| glycine-rich RNA-binding protein 8 splice variant 6 [Arabidopsis 
thaliana]
Length=121

 Score =   115 bits (289),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 65/134 (49%), Positives = 74/134 (55%), Gaps = 50/134 (37%)
 Frame = +2

Query  53   MAEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slc  232
            M+EVE+RCFVGGLAWAT +  L   FS FG+VI+SK                        
Sbjct  1    MSEVEYRCFVGGLAWATNDEDLQRTFSQFGDVIDSK------------------------  36

Query  233  yyyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQ  412
                                      IINDRE+GRSRGFGFVTFKDE+AM+DAIE MNG+
Sbjct  37   --------------------------IINDRESGRSRGFGFVTFKDEKAMRDAIEEMNGK  70

Query  413  SLDGRNITVNEAQS  454
             LDGR ITVNEAQS
Sbjct  71   ELDGRVITVNEAQS  84



>ref|XP_009794537.1| PREDICTED: glycine-rich RNA-binding protein GRP1A-like [Nicotiana 
sylvestris]
Length=146

 Score =   116 bits (290),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 63/136 (46%), Positives = 75/136 (55%), Gaps = 50/136 (37%)
 Frame = +2

Query  47   SVMAEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*s  226
             V A+VE+ CF+GGL WATT+ +L D F ++GEV++SK                      
Sbjct  48   KVAAKVEYSCFIGGLTWATTDRTLADTFGTYGEVLDSK----------------------  85

Query  227  lcyyyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMN  406
                                        IINDRETGRSRGFGFVTFKDE+ M+DAIEGMN
Sbjct  86   ----------------------------IINDRETGRSRGFGFVTFKDEKCMRDAIEGMN  117

Query  407  GQSLDGRNITVNEAQS  454
            GQ LD RNITVNEAQ+
Sbjct  118  GQELDDRNITVNEAQA  133



>ref|XP_004507451.1| PREDICTED: glycine-rich RNA-binding, abscisic acid-inducible 
protein-like [Cicer arietinum]
Length=155

 Score =   116 bits (291),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 62/133 (47%), Positives = 75/133 (56%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            A+VE+RCFVGGLAWAT   +L  AFS +GE+++SK                         
Sbjct  4    ADVEYRCFVGGLAWATDSDALEKAFSQYGEIVDSK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     IINDRETGRSRGFGFVTF +E++M+DAIEGMNGQ 
Sbjct  39   -------------------------IINDRETGRSRGFGFVTFANEKSMRDAIEGMNGQD  73

Query  416  LDGRNITVNEAQS  454
            +DGRNITVNEAQ+
Sbjct  74   MDGRNITVNEAQN  86



>sp|Q05966.1|GRP10_BRANA RecName: Full=Glycine-rich RNA-binding protein 10 [Brassica napus]
 emb|CAA78513.1| glycine-rich RNA binding protein [Brassica napus]
Length=169

 Score =   117 bits (292),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 66/134 (49%), Positives = 75/134 (56%), Gaps = 50/134 (37%)
 Frame = +2

Query  53   MAEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slc  232
            M+EVE+RCFVGGLAWAT ++ L   FS FGEVI+SK                        
Sbjct  1    MSEVEYRCFVGGLAWATGDAELERTFSQFGEVIDSK------------------------  36

Query  233  yyyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQ  412
                                      IINDRETGRSRGFGFVTFKDE++MKDAI+ MNG+
Sbjct  37   --------------------------IINDRETGRSRGFGFVTFKDEKSMKDAIDEMNGK  70

Query  413  SLDGRNITVNEAQS  454
             LDGR ITVNEAQS
Sbjct  71   ELDGRTITVNEAQS  84



>ref|XP_004963286.1| PREDICTED: glycine-rich RNA-binding protein 2-like [Setaria italica]
Length=163

 Score =   116 bits (291),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 66/133 (50%), Positives = 76/133 (57%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            ++VE+RCFVGGLAWAT ++SLH+AFS FGEV+ESK                         
Sbjct  4    SDVEYRCFVGGLAWATDDNSLHNAFSPFGEVLESK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     II DRET RSRGFGFVTF  EQAM+DAIEGMNG+ 
Sbjct  39   -------------------------IILDRETQRSRGFGFVTFASEQAMRDAIEGMNGKD  73

Query  416  LDGRNITVNEAQS  454
            LDGR+ITVNEAQS
Sbjct  74   LDGRSITVNEAQS  86



>ref|XP_009411337.1| PREDICTED: glycine-rich RNA-binding protein GRP1A-like [Musa 
acuminata subsp. malaccensis]
Length=155

 Score =   116 bits (290),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 63/133 (47%), Positives = 78/133 (59%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            ++VE+RCFVGGLAW+T + SL  AFS++GE+++SK                         
Sbjct  4    SDVEYRCFVGGLAWSTDDVSLERAFSAYGEIVDSK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     IINDRETGRSRGFGFVTF+DEQ+M+DAIEGMNGQ 
Sbjct  39   -------------------------IINDRETGRSRGFGFVTFRDEQSMRDAIEGMNGQI  73

Query  416  LDGRNITVNEAQS  454
            LDGR+ITVNEAQ+
Sbjct  74   LDGRSITVNEAQN  86



>ref|XP_010416925.1| PREDICTED: glycine-rich RNA-binding protein 7-like isoform X2 
[Camelina sativa]
Length=163

 Score =   116 bits (290),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 63/132 (48%), Positives = 75/132 (57%), Gaps = 50/132 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            ++VE+RCFVGGLAWAT + +L  AFS +G+V++SK                         
Sbjct  4    SDVEYRCFVGGLAWATDDRALETAFSQYGDVVDSK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     IINDRETGRSRGFGFVTFKDE++MKDAIE MNGQ 
Sbjct  39   -------------------------IINDRETGRSRGFGFVTFKDEKSMKDAIEAMNGQE  73

Query  416  LDGRNITVNEAQ  451
            LDGR+ITVNEAQ
Sbjct  74   LDGRSITVNEAQ  85



>gb|AAC61787.1| glycine-rich RNA-binding protein [Euphorbia esula]
Length=165

 Score =   116 bits (290),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 61/132 (46%), Positives = 75/132 (57%), Gaps = 50/132 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            A++E+RCFVGGLAWATT+ SL +AFS +GE+++SK                         
Sbjct  3    ADIEYRCFVGGLAWATTDQSLQEAFSPYGEILDSK-------------------------  37

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     IINDRETGRSRGFGFVTF +E++M+DAI+GMN Q 
Sbjct  38   -------------------------IINDRETGRSRGFGFVTFNNEKSMRDAIQGMNSQE  72

Query  416  LDGRNITVNEAQ  451
            LDGRN TVNEAQ
Sbjct  73   LDGRNTTVNEAQ  84



>ref|NP_849524.1| glycine-rich RNA-binding protein 8 [Arabidopsis thaliana]
 gb|AEE87046.1| glycine-rich RNA-binding protein 8 [Arabidopsis thaliana]
Length=92

 Score =   114 bits (285),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 65/134 (49%), Positives = 74/134 (55%), Gaps = 50/134 (37%)
 Frame = +2

Query  53   MAEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slc  232
            M+EVE+RCFVGGLAWAT +  L   FS FG+VI+SK                        
Sbjct  1    MSEVEYRCFVGGLAWATNDEDLQRTFSQFGDVIDSK------------------------  36

Query  233  yyyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQ  412
                                      IINDRE+GRSRGFGFVTFKDE+AM+DAIE MNG+
Sbjct  37   --------------------------IINDRESGRSRGFGFVTFKDEKAMRDAIEEMNGK  70

Query  413  SLDGRNITVNEAQS  454
             LDGR ITVNEAQS
Sbjct  71   ELDGRVITVNEAQS  84



>gb|ACN25391.1| unknown [Zea mays]
Length=120

 Score =   114 bits (286),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 76/133 (57%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            ++VE+RCFVGGLAWAT + SLH+AFS++GEV+ESK                         
Sbjct  4    SDVEYRCFVGGLAWATDDHSLHNAFSTYGEVLESK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     II DRET RSRGFGFVTF  E+AM++AIEGMNG+ 
Sbjct  39   -------------------------IILDRETQRSRGFGFVTFSTEEAMRNAIEGMNGKE  73

Query  416  LDGRNITVNEAQS  454
            LDGRNITVNEAQS
Sbjct  74   LDGRNITVNEAQS  86



>dbj|BAE92287.1| putative glycine-rich RNA binding protein [Cryptomeria japonica]
Length=181

 Score =   116 bits (291),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 63/133 (47%), Positives = 77/133 (58%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            A+VEFRCFVGGL+W+T + SL DAF++FGEV++SKV                        
Sbjct  4    ADVEFRCFVGGLSWSTDDRSLKDAFTAFGEVMDSKV------------------------  39

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                      ++DRETGRSRGFGFVTF DEQ+M+DAIEGMNG+ 
Sbjct  40   --------------------------VSDRETGRSRGFGFVTFMDEQSMRDAIEGMNGRD  73

Query  416  LDGRNITVNEAQS  454
            LDGRNITVN AQ+
Sbjct  74   LDGRNITVNRAQA  86



>ref|XP_010088923.1| Glycine-rich RNA-binding protein 7 [Morus notabilis]
 gb|EXB37127.1| Glycine-rich RNA-binding protein 7 [Morus notabilis]
Length=183

 Score =   116 bits (291),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 76/135 (56%), Gaps = 50/135 (37%)
 Frame = +2

Query  47   SVMAEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*s  226
            S + +VEFRCFVGGLAWAT   SL +AF+ +GE++ESK                      
Sbjct  16   SSLLQVEFRCFVGGLAWATDSQSLENAFAPYGEILESK----------------------  53

Query  227  lcyyyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMN  406
                                        IINDRETGRSRGFGFVTF +E+AM+DAIE MN
Sbjct  54   ----------------------------IINDRETGRSRGFGFVTFSNEKAMRDAIEAMN  85

Query  407  GQSLDGRNITVNEAQ  451
            GQ+LDGR+ITVNEAQ
Sbjct  86   GQNLDGRSITVNEAQ  100



>ref|XP_006349600.1| PREDICTED: glycine-rich RNA-binding protein-like [Solanum tuberosum]
 ref|XP_006349601.1| PREDICTED: glycine-rich RNA-binding protein-like [Solanum tuberosum]
 ref|XP_006349602.1| PREDICTED: glycine-rich RNA-binding protein 1-like isoform X1 
[Solanum tuberosum]
 ref|XP_006368094.1| PREDICTED: glycine-rich RNA-binding protein-like [Solanum tuberosum]
Length=166

 Score =   115 bits (289),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 63/132 (48%), Positives = 75/132 (57%), Gaps = 50/132 (38%)
 Frame = +2

Query  59   EVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcyy  238
            EVE+RCFVGGLAWAT + +L +AFS +G V++SK                          
Sbjct  4    EVEYRCFVGGLAWATNDRTLGEAFSQYGNVVDSK--------------------------  37

Query  239  yyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQSL  418
                                    IINDRETGRSRGFGFVTF DE++M++AIE MNGQ+L
Sbjct  38   ------------------------IINDRETGRSRGFGFVTFTDEKSMRNAIEAMNGQNL  73

Query  419  DGRNITVNEAQS  454
            DGRNITVNEAQS
Sbjct  74   DGRNITVNEAQS  85



>ref|XP_009802591.1| PREDICTED: glycine-rich RNA-binding protein-like [Nicotiana sylvestris]
Length=108

 Score =   114 bits (285),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 75/135 (56%), Gaps = 50/135 (37%)
 Frame = +2

Query  50   VMAEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*sl  229
            + AEVE+ CFV GLAWATT+ +L DAF ++GEV++SK                       
Sbjct  1    MAAEVEYSCFVCGLAWATTDRTLADAFGTYGEVLDSK-----------------------  37

Query  230  cyyyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNG  409
                                       IINDRETGRSRGFGFVTFKDE+ M+DAIE MNG
Sbjct  38   ---------------------------IINDRETGRSRGFGFVTFKDEKCMRDAIERMNG  70

Query  410  QSLDGRNITVNEAQS  454
            Q LD RNITVNEAQ+
Sbjct  71   QELDDRNITVNEAQA  85



>ref|XP_003537883.2| PREDICTED: glycine-rich RNA-binding protein GRP1A-like [Glycine 
max]
Length=143

 Score =   115 bits (287),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 72/132 (55%), Gaps = 50/132 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            A VE+RCFVGGLAWAT + +L  AFS +G ++ESK                         
Sbjct  7    AYVEYRCFVGGLAWATDDHALEKAFSHYGNIVESK-------------------------  41

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     IINDRETGRSRGFGFVTF  E +MKDAIEGMNGQ+
Sbjct  42   -------------------------IINDRETGRSRGFGFVTFASENSMKDAIEGMNGQN  76

Query  416  LDGRNITVNEAQ  451
            LDGRNITVNEAQ
Sbjct  77   LDGRNITVNEAQ  88



>gb|ABF98117.1| retrotransposon protein, putative, Ty1-copia subclass, expressed 
[Oryza sativa Japonica Group]
Length=153

 Score =   115 bits (288),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 63/131 (48%), Positives = 74/131 (56%), Gaps = 50/131 (38%)
 Frame = +2

Query  59   EVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcyy  238
            +VE+RCFVGGLAWAT + SL  AFS++GE+++SK                          
Sbjct  5    DVEYRCFVGGLAWATDDRSLEAAFSTYGEILDSK--------------------------  38

Query  239  yyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQSL  418
                                    IINDRETGRSRGFGFVTF  EQ+M+DAIEGMNG+ L
Sbjct  39   ------------------------IINDRETGRSRGFGFVTFSSEQSMRDAIEGMNGKEL  74

Query  419  DGRNITVNEAQ  451
            DGRNITVNEAQ
Sbjct  75   DGRNITVNEAQ  85



>gb|AGU36624.1| Gly-rich RNA binding protein, partial [Helianthus annuus]
Length=122

 Score =   114 bits (285),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 71/126 (56%), Gaps = 50/126 (40%)
 Frame = +2

Query  77   FVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcyyyyvtlI  256
            FV GLAWATT+ SL DAF  +GEV++SK                                
Sbjct  1    FVSGLAWATTDRSLEDAFRQYGEVLDSK--------------------------------  28

Query  257  ycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQSLDGRNIT  436
                              IINDRETGRSRGFGFVTFKDEQ+++DAIEGMNGQSLDGRNIT
Sbjct  29   ------------------IINDRETGRSRGFGFVTFKDEQSLRDAIEGMNGQSLDGRNIT  70

Query  437  VNEAQS  454
            VNEAQS
Sbjct  71   VNEAQS  76



>gb|KHN39785.1| Glycine-rich RNA-binding protein GRP1A [Glycine soja]
Length=156

 Score =   115 bits (287),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 72/132 (55%), Gaps = 50/132 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            A+VE+RCFVGGLAWAT    L  AFS +G+V+ESK                         
Sbjct  4    ADVEYRCFVGGLAWATDNYDLEKAFSQYGDVVESK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     IINDRETGRSRGFGFVTF  E +M+DAIEGMNGQ+
Sbjct  39   -------------------------IINDRETGRSRGFGFVTFASEDSMRDAIEGMNGQN  73

Query  416  LDGRNITVNEAQ  451
            LDGRNITVNEAQ
Sbjct  74   LDGRNITVNEAQ  85



>gb|AAT85299.1| glycine-rich RNA-binding protein, putative [Oryza sativa Japonica 
Group]
 gb|ABF98115.1| retrotransposon protein, putative, Ty1-copia subclass, expressed 
[Oryza sativa Japonica Group]
 gb|ABS83497.1| receptor-like serine threonine kinase [Oryza sativa Japonica 
Group]
 gb|ACA50485.1| glycine-rich RNA binding protein [Oryza sativa Japonica Group]
 dbj|BAG91726.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|ADM86846.1| glycine-rich RNA binding protein [Oryza sativa Japonica Group]
Length=162

 Score =   115 bits (288),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 63/131 (48%), Positives = 74/131 (56%), Gaps = 50/131 (38%)
 Frame = +2

Query  59   EVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcyy  238
            +VE+RCFVGGLAWAT + SL  AFS++GE+++SK                          
Sbjct  5    DVEYRCFVGGLAWATDDRSLEAAFSTYGEILDSK--------------------------  38

Query  239  yyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQSL  418
                                    IINDRETGRSRGFGFVTF  EQ+M+DAIEGMNG+ L
Sbjct  39   ------------------------IINDRETGRSRGFGFVTFSSEQSMRDAIEGMNGKEL  74

Query  419  DGRNITVNEAQ  451
            DGRNITVNEAQ
Sbjct  75   DGRNITVNEAQ  85



>emb|CDY42616.1| BnaC01g00280D [Brassica napus]
Length=157

 Score =   115 bits (287),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 74/133 (56%), Gaps = 50/133 (38%)
 Frame = +2

Query  53   MAEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slc  232
            M+EVE+RCFVGGLAWAT ++ L   FS FGEVI+SK                        
Sbjct  1    MSEVEYRCFVGGLAWATGDAELERTFSQFGEVIDSK------------------------  36

Query  233  yyyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQ  412
                                      IINDRETGRSRGFGFVTFKDE++MKDAI+ MNG+
Sbjct  37   --------------------------IINDRETGRSRGFGFVTFKDEKSMKDAIDEMNGK  70

Query  413  SLDGRNITVNEAQ  451
             LDGR ITVNEAQ
Sbjct  71   ELDGRTITVNEAQ  83



>ref|NP_001235801.1| uncharacterized protein LOC100305467 [Glycine max]
 gb|ACU13140.1| unknown [Glycine max]
Length=156

 Score =   115 bits (287),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 72/132 (55%), Gaps = 50/132 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            A+VE+RCFVGGLAWAT    L  AFS +G+V+ESK                         
Sbjct  4    ADVEYRCFVGGLAWATDNYDLEKAFSQYGDVVESK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     IINDRETGRSRGFGFVTF  E +M+DAIEGMNGQ+
Sbjct  39   -------------------------IINDRETGRSRGFGFVTFASEDSMRDAIEGMNGQN  73

Query  416  LDGRNITVNEAQ  451
            LDGRNITVNEAQ
Sbjct  74   LDGRNITVNEAQ  85



>gb|ACL54717.1| unknown [Zea mays]
 tpg|DAA47655.1| TPA: glycine-rich protein1 [Zea mays]
Length=144

 Score =   114 bits (286),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 76/133 (57%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            ++VE+RCFVGGLAWAT + SLH+AFS++GEV+ESK                         
Sbjct  4    SDVEYRCFVGGLAWATDDHSLHNAFSTYGEVLESK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     II DRET RSRGFGFVTF  E+AM++AIEGMNG+ 
Sbjct  39   -------------------------IILDRETQRSRGFGFVTFSTEEAMRNAIEGMNGKE  73

Query  416  LDGRNITVNEAQS  454
            LDGRNITVNEAQS
Sbjct  74   LDGRNITVNEAQS  86



>gb|AAB63589.1| glycine-rich RNA-binding protein [Oryza sativa Indica Group]
Length=165

 Score =   115 bits (288),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 74/132 (56%), Gaps = 50/132 (38%)
 Frame = +2

Query  59   EVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcyy  238
            +V++RCFVGGLAWAT   SL  AFS++GE++ESK                          
Sbjct  5    DVDYRCFVGGLAWATDNRSLEAAFSTYGEILESK--------------------------  38

Query  239  yyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQSL  418
                                    IINDRETGRSRGFGFVTF  EQAM+DAIEGM+G+ L
Sbjct  39   ------------------------IINDRETGRSRGFGFVTFSSEQAMRDAIEGMSGKEL  74

Query  419  DGRNITVNEAQS  454
            DGRNITVNEAQS
Sbjct  75   DGRNITVNEAQS  86



>gb|ACR36732.1| unknown [Zea mays]
Length=149

 Score =   114 bits (286),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 76/133 (57%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            ++VE+RCFVGGLAWAT + SLH+AFS++GEV+ESK                         
Sbjct  4    SDVEYRCFVGGLAWATDDHSLHNAFSTYGEVLESK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     II DRET RSRGFGFVTF  E+AM++AIEGMNG+ 
Sbjct  39   -------------------------IILDRETQRSRGFGFVTFSTEEAMRNAIEGMNGKE  73

Query  416  LDGRNITVNEAQS  454
            LDGRNITVNEAQS
Sbjct  74   LDGRNITVNEAQS  86



>ref|XP_003606910.1| Glycine-rich RNA binding protein [Medicago truncatula]
 gb|AES89107.1| RNA-binding (RRM/RBD/RNP motif) family protein [Medicago truncatula]
Length=161

 Score =   115 bits (287),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 62/133 (47%), Positives = 73/133 (55%), Gaps = 50/133 (38%)
 Frame = +2

Query  53   MAEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slc  232
            MA+VE+RCFVGGLAWAT   +L  AFS +GE+++SK                        
Sbjct  1    MADVEYRCFVGGLAWATDNEALEKAFSQYGEIVDSK------------------------  36

Query  233  yyyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQ  412
                                      IINDRETGRSRGFGFVTF +E++M DAIE MNGQ
Sbjct  37   --------------------------IINDRETGRSRGFGFVTFANEKSMNDAIEAMNGQ  70

Query  413  SLDGRNITVNEAQ  451
             LDGRNITVN+AQ
Sbjct  71   DLDGRNITVNQAQ  83



>gb|ACG28088.1| glycine-rich RNA-binding protein 2 [Zea mays]
 tpg|DAA47653.1| TPA: glycine-rich protein1 isoform 1 [Zea mays]
 tpg|DAA47654.1| TPA: glycine-rich protein1 isoform 2 [Zea mays]
Length=155

 Score =   114 bits (286),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 76/133 (57%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            ++VE+RCFVGGLAWAT + SLH+AFS++GEV+ESK                         
Sbjct  4    SDVEYRCFVGGLAWATDDHSLHNAFSTYGEVLESK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     II DRET RSRGFGFVTF  E+AM++AIEGMNG+ 
Sbjct  39   -------------------------IILDRETQRSRGFGFVTFSTEEAMRNAIEGMNGKE  73

Query  416  LDGRNITVNEAQS  454
            LDGRNITVNEAQS
Sbjct  74   LDGRNITVNEAQS  86



>gb|ACG26657.1| glycine-rich RNA-binding protein 2 [Zea mays]
 gb|ACG27870.1| glycine-rich RNA-binding protein 2 [Zea mays]
 gb|ACG28116.1| glycine-rich RNA-binding protein 2 [Zea mays]
Length=156

 Score =   114 bits (286),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 76/133 (57%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            ++VE+RCFVGGLAWAT + SLH+AFS++GEV+ESK                         
Sbjct  4    SDVEYRCFVGGLAWATDDHSLHNAFSTYGEVLESK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     II DRET RSRGFGFVTF  E+AM++AIEGMNG+ 
Sbjct  39   -------------------------IILDRETQRSRGFGFVTFSTEEAMRNAIEGMNGKE  73

Query  416  LDGRNITVNEAQS  454
            LDGRNITVNEAQS
Sbjct  74   LDGRNITVNEAQS  86



>gb|AGW47684.1| glycine-rich RNA-binding protein 8 splice variant 5 [Arabidopsis 
thaliana]
Length=119

 Score =   113 bits (283),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 73/133 (55%), Gaps = 50/133 (38%)
 Frame = +2

Query  53   MAEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slc  232
            M+EVE+RCFVGGLAWAT +  L   FS FG+VI+SK                        
Sbjct  1    MSEVEYRCFVGGLAWATNDEDLQRTFSQFGDVIDSK------------------------  36

Query  233  yyyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQ  412
                                      IINDRE+GRSRGFGFVTFKDE+AM+DAIE MNG+
Sbjct  37   --------------------------IINDRESGRSRGFGFVTFKDEKAMRDAIEEMNGK  70

Query  413  SLDGRNITVNEAQ  451
             LDGR ITVNEAQ
Sbjct  71   ELDGRVITVNEAQ  83



>ref|XP_009109892.1| PREDICTED: glycine-rich RNA-binding protein 10 isoform X1 [Brassica 
rapa]
Length=162

 Score =   114 bits (286),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 74/133 (56%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            AEVE+RCFVGGLAWAT ++ L   FS FGEVI+SK                         
Sbjct  3    AEVEYRCFVGGLAWATGDAELERTFSQFGEVIDSK-------------------------  37

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     IINDRETGRSRGFGFVTFKDE++M+DAI+ MNG+ 
Sbjct  38   -------------------------IINDRETGRSRGFGFVTFKDEKSMRDAIDEMNGKE  72

Query  416  LDGRNITVNEAQS  454
            LDGR ITVNEAQS
Sbjct  73   LDGRTITVNEAQS  85



>ref|NP_849523.1| glycine-rich RNA-binding protein 8 [Arabidopsis thaliana]
 gb|AEE87045.1| glycine-rich RNA-binding protein 8 [Arabidopsis thaliana]
Length=126

 Score =   113 bits (283),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 73/133 (55%), Gaps = 50/133 (38%)
 Frame = +2

Query  53   MAEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slc  232
            M+EVE+RCFVGGLAWAT +  L   FS FG+VI+SK                        
Sbjct  1    MSEVEYRCFVGGLAWATNDEDLQRTFSQFGDVIDSK------------------------  36

Query  233  yyyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQ  412
                                      IINDRE+GRSRGFGFVTFKDE+AM+DAIE MNG+
Sbjct  37   --------------------------IINDRESGRSRGFGFVTFKDEKAMRDAIEEMNGK  70

Query  413  SLDGRNITVNEAQ  451
             LDGR ITVNEAQ
Sbjct  71   ELDGRVITVNEAQ  83



>ref|XP_010531568.1| PREDICTED: glycine-rich RNA-binding protein GRP1A-like [Tarenaya 
hassleriana]
Length=148

 Score =   114 bits (285),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 75/132 (57%), Gaps = 50/132 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            +EVE+RCFVGGLAWAT + SL  AFS FGEV++SK                         
Sbjct  4    SEVEYRCFVGGLAWATDDHSLERAFSQFGEVLDSK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     IINDRETGRS+GFGFVTFKDE++M+ AI+GMNGQ 
Sbjct  39   -------------------------IINDRETGRSKGFGFVTFKDEESMRAAIDGMNGQE  73

Query  416  LDGRNITVNEAQ  451
            LDGR+ITVNEAQ
Sbjct  74   LDGRSITVNEAQ  85



>ref|XP_002868897.1| hypothetical protein ARALYDRAFT_490700 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45156.1| hypothetical protein ARALYDRAFT_490700 [Arabidopsis lyrata subsp. 
lyrata]
Length=164

 Score =   114 bits (286),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 73/133 (55%), Gaps = 50/133 (38%)
 Frame = +2

Query  53   MAEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slc  232
            M+EVE+RCFVGGLAWAT +  L   FS FG+V++SK                        
Sbjct  1    MSEVEYRCFVGGLAWATQDHDLERTFSQFGDVLDSK------------------------  36

Query  233  yyyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQ  412
                                      IINDRETGRSRGFGFVTFKDE+AM+DAIE MNG+
Sbjct  37   --------------------------IINDRETGRSRGFGFVTFKDEKAMRDAIEEMNGK  70

Query  413  SLDGRNITVNEAQ  451
             LDGR ITVNEAQ
Sbjct  71   ELDGRTITVNEAQ  83



>ref|NP_001238373.1| glycine-rich RNA-binding protein [Glycine max]
 gb|AAD48471.1|AF169205_1 glycine-rich RNA-binding protein [Glycine max]
Length=160

 Score =   114 bits (285),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 63/132 (48%), Positives = 73/132 (55%), Gaps = 50/132 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            A+VE+RCFVGGLAWAT + +L  AFS +GE++E+K                         
Sbjct  4    ADVEYRCFVGGLAWATDDHALERAFSQYGEIVETK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     IINDRETGRSRGFGFVTF  EQ+MKDAI  MNGQ+
Sbjct  39   -------------------------IINDRETGRSRGFGFVTFASEQSMKDAIGAMNGQN  73

Query  416  LDGRNITVNEAQ  451
            LDGRNITVNEAQ
Sbjct  74   LDGRNITVNEAQ  85



>gb|AAD28176.1|AF109917_1 glycine-rich RNA-binding protein [Picea glauca]
Length=155

 Score =   114 bits (285),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 63/133 (47%), Positives = 75/133 (56%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            A+VEFRCFVGGLAW+T + SL +AFS +GEV+ESK                         
Sbjct  4    ADVEFRCFVGGLAWSTDDRSLQEAFSPYGEVVESK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     II+DRETGRSRGFGFVTF DEQ+M+DAI+ MNG+ 
Sbjct  39   -------------------------IISDRETGRSRGFGFVTFNDEQSMRDAIDAMNGKM  73

Query  416  LDGRNITVNEAQS  454
            LDGR+ITVN AQS
Sbjct  74   LDGRSITVNPAQS  86



>ref|XP_003537882.1| PREDICTED: glycine-rich RNA-binding protein 2-like [Glycine max]
Length=170

 Score =   114 bits (286),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 72/133 (54%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            A+VEFRCFVGGLAW T   +L  AFS +G+++ESKV                        
Sbjct  4    ADVEFRCFVGGLAWVTGNDALEKAFSIYGDIVESKV------------------------  39

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                      INDRETGRSRGFGFVTF  EQ+MKDAI GMNGQ 
Sbjct  40   --------------------------INDRETGRSRGFGFVTFASEQSMKDAIAGMNGQD  73

Query  416  LDGRNITVNEAQS  454
            LDGRNITVNEAQ+
Sbjct  74   LDGRNITVNEAQT  86



>emb|CDY41969.1| BnaA01g05410D [Brassica napus]
Length=128

 Score =   113 bits (282),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 73/132 (55%), Gaps = 50/132 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            AEVE+RCFVGGLAWAT ++ L   FS FGEVI+SK                         
Sbjct  3    AEVEYRCFVGGLAWATGDAELERTFSQFGEVIDSK-------------------------  37

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     IINDRETGRSRGFGFVTFKDE++M+DAI+ MNG+ 
Sbjct  38   -------------------------IINDRETGRSRGFGFVTFKDEKSMRDAIDEMNGKE  72

Query  416  LDGRNITVNEAQ  451
            LDGR ITVNEAQ
Sbjct  73   LDGRTITVNEAQ  84



>ref|XP_004500810.1| PREDICTED: glycine-rich RNA-binding protein 7-like [Cicer arietinum]
Length=189

 Score =   115 bits (287),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 65/134 (49%), Positives = 74/134 (55%), Gaps = 50/134 (37%)
 Frame = +2

Query  53   MAEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slc  232
            MAEVE+RCFVGGLAWAT   +L  AFS FGE++ESKV                       
Sbjct  1    MAEVEYRCFVGGLAWATDSDALGKAFSQFGEIVESKV-----------------------  37

Query  233  yyyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQ  412
                                       I+DRETGRSRGFGFVTF  EQ+M++AIEGMNG 
Sbjct  38   ---------------------------ISDRETGRSRGFGFVTFATEQSMREAIEGMNGM  70

Query  413  SLDGRNITVNEAQS  454
             LDGRNITVNEAQ+
Sbjct  71   DLDGRNITVNEAQN  84



>dbj|BAJ89718.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87529.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88283.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK07523.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK04618.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=161

 Score =   114 bits (285),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 63/133 (47%), Positives = 73/133 (55%), Gaps = 50/133 (38%)
 Frame = +2

Query  53   MAEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slc  232
            MA+VE+RCFVGGLAWAT + SL +AFS +G+VI+SK                        
Sbjct  1    MADVEYRCFVGGLAWATDDQSLQNAFSKYGDVIDSK------------------------  36

Query  233  yyyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQ  412
                                      II DRETGRSRGFGFVTF  ++AM+ AIE MNGQ
Sbjct  37   --------------------------IITDRETGRSRGFGFVTFASDEAMRQAIEAMNGQ  70

Query  413  SLDGRNITVNEAQ  451
             LDGRNITVNEAQ
Sbjct  71   DLDGRNITVNEAQ  83



>gb|AGI04359.1| low temperature-responsive RNA-binding protein [Triticum aestivum]
Length=162

 Score =   114 bits (285),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 63/133 (47%), Positives = 73/133 (55%), Gaps = 50/133 (38%)
 Frame = +2

Query  53   MAEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slc  232
            MA+VE+RCFVGGLAWAT + SL +AFS +G+VI+SK                        
Sbjct  1    MADVEYRCFVGGLAWATDDQSLQNAFSKYGDVIDSK------------------------  36

Query  233  yyyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQ  412
                                      II DRETGRSRGFGFVTF  ++AM+ AIE MNGQ
Sbjct  37   --------------------------IITDRETGRSRGFGFVTFASDEAMRQAIEAMNGQ  70

Query  413  SLDGRNITVNEAQ  451
             LDGRNITVNEAQ
Sbjct  71   DLDGRNITVNEAQ  83



>dbj|BAF30986.1| glycine-rich RNA-binding protein [Triticum aestivum]
Length=163

 Score =   114 bits (285),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 63/133 (47%), Positives = 73/133 (55%), Gaps = 50/133 (38%)
 Frame = +2

Query  53   MAEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slc  232
            MA+VE+RCFVGGLAWAT + SL +AFS +G+VI+SK                        
Sbjct  1    MADVEYRCFVGGLAWATDDQSLQNAFSKYGDVIDSK------------------------  36

Query  233  yyyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQ  412
                                      II DRETGRSRGFGFVTF  ++AM+ AIE MNGQ
Sbjct  37   --------------------------IITDRETGRSRGFGFVTFASDEAMRQAIEAMNGQ  70

Query  413  SLDGRNITVNEAQ  451
             LDGRNITVNEAQ
Sbjct  71   DLDGRNITVNEAQ  83



>gb|ACN31562.1| unknown [Zea mays]
Length=326

 Score =   117 bits (294),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 63/132 (48%), Positives = 75/132 (57%), Gaps = 50/132 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            ++VE+RCFVGGLAWAT + SLH+AFS++GEV+ESK                         
Sbjct  4    SDVEYRCFVGGLAWATDDHSLHNAFSTYGEVLESK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     II DRET RSRGFGFVTF  E+AM++AIEGMNG+ 
Sbjct  39   -------------------------IILDRETQRSRGFGFVTFSTEEAMRNAIEGMNGKE  73

Query  416  LDGRNITVNEAQ  451
            LDGRNITVNEAQ
Sbjct  74   LDGRNITVNEAQ  85



>ref|XP_003522939.1| PREDICTED: glycine-rich RNA-binding protein 7-like [Glycine max]
Length=185

 Score =   114 bits (285),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 63/131 (48%), Positives = 72/131 (55%), Gaps = 50/131 (38%)
 Frame = +2

Query  62   VEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcyyy  241
            +E+RCFVGGLAWAT   +L  AFS +GE++ESKV +                        
Sbjct  6    IEYRCFVGGLAWATDSDALEKAFSHYGEIVESKVII------------------------  41

Query  242  yvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQSLD  421
                                      DRETGRSRGFGFVTF  EQAMKDAIEGMNGQ+LD
Sbjct  42   --------------------------DRETGRSRGFGFVTFASEQAMKDAIEGMNGQNLD  75

Query  422  GRNITVNEAQS  454
            GR+ITVNEAQS
Sbjct  76   GRSITVNEAQS  86



>sp|Q43472.1|GRP_HORVU RecName: Full=Glycine-rich RNA-binding protein blt801; AltName: 
Full=Low temperature-responsive RNA-binding protein [Hordeum 
vulgare]
 gb|AAB07749.1| low temperature-responsive RNA-binding protein [Hordeum vulgare 
subsp. vulgare]
Length=161

 Score =   113 bits (283),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 63/134 (47%), Positives = 73/134 (54%), Gaps = 50/134 (37%)
 Frame = +2

Query  53   MAEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slc  232
            MA+VE+RCFVGGL WAT + SL +AFS +G+VI+SK                        
Sbjct  1    MADVEYRCFVGGLRWATDDQSLQNAFSKYGDVIDSK------------------------  36

Query  233  yyyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQ  412
                                      II DRETGRSRGFGFVTF  ++AM+ AIE MNGQ
Sbjct  37   --------------------------IITDRETGRSRGFGFVTFASDEAMRQAIEAMNGQ  70

Query  413  SLDGRNITVNEAQS  454
             LDGRNITVNEAQS
Sbjct  71   DLDGRNITVNEAQS  84



>ref|XP_009109480.1| PREDICTED: glycine-rich RNA-binding protein 10-like [Brassica 
rapa]
 emb|CDX90323.1| BnaA08g16610D [Brassica napus]
Length=165

 Score =   113 bits (283),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 72/133 (54%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
             E E+RCFVGGLAWAT ++ L   FS FGEVI+SK                         
Sbjct  3    GEAEYRCFVGGLAWATADADLERTFSQFGEVIDSK-------------------------  37

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     IINDRETGRSRGFGFVTFKDE++M+DAIE MNG+ 
Sbjct  38   -------------------------IINDRETGRSRGFGFVTFKDEKSMRDAIEEMNGKE  72

Query  416  LDGRNITVNEAQS  454
            LDGR ITVNEAQS
Sbjct  73   LDGRTITVNEAQS  85



>ref|XP_008790382.1| PREDICTED: glycine-rich RNA-binding protein GRP1A-like [Phoenix 
dactylifera]
Length=154

 Score =   113 bits (282),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 63/133 (47%), Positives = 75/133 (56%), Gaps = 50/133 (38%)
 Frame = +2

Query  50   VMAEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*sl  229
            +  +VE+RCFVGGL+W T ++SL  AFS FGEV+ESK                       
Sbjct  1    MTTDVEYRCFVGGLSWVTDDTSLERAFSQFGEVLESK-----------------------  37

Query  230  cyyyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNG  409
                                       IINDRETGRSRGFGFVTF +EQ+M+DAIEGMNG
Sbjct  38   ---------------------------IINDRETGRSRGFGFVTFSNEQSMRDAIEGMNG  70

Query  410  QSLDGRNITVNEA  448
            Q+LDGR+ITVNEA
Sbjct  71   QTLDGRSITVNEA  83



>ref|XP_002442600.1| hypothetical protein SORBIDRAFT_08g022740 [Sorghum bicolor]
 gb|EES16438.1| hypothetical protein SORBIDRAFT_08g022740 [Sorghum bicolor]
Length=165

 Score =   113 bits (283),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 75/133 (56%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            ++VE+RCFVGGLAWAT ++SLH AFS++GEV+ESK                         
Sbjct  4    SDVEYRCFVGGLAWATDDNSLHSAFSTYGEVLESK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     II DRET RSRGFGFVTF  E+AM+ AIEGMNG+ 
Sbjct  39   -------------------------IILDRETQRSRGFGFVTFSTEEAMRSAIEGMNGKE  73

Query  416  LDGRNITVNEAQS  454
            LDGRNITVNEAQS
Sbjct  74   LDGRNITVNEAQS  86



>ref|NP_195637.1| glycine-rich RNA-binding protein 8 [Arabidopsis thaliana]
 sp|Q03251.1|RBG8_ARATH RecName: Full=Glycine-rich RNA-binding protein 8; Short=AtGR-RBP8; 
AltName: Full=AtRBG8; AltName: Full=Glycine-rich protein 
8; Short=AtGRP8; AltName: Full=Protein COLD, CIRCADIAN RHYTHM, 
AND RNA BINDING 1; Short=Protein CCR1 [Arabidopsis thaliana]
 emb|CAA78712.1| glycine rich protein [Arabidopsis thaliana]
 gb|AAA20201.1| ORF [Arabidopsis thaliana]
 gb|AAA32854.1| RNA-binding protein [Arabidopsis thaliana]
 emb|CAB43641.1| glycine-rich protein (clone AtGRP8) [Arabidopsis thaliana]
 emb|CAB80589.1| glycine-rich protein (clone AtGRP8) [Arabidopsis thaliana]
 dbj|BAH19515.1| AT4G39260 [Arabidopsis thaliana]
 gb|AEE87044.1| glycine-rich RNA-binding protein 8 [Arabidopsis thaliana]
Length=169

 Score =   113 bits (283),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 73/133 (55%), Gaps = 50/133 (38%)
 Frame = +2

Query  53   MAEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slc  232
            M+EVE+RCFVGGLAWAT +  L   FS FG+VI+SK                        
Sbjct  1    MSEVEYRCFVGGLAWATNDEDLQRTFSQFGDVIDSK------------------------  36

Query  233  yyyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQ  412
                                      IINDRE+GRSRGFGFVTFKDE+AM+DAIE MNG+
Sbjct  37   --------------------------IINDRESGRSRGFGFVTFKDEKAMRDAIEEMNGK  70

Query  413  SLDGRNITVNEAQ  451
             LDGR ITVNEAQ
Sbjct  71   ELDGRVITVNEAQ  83



>ref|XP_004507448.1| PREDICTED: glycine-rich RNA-binding protein GRP2A-like [Cicer 
arietinum]
Length=171

 Score =   113 bits (283),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 63/133 (47%), Positives = 72/133 (54%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            A+VE+RCFVGGLAWAT   +L  AFS +GEVI+SK                         
Sbjct  4    ADVEYRCFVGGLAWATDNDALQKAFSQYGEVIDSK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     II DRETGRSRGFGFVTF  EQ+M+DAIE MNGQ 
Sbjct  39   -------------------------IITDRETGRSRGFGFVTFTSEQSMRDAIEAMNGQD  73

Query  416  LDGRNITVNEAQS  454
            +DGR+ITVNEAQS
Sbjct  74   MDGRHITVNEAQS  86



>ref|XP_009782496.1| PREDICTED: glycine-rich RNA-binding, abscisic acid-inducible 
protein-like [Nicotiana sylvestris]
Length=107

 Score =   111 bits (278),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 63/135 (47%), Positives = 74/135 (55%), Gaps = 50/135 (37%)
 Frame = +2

Query  50   VMAEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*sl  229
            + AEVE+ CFVGGLAWATT  +L DAF ++G+V++SK                       
Sbjct  1    MAAEVEYNCFVGGLAWATTGRTLADAFGTYGKVLDSK-----------------------  37

Query  230  cyyyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNG  409
                                       IINDRETGRSRGFGFVTFKDE+ M+DAIE MNG
Sbjct  38   ---------------------------IINDRETGRSRGFGFVTFKDEKCMRDAIERMNG  70

Query  410  QSLDGRNITVNEAQS  454
            Q LD RN TVNEAQ+
Sbjct  71   QELDDRNNTVNEAQA  85



>gb|EMT06730.1| Glycine-rich RNA-binding protein [Aegilops tauschii]
Length=114

 Score =   111 bits (278),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 73/134 (54%), Gaps = 50/134 (37%)
 Frame = +2

Query  53   MAEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slc  232
            MAE E+RCFVGGLAWAT + +L  AFS +GE++++K                        
Sbjct  1    MAETEYRCFVGGLAWATDDHNLQQAFSQYGEILDAK------------------------  36

Query  233  yyyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQ  412
                                      IINDRETGRSRGFGFVTF  E++M+ AIE MNG+
Sbjct  37   --------------------------IINDRETGRSRGFGFVTFGSEESMRQAIEEMNGK  70

Query  413  SLDGRNITVNEAQS  454
             LDGRNITVNEAQS
Sbjct  71   ELDGRNITVNEAQS  84



>dbj|BAJ34207.1| unnamed protein product [Thellungiella halophila]
Length=166

 Score =   112 bits (281),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 63/131 (48%), Positives = 73/131 (56%), Gaps = 50/131 (38%)
 Frame = +2

Query  59   EVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcyy  238
            +VE+RCFVGGLAWAT ++ L   FS FGEVI+SK                          
Sbjct  4    DVEYRCFVGGLAWATADADLERTFSQFGEVIDSK--------------------------  37

Query  239  yyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQSL  418
                                    IINDRETGRSRGFGFVTFKDE++M+DAIE MNG+ L
Sbjct  38   ------------------------IINDRETGRSRGFGFVTFKDEKSMRDAIEEMNGKEL  73

Query  419  DGRNITVNEAQ  451
            DGR+ITVNEAQ
Sbjct  74   DGRSITVNEAQ  84



>ref|XP_006854654.1| hypothetical protein AMTR_s00030p00198740 [Amborella trichopoda]
 gb|ERN16121.1| hypothetical protein AMTR_s00030p00198740 [Amborella trichopoda]
Length=156

 Score =   112 bits (280),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 63/132 (48%), Positives = 75/132 (57%), Gaps = 50/132 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            ++VE+RCFVGGLAW T + +L  AFSS+G+VIESK                         
Sbjct  4    SDVEYRCFVGGLAWTTDDRTLGKAFSSYGDVIESK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     IINDRETGRSRGFGFVTF +EQ+M+DAIEGMNG +
Sbjct  39   -------------------------IINDRETGRSRGFGFVTFSNEQSMRDAIEGMNGFT  73

Query  416  LDGRNITVNEAQ  451
            LDGR+ITVNEAQ
Sbjct  74   LDGRSITVNEAQ  85



>gb|AAF06329.1|AF191305_1 glycine-rich RNA binding protein, partial [Medicago sativa]
Length=105

 Score =   110 bits (276),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 61/133 (46%), Positives = 71/133 (53%), Gaps = 50/133 (38%)
 Frame = +2

Query  53   MAEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slc  232
            MA+VE RCFVGGLAWAT   +L  AFS +GE+++SK                        
Sbjct  1    MADVEDRCFVGGLAWATDNDALEKAFSQYGEIVDSK------------------------  36

Query  233  yyyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQ  412
                                      IINDRETGRSRGFGFVTF +E++M D IE MNGQ
Sbjct  37   --------------------------IINDRETGRSRGFGFVTFANEKSMNDVIEAMNGQ  70

Query  413  SLDGRNITVNEAQ  451
             LDGRNITVN+AQ
Sbjct  71   DLDGRNITVNQAQ  83



>ref|NP_001132731.1| responsive to abscisic acid15 [Zea mays]
 gb|ACF81705.1| unknown [Zea mays]
 gb|AFW68010.1| responsive to abscisic acid15 [Zea mays]
Length=96

 Score =   110 bits (274),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 61/133 (46%), Positives = 73/133 (55%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            A+VE+RCFVGGLAWAT+  SL +AF+S+GE+++SKV                        
Sbjct  4    ADVEYRCFVGGLAWATSNESLENAFASYGEILDSKV------------------------  39

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                      I DRETGRSRGFGFVTF  E +M DAIE MNG+ 
Sbjct  40   --------------------------ITDRETGRSRGFGFVTFSSENSMLDAIENMNGKE  73

Query  416  LDGRNITVNEAQS  454
            LDGRNITVN+AQS
Sbjct  74   LDGRNITVNQAQS  86



>emb|CDY12133.1| BnaC03g60490D [Brassica napus]
Length=158

 Score =   111 bits (277),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 64/139 (46%), Positives = 74/139 (53%), Gaps = 52/139 (37%)
 Frame = +2

Query  35   YFLLSVMAEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssl  214
            Y + S   E E+RCFVGGLAWAT ++ L   FS FGEVI+SK                  
Sbjct  9    YIIWS--GETEYRCFVGGLAWATADADLERTFSQFGEVIDSK------------------  48

Query  215  lt*slcyyyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAI  394
                                            IINDRETGRSRGFGFVTFKD+++M+DAI
Sbjct  49   --------------------------------IINDRETGRSRGFGFVTFKDDKSMRDAI  76

Query  395  EGMNGQSLDGRNITVNEAQ  451
            E MNG+ LDGR ITVNEAQ
Sbjct  77   EEMNGKELDGRTITVNEAQ  95



>gb|AAA75104.1| single-stranded nucleic acid binding protein [Triticum aestivum]
Length=167

 Score =   111 bits (277),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 74/134 (55%), Gaps = 50/134 (37%)
 Frame = +2

Query  53   MAEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slc  232
            MAE E+RCFVGGLAWAT +++L  AFS +GE++++K                        
Sbjct  1    MAETEYRCFVGGLAWATDDNNLQQAFSQYGEILDAK------------------------  36

Query  233  yyyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQ  412
                                      IINDRETGRSRGFGFVTF  E++M+ AIE MNG+
Sbjct  37   --------------------------IINDRETGRSRGFGFVTFGSEESMRQAIEEMNGK  70

Query  413  SLDGRNITVNEAQS  454
             LDGRNITVNEAQS
Sbjct  71   ELDGRNITVNEAQS  84



>dbj|BAE91897.1| glycine-rich RNA-binding protein [Lolium perenne]
Length=107

 Score =   109 bits (272),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 71/133 (53%), Gaps = 51/133 (38%)
 Frame = +2

Query  53   MAEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slc  232
            MAE E+RCFVGGLAWAT + SL  AFS FGE+ + K                        
Sbjct  1    MAE-EYRCFVGGLAWATNDQSLEQAFSQFGEITDCK------------------------  35

Query  233  yyyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQ  412
                                      IINDRETGRSRGFGFVTF   ++MK+AIEGMNGQ
Sbjct  36   --------------------------IINDRETGRSRGFGFVTFSSSESMKNAIEGMNGQ  69

Query  413  SLDGRNITVNEAQ  451
             LDGRNITVNEAQ
Sbjct  70   DLDGRNITVNEAQ  82



>ref|XP_003606916.1| Glycine-rich RNA binding protein [Medicago truncatula]
 gb|AES89113.1| RNA-binding (RRM/RBD/RNP motif) family protein [Medicago truncatula]
Length=190

 Score =   111 bits (278),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 62/133 (47%), Positives = 73/133 (55%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            ++VE+RCFVGGLAWAT   +L  AFS FGE+ +SKV                        
Sbjct  4    SDVEYRCFVGGLAWATDSQALEQAFSKFGEITDSKV------------------------  39

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                      INDRETGRSRGFGFVTF +E++M+DAIE MNGQ 
Sbjct  40   --------------------------INDRETGRSRGFGFVTFAEEKSMRDAIEEMNGQD  73

Query  416  LDGRNITVNEAQS  454
            +DGRNITVNEAQS
Sbjct  74   IDGRNITVNEAQS  86



>gb|ACF80971.1| unknown [Zea mays]
Length=133

 Score =   110 bits (274),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 63/133 (47%), Positives = 74/133 (56%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            ++VE+RCFVGGLAWAT + SL++AFS++GEV+ESK                         
Sbjct  4    SDVEYRCFVGGLAWATDDHSLNNAFSTYGEVLESK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     II DRET RSRGFGFVTF  E AM+ AIEGMNG+ 
Sbjct  39   -------------------------IILDRETQRSRGFGFVTFSTEDAMRSAIEGMNGKE  73

Query  416  LDGRNITVNEAQS  454
            LDGRNITVNEAQS
Sbjct  74   LDGRNITVNEAQS  86



>gb|ACF84263.1| unknown [Zea mays]
 gb|AFW68009.1| responsive to abscisic acid15 [Zea mays]
Length=140

 Score =   110 bits (274),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 61/133 (46%), Positives = 73/133 (55%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            A+VE+RCFVGGLAWAT+  SL +AF+S+GE+++SKV                        
Sbjct  4    ADVEYRCFVGGLAWATSNESLENAFASYGEILDSKV------------------------  39

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                      I DRETGRSRGFGFVTF  E +M DAIE MNG+ 
Sbjct  40   --------------------------ITDRETGRSRGFGFVTFSSENSMLDAIENMNGKE  73

Query  416  LDGRNITVNEAQS  454
            LDGRNITVN+AQS
Sbjct  74   LDGRNITVNQAQS  86



>gb|ACG41989.1| glycine-rich RNA-binding protein 2 [Zea mays]
Length=142

 Score =   110 bits (274),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 61/133 (46%), Positives = 73/133 (55%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            A+VE+RCFVGGLAWAT+  SL +AF+S+GE+++SKV                        
Sbjct  4    ADVEYRCFVGGLAWATSNESLENAFASYGEILDSKV------------------------  39

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                      I DRETGRSRGFGFVTF  E +M DAIE MNG+ 
Sbjct  40   --------------------------ITDRETGRSRGFGFVTFSSENSMLDAIENMNGKE  73

Query  416  LDGRNITVNEAQS  454
            LDGRNITVN+AQS
Sbjct  74   LDGRNITVNQAQS  86



>dbj|BAH57166.1| AT2G21660 [Arabidopsis thaliana]
Length=99

 Score =   108 bits (271),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 60/127 (47%), Positives = 70/127 (55%), Gaps = 50/127 (39%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
             +VE+RCFVGGLAWAT + +L  AF+ +G+VI+SK                         
Sbjct  4    GDVEYRCFVGGLAWATDDRALETAFAQYGDVIDSK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     IINDRETGRSRGFGFVTFKDE+AMKDAIEGMNGQ 
Sbjct  39   -------------------------IINDRETGRSRGFGFVTFKDEKAMKDAIEGMNGQD  73

Query  416  LDGRNIT  436
            LDGR+IT
Sbjct  74   LDGRSIT  80



>ref|XP_008664443.1| PREDICTED: glycine-rich RNA-binding protein 1-like [Zea mays]
Length=146

 Score =   110 bits (274),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 63/133 (47%), Positives = 74/133 (56%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            ++VE+RCFVGGLAWAT + SL++AFS++GEV+ESK                         
Sbjct  4    SDVEYRCFVGGLAWATDDHSLNNAFSTYGEVLESK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     II DRET RSRGFGFVTF  E AM+ AIEGMNG+ 
Sbjct  39   -------------------------IILDRETQRSRGFGFVTFSTEDAMRSAIEGMNGKE  73

Query  416  LDGRNITVNEAQS  454
            LDGRNITVNEAQS
Sbjct  74   LDGRNITVNEAQS  86



>ref|NP_001105572.1| glycine-rich RNA binding protein [Zea mays]
 gb|AAB88616.1| glycine-rich RNA binding protein [Zea mays]
 gb|ACF80165.1| unknown [Zea mays]
 gb|ACG33356.1| glycine-rich RNA-binding protein 2 [Zea mays]
Length=145

 Score =   110 bits (274),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 63/133 (47%), Positives = 74/133 (56%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            ++VE+RCFVGGLAWAT + SL++AFS++GEV+ESK                         
Sbjct  4    SDVEYRCFVGGLAWATDDHSLNNAFSTYGEVLESK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     II DRET RSRGFGFVTF  E AM+ AIEGMNG+ 
Sbjct  39   -------------------------IILDRETQRSRGFGFVTFSTEDAMRSAIEGMNGKE  73

Query  416  LDGRNITVNEAQS  454
            LDGRNITVNEAQS
Sbjct  74   LDGRNITVNEAQS  86



>gb|ACG31231.1| glycine-rich RNA-binding protein 2 [Zea mays]
 gb|ACG34569.1| glycine-rich RNA-binding protein 2 [Zea mays]
Length=146

 Score =   110 bits (274),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 63/133 (47%), Positives = 74/133 (56%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            ++VE+RCFVGGLAWAT + SL++AFS++GEV+ESK                         
Sbjct  4    SDVEYRCFVGGLAWATDDHSLNNAFSTYGEVLESK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     II DRET RSRGFGFVTF  E AM+ AIEGMNG+ 
Sbjct  39   -------------------------IILDRETQRSRGFGFVTFSTEDAMRSAIEGMNGKE  73

Query  416  LDGRNITVNEAQS  454
            LDGRNITVNEAQS
Sbjct  74   LDGRNITVNEAQS  86



>ref|NP_001105707.1| glycine-rich protein1 [Zea mays]
 emb|CAA43431.1| glycine-rich protein [Zea mays]
Length=155

 Score =   110 bits (275),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 62/133 (47%), Positives = 74/133 (56%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            ++VE+RCFVGGLAWAT + SLH+AFS++GEV+ESK                         
Sbjct  4    SDVEYRCFVGGLAWATDDHSLHNAFSTYGEVLESK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     II DRET RSRGFGFVTF  E+ M++ IEGMNG+ 
Sbjct  39   -------------------------IILDRETQRSRGFGFVTFSTEERMRNRIEGMNGKE  73

Query  416  LDGRNITVNEAQS  454
            LDGRNITVNEAQS
Sbjct  74   LDGRNITVNEAQS  86



>gb|AAM16023.1| glycine-rich RNA binding protein, partial [Zea mays]
 gb|AAM16026.1| glycine-rich RNA binding protein, partial [Zea mays]
Length=148

 Score =   110 bits (274),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 63/133 (47%), Positives = 74/133 (56%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            ++VE+RCFVGGLAWAT + SL++AFS++GEV+ESK                         
Sbjct  7    SDVEYRCFVGGLAWATDDHSLNNAFSTYGEVLESK-------------------------  41

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     II DRET RSRGFGFVTF  E AM+ AIEGMNG+ 
Sbjct  42   -------------------------IILDRETQRSRGFGFVTFSTEDAMRSAIEGMNGKE  76

Query  416  LDGRNITVNEAQS  454
            LDGRNITVNEAQS
Sbjct  77   LDGRNITVNEAQS  89



>dbj|BAF34340.1| putative glycine-rich RNA-binding protein [Dianthus caryophyllus]
Length=163

 Score =   110 bits (275),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 62/133 (47%), Positives = 74/133 (56%), Gaps = 50/133 (38%)
 Frame = +2

Query  53   MAEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slc  232
            MAEVE+RCFVGGL+W T + SL +AF+ FGEV +SK                        
Sbjct  1    MAEVEYRCFVGGLSWGTDDRSLAEAFNKFGEVTDSK------------------------  36

Query  233  yyyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQ  412
                                      IINDRETGRSRGFGFVTF +EQ+M+DAI+ MNG+
Sbjct  37   --------------------------IINDRETGRSRGFGFVTFANEQSMRDAIDEMNGK  70

Query  413  SLDGRNITVNEAQ  451
             LDGR+ITVNEAQ
Sbjct  71   ELDGRSITVNEAQ  83



>gb|AAM16009.1| glycine-rich RNA binding protein, partial [Zea mays]
 gb|AAM16022.1| glycine-rich RNA binding protein, partial [Zea mays]
Length=149

 Score =   110 bits (274),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 63/133 (47%), Positives = 74/133 (56%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            ++VE+RCFVGGLAWAT + SL++AFS++GEV+ESK                         
Sbjct  7    SDVEYRCFVGGLAWATDDHSLNNAFSTYGEVLESK-------------------------  41

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     II DRET RSRGFGFVTF  E AM+ AIEGMNG+ 
Sbjct  42   -------------------------IILDRETQRSRGFGFVTFSTEDAMRSAIEGMNGKE  76

Query  416  LDGRNITVNEAQS  454
            LDGRNITVNEAQS
Sbjct  77   LDGRNITVNEAQS  89



>gb|AAM16010.1| glycine-rich RNA binding protein, partial [Zea mays]
Length=147

 Score =   110 bits (274),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 63/133 (47%), Positives = 74/133 (56%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            ++VE+RCFVGGLAWAT + SL++AFS++GEV+ESK                         
Sbjct  6    SDVEYRCFVGGLAWATDDHSLNNAFSTYGEVLESK-------------------------  40

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     II DRET RSRGFGFVTF  E AM+ AIEGMNG+ 
Sbjct  41   -------------------------IILDRETQRSRGFGFVTFSTEDAMRSAIEGMNGKE  75

Query  416  LDGRNITVNEAQS  454
            LDGRNITVNEAQS
Sbjct  76   LDGRNITVNEAQS  88



>gb|AAM16013.1| glycine-rich RNA binding protein, partial [Zea mays]
Length=149

 Score =   110 bits (274),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 63/133 (47%), Positives = 74/133 (56%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            ++VE+RCFVGGLAWAT + SL++AFS++GEV+ESK                         
Sbjct  8    SDVEYRCFVGGLAWATDDHSLNNAFSTYGEVLESK-------------------------  42

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     II DRET RSRGFGFVTF  E AM+ AIEGMNG+ 
Sbjct  43   -------------------------IILDRETQRSRGFGFVTFSTEDAMRSAIEGMNGKE  77

Query  416  LDGRNITVNEAQS  454
            LDGRNITVNEAQS
Sbjct  78   LDGRNITVNEAQS  90



>gb|ACG43341.1| glycine-rich RNA-binding protein 2 [Zea mays]
Length=156

 Score =   110 bits (274),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 61/133 (46%), Positives = 73/133 (55%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            A+VE+RCFVGGLAWAT+  SL +AF+S+GE+++SKV                        
Sbjct  4    ADVEYRCFVGGLAWATSNESLENAFASYGEILDSKV------------------------  39

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                      I DRETGRSRGFGFVTF  E +M DAIE MNG+ 
Sbjct  40   --------------------------ITDRETGRSRGFGFVTFSSENSMLDAIENMNGKE  73

Query  416  LDGRNITVNEAQS  454
            LDGRNITVN+AQS
Sbjct  74   LDGRNITVNQAQS  86



>emb|CDY46213.1| BnaA07g03570D [Brassica napus]
Length=122

 Score =   109 bits (272),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 72/133 (54%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            AE E+RCFVGGLAWAT E SL   FS FGEV++SK                         
Sbjct  4    AESEYRCFVGGLAWATDEQSLGRTFSEFGEVLDSK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     II DRETGRS+GFGFVTFKDE++M+ AIE MNGQ 
Sbjct  39   -------------------------IIIDRETGRSKGFGFVTFKDEESMRAAIERMNGQE  73

Query  416  LDGRNITVNEAQS  454
            LDGRNITVNEAQ+
Sbjct  74   LDGRNITVNEAQA  86



>sp|P10979.1|GRPA_MAIZE RecName: Full=Glycine-rich RNA-binding, abscisic acid-inducible 
protein [Zea mays]
 emb|CAA31077.1| ABA-inducible gene protein [Zea mays]
 gb|ACG24782.1| glycine-rich RNA-binding protein 2 [Zea mays]
 gb|ACG30598.1| glycine-rich RNA-binding protein 2 [Zea mays]
 gb|ACG31957.1| glycine-rich RNA-binding protein 2 [Zea mays]
 gb|ACG38128.1| glycine-rich RNA-binding protein 2 [Zea mays]
 prf||1410284A abscisic acid inducible gene
Length=157

 Score =   110 bits (274),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 61/133 (46%), Positives = 73/133 (55%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            A+VE+RCFVGGLAWAT+  SL +AF+S+GE+++SKV                        
Sbjct  4    ADVEYRCFVGGLAWATSNESLENAFASYGEILDSKV------------------------  39

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                      I DRETGRSRGFGFVTF  E +M DAIE MNG+ 
Sbjct  40   --------------------------ITDRETGRSRGFGFVTFSSENSMLDAIENMNGKE  73

Query  416  LDGRNITVNEAQS  454
            LDGRNITVN+AQS
Sbjct  74   LDGRNITVNQAQS  86



>gb|KFK30502.1| hypothetical protein AALP_AA7G270500 [Arabis alpina]
Length=167

 Score =   110 bits (275),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 64/134 (48%), Positives = 73/134 (54%), Gaps = 50/134 (37%)
 Frame = +2

Query  53   MAEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slc  232
            M++VE+RCFVGGLAWAT +  L   FS FGEVI+SK                        
Sbjct  1    MSDVEYRCFVGGLAWATGDQDLEREFSQFGEVIDSK------------------------  36

Query  233  yyyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQ  412
                                      IINDRETGRSRGFGFVTFKDE+AM++AIE MNG+
Sbjct  37   --------------------------IINDRETGRSRGFGFVTFKDEKAMREAIEEMNGK  70

Query  413  SLDGRNITVNEAQS  454
             L GR ITVNEAQS
Sbjct  71   ELSGRVITVNEAQS  84



>ref|XP_008681237.1| PREDICTED: responsive to abscisic acid15 isoform X1 [Zea mays]
 gb|AFW68008.1| responsive to abscisic acid15 [Zea mays]
Length=159

 Score =   110 bits (274),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 61/133 (46%), Positives = 73/133 (55%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            A+VE+RCFVGGLAWAT+  SL +AF+S+GE+++SKV                        
Sbjct  4    ADVEYRCFVGGLAWATSNESLENAFASYGEILDSKV------------------------  39

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                      I DRETGRSRGFGFVTF  E +M DAIE MNG+ 
Sbjct  40   --------------------------ITDRETGRSRGFGFVTFSSENSMLDAIENMNGKE  73

Query  416  LDGRNITVNEAQS  454
            LDGRNITVN+AQS
Sbjct  74   LDGRNITVNQAQS  86



>gb|AAM16021.1| glycine-rich RNA binding protein, partial [Zea mays]
Length=150

 Score =   109 bits (273),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 63/133 (47%), Positives = 74/133 (56%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            ++VE+RCFVGGLAWAT + SL++AFS++GEV+ESK                         
Sbjct  9    SDVEYRCFVGGLAWATDDHSLNNAFSTYGEVLESK-------------------------  43

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     II DRET RSRGFGFVTF  E AM+ AIEGMNG+ 
Sbjct  44   -------------------------IILDRETQRSRGFGFVTFSTEDAMRSAIEGMNGKE  78

Query  416  LDGRNITVNEAQS  454
            LDGRNITVNEAQS
Sbjct  79   LDGRNITVNEAQS  91



>gb|AAB66884.1| glycine-rich protein [Oryza sativa Japonica Group]
Length=162

 Score =   110 bits (274),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 60/131 (46%), Positives = 73/131 (56%), Gaps = 50/131 (38%)
 Frame = +2

Query  59   EVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcyy  238
            +V++RCFVGGLAWAT + SL  AFS++GE+++SK                          
Sbjct  5    DVKYRCFVGGLAWATDDRSLEAAFSTYGEILDSK--------------------------  38

Query  239  yyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQSL  418
                                    IINDRETGRS GFGF+TF  EQ+M+DAIEGMNG+ L
Sbjct  39   ------------------------IINDRETGRSLGFGFITFSSEQSMRDAIEGMNGKEL  74

Query  419  DGRNITVNEAQ  451
            DGRNITVNEAQ
Sbjct  75   DGRNITVNEAQ  85



>gb|AAM16007.1| glycine-rich RNA binding protein, partial [Zea mays]
Length=155

 Score =   109 bits (273),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 63/133 (47%), Positives = 74/133 (56%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            ++VE+RCFVGGLAWAT + SL++AFS++GEV+ESK                         
Sbjct  13   SDVEYRCFVGGLAWATDDHSLNNAFSTYGEVLESK-------------------------  47

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     II DRET RSRGFGFVTF  E AM+ AIEGMNG+ 
Sbjct  48   -------------------------IILDRETQRSRGFGFVTFSTEDAMRSAIEGMNGKE  82

Query  416  LDGRNITVNEAQS  454
            LDGRNITVNEAQS
Sbjct  83   LDGRNITVNEAQS  95



>gb|AAB61213.1| glycine-rich protein [Oryza sativa Japonica Group]
Length=197

 Score =   110 bits (276),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 66/139 (47%), Positives = 78/139 (56%), Gaps = 28/139 (20%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEV-------IESKVCLsqssdrisvspdssl  214
             +VE+RCFVGGLAWAT + SL  AFS++GE+       I S +C         V      
Sbjct  4    PDVEYRCFVGGLAWATDDRSLEAAFSTYGEILESKVRWIPSSLCFFLMRFGGGVRQIWLR  63

Query  215  lt*slcyyyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAI  394
             +     Y                        IINDRETGRSRGFGFVTF +EQAM+DAI
Sbjct  64   KSDYGGGYAV---------------------QIINDRETGRSRGFGFVTFSNEQAMRDAI  102

Query  395  EGMNGQSLDGRNITVNEAQ  451
            +GMNG+ LDGRNITVNEAQ
Sbjct  103  QGMNGKELDGRNITVNEAQ  121



>gb|AAM15999.1| glycine-rich RNA binding protein, partial [Zea mays]
 gb|AAM16001.1| glycine-rich RNA binding protein, partial [Zea mays]
 gb|AAM16004.1| glycine-rich RNA binding protein, partial [Zea mays]
 gb|AAM16008.1| glycine-rich RNA binding protein, partial [Zea mays]
 gb|AAM16017.1| glycine-rich RNA binding protein, partial [Zea mays]
 gb|AAM16024.1| glycine-rich RNA binding protein, partial [Zea mays]
 gb|AAM16025.1| glycine-rich RNA binding protein, partial [Zea mays]
Length=154

 Score =   109 bits (272),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 63/133 (47%), Positives = 74/133 (56%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            ++VE+RCFVGGLAWAT + SL++AFS++GEV+ESK                         
Sbjct  13   SDVEYRCFVGGLAWATDDHSLNNAFSTYGEVLESK-------------------------  47

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     II DRET RSRGFGFVTF  E AM+ AIEGMNG+ 
Sbjct  48   -------------------------IILDRETQRSRGFGFVTFSTEDAMRSAIEGMNGKE  82

Query  416  LDGRNITVNEAQS  454
            LDGRNITVNEAQS
Sbjct  83   LDGRNITVNEAQS  95



>gb|AAM16000.1| glycine-rich RNA binding protein, partial [Zea mays]
Length=155

 Score =   109 bits (272),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 63/133 (47%), Positives = 74/133 (56%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            ++VE+RCFVGGLAWAT + SL++AFS++GEV+ESK                         
Sbjct  14   SDVEYRCFVGGLAWATDDHSLNNAFSTYGEVLESK-------------------------  48

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     II DRET RSRGFGFVTF  E AM+ AIEGMNG+ 
Sbjct  49   -------------------------IILDRETQRSRGFGFVTFSTEDAMRSAIEGMNGKE  83

Query  416  LDGRNITVNEAQS  454
            LDGRNITVNEAQS
Sbjct  84   LDGRNITVNEAQS  96



>gb|AAM16011.1| glycine-rich RNA binding protein, partial [Zea mays]
Length=155

 Score =   109 bits (272),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 63/133 (47%), Positives = 74/133 (56%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            ++VE+RCFVGGLAWAT + SL++AFS++GEV+ESK                         
Sbjct  13   SDVEYRCFVGGLAWATDDHSLNNAFSTYGEVLESK-------------------------  47

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     II DRET RSRGFGFVTF  E AM+ AIEGMNG+ 
Sbjct  48   -------------------------IILDRETQRSRGFGFVTFSTEDAMRSAIEGMNGKE  82

Query  416  LDGRNITVNEAQS  454
            LDGRNITVNEAQS
Sbjct  83   LDGRNITVNEAQS  95



>gb|AAM16003.1| glycine-rich RNA binding protein, partial [Zea mays]
Length=156

 Score =   109 bits (272),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 63/133 (47%), Positives = 74/133 (56%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            ++VE+RCFVGGLAWAT + SL++AFS++GEV+ESK                         
Sbjct  14   SDVEYRCFVGGLAWATDDHSLNNAFSTYGEVLESK-------------------------  48

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     II DRET RSRGFGFVTF  E AM+ AIEGMNG+ 
Sbjct  49   -------------------------IILDRETQRSRGFGFVTFSTEDAMRSAIEGMNGKE  83

Query  416  LDGRNITVNEAQS  454
            LDGRNITVNEAQS
Sbjct  84   LDGRNITVNEAQS  96



>gb|AAM16019.1| glycine-rich RNA binding protein, partial [Zea mays]
Length=154

 Score =   109 bits (272),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 63/133 (47%), Positives = 74/133 (56%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            ++VE+RCFVGGLAWAT + SL++AFS++GEV+ESK                         
Sbjct  13   SDVEYRCFVGGLAWATDDHSLNNAFSTYGEVLESK-------------------------  47

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     II DRET RSRGFGFVTF  E AM+ AIEGMNG+ 
Sbjct  48   -------------------------IILDRETQRSRGFGFVTFSXEDAMRSAIEGMNGKE  82

Query  416  LDGRNITVNEAQS  454
            LDGRNITVNEAQS
Sbjct  83   LDGRNITVNEAQS  95



>gb|ACG35271.1| glycine-rich RNA-binding protein 2 [Zea mays]
Length=203

 Score =   110 bits (275),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 69/153 (45%), Positives = 79/153 (52%), Gaps = 52/153 (34%)
 Frame = +2

Query  2    LSSLLVFSFCLYFLLSVMA--EVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsq  175
            L    VF F        MA  +VE+RCFVGGLAWAT + SL++AFS++GEV+ESK     
Sbjct  41   LPHRFVFRFWFVGEREEMAASDVEYRCFVGGLAWATDDHSLNNAFSTYGEVLESK-----  95

Query  176  ssdrisvspdssllt*slcyyyyvtlIycslslcyylllllsPETIINDRETGRSRGFGF  355
                                                         II DRET RSRGFGF
Sbjct  96   ---------------------------------------------IILDRETQRSRGFGF  110

Query  356  VTFKDEQAMKDAIEGMNGQSLDGRNITVNEAQS  454
            VTF  E AM+ AIEGMNG+ LDGRNITVNEAQS
Sbjct  111  VTFSTEDAMRSAIEGMNGKELDGRNITVNEAQS  143



>sp|Q99070.1|GRP2_SORBI RecName: Full=Glycine-rich RNA-binding protein 2 [Sorghum bicolor]
 emb|CAA40862.1| glycine-rich RNA-binding protein [Sorghum bicolor]
Length=168

 Score =   109 bits (273),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 62/133 (47%), Positives = 72/133 (54%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            A+VE+RCFVGGLAWAT   +L  AF++FG+VI+SKV                        
Sbjct  4    ADVEYRCFVGGLAWATNNETLEQAFANFGQVIDSKV------------------------  39

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                      I DRETGRSRGFGFVTF  EQ+M DAIE MNG+ 
Sbjct  40   --------------------------ITDRETGRSRGFGFVTFSSEQSMLDAIENMNGKE  73

Query  416  LDGRNITVNEAQS  454
            LDGRNITVN+AQS
Sbjct  74   LDGRNITVNQAQS  86



>ref|XP_009121223.1| PREDICTED: glycine-rich RNA-binding protein 10-like [Brassica 
rapa]
Length=164

 Score =   109 bits (272),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 72/133 (54%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            AE E+RCFVGGLAWAT E SL   FS FGEV++SK                         
Sbjct  4    AESEYRCFVGGLAWATDEQSLGRTFSEFGEVLDSK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     II DRETGRS+GFGFVTFKDE++M+ AIE MNGQ 
Sbjct  39   -------------------------IIIDRETGRSKGFGFVTFKDEESMRAAIERMNGQE  73

Query  416  LDGRNITVNEAQS  454
            LDGRNITVNEAQ+
Sbjct  74   LDGRNITVNEAQA  86



>emb|CDX71276.1| BnaC07g05550D [Brassica napus]
Length=172

 Score =   109 bits (272),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 72/133 (54%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            AE E+RCFVGGLAWAT E SL   FS FGEV++SK                         
Sbjct  4    AESEYRCFVGGLAWATDEQSLGRTFSEFGEVLDSK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     II DRETGRS+GFGFVTFKDE++M+ AIE MNGQ 
Sbjct  39   -------------------------IIIDRETGRSKGFGFVTFKDEESMRAAIERMNGQE  73

Query  416  LDGRNITVNEAQS  454
            LDGRNITVNEAQ+
Sbjct  74   LDGRNITVNEAQA  86



>gb|KFK41270.1| hypothetical protein AALP_AA2G108100 [Arabis alpina]
Length=176

 Score =   108 bits (271),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 62/133 (47%), Positives = 72/133 (54%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            A+ E+RCFVGGLAWAT E SL   FS FGE+I+SK                         
Sbjct  4    ADSEYRCFVGGLAWATDEQSLESTFSQFGEIIDSK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     II DRE+GRS+GFGFVTFKDE++M+ AIE MNGQ 
Sbjct  39   -------------------------IIIDRESGRSKGFGFVTFKDEESMRSAIERMNGQD  73

Query  416  LDGRNITVNEAQS  454
            LDGRNITVNEAQ+
Sbjct  74   LDGRNITVNEAQA  86



>gb|ACG32421.1| glycine-rich RNA-binding protein 2 [Zea mays]
Length=146

 Score =   107 bits (268),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 62/133 (47%), Positives = 73/133 (55%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            ++VE+RCFVG LAWAT + SL++AFS++GEV+ESK                         
Sbjct  4    SDVEYRCFVGXLAWATDDHSLNNAFSTYGEVLESK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     II DRET RSRGFGFVTF  E AM+ AIEGMNG+ 
Sbjct  39   -------------------------IILDRETQRSRGFGFVTFSTEDAMRSAIEGMNGKE  73

Query  416  LDGRNITVNEAQS  454
            LDGRNITVNEAQS
Sbjct  74   LDGRNITVNEAQS  86



>gb|AAM16006.1| glycine-rich RNA binding protein, partial [Zea mays]
Length=148

 Score =   107 bits (268),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 62/133 (47%), Positives = 73/133 (55%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            ++VE+RCFVGGLAWAT + SL++AFS++GEV+ESK                         
Sbjct  7    SDVEYRCFVGGLAWATDDHSLNNAFSTYGEVLESK-------------------------  41

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     II DRET RSRGFGFVTF    AM+ AIEGMNG+ 
Sbjct  42   -------------------------IILDRETQRSRGFGFVTFSXXXAMRSAIEGMNGKE  76

Query  416  LDGRNITVNEAQS  454
            LDGRNITVNEAQS
Sbjct  77   LDGRNITVNEAQS  89



>gb|AAG23220.1| glycine-rich RNA-binding protein [Sorghum bicolor]
Length=170

 Score =   108 bits (269),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 61/133 (46%), Positives = 72/133 (54%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            A+VE+RCFVGGLAWAT   +L  AF++FG+V++SKV                        
Sbjct  4    ADVEYRCFVGGLAWATNNETLEHAFANFGQVLDSKV------------------------  39

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                      I DRETGRSRGFGFVTF  EQ+M DAIE MNG+ 
Sbjct  40   --------------------------ITDRETGRSRGFGFVTFSSEQSMLDAIENMNGKE  73

Query  416  LDGRNITVNEAQS  454
            LDGRNITVN+AQS
Sbjct  74   LDGRNITVNQAQS  86



>gb|AAM16002.1| glycine-rich RNA binding protein, partial [Zea mays]
Length=139

 Score =   107 bits (266),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 62/130 (48%), Positives = 71/130 (55%), Gaps = 50/130 (38%)
 Frame = +2

Query  65   EFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcyyyy  244
            E+RCFVGGLAWAT + SL++AFS++GEV+ESK                            
Sbjct  1    EYRCFVGGLAWATDDHSLNNAFSTYGEVLESK----------------------------  32

Query  245  vtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQSLDG  424
                                  II DRET RSRGFGFVTF  E AM+ AIEGMNG+ LDG
Sbjct  33   ----------------------IILDRETQRSRGFGFVTFSTEDAMRSAIEGMNGKELDG  70

Query  425  RNITVNEAQS  454
            RNITVNEAQS
Sbjct  71   RNITVNEAQS  80



>dbj|BAJ85361.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=175

 Score =   108 bits (269),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 60/134 (45%), Positives = 73/134 (54%), Gaps = 50/134 (37%)
 Frame = +2

Query  53   MAEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slc  232
            MAE E+RCFVGGLAWAT + +L  AFS +GE++++K                        
Sbjct  1    MAETEYRCFVGGLAWATDDHNLQAAFSQYGEILDAK------------------------  36

Query  233  yyyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQ  412
                                      IINDRETGRSRGFGFVTF  E++M+ AIE MNG+
Sbjct  37   --------------------------IINDRETGRSRGFGFVTFGSEESMRQAIEEMNGK  70

Query  413  SLDGRNITVNEAQS  454
             LDGR+ITVNEAQS
Sbjct  71   ELDGRSITVNEAQS  84



>ref|XP_004162998.1| PREDICTED: glycine-rich RNA-binding protein blt801-like [Cucumis 
sativus]
Length=139

 Score =   107 bits (266),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 60/130 (46%), Positives = 70/130 (54%), Gaps = 50/130 (38%)
 Frame = +2

Query  62   VEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcyyy  241
            VEFRCFVGGLAWAT  +SL  AFS +GE++E+K                           
Sbjct  6    VEFRCFVGGLAWATDSNSLEKAFSVYGEIVEAK---------------------------  38

Query  242  yvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQSLD  421
                                   I++DRETGRSRGFGFVTF +E+AM+ AIE MNG  LD
Sbjct  39   -----------------------IVSDRETGRSRGFGFVTFLEEEAMRSAIEAMNGHILD  75

Query  422  GRNITVNEAQ  451
            GRNITVNEAQ
Sbjct  76   GRNITVNEAQ  85



>gb|AAM16012.1| glycine-rich RNA binding protein, partial [Zea mays]
Length=153

 Score =   107 bits (267),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 62/133 (47%), Positives = 73/133 (55%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            ++VE+RCFVGGLAWAT + SL++AFS++GEV+ESK                         
Sbjct  11   SDVEYRCFVGGLAWATDDHSLNNAFSTYGEVLESK-------------------------  45

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     II DRET RSRGFGFVTF    AM+ AIEGMNG+ 
Sbjct  46   -------------------------IILDRETQRSRGFGFVTFSXXDAMRSAIEGMNGKE  80

Query  416  LDGRNITVNEAQS  454
            LDGRNITVNEAQS
Sbjct  81   LDGRNITVNEAQS  93



>ref|XP_004148848.1| PREDICTED: glycine-rich RNA-binding protein blt801-like [Cucumis 
sativus]
 ref|XP_004162997.1| PREDICTED: glycine-rich RNA-binding protein blt801-like [Cucumis 
sativus]
Length=141

 Score =   107 bits (266),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 60/130 (46%), Positives = 70/130 (54%), Gaps = 50/130 (38%)
 Frame = +2

Query  62   VEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcyyy  241
            VEFRCFVGGLAWAT  +SL  AFS +GE++E+K                           
Sbjct  6    VEFRCFVGGLAWATDSNSLEKAFSVYGEIVEAK---------------------------  38

Query  242  yvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQSLD  421
                                   I++DRETGRSRGFGFVTF +E+AM+ AIE MNG  LD
Sbjct  39   -----------------------IVSDRETGRSRGFGFVTFLEEEAMRSAIEAMNGHILD  75

Query  422  GRNITVNEAQ  451
            GRNITVNEAQ
Sbjct  76   GRNITVNEAQ  85



>ref|XP_001771291.1| predicted protein [Physcomitrella patens]
 gb|EDQ63851.1| predicted protein, partial [Physcomitrella patens]
Length=87

 Score =   105 bits (262),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 60/130 (46%), Positives = 69/130 (53%), Gaps = 50/130 (38%)
 Frame = +2

Query  65   EFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcyyyy  244
            EFRCFVGGLAWATT+  L  AF  FG+VI+SKV                           
Sbjct  1    EFRCFVGGLAWATTDDRLEQAFRPFGDVIQSKV---------------------------  33

Query  245  vtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQSLDG  424
                                   I+DRETGRSRGFGF+TF DE AM +AI+ MNG+ LDG
Sbjct  34   -----------------------ISDRETGRSRGFGFITFADENAMNEAIKEMNGKELDG  70

Query  425  RNITVNEAQS  454
            RNITVN+AQS
Sbjct  71   RNITVNQAQS  80



>ref|XP_004148847.1| PREDICTED: glycine-rich RNA-binding protein blt801-like [Cucumis 
sativus]
 ref|XP_004162996.1| PREDICTED: glycine-rich RNA-binding protein blt801-like [Cucumis 
sativus]
Length=144

 Score =   107 bits (266),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 60/130 (46%), Positives = 70/130 (54%), Gaps = 50/130 (38%)
 Frame = +2

Query  62   VEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcyyy  241
            VEFRCFVGGLAWAT  +SL  AFS +GE++E+K                           
Sbjct  6    VEFRCFVGGLAWATDSNSLEKAFSVYGEIVEAK---------------------------  38

Query  242  yvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQSLD  421
                                   I++DRETGRSRGFGFVTF +E+AM+ AIE MNG  LD
Sbjct  39   -----------------------IVSDRETGRSRGFGFVTFLEEEAMRSAIEAMNGHILD  75

Query  422  GRNITVNEAQ  451
            GRNITVNEAQ
Sbjct  76   GRNITVNEAQ  85



>emb|CAA88558.1| glycine rich protein, RNA binding protein [Hordeum vulgare subsp. 
vulgare]
Length=173

 Score =   107 bits (268),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 59/134 (44%), Positives = 72/134 (54%), Gaps = 50/134 (37%)
 Frame = +2

Query  53   MAEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slc  232
            MAE E+RCFVGGLAWAT + +L  AFS +GE++++K                        
Sbjct  1    MAETEYRCFVGGLAWATDDHNLQAAFSQYGEILDAK------------------------  36

Query  233  yyyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQ  412
                                      IINDRETGRSRGFGFVTF  E++M+ AIE MNG+
Sbjct  37   --------------------------IINDRETGRSRGFGFVTFGSEESMRQAIEEMNGK  70

Query  413  SLDGRNITVNEAQS  454
             LDGR +TVNEAQS
Sbjct  71   ELDGRQVTVNEAQS  84



>ref|XP_004982205.1| PREDICTED: glycine-rich RNA-binding protein 2-like [Setaria italica]
Length=152

 Score =   107 bits (266),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 61/133 (46%), Positives = 72/133 (54%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            A+VE+RCFVGGLAWAT   SL  AF+S+G+V++SKV                        
Sbjct  4    ADVEYRCFVGGLAWATDSESLQLAFASYGDVVDSKV------------------------  39

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                      I DRETGRSRGFGFVTF  EQ+M +AIE MNG+ 
Sbjct  40   --------------------------ITDRETGRSRGFGFVTFSTEQSMLEAIENMNGKE  73

Query  416  LDGRNITVNEAQS  454
            LDGRNITVN+AQS
Sbjct  74   LDGRNITVNQAQS  86



>gb|AAM16005.1| glycine-rich RNA binding protein, partial [Zea mays]
Length=154

 Score =   107 bits (266),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 62/133 (47%), Positives = 73/133 (55%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            ++VE+RCFVGGLAWAT + SL++AFS++GEV+ESK                         
Sbjct  13   SDVEYRCFVGGLAWATDDHSLNNAFSTYGEVLESK-------------------------  47

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     II DRET RSRGFGFVTF    AM+ AIEGMNG+ 
Sbjct  48   -------------------------IILDRETQRSRGFGFVTFSXXXAMRSAIEGMNGKE  82

Query  416  LDGRNITVNEAQS  454
            LDGRNITVNEAQS
Sbjct  83   LDGRNITVNEAQS  95



>gb|AAM16015.1| glycine-rich RNA binding protein, partial [Zea mays]
 gb|AAM16018.1| glycine-rich RNA binding protein, partial [Zea mays]
Length=155

 Score =   107 bits (266),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 62/133 (47%), Positives = 73/133 (55%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            ++VE+RCFVGGLAWAT + SL++AFS++GEV+ESK                         
Sbjct  13   SDVEYRCFVGGLAWATDDHSLNNAFSTYGEVLESK-------------------------  47

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     II DRET RSRGFGFVTF    AM+ AIEGMNG+ 
Sbjct  48   -------------------------IILDRETQRSRGFGFVTFSXXXAMRSAIEGMNGKE  82

Query  416  LDGRNITVNEAQS  454
            LDGRNITVNEAQS
Sbjct  83   LDGRNITVNEAQS  95



>ref|XP_004148846.1| PREDICTED: glycine-rich RNA-binding protein blt801-like [Cucumis 
sativus]
Length=156

 Score =   107 bits (266),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 60/130 (46%), Positives = 70/130 (54%), Gaps = 50/130 (38%)
 Frame = +2

Query  62   VEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcyyy  241
            VEFRCFVGGLAWAT  +SL  AFS +GE++E+K                           
Sbjct  6    VEFRCFVGGLAWATDSNSLEKAFSVYGEIVEAK---------------------------  38

Query  242  yvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQSLD  421
                                   I++DRETGRSRGFGFVTF +E+AM+ AIE MNG  LD
Sbjct  39   -----------------------IVSDRETGRSRGFGFVTFLEEEAMRSAIEAMNGHILD  75

Query  422  GRNITVNEAQ  451
            GRNITVNEAQ
Sbjct  76   GRNITVNEAQ  85



>gb|KGN61792.1| hypothetical protein Csa_2G247040 [Cucumis sativus]
Length=160

 Score =   107 bits (266),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 60/130 (46%), Positives = 70/130 (54%), Gaps = 50/130 (38%)
 Frame = +2

Query  62   VEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcyyy  241
            VEFRCFVGGLAWAT  +SL  AFS +GE++E+K                           
Sbjct  6    VEFRCFVGGLAWATDSNSLEKAFSVYGEIVEAK---------------------------  38

Query  242  yvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQSLD  421
                                   I++DRETGRSRGFGFVTF +E+AM+ AIE MNG  LD
Sbjct  39   -----------------------IVSDRETGRSRGFGFVTFLEEEAMRSAIEAMNGHILD  75

Query  422  GRNITVNEAQ  451
            GRNITVNEAQ
Sbjct  76   GRNITVNEAQ  85



>ref|XP_004148845.1| PREDICTED: glycine-rich RNA-binding protein blt801-like [Cucumis 
sativus]
 ref|XP_004162995.1| PREDICTED: glycine-rich RNA-binding protein blt801-like [Cucumis 
sativus]
Length=171

 Score =   107 bits (266),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 60/130 (46%), Positives = 70/130 (54%), Gaps = 50/130 (38%)
 Frame = +2

Query  62   VEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcyyy  241
            VEFRCFVGGLAWAT  +SL  AFS +GE++E+K                           
Sbjct  6    VEFRCFVGGLAWATDSNSLEKAFSVYGEIVEAK---------------------------  38

Query  242  yvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQSLD  421
                                   I++DRETGRSRGFGFVTF +E+AM+ AIE MNG  LD
Sbjct  39   -----------------------IVSDRETGRSRGFGFVTFLEEEAMRSAIEAMNGHILD  75

Query  422  GRNITVNEAQ  451
            GRNITVNEAQ
Sbjct  76   GRNITVNEAQ  85



>gb|AAM16020.1| glycine-rich RNA binding protein, partial [Zea mays]
Length=155

 Score =   106 bits (264),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 62/133 (47%), Positives = 72/133 (54%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            ++VE+RCFVGGLAWAT   SL++AFS++GEV+ESK                         
Sbjct  13   SDVEYRCFVGGLAWATDXHSLNNAFSTYGEVLESK-------------------------  47

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     II DRET RSRGFGFVTF    AM+ AIEGMNG+ 
Sbjct  48   -------------------------IILDRETQRSRGFGFVTFSXXXAMRSAIEGMNGKE  82

Query  416  LDGRNITVNEAQS  454
            LDGRNITVNEAQS
Sbjct  83   LDGRNITVNEAQS  95



>pdb|2MPU|A Chain A, Structural And Functional Analysis Of The Hordeum Vulgare 
L. Hvgr-rbp1 Protein, A Glycine-rich Rna Binding Protein 
Implicated In The Regulation Of Barley Leaf Senescence And 
Environmental Adaptation
Length=92

 Score =   103 bits (258),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 61/137 (45%), Positives = 73/137 (53%), Gaps = 53/137 (39%)
 Frame = +2

Query  53   MAE---VEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*  223
            MAE    E+RCFVG L+W T +  L  AFSSFGE++++K                     
Sbjct  1    MAESDGAEYRCFVGSLSWNTDDRGLEAAFSSFGEILDAK---------------------  39

Query  224  slcyyyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGM  403
                                         IINDRETGRSRGFGFV+F +EQAM+DAIEGM
Sbjct  40   -----------------------------IINDRETGRSRGFGFVSFSNEQAMQDAIEGM  70

Query  404  NGQSLDGRNITVNEAQS  454
            NG+ LDGR+I VNEAQS
Sbjct  71   NGKELDGRSIVVNEAQS  87



>ref|XP_010472509.1| PREDICTED: glycine-rich RNA-binding protein GRP1A-like [Camelina 
sativa]
Length=173

 Score =   106 bits (264),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 62/133 (47%), Positives = 72/133 (54%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            AE E+RCFVGGLAWAT E SL  +FS FGEV++SK                         
Sbjct  4    AESEYRCFVGGLAWATDEQSLGRSFSQFGEVLDSK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     II DRE+GRS+GFGFVTFKDE +M+ AIE MNGQ 
Sbjct  39   -------------------------IIIDRESGRSKGFGFVTFKDEDSMRTAIERMNGQE  73

Query  416  LDGRNITVNEAQS  454
            LDGR+ITVNEAQ+
Sbjct  74   LDGRSITVNEAQA  86



>ref|XP_010429491.1| PREDICTED: probable glycine-rich RNA-binding protein 1 [Camelina 
sativa]
Length=174

 Score =   105 bits (263),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 61/133 (46%), Positives = 72/133 (54%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            AE E+RCFVGGLAWAT E SL  +FS FGEV++SK                         
Sbjct  4    AESEYRCFVGGLAWATDEQSLERSFSQFGEVLDSK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     II DRE+GRS+GFGFVTF+DE +M+ AIE MNGQ 
Sbjct  39   -------------------------IIIDRESGRSKGFGFVTFRDEDSMRTAIERMNGQE  73

Query  416  LDGRNITVNEAQS  454
            LDGR+ITVNEAQ+
Sbjct  74   LDGRSITVNEAQA  86



>ref|XP_004507450.1| PREDICTED: glycine-rich RNA-binding protein GRP2A-like isoform 
X2 [Cicer arietinum]
Length=152

 Score =   105 bits (261),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 61/130 (47%), Positives = 68/130 (52%), Gaps = 50/130 (38%)
 Frame = +2

Query  62   VEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcyyy  241
            VE+RCFVGGLA      +L  AFSS+GEV +SKV                          
Sbjct  6    VEYRCFVGGLAGPPDSDALAKAFSSYGEVTDSKV--------------------------  39

Query  242  yvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQSLD  421
                                    INDRETGRSRGFGFVTF  EQ+M+DAIEGMNGQ +D
Sbjct  40   ------------------------INDRETGRSRGFGFVTFSTEQSMRDAIEGMNGQDVD  75

Query  422  GRNITVNEAQ  451
            GRNITVNEAQ
Sbjct  76   GRNITVNEAQ  85



>ref|XP_004507449.1| PREDICTED: glycine-rich RNA-binding protein GRP2A-like isoform 
X1 [Cicer arietinum]
Length=166

 Score =   105 bits (261),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 61/130 (47%), Positives = 68/130 (52%), Gaps = 50/130 (38%)
 Frame = +2

Query  62   VEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcyyy  241
            VE+RCFVGGLA      +L  AFSS+GEV +SKV                          
Sbjct  6    VEYRCFVGGLAGPPDSDALAKAFSSYGEVTDSKV--------------------------  39

Query  242  yvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQSLD  421
                                    INDRETGRSRGFGFVTF  EQ+M+DAIEGMNGQ +D
Sbjct  40   ------------------------INDRETGRSRGFGFVTFSTEQSMRDAIEGMNGQDVD  75

Query  422  GRNITVNEAQ  451
            GRNITVNEAQ
Sbjct  76   GRNITVNEAQ  85



>ref|XP_008460935.1| PREDICTED: glycine-rich RNA-binding protein 1-like [Cucumis melo]
Length=171

 Score =   105 bits (261),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 58/130 (45%), Positives = 69/130 (53%), Gaps = 50/130 (38%)
 Frame = +2

Query  62   VEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcyyy  241
            VE+RCFVGGLAWAT  ++L  AFS FG+++E+K                           
Sbjct  6    VEYRCFVGGLAWATDSNALEKAFSPFGDIVEAK---------------------------  38

Query  242  yvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQSLD  421
                                   I++DRETGRSRGFGFVTF +E AM+ AIE MNG  LD
Sbjct  39   -----------------------IVSDRETGRSRGFGFVTFSEEDAMRSAIEAMNGHILD  75

Query  422  GRNITVNEAQ  451
            GRNITVNEAQ
Sbjct  76   GRNITVNEAQ  85



>ref|XP_001760393.1| predicted protein [Physcomitrella patens]
 dbj|BAC00785.1| glycine-rich RNA binding protein [Physcomitrella patens]
 gb|ABA41484.1| glycine-rich RNA binding protein [Physcomitrella patens]
 gb|EDQ74784.1| predicted protein [Physcomitrella patens]
Length=162

 Score =   104 bits (260),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 61/130 (47%), Positives = 68/130 (52%), Gaps = 50/130 (38%)
 Frame = +2

Query  65   EFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcyyyy  244
            EFRCFVGGLAWATT+  L  AF  FGEV++SKV                           
Sbjct  6    EFRCFVGGLAWATTDGRLEGAFRPFGEVVQSKV---------------------------  38

Query  245  vtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQSLDG  424
                                   I+DRETGRSRGFGFVTF DE +M  AI+ MNGQ LDG
Sbjct  39   -----------------------ISDRETGRSRGFGFVTFADENSMNAAIKEMNGQELDG  75

Query  425  RNITVNEAQS  454
            RNITVN+AQS
Sbjct  76   RNITVNQAQS  85



>gb|AFP52931.1| RBP1 [Hordeum vulgare]
Length=162

 Score =   104 bits (259),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 61/137 (45%), Positives = 73/137 (53%), Gaps = 53/137 (39%)
 Frame = +2

Query  53   MAE---VEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*  223
            MAE    E+RCFVG L+W T +  L  AFSSFGE++++K                     
Sbjct  1    MAESDGAEYRCFVGSLSWNTDDRGLEAAFSSFGEILDAK---------------------  39

Query  224  slcyyyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGM  403
                                         IINDRETGRSRGFGFV+F +EQAM+DAIEGM
Sbjct  40   -----------------------------IINDRETGRSRGFGFVSFSNEQAMQDAIEGM  70

Query  404  NGQSLDGRNITVNEAQS  454
            NG+ LDGR+I VNEAQS
Sbjct  71   NGKELDGRSIVVNEAQS  87



>gb|AAM16014.1| glycine-rich RNA binding protein, partial [Zea mays]
Length=148

 Score =   103 bits (256),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 60/133 (45%), Positives = 71/133 (53%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            ++VE+RCFVGGLAWAT + SL++AFS++GEV+ESK                         
Sbjct  7    SDVEYRCFVGGLAWATDDHSLNNAFSTYGEVLESK-------------------------  41

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     II DRET RSRGFGFVTF      + AIEGMNG+ 
Sbjct  42   -------------------------IILDRETQRSRGFGFVTFSXXXXXRSAIEGMNGKE  76

Query  416  LDGRNITVNEAQS  454
            LDGRNITVNEAQS
Sbjct  77   LDGRNITVNEAQS  89



>ref|XP_001770275.1| predicted protein [Physcomitrella patens]
 gb|EDQ64950.1| predicted protein, partial [Physcomitrella patens]
Length=106

 Score =   101 bits (251),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 58/128 (45%), Positives = 67/128 (52%), Gaps = 50/128 (39%)
 Frame = +2

Query  65   EFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcyyyy  244
            EFRCFVGGLAWATT+ SL +AF  FGEV++ KV                           
Sbjct  1    EFRCFVGGLAWATTDGSLEEAFRPFGEVVQCKV---------------------------  33

Query  245  vtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQSLDG  424
                                   I DRETGRSRGFGFVTF DE +M +AI+ MNG+ LDG
Sbjct  34   -----------------------ITDRETGRSRGFGFVTFADENSMNEAIKDMNGKELDG  70

Query  425  RNITVNEA  448
            RNITVN+A
Sbjct  71   RNITVNQA  78



>ref|XP_010690881.1| PREDICTED: glycine-rich RNA-binding protein-like [Beta vulgaris 
subsp. vulgaris]
Length=170

 Score =   103 bits (256),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 59/134 (44%), Positives = 70/134 (52%), Gaps = 50/134 (37%)
 Frame = +2

Query  53   MAEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slc  232
            M+EVE+RCFVGGLAWAT + SL  AFS +G+V++SKV                       
Sbjct  1    MSEVEYRCFVGGLAWATDDRSLGSAFSQYGDVVDSKV-----------------------  37

Query  233  yyyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQ  412
                                       I DRETGRSRGFGFVTF  ++++  AIE MNG 
Sbjct  38   ---------------------------IQDRETGRSRGFGFVTFSSKESLDAAIEAMNGS  70

Query  413  SLDGRNITVNEAQS  454
             LDGR ITVNEAQS
Sbjct  71   ELDGRQITVNEAQS  84



>ref|XP_010417257.1| PREDICTED: glycine-rich RNA-binding protein GRP2A-like [Camelina 
sativa]
Length=169

 Score =   102 bits (255),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 60/133 (45%), Positives = 72/133 (54%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            AE E+RCFVGGLAWAT + SL  +FS FGEV++SK                         
Sbjct  4    AESEYRCFVGGLAWATDDQSLARSFSEFGEVLDSK-------------------------  38

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     II DRE+GRS+GFGFVTFKDE +M+ AIE MNGQ 
Sbjct  39   -------------------------IIIDRESGRSKGFGFVTFKDEDSMRTAIERMNGQE  73

Query  416  LDGRNITVNEAQS  454
            LDGR+ITVNEA++
Sbjct  74   LDGRSITVNEARA  86



>gb|AAM16016.1| glycine-rich RNA binding protein, partial [Zea mays]
Length=154

 Score =   102 bits (254),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 60/133 (45%), Positives = 71/133 (53%), Gaps = 50/133 (38%)
 Frame = +2

Query  56   AEVEFRCFVGGLAWATTESSLHDAFSSFGEVIESKVCLsqssdrisvspdssllt*slcy  235
            ++VE+RCFVGGLAWAT + SL++AFS++GEV+ESK                         
Sbjct  13   SDVEYRCFVGGLAWATDDHSLNNAFSTYGEVLESK-------------------------  47

Query  236  yyyvtlIycslslcyylllllsPETIINDRETGRSRGFGFVTFKDEQAMKDAIEGMNGQS  415
                                     II DRET RSRGFGFVTF      + AIEGMNG+ 
Sbjct  48   -------------------------IILDRETQRSRGFGFVTFSXXXXXRSAIEGMNGKE  82

Query  416  LDGRNITVNEAQS  454
            LDGRNITVNEAQS
Sbjct  83   LDGRNITVNEAQS  95



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 553975666000