BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001P14

Length=611
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|EYU37517.1|  hypothetical protein MIMGU_mgv11b017514mg             47.8    2e-07   Erythranthe guttata [common monkey flower]
gb|EPS63318.1|  hypothetical protein M569_11468                       51.6    2e-05   Genlisea aurea
gb|KJB21194.1|  hypothetical protein B456_003G187000                  45.1    2e-05   Gossypium raimondii



>gb|EYU37517.1| hypothetical protein MIMGU_mgv11b017514mg [Erythranthe guttata]
Length=80

 Score = 47.8 bits (112),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 28/46 (61%), Gaps = 0/46 (0%)
 Frame = +2

Query  104  MPLPPQVLLDFNSKGLISLRTWSKYAFGQIAICIKCYHSKKCLMNG  241
            MP PP V+  F+ K LIS RTWSK+A GQIA   + +H +     G
Sbjct  1    MPFPPPVVHHFSLKRLISSRTWSKFASGQIATTAEFFHYRNFSTGG  46


 Score = 34.3 bits (77),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 21/32 (66%), Gaps = 0/32 (0%)
 Frame = +1

Query  244  SSMWIFFSFPLSIALSEEPFLNDQFRMPTANS  339
            SS+ I F FPLSIALSE  FL DQ R   A S
Sbjct  48   SSVEILFLFPLSIALSEHLFLRDQHRWLNACS  79



>gb|EPS63318.1| hypothetical protein M569_11468, partial [Genlisea aurea]
Length=108

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 30/48 (63%), Gaps = 0/48 (0%)
 Frame = +2

Query  101  VMPLPPQVLLDFNSKGLISLRTWSKYAFGQIAICIKCYHSKKCLMNGS  244
            VMP  P   LDF+SKGL   RTW  Y FGQIA+ +  + S+K L+  S
Sbjct  14   VMPFSPPGALDFDSKGLTLFRTWRNYVFGQIAVGMGFHLSRKFLIGDS  61



>gb|KJB21194.1| hypothetical protein B456_003G187000 [Gossypium raimondii]
Length=97

 Score = 45.1 bits (105),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 18/27 (67%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  163  DMEQICLWSDCYLYQVLSFQKVLDERF  243
            DMEQ+C WS+CYL+++ SFQ+VLD RF
Sbjct  56   DMEQVCFWSNCYLFRMFSFQEVLDWRF  82


 Score = 30.4 bits (67),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 13/15 (87%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = +3

Query  243  LIHVDFLLVSFVNCT  287
            +IH DFLLVSFVNCT
Sbjct  83   IIHGDFLLVSFVNCT  97



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 829366762230